F489337

General Info

Members Datasets Scaffolds Average Seq Length
1063 475 2126 427

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2548876994|2550692510
Length 486
Sequence ILGSGVIGVTSAYYLARAGHQVTVLDRQPGPALETSFANAGQISPGYASPWGAPGIPLKALKWMFEEHAPLAIRPDGTLQQLRWMWQMLRNCSADRYAVNKERMVRLAEYSRDCFRELRAATGIDYEGRQQGTLQLFRTQEQFDGAAKDIAVLRQSGVPFELLSREQLAGAEPALAKVSHKLTGGLRLPNDETGDCQLFTTKLAKMAEELGVQFRYDVDIQASARRCLRGGAGFVLRQLPASHRRHSGVSAEGLFDHRAGGRLPRRAGLDHPRRNLQDRRHPLRQPHPRGRHGGSGRFQQELVRGDAYVVALGSYSANFLRRIVDIPVYPLKGYSITVPVVDSRAAPVSTILDETYKIAVTRFDNRIRVGGMAEVVGFNKELNPKRRATLELVVNDLFPGAGNTAQASFWTGLRPMTPDGTPIVGATPLNNLFLNTGHGTLGWTMSCGSGQLLADLISGKRPAIAADDLSMARYLGQRQFSSAVTA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
146 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
147 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
274 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
298 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
305 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
306 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
307 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
308 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
309 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
312 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
313 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
318 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
321 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
326 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
327 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
328 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
329 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
330 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
331 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
332 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
333 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
334 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
335 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
336 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
337 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
338 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
339 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
340 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
341 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
342 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
343 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
344 2519103095 Burkholderia sp. KJ006 Isolate Nodule
345 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
346 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
347 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
348 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
349 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
350 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
351 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
352 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
353 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
354 2643221556 Massilia sp. Root1485 Isolate Unclassified
355 2643221558 Rhizobium sp. Root149 Isolate Unclassified
356 2643221645 Massilia sp. Root351 Isolate Unclassified
357 2643221664 Massilia sp. Root418 Isolate Unclassified
358 2643221684 Massilia sp. Root133 Isolate Unclassified
359 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
360 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
361 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
362 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
363 2738541280 Massilia sp. GV090 Isolate Unclassified
364 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
365 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
366 2738541297 Duganella sp. GV083 Isolate Unclassified
367 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
368 2738541300 Massilia sp. GV016 Isolate Unclassified
369 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
370 2738541357 Duganella sp. GV053 Isolate Unclassified
371 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
372 2738543003 Duganella sp. GV066 Isolate Unclassified
373 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
374 2738543018 Massilia sp. GV045 Isolate Unclassified
375 2738543026 Duganella sp. GV089 Isolate Unclassified
376 2738543029 Duganella sp. GV039 Isolate Unclassified
377 2738543030 Massilia sp. GV097 Isolate Unclassified
378 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
379 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
380 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
381 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
382 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
383 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
384 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
385 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
386 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
387 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
388 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
389 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
390 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
391 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
392 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
393 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
394 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
395 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
396 2818991450 Burkholderia sp. 604 Isolate Unclassified
397 2818991452 Burkholderia cepacia 561 Isolate Unclassified
398 2821131069 Duganella sp. 1224 Isolate Unclassified
399 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
400 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
401 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
402 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
403 2842711865 Duganella sp. R-73148 Isolate Unclassified
404 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
405 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
406 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
407 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
408 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
409 2857553236 Duganella sp. R-74557 Isolate Unclassified
410 2857558681 Duganella sp. R-74565 Isolate Unclassified
411 2857564685 Duganella sp. R-74599 Isolate Unclassified
412 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
413 2865014394 Pantoea sp. R-71966 Isolate Unclassified
414 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
415 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
416 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
417 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
418 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
419 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
420 2885266251 Ralstonia sp. SET104 Isolate Nodule
421 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
422 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
423 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
424 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
425 2904424332 Duganella sp. 1411 Isolate Rhizosphere
426 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
427 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
428 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
429 2904564687 Burkholderia sp. 571 Isolate Unclassified
430 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
431 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
432 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
433 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
434 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
435 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
436 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
437 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
438 2919476304 Duganella sp. 3397 Isolate Unclassified
439 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
440 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
441 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
442 2928058823 Ralstonia sp. 1138 Isolate Unclassified
443 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
444 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
445 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
446 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
447 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
448 2928163908 Burkholderia sp. 567 Isolate Unclassified
449 2928170801 Burkholderia sp. 572 Isolate Unclassified
450 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
451 2928536128 Burkholderia sola 565 Isolate Unclassified
452 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
453 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
454 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
455 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
456 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
457 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
458 639633007 Azoarcus olearius BH72 Isolate Unclassified
459 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
460 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
461 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
462 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
463 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
464 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
465 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
466 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
467 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
468 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
469 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
470 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
471 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
472 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
473 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
474 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
475 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.38
Metatranscriptomes 1.51
Isolates 14.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.35
Nodule 2.45
Rhizoplane 3.1
Rhizosphere 67.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000401 3300001915 Bacteria 13061
2 JGI24740J21852_10000321 3300001979 Bacteria 20355
3 JGI24739J22299_10006043 3300001989 Bacteria 4582
4 JGI24735J21928_10000185 3300002067 Bacteria 22276
5 JGI24735J21928_10000211 3300002067 Bacteria 20387
6 JGI24735J21928_10001957 3300002067 Bacteria 7236
7 JGI24735J21928_10004968 3300002067 Bacteria 4432
8 JGI24735J21928_10008800 3300002067 Bacteria 3257
9 JGI24738J21930_10002074 3300002075 Bacteria 5368
10 JGI25155J39150_1000080 3300002704 Bacteria 56018
11 JGI25156J39149_1000112 3300002705 Bacteria 59192
12 JGI25156J39149_1000128 3300002705 Bacteria 56012
13 JGI25156J39149_1002049 3300002705 Bacteria 7668
14 JGI25156J39149_1002067 3300002705 Bacteria 7625
15 JGI25156J39149_1003272 3300002705 Bacteria 5375
16 JGI25156J39149_1003825 3300002705 Bacteria 4788
17 JGI25154J39366_1000143 3300002738 Bacteria 56016
18 JGI25154J39366_1000228 3300002738 Bacteria 37567
19 JGI25154J39366_1000987 3300002738 Bacteria 11522
20 JGI25154J39366_1002015 3300002738 Bacteria 5878
21 JGI25157J39369_1000134 3300002741 Bacteria 61613
22 JGI25150J39212_1005914 3300002774 Bacteria 2573
23 JGI25159J45721_1000415 3300002987 Bacteria 19675
24 rootH1_10051707 3300003316 Bacteria 6215
25 rootH2_10118416 3300003320 Bacteria 3450
26 rootL2_10096030 3300003322 Bacteria 1785
27 JGI25160J50197_1000818 3300003354 Bacteria 16694
28 Ga0007410J51695_1020040 3300003574 Bacteria 1329
29 Ga0007416J51690_1024636 3300003577 Bacteria 1647
30 Ga0006562J51391_1027748 3300003578 Bacteria 1400
31 Ga0055538_1000045 3300003751 Bacteria 139066
32 Ga0055538_1001125 3300003751 Bacteria 5779
33 Ga0055539_1000064 3300003752 Bacteria 139066
34 Ga0055533_1000074 3300003756 Bacteria 139066
35 Ga0055533_1001120 3300003756 Bacteria 7618
36 Ga0055533_1001259 3300003756 Bacteria 6969
37 Ga0055533_1005185 3300003756 Bacteria 2149
38 Ga0055532_1000039 3300003758 Bacteria 198049
39 Ga0055532_1000101 3300003758 Bacteria 92881
40 Ga0055525_1000008 3300003759 Bacteria 604287
41 Ga0055525_1000092 3300003759 Bacteria 139066
42 Ga0055527_1000024 3300003760 Bacteria 198049
43 Ga0055527_1000493 3300003760 Bacteria 14159
44 Ga0055527_1000532 3300003760 Bacteria 12837
45 Ga0055535_1000028 3300003761 Bacteria 198049
46 Ga0055535_1001248 3300003761 Bacteria 14159
47 Ga0055535_1001362 3300003761 Bacteria 12837
48 Ga0055542_1000047 3300003762 Bacteria 198049
49 Ga0055542_1001239 3300003762 Bacteria 14176
50 Ga0055542_1001248 3300003762 Bacteria 14073
51 Ga0055529_1000054 3300003763 Bacteria 198049
52 Ga0055529_1000068 3300003763 Bacteria 163911
53 Ga0055529_1000492 3300003763 Bacteria 36023
54 Ga0055526_1000050 3300003771 Bacteria 117283
55 Ga0055526_1000266 3300003771 Bacteria 44005
56 Ga0055526_1008612 3300003771 Bacteria 5054
57 Ga0055537_1002528 3300003773 Bacteria 6062
58 Ga0055524_1000008 3300003775 Bacteria 297761
59 Ga0055524_1000757 3300003775 Bacteria 21800
60 Ga0055534_1001148 3300003784 Bacteria 11208
61 Ga0055528_1007588 3300003790 Bacteria 4777
62 Ga0055541_1000046 3300003841 Bacteria 139066
63 Ga0055541_1000338 3300003841 Bacteria 14759
64 Ga0058692_1002178 3300003856 Bacteria 6693
65 Ga0058692_1010584 3300003856 Bacteria 2274
66 Ga0058692_1011276 3300003856 Bacteria 2167
67 Ga0058860_12094178 3300004801 Bacteria 1385
68 Ga0065165_1001552 3300005262 Bacteria 23926
69 Ga0065165_1002547 3300005262 Bacteria 15111
70 Ga0070660_100000016 3300005339 Bacteria 102648
71 Ga0070660_100005437 3300005339 Bacteria 8822
72 Ga0070660_100060822 3300005339 Bacteria 2932
73 Ga0070668_100012227 3300005347 Bacteria 6395
74 Ga0070659_100000014 3300005366 Bacteria 178272
75 Ga0070659_100008470 3300005366 Bacteria 7514
76 Ga0070663_100002932 3300005455 Bacteria 9709
77 Ga0070663_100067188 3300005455 Bacteria 2600
78 Ga0070663_100085631 3300005455 Bacteria 2326
79 Ga0068867_100259328 3300005459 Bacteria 1417
80 Ga0068853_100002082 3300005539 Bacteria 14838
81 Ga0068853_100013775 3300005539 Bacteria 6607
82 Ga0068855_100000072 3300005563 Bacteria 121486
83 Ga0068855_100004807 3300005563 Bacteria 16490
84 Ga0068855_100013735 3300005563 Bacteria 9761
85 Ga0068855_100046114 3300005563 Bacteria 5153
86 Ga0068855_100068318 3300005563 Bacteria 4137
87 Ga0068855_100124015 3300005563 Bacteria 2955
88 Ga0068857_100220021 3300005577 Bacteria 1734
89 Ga0068854_100073808 3300005578 Bacteria 2501
90 Ga0068856_100089098 3300005614 Bacteria 3068
91 Ga0068852_100120980 3300005616 Bacteria 2397
92 Ga0075364_10101476 3300006051 Bacteria 1916
93 Ga0075369_10050767 3300006186 Bacteria 1795
94 Ga0075434_100124417 3300006871 Bacteria 2596
95 Ga0099826_10000001 3300006948 Bacteria 1155201
96 Ga0105251_10001940 3300009011 Bacteria 16937
97 Ga0105251_10003240 3300009011 Bacteria 11970
98 Ga0105251_10003354 3300009011 Bacteria 11660
99 Ga0105244_10001399 3300009036 Bacteria 19606
100 Ga0105244_10006780 3300009036 Bacteria 7367
101 Ga0105250_10008806 3300009092 Bacteria 4274
102 Ga0105240_10003437 3300009093 Bacteria 24590
103 Ga0105240_10007932 3300009093 Bacteria 15315
104 Ga0105240_10020875 3300009093 Bacteria 8724
105 Ga0105240_10108247 3300009093 Bacteria 3368
106 Ga0105241_10110149 3300009174 Bacteria 2203
107 Ga0105241_10135866 3300009174 Bacteria 1996
108 Ga0105237_10007453 3300009545 Bacteria 11973
109 Ga0105238_10008553 3300009551 Bacteria 10241
110 Ga0105238_10046424 3300009551 Bacteria 4384
111 Ga0105238_10327108 3300009551 Bacteria 1519
112 Ga0105239_10012776 3300010375 Bacteria 9342
113 Ga0105246_10033371 3300011119 Bacteria 3421
114 Ga0157371_10000060 3300013102 Bacteria 170456
115 Ga0157371_10060213 3300013102 Bacteria 2692
116 Ga0157370_10008182 3300013104 Bacteria 11305
117 Ga0157369_10001025 3300013105 Bacteria 35250
118 Ga0157369_10002277 3300013105 Bacteria 23092
119 Ga0157369_10017044 3300013105 Bacteria 8162
120 Ga0157374_10000065 3300013296 Bacteria 108630
121 Ga0157374_10154109 3300013296 Bacteria 2235
122 Ga0157378_10304588 3300013297 Bacteria 1543
123 Ga0157372_10005829 3300013307 Bacteria 13120
124 Ga0157372_10373069 3300013307 Bacteria 1662
125 Ga0182008_10017279 3300014497 Bacteria 3743
126 Ga0182006_1000029 3300015261 Bacteria 247579
127 Ga0182006_1001675 3300015261 Bacteria 13013
128 Ga0182006_1011977 3300015261 Bacteria 3798
129 Ga0182007_10022643 3300015262 Bacteria 2216
130 Ga0182005_1000012 3300015265 Bacteria 396944
131 Ga0183361_10039 3300016635 Bacteria 25237
132 Ga0197907_10094810 3300020069 Bacteria 2302
133 Ga0206356_10207775 3300020070 Bacteria 6647
134 Ga0206355_1201316 3300020076 Bacteria 1527
135 Ga0206352_10616037 3300020078 Bacteria 1387
136 Ga0206350_10823393 3300020080 Bacteria 1322
137 Ga0206353_10857790 3300020082 Bacteria 9460
138 Ga0213872_10000078 3300021361 Bacteria 89790
139 Ga0213872_10028116 3300021361 Bacteria 2580
140 Ga0213872_10035227 3300021361 Bacteria 2289
141 Ga0213872_10049988 3300021361 Bacteria 1898
142 Ga0224712_10014477 3300022467 Bacteria 2541
143 Ga0224712_10053556 3300022467 Bacteria 1580
144 Ga0224712_10077390 3300022467 Bacteria 1365
145 Ga0209435_100016 3300025206 Bacteria 305566
146 Ga0209435_101536 3300025206 Bacteria 2878
147 Ga0209784_100002 3300025224 Bacteria 1753105
148 Ga0209784_100355 3300025224 Bacteria 22209
149 Ga0209566_100003 3300025225 Bacteria 1753105
150 Ga0209566_100206 3300025225 Bacteria 60781
151 Ga0209674_100004 3300025226 Bacteria 1753105
152 Ga0209674_100013 3300025226 Bacteria 813140
153 Ga0209674_100317 3300025226 Bacteria 31110
154 Ga0209674_100508 3300025226 Bacteria 16000
155 Ga0209672_100010 3300025228 Bacteria 873151
156 Ga0209672_100019 3300025228 Bacteria 432215
157 Ga0209672_100051 3300025228 Bacteria 234414
158 Ga0209672_100663 3300025228 Bacteria 17421
159 Ga0209147_100006 3300025229 Bacteria 873276
160 Ga0209147_100023 3300025229 Bacteria 437803
161 Ga0209147_100026 3300025229 Bacteria 421622
162 Ga0209147_100192 3300025229 Bacteria 70162
163 Ga0209147_100544 3300025229 Bacteria 21444
164 Ga0209563_100003 3300025230 Bacteria 1932942
165 Ga0209563_100006 3300025230 Bacteria 1753105
166 Ga0207427_100524 3300025231 Bacteria 19948
167 Ga0209437_100166 3300025233 Bacteria 144787
168 Ga0209258_100010 3300025242 Bacteria 873276
169 Ga0209258_100031 3300025242 Bacteria 463572
170 Ga0209258_100345 3300025242 Bacteria 67870
171 Ga0209258_100358 3300025242 Bacteria 61852
172 Ga0207425_1000198 3300025245 Bacteria 48223
173 Ga0209646_1000007 3300025246 Bacteria 670994
174 Ga0209646_1000022 3300025246 Bacteria 446621
175 Ga0209646_1000033 3300025246 Bacteria 369507
176 Ga0209026_1000031 3300025250 Bacteria 325747
177 Ga0209677_100003 3300025253 Bacteria 1753105
178 Ga0209677_102782 3300025253 Bacteria 6219
179 Ga0209148_1000018 3300025254 Bacteria 756247
180 Ga0209148_1000021 3300025254 Bacteria 714645
181 Ga0209148_1000027 3300025254 Bacteria 616374
182 Ga0209148_1000400 3300025254 Bacteria 50569
183 Ga0209148_1001190 3300025254 Bacteria 14889
184 Ga0209148_1005336 3300025254 Bacteria 2969
185 Ga0209759_1000160 3300025256 Bacteria 116290
186 Ga0209759_1000227 3300025256 Bacteria 84278
187 Ga0209759_1000830 3300025256 Bacteria 24405
188 Ga0209759_1002634 3300025256 Bacteria 7717
189 Ga0209759_1005851 3300025256 Bacteria 4219
190 Ga0209759_1007134 3300025256 Bacteria 3643
191 Ga0209759_1008597 3300025256 Bacteria 3166
192 Ga0209233_1000135 3300025261 Bacteria 201057
193 Ga0209565_1000136 3300025263 Bacteria 103019
194 Ga0209565_1012467 3300025263 Bacteria 2028
195 Ga0209455_1000015 3300025272 Bacteria 756128
196 Ga0209455_1000026 3300025272 Bacteria 653778
197 Ga0209455_1000213 3300025272 Bacteria 82040
198 Ga0209455_1000746 3300025272 Bacteria 18598
199 Ga0209673_1000201 3300025273 Bacteria 120059
200 Ga0209675_1000670 3300025291 Bacteria 24015
201 Ga0209025_1004560 3300025294 Bacteria 11922
202 Ga0209564_1000002 3300025295 Bacteria 1636803
203 Ga0209564_1000007 3300025295 Bacteria 1028582
204 Ga0209564_1002172 3300025295 Bacteria 16506
205 Ga0209564_1003554 3300025295 Bacteria 10463
206 Ga0209564_1030619 3300025295 Bacteria 1664
207 Ga0209758_1001300 3300025297 Bacteria 30598
208 Ga0209256_1000005 3300025299 Bacteria 1315082
209 Ga0207426_1000183 3300025302 Bacteria 154449
210 Ga0207655_1010700 3300025728 Bacteria 5544
211 Ga0207713_1024483 3300025735 Bacteria 2814
212 Ga0207647_10002579 3300025904 Bacteria 13712
213 Ga0207647_10005988 3300025904 Bacteria 8859
214 Ga0207647_10013632 3300025904 Bacteria 5629
215 Ga0207647_10014941 3300025904 Bacteria 5335
216 Ga0207647_10021360 3300025904 Bacteria 4322
217 Ga0207705_10000909 3300025909 Bacteria 24236
218 Ga0207705_10068844 3300025909 Bacteria 2563
219 Ga0207654_10020282 3300025911 Bacteria 3521
220 Ga0207695_10001378 3300025913 Bacteria 41129
221 Ga0207695_10003550 3300025913 Bacteria 21855
222 Ga0207695_10017376 3300025913 Bacteria 8370
223 Ga0207695_10022439 3300025913 Bacteria 7163
224 Ga0207671_10018507 3300025914 Bacteria 5341
225 Ga0207671_10062016 3300025914 Bacteria 2775
226 Ga0207657_10000001 3300025919 Bacteria 458536
227 Ga0207657_10011207 3300025919 Bacteria 8914
228 Ga0207657_10162278 3300025919 Bacteria 1815
229 Ga0207694_10005502 3300025924 Bacteria 9721
230 Ga0207694_10005690 3300025924 Bacteria 9559
231 Ga0207690_10000006 3300025932 Bacteria 433880
232 Ga0207690_10062100 3300025932 Bacteria 2542
233 Ga0207686_10106992 3300025934 Bacteria 1879
234 Ga0207689_10256758 3300025942 Bacteria 1446
235 Ga0207667_10000055 3300025949 Bacteria 223770
236 Ga0207667_10005385 3300025949 Bacteria 15603
237 Ga0207667_10009859 3300025949 Bacteria 11214
238 Ga0207667_10023435 3300025949 Bacteria 6798
239 Ga0207667_10026316 3300025949 Bacteria 6358
240 Ga0207667_10102192 3300025949 Bacteria 2957
241 Ga0207668_10023326 3300025972 Bacteria 3975
242 Ga0207639_10011574 3300026041 Bacteria 6129
243 Ga0207678_10000640 3300026067 Bacteria 32171
244 Ga0207702_10215259 3300026078 Bacteria 1788
245 Ga0207648_10073287 3300026089 Bacteria 2984
246 Ga0207698_10136833 3300026142 Bacteria 2103
247 Ga0209371_1000202 3300027312 Bacteria 85989
248 Ga0209371_1002201 3300027312 Bacteria 11330
249 Ga0209371_1006356 3300027312 Bacteria 4392
250 Ga0209371_1013531 3300027312 Bacteria 2285
251 Ga0209282_1000001 3300027666 Bacteria 2450367
252 Ga0307515_10114288 3300028794 Bacteria 3122
253 Ga0265338_10000183 3300028800 Bacteria 117272
254 Ga0265338_10001296 3300028800 Bacteria 41001
255 Ga0268256_1000189 3300030500 Bacteria 72206
256 Ga0268256_1001207 3300030500 Bacteria 16482
257 Ga0268256_1007934 3300030500 Bacteria 3705
258 Ga0268256_1011771 3300030500 Bacteria 2744
259 Ga0265314_10045322 3300031711 Bacteria 3110
260 Ga0307407_10045476 3300031903 Bacteria 2481
261 Ga0307412_10000008 3300031911 Bacteria 461034
262 Ga0307412_10016506 3300031911 Bacteria 4400
263 Ga0316583_10000075 3300032133 Bacteria 20871
264 Ga0373927_0099159 3300035695 Bacteria 1894
265 Ga0395899_0000041 3300037312 Bacteria 255615
266 Ga0395899_0001045 3300037312 Bacteria 25131
267 Ga0395899_0001913 3300037312 Bacteria 17173
268 Ga0395899_0005775 3300037312 Bacteria 9606
269 Ga0395899_0013914 3300037312 Bacteria 6144
270 Ga0395899_0027231 3300037312 Bacteria 4311
271 Ga0395900_0000065 3300037418 Bacteria 196327
272 Ga0395900_0000077 3300037418 Bacteria 179525
273 Ga0395900_0000097 3300037418 Bacteria 161598
274 Ga0395900_0001188 3300037418 Bacteria 32276
275 Ga0395900_0001196 3300037418 Bacteria 32097
276 Ga0395900_0003753 3300037418 Bacteria 16318
277 Ga0395900_0024334 3300037418 Bacteria 6200
278 Ga0395900_0038860 3300037418 Bacteria 4905
279 Ga0395900_0065140 3300037418 Bacteria 3743
280 Ga0395900_0192157 3300037418 Bacteria 2070
281 Ga0395898_0000220 3300037466 Bacteria 146473
282 Ga0395898_0000359 3300037466 Bacteria 100304
283 Ga0395898_0002178 3300037466 Bacteria 23964
284 Ga0395898_0021459 3300037466 Bacteria 6549
285 Ga0395898_0297620 3300037466 Bacteria 1539
286 Ga0395905_0000185 3300037471 Bacteria 99394
287 Ga0395905_0009767 3300037471 Bacteria 9358
288 Ga0395905_0026588 3300037471 Bacteria 5456
289 Ga0395905_0099536 3300037471 Bacteria 2730
290 Ga0395905_0143228 3300037471 Bacteria 2249
291 Ga0395905_0182492 3300037471 Bacteria 1970
292 Ga0395901_0000011 3300038443 Bacteria 400724
293 Ga0395901_0000085 3300038443 Bacteria 126093
294 Ga0395901_0000639 3300038443 Bacteria 40528
295 Ga0395901_0000928 3300038443 Bacteria 31902
296 Ga0395901_0001168 3300038443 Bacteria 27890
297 Ga0395901_0001807 3300038443 Bacteria 22099
298 Ga0395901_0018670 3300038443 Bacteria 7083
299 Ga0395901_0100600 3300038443 Bacteria 3032
300 Ga0436361_0051331 3300039447 Bacteria 27824
301 Ga0436361_0081046 3300039447 Bacteria 44857
302 Ga0436361_0233238 3300039447 Bacteria 7286
303 Ga0436361_0457272 3300039447 Bacteria 12371
304 Ga0436361_0461069 3300039447 Bacteria 3811
305 Ga0436361_0732452 3300039447 Bacteria 3970
306 Ga0436361_0997150 3300039447 Bacteria 20731
307 Ga0436361_1068465 3300039447 Bacteria 2558
308 Ga0439466_0000136 3300041411 Bacteria 28940
309 Ga0439465_0014195 3300041413 Bacteria 2483
310 Ga0439433_0007872 3300041999 Bacteria 2304
311 Ga0439448_0000397 3300042005 Bacteria 9912
312 Ga0439455_0006374 3300042012 Bacteria 2446
313 Ga0439455_0012221 3300042012 Bacteria 1924
314 Ga0450911_003740 3300042115 Bacteria 2617
315 Ga0450907_001052 3300042146 Bacteria 6453
316 Ga0439464_0005502 3300042439 Bacteria 3277
317 Ga0466969_0003870 3300044656 Bacteria 7945
318 Ga0466969_0011061 3300044656 Bacteria 4778
319 Ga0466969_0075275 3300044656 Bacteria 1618
320 Ga0466972_0032058 3300044658 Bacteria 2582
321 Ga0466972_0077901 3300044658 Bacteria 1578
322 Ga0466977_0156671 3300044666 Bacteria 1471
323 Ga0466965_0012256 3300044683 Bacteria 4029
324 Ga0466965_0014090 3300044683 Bacteria 3782
325 Ga0466965_0016894 3300044683 Bacteria 3480
326 Ga0466966_0000002 3300044684 Bacteria 370962
327 Ga0466966_0003020 3300044684 Bacteria 11101
328 Ga0466966_0019301 3300044684 Bacteria 4487
329 Ga0466966_0029417 3300044684 Bacteria 3574
330 Ga0466961_0000061 3300044693 Bacteria 64795
331 Ga0466961_0058701 3300044693 Bacteria 2447
332 Ga0466961_0088868 3300044693 Bacteria 1952
333 Ga0466963_0003013 3300044694 Bacteria 9526
334 Ga0466963_0037902 3300044694 Bacteria 3151
335 Ga0466964_0001523 3300044706 Bacteria 7970
336 Ga0466971_0008015 3300044719 Bacteria 4604
337 Ga0466968_0003359 3300044735 Bacteria 5915
338 Ga0466968_0005763 3300044735 Bacteria 4647
339 Ga0466957_0000075 3300044842 Bacteria 38931
340 Ga0466957_0002815 3300044842 Bacteria 9408
341 Ga0466957_0022510 3300044842 Bacteria 3719
342 Ga0466957_0046544 3300044842 Bacteria 2634
343 Ga0466960_0100405 3300044901 Bacteria 1489
344 Ga0466959_0009742 3300045049 Bacteria 6843
345 Ga0466959_0039385 3300045049 Bacteria 3492
346 Ga0466959_0052406 3300045049 Bacteria 2988
347 Ga0451576_0018798 3300045051 Bacteria 7555
348 Ga0466958_0002064 3300045836 Bacteria 9933
349 Ga0466958_0020934 3300045836 Bacteria 3818
350 Ga0466958_0027882 3300045836 Bacteria 3344
351 Ga0466958_0108779 3300045836 Bacteria 1729
352 Ga0495617_000001 3300046452 Bacteria 877032
353 Ga0495617_000021 3300046452 Bacteria 215885
354 Ga0495617_015762 3300046452 Bacteria 2558
355 Ga0495627_000007 3300046453 Bacteria 575915
356 Ga0495627_000026 3300046453 Bacteria 238494
357 Ga0495592_0028762 3300046454 Bacteria 4206
358 Ga0495592_0034333 3300046454 Bacteria 3824
359 Ga0495603_0032716 3300046455 Bacteria 3128
360 Ga0495590_0000010 3300046457 Bacteria 317890
361 Ga0495590_0000028 3300046457 Bacteria 152333
362 Ga0495590_0000083 3300046457 Bacteria 62385
363 Ga0495590_0000820 3300046457 Bacteria 14123
364 Ga0495590_0004307 3300046457 Bacteria 5751
365 Ga0495590_0039625 3300046457 Bacteria 1643
366 Ga0495591_000007 3300046458 Bacteria 366385
367 Ga0495591_000038 3300046458 Bacteria 157347
368 Ga0495629_0000119 3300046459 Bacteria 69922
369 Ga0495629_0005983 3300046459 Bacteria 9045
370 Ga0495629_0007935 3300046459 Bacteria 7809
371 Ga0495629_0012236 3300046459 Bacteria 6215
372 Ga0495629_0012487 3300046459 Bacteria 6152
373 Ga0495629_0021233 3300046459 Bacteria 4634
374 Ga0495638_0000157 3300046460 Bacteria 107187
375 Ga0495638_0006691 3300046460 Bacteria 8352
376 Ga0495638_0034096 3300046460 Bacteria 3251
377 Ga0495638_0047636 3300046460 Bacteria 2686
378 Ga0495641_0030934 3300046461 Bacteria 2562
379 Ga0495651_0026578 3300046462 Bacteria 4508
380 Ga0495653_0000010 3300046463 Bacteria 274131
381 Ga0495653_0000105 3300046463 Bacteria 69642
382 Ga0495653_0001720 3300046463 Bacteria 17247
383 Ga0495653_0004899 3300046463 Bacteria 10861
384 Ga0495653_0005296 3300046463 Bacteria 10491
385 Ga0495653_0010674 3300046463 Bacteria 7521
386 Ga0495653_0014076 3300046463 Bacteria 6522
387 Ga0495653_0034739 3300046463 Bacteria 3983
388 Ga0495653_0114335 3300046463 Bacteria 1934
389 Ga0495653_0119173 3300046463 Bacteria 1884
390 Ga0495650_0000085 3300046471 Bacteria 235655
391 Ga0495650_0000159 3300046471 Bacteria 152501
392 Ga0495650_0000194 3300046471 Bacteria 131682
393 Ga0495650_0000299 3300046471 Bacteria 90064
394 Ga0495650_0000410 3300046471 Bacteria 70515
395 Ga0495650_0000595 3300046471 Bacteria 49927
396 Ga0495650_0001326 3300046471 Bacteria 24868
397 Ga0495650_0008519 3300046471 Bacteria 5967
398 Ga0495650_0022964 3300046471 Bacteria 2980
399 Ga0495580_0000291 3300046472 Bacteria 40835
400 Ga0495580_0001451 3300046472 Bacteria 20796
401 Ga0495580_0002463 3300046472 Bacteria 16164
402 Ga0495580_0005978 3300046472 Bacteria 9973
403 Ga0495580_0010366 3300046472 Bacteria 7264
404 Ga0495580_0018264 3300046472 Bacteria 5223
405 Ga0495580_0056101 3300046472 Bacteria 2774
406 Ga0495582_0004843 3300046473 Bacteria 7551
407 Ga0495582_0007260 3300046473 Bacteria 6144
408 Ga0495582_0009445 3300046473 Bacteria 5372
409 Ga0495582_0011544 3300046473 Bacteria 4866
410 Ga0495605_0000004 3300046474 Bacteria 395282
411 Ga0495605_0000027 3300046474 Bacteria 220680
412 Ga0495605_0000160 3300046474 Bacteria 86202
413 Ga0495605_0003001 3300046474 Bacteria 10192
414 Ga0495605_0005586 3300046474 Bacteria 7311
415 Ga0495605_0044987 3300046474 Bacteria 2178
416 Ga0495639_0006666 3300046475 Bacteria 4969
417 Ga0495662_0064856 3300046476 Bacteria 1765
418 Ga0495664_0000037 3300046477 Bacteria 70108
419 Ga0495664_0052460 3300046477 Bacteria 2423
420 Ga0495584_0000234 3300046491 Bacteria 39911
421 Ga0495584_0000390 3300046491 Bacteria 30206
422 Ga0495584_0013417 3300046491 Bacteria 4183
423 Ga0495585_0000521 3300046492 Bacteria 36396
424 Ga0495585_0001083 3300046492 Bacteria 22419
425 Ga0495585_0036248 3300046492 Bacteria 2783
426 Ga0495594_0019212 3300046499 Bacteria 3629
427 Ga0495594_0039169 3300046499 Bacteria 2590
428 Ga0495596_0000276 3300046500 Bacteria 34053
429 Ga0495596_0005192 3300046500 Bacteria 6193
430 Ga0495596_0012822 3300046500 Bacteria 3575
431 Ga0495596_0027136 3300046500 Bacteria 2305
432 Ga0495596_0027302 3300046500 Bacteria 2297
433 Ga0495596_0041783 3300046500 Bacteria 1807
434 Ga0495607_0000272 3300046501 Bacteria 55661
435 Ga0495607_0002570 3300046501 Bacteria 14663
436 Ga0495607_0010437 3300046501 Bacteria 6244
437 Ga0495607_0016076 3300046501 Bacteria 4835
438 Ga0495607_0041184 3300046501 Bacteria 2745
439 Ga0495583_0000006 3300046506 Bacteria 436893
440 Ga0495583_0000182 3300046506 Bacteria 107009
441 Ga0495583_0013576 3300046506 Bacteria 4535
442 Ga0495583_0013600 3300046506 Bacteria 4527
443 Ga0495583_0014902 3300046506 Bacteria 4256
444 Ga0495606_0000088 3300046507 Bacteria 155985
445 Ga0495606_0000103 3300046507 Bacteria 145893
446 Ga0495606_0000132 3300046507 Bacteria 126919
447 Ga0495606_0000247 3300046507 Bacteria 95120
448 Ga0495606_0002709 3300046507 Bacteria 19972
449 Ga0495606_0005424 3300046507 Bacteria 12220
450 Ga0495606_0013103 3300046507 Bacteria 6584
451 Ga0495606_0013303 3300046507 Bacteria 6517
452 Ga0495606_0013765 3300046507 Bacteria 6365
453 Ga0495606_0014367 3300046507 Bacteria 6186
454 Ga0495606_0018038 3300046507 Bacteria 5308
455 Ga0495606_0049803 3300046507 Bacteria 2744
456 Ga0495606_0083158 3300046507 Bacteria 1985
457 Ga0495606_0099810 3300046507 Bacteria 1769
458 Ga0495608_0041172 3300046511 Bacteria 3093
459 Ga0495610_0000008 3300046512 Bacteria 622732
460 Ga0495610_0002900 3300046512 Bacteria 13881
461 Ga0495610_0004713 3300046512 Bacteria 9955
462 Ga0495610_0005527 3300046512 Bacteria 8954
463 Ga0495610_0007881 3300046512 Bacteria 6999
464 Ga0495610_0009532 3300046512 Bacteria 6126
465 Ga0495616_0001024 3300046513 Bacteria 20008
466 Ga0495616_0002266 3300046513 Bacteria 12867
467 Ga0495616_0005147 3300046513 Bacteria 8115
468 Ga0495618_0003931 3300046514 Bacteria 9171
469 Ga0495620_0028049 3300046515 Bacteria 2624
470 Ga0495628_0006279 3300046516 Bacteria 10376
471 Ga0495628_0010178 3300046516 Bacteria 8000
472 Ga0495628_0025525 3300046516 Bacteria 4827
473 Ga0495628_0047828 3300046516 Bacteria 3391
474 Ga0495628_0084124 3300046516 Bacteria 2469
475 Ga0495630_0005881 3300046517 Bacteria 8676
476 Ga0495631_0000105 3300046518 Bacteria 55305
477 Ga0495631_0003775 3300046518 Bacteria 8241
478 Ga0495631_0024157 3300046518 Bacteria 2808
479 Ga0495632_0000024 3300046519 Bacteria 179517
480 Ga0495632_0000043 3300046519 Bacteria 143694
481 Ga0495632_0000106 3300046519 Bacteria 85449
482 Ga0495632_0006661 3300046519 Bacteria 7386
483 Ga0495637_0000002 3300046520 Bacteria 629280
484 Ga0495637_0003552 3300046520 Bacteria 8266
485 Ga0495637_0013350 3300046520 Bacteria 3899
486 Ga0495643_0000022 3300046522 Bacteria 289691
487 Ga0495643_0000117 3300046522 Bacteria 129698
488 Ga0495643_0000552 3300046522 Bacteria 46298
489 Ga0495643_0008044 3300046522 Bacteria 6722
490 Ga0495643_0017855 3300046522 Bacteria 4137
491 Ga0495643_0024905 3300046522 Bacteria 3390
492 Ga0495643_0074302 3300046522 Bacteria 1780
493 Ga0495644_0030135 3300046523 Bacteria 2048
494 Ga0495648_0000022 3300046524 Bacteria 242791
495 Ga0495648_0000875 3300046524 Bacteria 31749
496 Ga0495648_0001544 3300046524 Bacteria 22488
497 Ga0495648_0002193 3300046524 Bacteria 18300
498 Ga0495648_0002666 3300046524 Bacteria 16142
499 Ga0495648_0004350 3300046524 Bacteria 12127
500 Ga0495648_0009106 3300046524 Bacteria 7744
501 Ga0495648_0016093 3300046524 Bacteria 5397
502 Ga0495648_0027086 3300046524 Bacteria 3844
503 Ga0495648_0035692 3300046524 Bacteria 3219
504 Ga0495666_0003723 3300046526 Bacteria 7702
505 Ga0495666_0007129 3300046526 Bacteria 5616
506 Ga0495666_0026377 3300046526 Bacteria 2864
507 Ga0495666_0028271 3300046526 Bacteria 2759
508 Ga0495666_0028744 3300046526 Bacteria 2735
509 Ga0495666_0070065 3300046526 Bacteria 1668
510 Ga0495642_0000001 3300046528 Bacteria 389656
511 Ga0495642_0000865 3300046528 Bacteria 14325
512 Ga0495642_0001857 3300046528 Bacteria 9016
513 Ga0495642_0003562 3300046528 Bacteria 6129
514 Ga0495642_0006888 3300046528 Bacteria 4358
515 Ga0495642_0018725 3300046528 Bacteria 2710
516 Ga0495652_0018710 3300046529 Bacteria 6174
517 Ga0495652_0022578 3300046529 Bacteria 5583
518 Ga0495652_0047350 3300046529 Bacteria 3687
519 Ga0495652_0110293 3300046529 Bacteria 2213
520 Ga0495654_0000002 3300046530 Bacteria 1021205
521 Ga0495654_0009202 3300046530 Bacteria 5416
522 Ga0495654_0055852 3300046530 Bacteria 1910
523 Ga0495665_0001952 3300046531 Bacteria 11127
524 Ga0495665_0003338 3300046531 Bacteria 8704
525 Ga0495665_0007204 3300046531 Bacteria 6004
526 Ga0495665_0035472 3300046531 Bacteria 2664
527 Ga0495665_0035677 3300046531 Bacteria 2656
528 Ga0495640_0052953 3300046533 Bacteria 2784
529 Ga0495640_0109210 3300046533 Bacteria 1809
530 Ga0495586_0001962 3300046535 Bacteria 11218
531 Ga0495586_0013680 3300046535 Bacteria 4305
532 Ga0495586_0017444 3300046535 Bacteria 3816
533 Ga0495587_0002254 3300046536 Bacteria 12891
534 Ga0495587_0016882 3300046536 Bacteria 4539
535 Ga0495609_0000445 3300046538 Bacteria 34051
536 Ga0495609_0000554 3300046538 Bacteria 29545
537 Ga0495609_0001464 3300046538 Bacteria 15675
538 Ga0495609_0003850 3300046538 Bacteria 8440
539 Ga0495609_0011535 3300046538 Bacteria 4205
540 Ga0495597_0000030 3300046542 Bacteria 134736
541 Ga0495597_0000070 3300046542 Bacteria 89649
542 Ga0495597_0000189 3300046542 Bacteria 55865
543 Ga0495597_0000302 3300046542 Bacteria 44243
544 Ga0495597_0001611 3300046542 Bacteria 15835
545 Ga0495597_0001677 3300046542 Bacteria 15363
546 Ga0495597_0003633 3300046542 Bacteria 8864
547 Ga0495597_0042076 3300046542 Bacteria 2038
548 Ga0495645_0007362 3300046543 Bacteria 7658
549 Ga0495645_0084025 3300046543 Bacteria 2280
550 Ga0495645_0095254 3300046543 Bacteria 2122
551 Ga0495622_0000012 3300046557 Bacteria 189011
552 Ga0495622_0000048 3300046557 Bacteria 108955
553 Ga0495633_0001106 3300046558 Bacteria 21686
554 Ga0495633_0001287 3300046558 Bacteria 19867
555 Ga0495633_0005502 3300046558 Bacteria 7710
556 Ga0495633_0012459 3300046558 Bacteria 4521
557 Ga0495633_0029467 3300046558 Bacteria 2671
558 Ga0495656_0008392 3300046615 Bacteria 3684
559 Ga0495668_0000036 3300046616 Bacteria 235057
560 Ga0495668_0000038 3300046616 Bacteria 232122
561 Ga0495668_0000280 3300046616 Bacteria 70339
562 Ga0495668_0000428 3300046616 Bacteria 54563
563 Ga0495668_0001093 3300046616 Bacteria 28137
564 Ga0495668_0001482 3300046616 Bacteria 22483
565 Ga0495668_0004604 3300046616 Bacteria 9700
566 Ga0495668_0011982 3300046616 Bacteria 5162
567 Ga0495668_0016754 3300046616 Bacteria 4259
568 Ga0495668_0047721 3300046616 Bacteria 2377
569 Ga0495634_0008649 3300046642 Bacteria 7555
570 Ga0495634_0025885 3300046642 Bacteria 4097
571 Ga0495634_0070031 3300046642 Bacteria 2312
572 Ga0495611_0000191 3300046648 Bacteria 43883
573 Ga0495611_0000408 3300046648 Bacteria 26792
574 Ga0495625_0000241 3300046660 Bacteria 85835
575 Ga0495625_0000745 3300046660 Bacteria 45415
576 Ga0495625_0001333 3300046660 Bacteria 30655
577 Ga0495625_0012563 3300046660 Bacteria 6855
578 Ga0495625_0013580 3300046660 Bacteria 6535
579 Ga0495625_0019537 3300046660 Bacteria 5252
580 Ga0495625_0027228 3300046660 Bacteria 4308
581 Ga0495625_0040024 3300046660 Bacteria 3421
582 Ga0495635_0002476 3300046663 Bacteria 12606
583 Ga0495635_0022427 3300046663 Bacteria 4396
584 Ga0495635_0174118 3300046663 Bacteria 1463
585 Ga0495659_0000008 3300046664 Bacteria 102082
586 Ga0495661_0000040 3300046665 Bacteria 151437
587 Ga0495661_0001097 3300046665 Bacteria 23749
588 Ga0495661_0001236 3300046665 Bacteria 22115
589 Ga0495661_0003616 3300046665 Bacteria 11388
590 Ga0495661_0005279 3300046665 Bacteria 9184
591 Ga0495661_0006401 3300046665 Bacteria 8278
592 Ga0495661_0007134 3300046665 Bacteria 7801
593 Ga0495661_0011445 3300046665 Bacteria 6022
594 Ga0495661_0013687 3300046665 Bacteria 5446
595 Ga0495661_0034998 3300046665 Bacteria 3156
596 Ga0495661_0040333 3300046665 Bacteria 2896
597 Ga0495661_0059347 3300046665 Bacteria 2277
598 Ga0495588_0000052 3300046674 Bacteria 304493
599 Ga0495588_0008561 3300046674 Bacteria 4700
600 Ga0495588_0011112 3300046674 Bacteria 4214
601 Ga0495588_0016502 3300046674 Bacteria 3570
602 Ga0495599_0074269 3300046678 Bacteria 2122
603 Ga0495599_0105737 3300046678 Bacteria 1753
604 Ga0495623_0009910 3300046679 Bacteria 6171
605 Ga0495623_0033966 3300046679 Bacteria 3272
606 Ga0495623_0043178 3300046679 Bacteria 2869
607 Ga0495646_0000964 3300046680 Bacteria 16453
608 Ga0495646_0008960 3300046680 Bacteria 6351
609 Ga0495646_0009760 3300046680 Bacteria 6096
610 Ga0495669_0000013 3300046684 Bacteria 151423
611 Ga0495669_0000175 3300046684 Bacteria 40487
612 Ga0495669_0021154 3300046684 Bacteria 2820
613 Ga0495669_0069591 3300046684 Bacteria 1602
614 Ga0495613_0008181 3300046689 Bacteria 7773
615 Ga0495613_0275020 3300046689 Bacteria 1170
616 Ga0495624_0008867 3300046690 Bacteria 6990
617 Ga0495624_0009686 3300046690 Bacteria 6669
618 Ga0495624_0011804 3300046690 Bacteria 5993
619 Ga0495624_0011969 3300046690 Bacteria 5948
620 Ga0495624_0032254 3300046690 Bacteria 3397
621 Ga0495671_0000002 3300046692 Bacteria 1136189
622 Ga0495671_0000155 3300046692 Bacteria 59986
623 Ga0495671_0000313 3300046692 Bacteria 41127
624 Ga0495671_0004065 3300046692 Bacteria 8832
625 Ga0495671_0006095 3300046692 Bacteria 6999
626 Ga0495671_0084363 3300046692 Bacteria 1556
627 Ga0495649_0000085 3300046694 Bacteria 80698
628 Ga0495649_0000469 3300046694 Bacteria 34749
629 Ga0495649_0002029 3300046694 Bacteria 14644
630 Ga0495649_0036293 3300046694 Bacteria 2708
631 Ga0495589_0000058 3300046794 Bacteria 107640
632 Ga0495589_0000227 3300046794 Bacteria 47488
633 Ga0495589_0001047 3300046794 Bacteria 16678
634 Ga0495589_0020385 3300046794 Bacteria 3390
635 Ga0495589_0028869 3300046794 Bacteria 2798
636 Ga0495589_0038261 3300046794 Bacteria 2402
637 Ga0495589_0040762 3300046794 Bacteria 2318
638 Ga0495600_0004893 3300046809 Bacteria 8046
639 Ga0495660_0000050 3300046810 Bacteria 140329
640 Ga0495660_0000285 3300046810 Bacteria 47026
641 Ga0495660_0000339 3300046810 Bacteria 41484
642 Ga0495660_0003258 3300046810 Bacteria 10085
643 Ga0495660_0005819 3300046810 Bacteria 7360
644 Ga0495660_0016426 3300046810 Bacteria 4268
645 Ga0495660_0029698 3300046810 Bacteria 3083
646 Ga0495581_0007807 3300047315 Bacteria 6197
647 Ga0495581_0008391 3300047315 Bacteria 5988
648 Ga0495604_0000220 3300047317 Bacteria 52204
649 Ga0495604_0012680 3300047317 Bacteria 6706
650 Ga0495604_0016491 3300047317 Bacteria 5906
651 Ga0495604_0016819 3300047317 Bacteria 5850
652 Ga0495604_0019475 3300047317 Bacteria 5432
653 Ga0495604_0082873 3300047317 Bacteria 2397
654 Ga0495604_0102648 3300047317 Bacteria 2099
655 Ga0495674_0003517 3300047319 Bacteria 15254
656 Ga0495674_0004385 3300047319 Bacteria 13569
657 Ga0495674_0004393 3300047319 Bacteria 13550
658 Ga0495674_0005533 3300047319 Bacteria 12118
659 Ga0495674_0012988 3300047319 Bacteria 7839
660 Ga0495674_0013595 3300047319 Bacteria 7647
661 Ga0495674_0030002 3300047319 Bacteria 4947
662 Ga0495674_0036553 3300047319 Bacteria 4419
663 Ga0495672_0000015 3300047320 Bacteria 502855
664 Ga0495672_0000325 3300047320 Bacteria 63353
665 Ga0495672_0000677 3300047320 Bacteria 37926
666 Ga0495672_0001219 3300047320 Bacteria 25944
667 Ga0495672_0005093 3300047320 Bacteria 10496
668 Ga0495672_0006470 3300047320 Bacteria 9062
669 Ga0495672_0009080 3300047320 Bacteria 7249
670 Ga0495676_0000029 3300047321 Bacteria 140281
671 Ga0495676_0024837 3300047321 Bacteria 5179
672 Ga0495676_0054971 3300047321 Bacteria 3160
673 Ga0495680_0001059 3300047322 Bacteria 30455
674 Ga0495680_0005882 3300047322 Bacteria 11476
675 Ga0495680_0010964 3300047322 Bacteria 8053
676 Ga0495680_0019270 3300047322 Bacteria 5768
677 Ga0495680_0095210 3300047322 Bacteria 2226
678 Ga0495683_0000012 3300047323 Bacteria 205754
679 Ga0495683_0009313 3300047323 Bacteria 5233
680 Ga0495683_0013078 3300047323 Bacteria 4346
681 Ga0495683_0018236 3300047323 Bacteria 3630
682 Ga0495683_0029389 3300047323 Bacteria 2809
683 Ga0495683_0037256 3300047323 Bacteria 2466
684 Ga0495683_0076643 3300047323 Bacteria 1635
685 Ga0495687_000002 3300047443 Bacteria 1085770
686 Ga0495687_000003 3300047443 Bacteria 859509
687 Ga0495687_000007 3300047443 Bacteria 552679
688 Ga0495687_000025 3300047443 Bacteria 310498
689 Ga0495687_000073 3300047443 Bacteria 155429
690 Ga0495687_000445 3300047443 Bacteria 51086
691 Ga0495687_000489 3300047443 Bacteria 47669
692 Ga0495687_001493 3300047443 Bacteria 21363
693 Ga0495687_020518 3300047443 Bacteria 3217
694 Ga0495687_068084 3300047443 Bacteria 1438
695 Ga0495675_0010007 3300047444 Bacteria 5914
696 Ga0495675_0040644 3300047444 Bacteria 2963
697 Ga0495675_0051409 3300047444 Bacteria 2617
698 Ga0495677_0000144 3300047445 Bacteria 34126
699 Ga0495677_0000152 3300047445 Bacteria 32933
700 Ga0495677_0001812 3300047445 Bacteria 8544
701 Ga0495677_0008040 3300047445 Bacteria 3917
702 Ga0495677_0037019 3300047445 Bacteria 1782
703 Ga0495679_000036 3300047446 Bacteria 161473
704 Ga0495679_000038 3300047446 Bacteria 157311
705 Ga0495679_001340 3300047446 Bacteria 14236
706 Ga0495679_004357 3300047446 Bacteria 6559
707 Ga0495679_010320 3300047446 Bacteria 3672
708 Ga0495679_019679 3300047446 Bacteria 2365
709 Ga0495673_0000005 3300047469 Bacteria 943364
710 Ga0495673_0000064 3300047469 Bacteria 225793
711 Ga0495673_0000109 3300047469 Bacteria 166877
712 Ga0495673_0024774 3300047469 Bacteria 2892
713 Ga0495673_0046225 3300047469 Bacteria 1930
714 Ga0495681_0000005 3300047470 Bacteria 225279
715 Ga0495681_0000555 3300047470 Bacteria 28608
716 Ga0495681_0004387 3300047470 Bacteria 9639
717 Ga0495681_0008550 3300047470 Bacteria 6406
718 Ga0495684_0055846 3300047471 Bacteria 3011
719 Ga0495686_0000015 3300047472 Bacteria 471703
720 Ga0495686_0000032 3300047472 Bacteria 345132
721 Ga0495686_0000051 3300047472 Bacteria 263489
722 Ga0495686_0016243 3300047472 Bacteria 5053
723 Ga0495686_0104020 3300047472 Bacteria 1710
724 Ga0495593_0001558 3300047673 Bacteria 13525
725 Ga0495593_0008313 3300047673 Bacteria 6039
726 Ga0495593_0009404 3300047673 Bacteria 5670
727 Ga0495593_0014443 3300047673 Bacteria 4489
728 Ga0495593_0056827 3300047673 Bacteria 2056
729 Ga0495602_0020951 3300048088 Bacteria 6446
730 Ga0495602_0022831 3300048088 Bacteria 6113
731 Ga0495602_0025386 3300048088 Bacteria 5736
732 Ga0495602_0066735 3300048088 Bacteria 3098
733 Ga0495602_0167378 3300048088 Bacteria 1709
734 Ga0495614_0005056 3300048089 Bacteria 5951
735 Ga0495614_0037762 3300048089 Bacteria 2072
736 Ga0495626_0000066 3300048091 Bacteria 141280
737 Ga0495626_0000145 3300048091 Bacteria 89603
738 Ga0495626_0010793 3300048091 Bacteria 4854
739 Ga0495626_0020232 3300048091 Bacteria 3318
740 Ga0495626_0059771 3300048091 Bacteria 1738
741 Ga0496100_0244005 3300048903 Bacteria 1326
742 Ga0496101_0001448 3300048904 Bacteria 14161
743 Ga0496101_0076508 3300048904 Bacteria 2465
744 Ga0496101_0154564 3300048904 Bacteria 1757
745 Ga0496102_0000033 3300048905 Bacteria 213952
746 Ga0496102_0004637 3300048905 Bacteria 11630
747 Ga0496102_0106004 3300048905 Bacteria 2615
748 Ga0496102_0108444 3300048905 Bacteria 2586
749 Ga0496103_0001960 3300048906 Bacteria 13315
750 Ga0496103_0002086 3300048906 Bacteria 12767
751 Ga0496103_0002298 3300048906 Bacteria 12076
752 Ga0496104_0074198 3300048907 Bacteria 3238
753 Ga0496105_0049200 3300048908 Bacteria 3480
754 Ga0496106_0000019 3300048909 Bacteria 174698
755 Ga0496106_0022320 3300048909 Bacteria 4701
756 Ga0496106_0042892 3300048909 Bacteria 3393
757 Ga0496107_0163415 3300048910 Bacteria 1651
758 Ga0496109_0006962 3300048912 Bacteria 9543
759 Ga0496109_0181892 3300048912 Bacteria 1975
760 Ga0496110_0000007 3300048913 Bacteria 114271
761 Ga0496110_0095948 3300048913 Bacteria 2657
762 Ga0496112_0037713 3300048915 Bacteria 4718
763 Ga0496112_0063266 3300048915 Bacteria 3650
764 Ga0496112_0164239 3300048915 Bacteria 2186
765 Ga0496113_0007646 3300048916 Bacteria 6974
766 Ga0496114_0032092 3300048917 Bacteria 4321
767 Ga0496114_0177710 3300048917 Bacteria 1858
768 Ga0496116_0008917 3300048919 Bacteria 8625
769 Ga0496116_0013017 3300048919 Bacteria 6746
770 Ga0496116_0013744 3300048919 Bacteria 6507
771 Ga0496116_0080780 3300048919 Bacteria 2018
772 Ga0496117_0000058 3300048920 Bacteria 264132
773 Ga0496117_0007793 3300048920 Bacteria 10322
774 Ga0496117_0015289 3300048920 Bacteria 6553
775 Ga0496117_0025869 3300048920 Bacteria 4602
776 Ga0496117_0078788 3300048920 Bacteria 2174
777 Ga0496117_0090904 3300048920 Bacteria 1965
778 Ga0496118_0003177 3300048921 Bacteria 20986
779 Ga0496118_0004991 3300048921 Bacteria 15338
780 Ga0496118_0005234 3300048921 Bacteria 14834
781 Ga0496118_0041145 3300048921 Bacteria 3663
782 Ga0496118_0052180 3300048921 Bacteria 3122
783 Ga0496118_0070827 3300048921 Bacteria 2514
784 Ga0496119_0000089 3300048922 Bacteria 134344
785 Ga0496119_0034680 3300048922 Bacteria 3317
786 Ga0496120_0000117 3300048923 Bacteria 134343
787 Ga0496120_0001811 3300048923 Bacteria 23902
788 Ga0496120_0025297 3300048923 Bacteria 3687
789 Ga0496121_0000205 3300048924 Bacteria 130748
790 Ga0496121_0000310 3300048924 Bacteria 101522
791 Ga0496121_0003570 3300048924 Bacteria 21990
792 Ga0496121_0006733 3300048924 Bacteria 14106
793 Ga0496121_0007511 3300048924 Bacteria 13151
794 Ga0496121_0010176 3300048924 Bacteria 10649
795 Ga0496121_0147738 3300048924 Bacteria 1734
796 Ga0496122_0000279 3300048925 Bacteria 114185
797 Ga0496122_0000457 3300048925 Bacteria 84895
798 Ga0496122_0002401 3300048925 Bacteria 26723
799 Ga0496122_0005248 3300048925 Bacteria 15531
800 Ga0496122_0012927 3300048925 Bacteria 8240
801 Ga0496123_0000146 3300048926 Bacteria 143990
802 Ga0496123_0000321 3300048926 Bacteria 91682
803 Ga0496123_0001138 3300048926 Bacteria 39752
804 Ga0496123_0010024 3300048926 Bacteria 8440
805 Ga0496123_0015195 3300048926 Bacteria 6332
806 Ga0496123_0120475 3300048926 Bacteria 1477
807 Ga0496124_0000007 3300048927 Bacteria 883534
808 Ga0496124_0000208 3300048927 Bacteria 115312
809 Ga0496124_0002145 3300048927 Bacteria 26496
810 Ga0496124_0005692 3300048927 Bacteria 13887
811 Ga0496124_0010579 3300048927 Bacteria 9329
812 Ga0496124_0036217 3300048927 Bacteria 4306
813 Ga0496124_0070548 3300048927 Bacteria 2898
814 Ga0496124_0141287 3300048927 Bacteria 1900
815 Ga0496125_0000895 3300048928 Bacteria 47230
816 Ga0496125_0000938 3300048928 Bacteria 45852
817 Ga0496125_0020498 3300048928 Bacteria 6204
818 Ga0496125_0023674 3300048928 Bacteria 5663
819 Ga0496125_0043939 3300048928 Bacteria 3786
820 Ga0496125_0050210 3300048928 Bacteria 3456
821 Ga0496125_0050623 3300048928 Bacteria 3437
822 Ga0496125_0091759 3300048928 Bacteria 2274
823 Ga0496126_0000034 3300048929 Bacteria 362440
824 Ga0496126_0000706 3300048929 Bacteria 60980
825 Ga0496126_0006701 3300048929 Bacteria 12792
826 Ga0496126_0023730 3300048929 Bacteria 5939
827 Ga0496126_0033941 3300048929 Bacteria 4798
828 Ga0496126_0044704 3300048929 Bacteria 4076
829 Ga0496126_0068323 3300048929 Bacteria 3173
830 Ga0496126_0140724 3300048929 Bacteria 2077
831 Ga0501308_000888 3300049128 Bacteria 2184
832 Ga0495678_000004 3300049459 Bacteria 532920
833 Ga0495678_000015 3300049459 Bacteria 309544
834 Ga0495678_000022 3300049459 Bacteria 237031
835 Ga0495678_000103 3300049459 Bacteria 103891
836 Ga0495678_001009 3300049459 Bacteria 24097
837 Ga0495678_001189 3300049459 Bacteria 21418
838 Ga0495678_029569 3300049459 Bacteria 2299
839 Ga0495682_0000038 3300049460 Bacteria 120212
840 Ga0495682_0009396 3300049460 Bacteria 3816
841 Ga0495682_0035115 3300049460 Bacteria 1847
842 Ga0501031_0001921 3300049568 Bacteria 13100
843 Ga0501031_0007771 3300049568 Bacteria 6979
844 Ga0501032_0003027 3300049569 Bacteria 13035
845 Ga0501032_0105607 3300049569 Bacteria 1866
846 Ga0501033_0000665 3300049570 Bacteria 31783
847 Ga0501033_0001358 3300049570 Bacteria 21808
848 Ga0501033_0036882 3300049570 Bacteria 3662
849 Ga0501033_0071779 3300049570 Bacteria 2543
850 Ga0501036_0000045 3300049572 Bacteria 78277
851 Ga0501037_0000236 3300049573 Bacteria 47586
852 Ga0501037_0001205 3300049573 Bacteria 19110
853 Ga0501038_0005951 3300049574 Bacteria 11281
854 Ga0501038_0014317 3300049574 Bacteria 7228
855 Ga0501038_0066255 3300049574 Bacteria 3076
856 Ga0501043_0000065 3300049579 Bacteria 93521
857 Ga0501043_0002979 3300049579 Bacteria 14103
858 Ga0501043_0207481 3300049579 Bacteria 1519
859 Ga0501046_0001304 3300049580 Bacteria 24149
860 Ga0501047_0006181 3300049581 Bacteria 11261
861 Ga0501047_0082840 3300049581 Bacteria 3083
862 Ga0501047_0083059 3300049581 Bacteria 3079
863 Ga0501047_0185404 3300049581 Bacteria 1946
864 Ga0501047_0234088 3300049581 Bacteria 1689
865 Ga0501069_0000002 3300049585 Bacteria 269636
866 Ga0501070_0000339 3300049586 Bacteria 42523
867 Ga0501070_0016944 3300049586 Bacteria 6115
868 Ga0501070_0039176 3300049586 Bacteria 3953
869 Ga0501071_0014589 3300049587 Bacteria 5376
870 Ga0501073_0008914 3300049589 Bacteria 7414
871 Ga0501074_0001070 3300049590 Bacteria 17857
872 Ga0501074_0248541 3300049590 Bacteria 1265
873 Ga0501076_0110333 3300049592 Bacteria 2224
874 Ga0501077_0035933 3300049593 Bacteria 3155
875 Ga0501209_000052 3300049656 Bacteria 11469
876 Ga0501249_003643 3300049679 Bacteria 3103
877 Ga0501079_0139149 3300049741 Bacteria 1891
878 Ga0501080_0000617 3300049742 Bacteria 28211
879 Ga0501080_0019404 3300049742 Bacteria 6299
880 Ga0501083_0185607 3300049744 Bacteria 1357
881 Ga0501083_0214208 3300049744 Bacteria 1255
882 Ga0501035_0000124 3300049822 Bacteria 93561
883 Ga0501035_0000552 3300049822 Bacteria 41623
884 Ga0501035_0004858 3300049822 Bacteria 12747
885 Ga0501035_0007250 3300049822 Bacteria 10377
886 Ga0501035_0010969 3300049822 Bacteria 8389
887 Ga0501044_0000087 3300049823 Bacteria 112979
888 Ga0501044_0001108 3300049823 Bacteria 32043
889 Ga0501044_0003419 3300049823 Bacteria 17892
890 Ga0501044_0030772 3300049823 Bacteria 5654
891 Ga0500644_0012225 3300053088 Bacteria 2368
892 Ga0500581_056119 3300053089 Bacteria 2001
893 Ga0500651_0019866 3300053093 Bacteria 4180
894 Ga0500650_0000508 3300053098 Bacteria 9861
895 Ga0500556_0000016 3300053104 Bacteria 194958
896 Ga0500569_020990 3300053109 Bacteria 1721
897 Ga0500594_0005059 3300053118 Bacteria 2915
898 Ga0500618_000032 3300053125 Bacteria 126990
899 Ga0500642_0000017 3300053130 Bacteria 167670
900 Ga0500652_000306 3300053131 Bacteria 17755
901 Ga0500658_0062856 3300053134 Bacteria 1548
902 Ga0500559_0072688 3300053136 Bacteria 1550
903 Ga0500568_0002231 3300053139 Bacteria 11614
904 Ga0500586_039428 3300053145 Bacteria 1596
905 Ga0500604_0000678 3300053151 Bacteria 9334
906 Ga0500616_0000169 3300053153 Bacteria 109205
907 Ga0500627_0136423 3300053158 Bacteria 1108
908 Ga0500645_000991 3300053730 Bacteria 16014
909 Ga0501084_0036996 3300054114 Bacteria 4078
910 Ga0587077_001466 3300059493 Bacteria 2542
911 Ga0587085_005324 3300059506 Bacteria 1510
912 Ga0466962_0006514 3300061719 Bacteria 5604
913 Ga0466962_0018488 3300061719 Bacteria 3352
914 2550692510 2548876994 Bacteria 4904866
915 2501071499 2501025501 Bacteria 7768574
916 2501081178 2501025502 Bacteria 9641094
917 2501408349 2501025504 Bacteria 8008976
918 2509131446 2508501125 Bacteria 7208311
919 2510251854 2510065045 Bacteria 7761063
920 2511085953 2510917013 Bacteria 9951648
921 2511096089 2510917014 Bacteria 8296963
922 2511103187 2510917015 Bacteria 7950052
923 2511384505 2511231026 Bacteria 5225445
924 2512345178 2512047030 Bacteria 9031815
925 2513555581 2513237082 Bacteria 8640282
926 2513563475 2513237083 Bacteria 8410967
927 2513961405 2513237151 Bacteria 6309801
928 2514053378 2513237166 Bacteria 10373764
929 2515684268 2515154122 Bacteria 8609520
930 2515687463 2515154123 Bacteria 6387382
931 2516022486 2515154189 Bacteria 9629850
932 2519458198 2519103095 Bacteria 6629912
933 2521557642 2521172590 Bacteria 5047645
934 2527080707 2526164713 Bacteria 6780608
935 2553002760 2551306416 Bacteria 6152985
936 2563059283 2562617112 Bacteria 10918404
937 2585294748 2582581311 Bacteria 6763856
938 2599738060 2599185239 Bacteria 8686614
939 2599742568 2599185240 Bacteria 7968121
940 2600204686 2599185355 Bacteria 7968906
941 2603858197 2602042107 Bacteria 6226103
942 2643797235 2643221556 Bacteria 7251154
943 2643814371 2643221558 Bacteria 5460675
944 2644253215 2643221645 Bacteria 7207331
945 2644355743 2643221664 Bacteria 7272945
946 2644474223 2643221684 Bacteria 7145183
947 2676741672 2675903129 Bacteria 7964495
948 2713479783 2711768613 Bacteria 11048459
949 2719640965 2718217991 Bacteria 7829542
950 2723876924 2721755763 Bacteria 4464185
951 2738742190 2738541280 Bacteria 6630198
952 2738745273 2738541281 Bacteria 5112672
953 2738819043 2738541296 Bacteria 7285013
954 2738828664 2738541297 Bacteria 6549566
955 2738830801 2738541298 Bacteria 7286732
956 2738841361 2738541300 Bacteria 6675882
957 2738872327 2738541306 Bacteria 7284992
958 2739152460 2738541357 Bacteria 6549408
959 2739183958 2738543002 Bacteria 7284546
960 2739194380 2738543003 Bacteria 6549560
961 2739218928 2738543008 Bacteria 7282815
962 2739272231 2738543018 Bacteria 6718814
963 2739320856 2738543026 Bacteria 6549408
964 2739339097 2738543029 Bacteria 6549249
965 2739341275 2738543030 Bacteria 6719714
966 2739354503 2738543032 Bacteria 5115625
967 2739610524 2739367655 Bacteria 4051151
968 2746088225 2744054900 Bacteria 8399525
969 2746096881 2744054901 Bacteria 8397047
970 2765570192 2765235838 Bacteria 5445269
971 2792840548 2791355137 Bacteria 9654227
972 2808969967 2808606384 Bacteria 8474373
973 2808981532 2808606386 Bacteria 4471946
974 2809005186 2808606390 Bacteria 8476311
975 2809011673 2808606391 Bacteria 8308166
976 2809129115 2808606415 Bacteria 4576710
977 2809143657 2808606418 Bacteria 6724496
978 2809148735 2808606419 Bacteria 4576925
979 2817260350 2816332253 Bacteria 6764532
980 2817278038 2816332256 Bacteria 6891714
981 2817455605 2816332286 Bacteria 6853759
982 2819591496 2818991445 Bacteria 4955017
983 2819615215 2818991449 Bacteria 5518009
984 2819623521 2818991450 Bacteria 6962147
985 2819632876 2818991452 Bacteria 8442785
986 2821132907 2821131069 Bacteria 6108407
987 2839096866 2839094727 Bacteria 5534556
988 2842325040 2842324504 Bacteria 9364110
989 2842349318 2842348783 Bacteria 9002918
990 2842459939 2842454564 Bacteria 8730687
991 2842714580 2842711865 Bacteria 7155354
992 2844531156 2844528606 Bacteria 4733806
993 2852621273 2852618963 Bacteria 4577824
994 2856292821 2856287931 Bacteria 7223934
995 2857361055 2857357740 Bacteria 9937880
996 2857527588 2857524615 Bacteria 6615449
997 2857554732 2857553236 Bacteria 6166726
998 2857563577 2857558681 Bacteria 6617694
999 2857568815 2857564685 Bacteria 6290584
1000 2863421887 2863421361 Bacteria 7300805
1001 2865015529 2865014394 Bacteria 4764573
1002 2870072171 2870068957 Bacteria 8925310
1003 2881613599 2881609920 Bacteria 4405319
1004 2883088077 2883087390 Bacteria 9532701
1005 2884816588 2884811622 Bacteria 5552861
1006 2884837305 2884836552 Bacteria 5219991
1007 2884853596 2884852848 Bacteria 5221161
1008 2885267637 2885266251 Bacteria 4796748
1009 2885271036 2885270888 Bacteria 9831543
1010 2896155287 2896154374 Bacteria 5221518
1011 2900637764 2900634093 Bacteria 10263517
1012 2902687376 2902682994 Bacteria 8951596
1013 2904427100 2904424332 Bacteria 7633521
1014 2904441623 2904439833 Bacteria 5931679
1015 2904487456 2904483920 Bacteria 7545285
1016 2904531455 2904530477 Bacteria 5876334
1017 2904566052 2904564687 Bacteria 7609577
1018 2904573096 2904571731 Bacteria 7608790
1019 2904586905 2904584206 Bacteria 6028872
1020 2904593062 2904589729 Bacteria 6113573
1021 2904603101 2904601388 Bacteria 5884906
1022 2904623602 2904615490 Bacteria 10047340
1023 2919050926 2919046199 Bacteria 5567169
1024 2919073440 2919073203 Bacteria 6531949
1025 2919083887 2919079590 Bacteria 5946433
1026 2919480126 2919476304 Bacteria 5888696
1027 2919528763 2919527303 Bacteria 7718827
1028 2921653448 2921643360 Bacteria 11448031
1029 2923510840 2923510766 Bacteria 5926163
1030 2928062992 2928058823 Bacteria 5520022
1031 2928110891 2928108538 Bacteria 7360024
1032 2928119909 2928115317 Bacteria 6477646
1033 2928135127 2928130867 Bacteria 5467269
1034 2928137551 2928135762 Bacteria 7259641
1035 2928159532 2928157003 Bacteria 7522202
1036 2928164408 2928163908 Bacteria 7561269
1037 2928177608 2928170801 Bacteria 8785406
1038 2928505742 2928503688 Bacteria 7268108
1039 2928538382 2928536128 Bacteria 7657547
1040 2939606175 2939602548 Bacteria 4950493
1041 2945937725 2945934425 Bacteria 7444609
1042 2945952718 2945951305 Bacteria 4918162
1043 2981993966 2981990288 Bacteria 7590678
1044 2990199771 2990196909 Bacteria 4054280
1045 2990705557 2990703756 Bacteria 7715990
1046 639789091 639633007 Bacteria 4376040
1047 642424578 641736151 Bacteria 7477263
1048 642417917 641736154 Bacteria 7689995
1049 642592533 642555112 Bacteria 8676562
1050 642622552 642555113 Bacteria 8214658
1051 8003957766 8003955200 Bacteria 8601927
1052 8018850321 8018845410 Bacteria 8933938
1053 8020808897 8020807995 Bacteria 6801506
1054 8020939347 8020938398 Bacteria 7472757
1055 8020947275 8020945358 Bacteria 8467355
1056 8020954429 8020953355 Bacteria 7439080
1057 8021122783 8021120328 Bacteria 8782274
1058 8039099749 8039098773 Bacteria 6602928
1059 8040169347 8040167225 Bacteria 6542727
1060 8040174949 8040173305 Bacteria 6827067
1061 8047674923 8047673197 Bacteria 7395230
1062 8055267010 8055266321 Bacteria 7999742
1063 8055301676 8055301274 Bacteria 8587385
1064 JGI24741J21665_1000401
1065 JGI24740J21852_10000321
1066 JGI24739J22299_10006043
1067 JGI24735J21928_10000185
1068 JGI24735J21928_10000211
1069 JGI24735J21928_10001957
1070 JGI24735J21928_10004968
1071 JGI24735J21928_10008800
1072 JGI24738J21930_10002074
1073 JGI25155J39150_1000080
1074 JGI25156J39149_1000112
1075 JGI25156J39149_1000128
1076 JGI25156J39149_1002049
1077 JGI25156J39149_1002067
1078 JGI25156J39149_1003272
1079 JGI25156J39149_1003825
1080 JGI25154J39366_1000143
1081 JGI25154J39366_1000228
1082 JGI25154J39366_1000987
1083 JGI25154J39366_1002015
1084 JGI25157J39369_1000134
1085 JGI25150J39212_1005914
1086 JGI25159J45721_1000415
1087 rootH1_10051707
1088 rootH2_10118416
1089 rootL2_10096030
1090 JGI25160J50197_1000818
1091 Ga0007410J51695_1020040
1092 Ga0007416J51690_1024636
1093 Ga0006562J51391_1027748
1094 Ga0055538_1000045
1095 Ga0055538_1001125
1096 Ga0055539_1000064
1097 Ga0055533_1000074
1098 Ga0055533_1001120
1099 Ga0055533_1001259
1100 Ga0055533_1005185
1101 Ga0055532_1000039
1102 Ga0055532_1000101
1103 Ga0055525_1000008
1104 Ga0055525_1000092
1105 Ga0055527_1000024
1106 Ga0055527_1000493
1107 Ga0055527_1000532
1108 Ga0055535_1000028
1109 Ga0055535_1001248
1110 Ga0055535_1001362
1111 Ga0055542_1000047
1112 Ga0055542_1001239
1113 Ga0055542_1001248
1114 Ga0055529_1000054
1115 Ga0055529_1000068
1116 Ga0055529_1000492
1117 Ga0055526_1000050
1118 Ga0055526_1000266
1119 Ga0055526_1008612
1120 Ga0055537_1002528
1121 Ga0055524_1000008
1122 Ga0055524_1000757
1123 Ga0055534_1001148
1124 Ga0055528_1007588
1125 Ga0055541_1000046
1126 Ga0055541_1000338
1127 Ga0058692_1002178
1128 Ga0058692_1010584
1129 Ga0058692_1011276
1130 Ga0058860_12094178
1131 Ga0065165_1001552
1132 Ga0065165_1002547
1133 Ga0070660_100000016
1134 Ga0070660_100005437
1135 Ga0070660_100060822
1136 Ga0070668_100012227
1137 Ga0070659_100000014
1138 Ga0070659_100008470
1139 Ga0070663_100002932
1140 Ga0070663_100067188
1141 Ga0070663_100085631
1142 Ga0068867_100259328
1143 Ga0068853_100002082
1144 Ga0068853_100013775
1145 Ga0068855_100000072
1146 Ga0068855_100004807
1147 Ga0068855_100013735
1148 Ga0068855_100046114
1149 Ga0068855_100068318
1150 Ga0068855_100124015
1151 Ga0068857_100220021
1152 Ga0068854_100073808
1153 Ga0068856_100089098
1154 Ga0068852_100120980
1155 Ga0075364_10101476
1156 Ga0075369_10050767
1157 Ga0075434_100124417
1158 Ga0099826_10000001
1159 Ga0105251_10001940
1160 Ga0105251_10003240
1161 Ga0105251_10003354
1162 Ga0105244_10001399
1163 Ga0105244_10006780
1164 Ga0105250_10008806
1165 Ga0105240_10003437
1166 Ga0105240_10007932
1167 Ga0105240_10020875
1168 Ga0105240_10108247
1169 Ga0105241_10110149
1170 Ga0105241_10135866
1171 Ga0105237_10007453
1172 Ga0105238_10008553
1173 Ga0105238_10046424
1174 Ga0105238_10327108
1175 Ga0105239_10012776
1176 Ga0105246_10033371
1177 Ga0157371_10000060
1178 Ga0157371_10060213
1179 Ga0157370_10008182
1180 Ga0157369_10001025
1181 Ga0157369_10002277
1182 Ga0157369_10017044
1183 Ga0157374_10000065
1184 Ga0157374_10154109
1185 Ga0157378_10304588
1186 Ga0157372_10005829
1187 Ga0157372_10373069
1188 Ga0182008_10017279
1189 Ga0182006_1000029
1190 Ga0182006_1001675
1191 Ga0182006_1011977
1192 Ga0182007_10022643
1193 Ga0182005_1000012
1194 Ga0183361_10039
1195 Ga0197907_10094810
1196 Ga0206356_10207775
1197 Ga0206355_1201316
1198 Ga0206352_10616037
1199 Ga0206350_10823393
1200 Ga0206353_10857790
1201 Ga0213872_10000078
1202 Ga0213872_10028116
1203 Ga0213872_10035227
1204 Ga0213872_10049988
1205 Ga0224712_10014477
1206 Ga0224712_10053556
1207 Ga0224712_10077390
1208 Ga0209435_100016
1209 Ga0209435_101536
1210 Ga0209784_100002
1211 Ga0209784_100355
1212 Ga0209566_100003
1213 Ga0209566_100206
1214 Ga0209674_100004
1215 Ga0209674_100013
1216 Ga0209674_100317
1217 Ga0209674_100508
1218 Ga0209672_100010
1219 Ga0209672_100019
1220 Ga0209672_100051
1221 Ga0209672_100663
1222 Ga0209147_100006
1223 Ga0209147_100023
1224 Ga0209147_100026
1225 Ga0209147_100192
1226 Ga0209147_100544
1227 Ga0209563_100003
1228 Ga0209563_100006
1229 Ga0207427_100524
1230 Ga0209437_100166
1231 Ga0209258_100010
1232 Ga0209258_100031
1233 Ga0209258_100345
1234 Ga0209258_100358
1235 Ga0207425_1000198
1236 Ga0209646_1000007
1237 Ga0209646_1000022
1238 Ga0209646_1000033
1239 Ga0209026_1000031
1240 Ga0209677_100003
1241 Ga0209677_102782
1242 Ga0209148_1000018
1243 Ga0209148_1000021
1244 Ga0209148_1000027
1245 Ga0209148_1000400
1246 Ga0209148_1001190
1247 Ga0209148_1005336
1248 Ga0209759_1000160
1249 Ga0209759_1000227
1250 Ga0209759_1000830
1251 Ga0209759_1002634
1252 Ga0209759_1005851
1253 Ga0209759_1007134
1254 Ga0209759_1008597
1255 Ga0209233_1000135
1256 Ga0209565_1000136
1257 Ga0209565_1012467
1258 Ga0209455_1000015
1259 Ga0209455_1000026
1260 Ga0209455_1000213
1261 Ga0209455_1000746
1262 Ga0209673_1000201
1263 Ga0209675_1000670
1264 Ga0209025_1004560
1265 Ga0209564_1000002
1266 Ga0209564_1000007
1267 Ga0209564_1002172
1268 Ga0209564_1003554
1269 Ga0209564_1030619
1270 Ga0209758_1001300
1271 Ga0209256_1000005
1272 Ga0207426_1000183
1273 Ga0207655_1010700
1274 Ga0207713_1024483
1275 Ga0207647_10002579
1276 Ga0207647_10005988
1277 Ga0207647_10013632
1278 Ga0207647_10014941
1279 Ga0207647_10021360
1280 Ga0207705_10000909
1281 Ga0207705_10068844
1282 Ga0207654_10020282
1283 Ga0207695_10001378
1284 Ga0207695_10003550
1285 Ga0207695_10017376
1286 Ga0207695_10022439
1287 Ga0207671_10018507
1288 Ga0207671_10062016
1289 Ga0207657_10000001
1290 Ga0207657_10011207
1291 Ga0207657_10162278
1292 Ga0207694_10005502
1293 Ga0207694_10005690
1294 Ga0207690_10000006
1295 Ga0207690_10062100
1296 Ga0207686_10106992
1297 Ga0207689_10256758
1298 Ga0207667_10000055
1299 Ga0207667_10005385
1300 Ga0207667_10009859
1301 Ga0207667_10023435
1302 Ga0207667_10026316
1303 Ga0207667_10102192
1304 Ga0207668_10023326
1305 Ga0207639_10011574
1306 Ga0207678_10000640
1307 Ga0207702_10215259
1308 Ga0207648_10073287
1309 Ga0207698_10136833
1310 Ga0209371_1000202
1311 Ga0209371_1002201
1312 Ga0209371_1006356
1313 Ga0209371_1013531
1314 Ga0209282_1000001
1315 Ga0307515_10114288
1316 Ga0265338_10000183
1317 Ga0265338_10001296
1318 Ga0268256_1000189
1319 Ga0268256_1001207
1320 Ga0268256_1007934
1321 Ga0268256_1011771
1322 Ga0265314_10045322
1323 Ga0307407_10045476
1324 Ga0307412_10000008
1325 Ga0307412_10016506
1326 Ga0316583_10000075
1327 Ga0373927_0099159
1328 Ga0395899_0000041
1329 Ga0395899_0001045
1330 Ga0395899_0001913
1331 Ga0395899_0005775
1332 Ga0395899_0013914
1333 Ga0395899_0027231
1334 Ga0395900_0000065
1335 Ga0395900_0000077
1336 Ga0395900_0000097
1337 Ga0395900_0001188
1338 Ga0395900_0001196
1339 Ga0395900_0003753
1340 Ga0395900_0024334
1341 Ga0395900_0038860
1342 Ga0395900_0065140
1343 Ga0395900_0192157
1344 Ga0395898_0000220
1345 Ga0395898_0000359
1346 Ga0395898_0002178
1347 Ga0395898_0021459
1348 Ga0395898_0297620
1349 Ga0395905_0000185
1350 Ga0395905_0009767
1351 Ga0395905_0026588
1352 Ga0395905_0099536
1353 Ga0395905_0143228
1354 Ga0395905_0182492
1355 Ga0395901_0000011
1356 Ga0395901_0000085
1357 Ga0395901_0000639
1358 Ga0395901_0000928
1359 Ga0395901_0001168
1360 Ga0395901_0001807
1361 Ga0395901_0018670
1362 Ga0395901_0100600
1363 Ga0436361_0051331
1364 Ga0436361_0081046
1365 Ga0436361_0233238
1366 Ga0436361_0457272
1367 Ga0436361_0461069
1368 Ga0436361_0732452
1369 Ga0436361_0997150
1370 Ga0436361_1068465
1371 Ga0439466_0000136
1372 Ga0439465_0014195
1373 Ga0439433_0007872
1374 Ga0439448_0000397
1375 Ga0439455_0006374
1376 Ga0439455_0012221
1377 Ga0450911_003740
1378 Ga0450907_001052
1379 Ga0439464_0005502
1380 Ga0466969_0003870
1381 Ga0466969_0011061
1382 Ga0466969_0075275
1383 Ga0466972_0032058
1384 Ga0466972_0077901
1385 Ga0466977_0156671
1386 Ga0466965_0012256
1387 Ga0466965_0014090
1388 Ga0466965_0016894
1389 Ga0466966_0000002
1390 Ga0466966_0003020
1391 Ga0466966_0019301
1392 Ga0466966_0029417
1393 Ga0466961_0000061
1394 Ga0466961_0058701
1395 Ga0466961_0088868
1396 Ga0466963_0003013
1397 Ga0466963_0037902
1398 Ga0466964_0001523
1399 Ga0466971_0008015
1400 Ga0466968_0003359
1401 Ga0466968_0005763
1402 Ga0466957_0000075
1403 Ga0466957_0002815
1404 Ga0466957_0022510
1405 Ga0466957_0046544
1406 Ga0466960_0100405
1407 Ga0466959_0009742
1408 Ga0466959_0039385
1409 Ga0466959_0052406
1410 Ga0451576_0018798
1411 Ga0466958_0002064
1412 Ga0466958_0020934
1413 Ga0466958_0027882
1414 Ga0466958_0108779
1415 Ga0495617_000001
1416 Ga0495617_000021
1417 Ga0495617_015762
1418 Ga0495627_000007
1419 Ga0495627_000026
1420 Ga0495592_0028762
1421 Ga0495592_0034333
1422 Ga0495603_0032716
1423 Ga0495590_0000010
1424 Ga0495590_0000028
1425 Ga0495590_0000083
1426 Ga0495590_0000820
1427 Ga0495590_0004307
1428 Ga0495590_0039625
1429 Ga0495591_000007
1430 Ga0495591_000038
1431 Ga0495629_0000119
1432 Ga0495629_0005983
1433 Ga0495629_0007935
1434 Ga0495629_0012236
1435 Ga0495629_0012487
1436 Ga0495629_0021233
1437 Ga0495638_0000157
1438 Ga0495638_0006691
1439 Ga0495638_0034096
1440 Ga0495638_0047636
1441 Ga0495641_0030934
1442 Ga0495651_0026578
1443 Ga0495653_0000010
1444 Ga0495653_0000105
1445 Ga0495653_0001720
1446 Ga0495653_0004899
1447 Ga0495653_0005296
1448 Ga0495653_0010674
1449 Ga0495653_0014076
1450 Ga0495653_0034739
1451 Ga0495653_0114335
1452 Ga0495653_0119173
1453 Ga0495650_0000085
1454 Ga0495650_0000159
1455 Ga0495650_0000194
1456 Ga0495650_0000299
1457 Ga0495650_0000410
1458 Ga0495650_0000595
1459 Ga0495650_0001326
1460 Ga0495650_0008519
1461 Ga0495650_0022964
1462 Ga0495580_0000291
1463 Ga0495580_0001451
1464 Ga0495580_0002463
1465 Ga0495580_0005978
1466 Ga0495580_0010366
1467 Ga0495580_0018264
1468 Ga0495580_0056101
1469 Ga0495582_0004843
1470 Ga0495582_0007260
1471 Ga0495582_0009445
1472 Ga0495582_0011544
1473 Ga0495605_0000004
1474 Ga0495605_0000027
1475 Ga0495605_0000160
1476 Ga0495605_0003001
1477 Ga0495605_0005586
1478 Ga0495605_0044987
1479 Ga0495639_0006666
1480 Ga0495662_0064856
1481 Ga0495664_0000037
1482 Ga0495664_0052460
1483 Ga0495584_0000234
1484 Ga0495584_0000390
1485 Ga0495584_0013417
1486 Ga0495585_0000521
1487 Ga0495585_0001083
1488 Ga0495585_0036248
1489 Ga0495594_0019212
1490 Ga0495594_0039169
1491 Ga0495596_0000276
1492 Ga0495596_0005192
1493 Ga0495596_0012822
1494 Ga0495596_0027136
1495 Ga0495596_0027302
1496 Ga0495596_0041783
1497 Ga0495607_0000272
1498 Ga0495607_0002570
1499 Ga0495607_0010437
1500 Ga0495607_0016076
1501 Ga0495607_0041184
1502 Ga0495583_0000006
1503 Ga0495583_0000182
1504 Ga0495583_0013576
1505 Ga0495583_0013600
1506 Ga0495583_0014902
1507 Ga0495606_0000088
1508 Ga0495606_0000103
1509 Ga0495606_0000132
1510 Ga0495606_0000247
1511 Ga0495606_0002709
1512 Ga0495606_0005424
1513 Ga0495606_0013103
1514 Ga0495606_0013303
1515 Ga0495606_0013765
1516 Ga0495606_0014367
1517 Ga0495606_0018038
1518 Ga0495606_0049803
1519 Ga0495606_0083158
1520 Ga0495606_0099810
1521 Ga0495608_0041172
1522 Ga0495610_0000008
1523 Ga0495610_0002900
1524 Ga0495610_0004713
1525 Ga0495610_0005527
1526 Ga0495610_0007881
1527 Ga0495610_0009532
1528 Ga0495616_0001024
1529 Ga0495616_0002266
1530 Ga0495616_0005147
1531 Ga0495618_0003931
1532 Ga0495620_0028049
1533 Ga0495628_0006279
1534 Ga0495628_0010178
1535 Ga0495628_0025525
1536 Ga0495628_0047828
1537 Ga0495628_0084124
1538 Ga0495630_0005881
1539 Ga0495631_0000105
1540 Ga0495631_0003775
1541 Ga0495631_0024157
1542 Ga0495632_0000024
1543 Ga0495632_0000043
1544 Ga0495632_0000106
1545 Ga0495632_0006661
1546 Ga0495637_0000002
1547 Ga0495637_0003552
1548 Ga0495637_0013350
1549 Ga0495643_0000022
1550 Ga0495643_0000117
1551 Ga0495643_0000552
1552 Ga0495643_0008044
1553 Ga0495643_0017855
1554 Ga0495643_0024905
1555 Ga0495643_0074302
1556 Ga0495644_0030135
1557 Ga0495648_0000022
1558 Ga0495648_0000875
1559 Ga0495648_0001544
1560 Ga0495648_0002193
1561 Ga0495648_0002666
1562 Ga0495648_0004350
1563 Ga0495648_0009106
1564 Ga0495648_0016093
1565 Ga0495648_0027086
1566 Ga0495648_0035692
1567 Ga0495666_0003723
1568 Ga0495666_0007129
1569 Ga0495666_0026377
1570 Ga0495666_0028271
1571 Ga0495666_0028744
1572 Ga0495666_0070065
1573 Ga0495642_0000001
1574 Ga0495642_0000865
1575 Ga0495642_0001857
1576 Ga0495642_0003562
1577 Ga0495642_0006888
1578 Ga0495642_0018725
1579 Ga0495652_0018710
1580 Ga0495652_0022578
1581 Ga0495652_0047350
1582 Ga0495652_0110293
1583 Ga0495654_0000002
1584 Ga0495654_0009202
1585 Ga0495654_0055852
1586 Ga0495665_0001952
1587 Ga0495665_0003338
1588 Ga0495665_0007204
1589 Ga0495665_0035472
1590 Ga0495665_0035677
1591 Ga0495640_0052953
1592 Ga0495640_0109210
1593 Ga0495586_0001962
1594 Ga0495586_0013680
1595 Ga0495586_0017444
1596 Ga0495587_0002254
1597 Ga0495587_0016882
1598 Ga0495609_0000445
1599 Ga0495609_0000554
1600 Ga0495609_0001464
1601 Ga0495609_0003850
1602 Ga0495609_0011535
1603 Ga0495597_0000030
1604 Ga0495597_0000070
1605 Ga0495597_0000189
1606 Ga0495597_0000302
1607 Ga0495597_0001611
1608 Ga0495597_0001677
1609 Ga0495597_0003633
1610 Ga0495597_0042076
1611 Ga0495645_0007362
1612 Ga0495645_0084025
1613 Ga0495645_0095254
1614 Ga0495622_0000012
1615 Ga0495622_0000048
1616 Ga0495633_0001106
1617 Ga0495633_0001287
1618 Ga0495633_0005502
1619 Ga0495633_0012459
1620 Ga0495633_0029467
1621 Ga0495656_0008392
1622 Ga0495668_0000036
1623 Ga0495668_0000038
1624 Ga0495668_0000280
1625 Ga0495668_0000428
1626 Ga0495668_0001093
1627 Ga0495668_0001482
1628 Ga0495668_0004604
1629 Ga0495668_0011982
1630 Ga0495668_0016754
1631 Ga0495668_0047721
1632 Ga0495634_0008649
1633 Ga0495634_0025885
1634 Ga0495634_0070031
1635 Ga0495611_0000191
1636 Ga0495611_0000408
1637 Ga0495625_0000241
1638 Ga0495625_0000745
1639 Ga0495625_0001333
1640 Ga0495625_0012563
1641 Ga0495625_0013580
1642 Ga0495625_0019537
1643 Ga0495625_0027228
1644 Ga0495625_0040024
1645 Ga0495635_0002476
1646 Ga0495635_0022427
1647 Ga0495635_0174118
1648 Ga0495659_0000008
1649 Ga0495661_0000040
1650 Ga0495661_0001097
1651 Ga0495661_0001236
1652 Ga0495661_0003616
1653 Ga0495661_0005279
1654 Ga0495661_0006401
1655 Ga0495661_0007134
1656 Ga0495661_0011445
1657 Ga0495661_0013687
1658 Ga0495661_0034998
1659 Ga0495661_0040333
1660 Ga0495661_0059347
1661 Ga0495588_0000052
1662 Ga0495588_0008561
1663 Ga0495588_0011112
1664 Ga0495588_0016502
1665 Ga0495599_0074269
1666 Ga0495599_0105737
1667 Ga0495623_0009910
1668 Ga0495623_0033966
1669 Ga0495623_0043178
1670 Ga0495646_0000964
1671 Ga0495646_0008960
1672 Ga0495646_0009760
1673 Ga0495669_0000013
1674 Ga0495669_0000175
1675 Ga0495669_0021154
1676 Ga0495669_0069591
1677 Ga0495613_0008181
1678 Ga0495613_0275020
1679 Ga0495624_0008867
1680 Ga0495624_0009686
1681 Ga0495624_0011804
1682 Ga0495624_0011969
1683 Ga0495624_0032254
1684 Ga0495671_0000002
1685 Ga0495671_0000155
1686 Ga0495671_0000313
1687 Ga0495671_0004065
1688 Ga0495671_0006095
1689 Ga0495671_0084363
1690 Ga0495649_0000085
1691 Ga0495649_0000469
1692 Ga0495649_0002029
1693 Ga0495649_0036293
1694 Ga0495589_0000058
1695 Ga0495589_0000227
1696 Ga0495589_0001047
1697 Ga0495589_0020385
1698 Ga0495589_0028869
1699 Ga0495589_0038261
1700 Ga0495589_0040762
1701 Ga0495600_0004893
1702 Ga0495660_0000050
1703 Ga0495660_0000285
1704 Ga0495660_0000339
1705 Ga0495660_0003258
1706 Ga0495660_0005819
1707 Ga0495660_0016426
1708 Ga0495660_0029698
1709 Ga0495581_0007807
1710 Ga0495581_0008391
1711 Ga0495604_0000220
1712 Ga0495604_0012680
1713 Ga0495604_0016491
1714 Ga0495604_0016819
1715 Ga0495604_0019475
1716 Ga0495604_0082873
1717 Ga0495604_0102648
1718 Ga0495674_0003517
1719 Ga0495674_0004385
1720 Ga0495674_0004393
1721 Ga0495674_0005533
1722 Ga0495674_0012988
1723 Ga0495674_0013595
1724 Ga0495674_0030002
1725 Ga0495674_0036553
1726 Ga0495672_0000015
1727 Ga0495672_0000325
1728 Ga0495672_0000677
1729 Ga0495672_0001219
1730 Ga0495672_0005093
1731 Ga0495672_0006470
1732 Ga0495672_0009080
1733 Ga0495676_0000029
1734 Ga0495676_0024837
1735 Ga0495676_0054971
1736 Ga0495680_0001059
1737 Ga0495680_0005882
1738 Ga0495680_0010964
1739 Ga0495680_0019270
1740 Ga0495680_0095210
1741 Ga0495683_0000012
1742 Ga0495683_0009313
1743 Ga0495683_0013078
1744 Ga0495683_0018236
1745 Ga0495683_0029389
1746 Ga0495683_0037256
1747 Ga0495683_0076643
1748 Ga0495687_000002
1749 Ga0495687_000003
1750 Ga0495687_000007
1751 Ga0495687_000025
1752 Ga0495687_000073
1753 Ga0495687_000445
1754 Ga0495687_000489
1755 Ga0495687_001493
1756 Ga0495687_020518
1757 Ga0495687_068084
1758 Ga0495675_0010007
1759 Ga0495675_0040644
1760 Ga0495675_0051409
1761 Ga0495677_0000144
1762 Ga0495677_0000152
1763 Ga0495677_0001812
1764 Ga0495677_0008040
1765 Ga0495677_0037019
1766 Ga0495679_000036
1767 Ga0495679_000038
1768 Ga0495679_001340
1769 Ga0495679_004357
1770 Ga0495679_010320
1771 Ga0495679_019679
1772 Ga0495673_0000005
1773 Ga0495673_0000064
1774 Ga0495673_0000109
1775 Ga0495673_0024774
1776 Ga0495673_0046225
1777 Ga0495681_0000005
1778 Ga0495681_0000555
1779 Ga0495681_0004387
1780 Ga0495681_0008550
1781 Ga0495684_0055846
1782 Ga0495686_0000015
1783 Ga0495686_0000032
1784 Ga0495686_0000051
1785 Ga0495686_0016243
1786 Ga0495686_0104020
1787 Ga0495593_0001558
1788 Ga0495593_0008313
1789 Ga0495593_0009404
1790 Ga0495593_0014443
1791 Ga0495593_0056827
1792 Ga0495602_0020951
1793 Ga0495602_0022831
1794 Ga0495602_0025386
1795 Ga0495602_0066735
1796 Ga0495602_0167378
1797 Ga0495614_0005056
1798 Ga0495614_0037762
1799 Ga0495626_0000066
1800 Ga0495626_0000145
1801 Ga0495626_0010793
1802 Ga0495626_0020232
1803 Ga0495626_0059771
1804 Ga0496100_0244005
1805 Ga0496101_0001448
1806 Ga0496101_0076508
1807 Ga0496101_0154564
1808 Ga0496102_0000033
1809 Ga0496102_0004637
1810 Ga0496102_0106004
1811 Ga0496102_0108444
1812 Ga0496103_0001960
1813 Ga0496103_0002086
1814 Ga0496103_0002298
1815 Ga0496104_0074198
1816 Ga0496105_0049200
1817 Ga0496106_0000019
1818 Ga0496106_0022320
1819 Ga0496106_0042892
1820 Ga0496107_0163415
1821 Ga0496109_0006962
1822 Ga0496109_0181892
1823 Ga0496110_0000007
1824 Ga0496110_0095948
1825 Ga0496112_0037713
1826 Ga0496112_0063266
1827 Ga0496112_0164239
1828 Ga0496113_0007646
1829 Ga0496114_0032092
1830 Ga0496114_0177710
1831 Ga0496116_0008917
1832 Ga0496116_0013017
1833 Ga0496116_0013744
1834 Ga0496116_0080780
1835 Ga0496117_0000058
1836 Ga0496117_0007793
1837 Ga0496117_0015289
1838 Ga0496117_0025869
1839 Ga0496117_0078788
1840 Ga0496117_0090904
1841 Ga0496118_0003177
1842 Ga0496118_0004991
1843 Ga0496118_0005234
1844 Ga0496118_0041145
1845 Ga0496118_0052180
1846 Ga0496118_0070827
1847 Ga0496119_0000089
1848 Ga0496119_0034680
1849 Ga0496120_0000117
1850 Ga0496120_0001811
1851 Ga0496120_0025297
1852 Ga0496121_0000205
1853 Ga0496121_0000310
1854 Ga0496121_0003570
1855 Ga0496121_0006733
1856 Ga0496121_0007511
1857 Ga0496121_0010176
1858 Ga0496121_0147738
1859 Ga0496122_0000279
1860 Ga0496122_0000457
1861 Ga0496122_0002401
1862 Ga0496122_0005248
1863 Ga0496122_0012927
1864 Ga0496123_0000146
1865 Ga0496123_0000321
1866 Ga0496123_0001138
1867 Ga0496123_0010024
1868 Ga0496123_0015195
1869 Ga0496123_0120475
1870 Ga0496124_0000007
1871 Ga0496124_0000208
1872 Ga0496124_0002145
1873 Ga0496124_0005692
1874 Ga0496124_0010579
1875 Ga0496124_0036217
1876 Ga0496124_0070548
1877 Ga0496124_0141287
1878 Ga0496125_0000895
1879 Ga0496125_0000938
1880 Ga0496125_0020498
1881 Ga0496125_0023674
1882 Ga0496125_0043939
1883 Ga0496125_0050210
1884 Ga0496125_0050623
1885 Ga0496125_0091759
1886 Ga0496126_0000034
1887 Ga0496126_0000706
1888 Ga0496126_0006701
1889 Ga0496126_0023730
1890 Ga0496126_0033941
1891 Ga0496126_0044704
1892 Ga0496126_0068323
1893 Ga0496126_0140724
1894 Ga0501308_000888
1895 Ga0495678_000004
1896 Ga0495678_000015
1897 Ga0495678_000022
1898 Ga0495678_000103
1899 Ga0495678_001009
1900 Ga0495678_001189
1901 Ga0495678_029569
1902 Ga0495682_0000038
1903 Ga0495682_0009396
1904 Ga0495682_0035115
1905 Ga0501031_0001921
1906 Ga0501031_0007771
1907 Ga0501032_0003027
1908 Ga0501032_0105607
1909 Ga0501033_0000665
1910 Ga0501033_0001358
1911 Ga0501033_0036882
1912 Ga0501033_0071779
1913 Ga0501036_0000045
1914 Ga0501037_0000236
1915 Ga0501037_0001205
1916 Ga0501038_0005951
1917 Ga0501038_0014317
1918 Ga0501038_0066255
1919 Ga0501043_0000065
1920 Ga0501043_0002979
1921 Ga0501043_0207481
1922 Ga0501046_0001304
1923 Ga0501047_0006181
1924 Ga0501047_0082840
1925 Ga0501047_0083059
1926 Ga0501047_0185404
1927 Ga0501047_0234088
1928 Ga0501069_0000002
1929 Ga0501070_0000339
1930 Ga0501070_0016944
1931 Ga0501070_0039176
1932 Ga0501071_0014589
1933 Ga0501073_0008914
1934 Ga0501074_0001070
1935 Ga0501074_0248541
1936 Ga0501076_0110333
1937 Ga0501077_0035933
1938 Ga0501209_000052
1939 Ga0501249_003643
1940 Ga0501079_0139149
1941 Ga0501080_0000617
1942 Ga0501080_0019404
1943 Ga0501083_0185607
1944 Ga0501083_0214208
1945 Ga0501035_0000124
1946 Ga0501035_0000552
1947 Ga0501035_0004858
1948 Ga0501035_0007250
1949 Ga0501035_0010969
1950 Ga0501044_0000087
1951 Ga0501044_0001108
1952 Ga0501044_0003419
1953 Ga0501044_0030772
1954 Ga0500644_0012225
1955 Ga0500581_056119
1956 Ga0500651_0019866
1957 Ga0500650_0000508
1958 Ga0500556_0000016
1959 Ga0500569_020990
1960 Ga0500594_0005059
1961 Ga0500618_000032
1962 Ga0500642_0000017
1963 Ga0500652_000306
1964 Ga0500658_0062856
1965 Ga0500559_0072688
1966 Ga0500568_0002231
1967 Ga0500586_039428
1968 Ga0500604_0000678
1969 Ga0500616_0000169
1970 Ga0500627_0136423
1971 Ga0500645_000991
1972 Ga0501084_0036996
1973 Ga0587077_001466
1974 Ga0587085_005324
1975 Ga0466962_0006514
1976 Ga0466962_0018488
1977 2550692510
1978 2501071499
1979 2501081178
1980 2501408349
1981 2509131446
1982 2510251854
1983 2511085953
1984 2511096089
1985 2511103187
1986 2511384505
1987 2512345178
1988 2513555581
1989 2513563475
1990 2513961405
1991 2514053378
1992 2515684268
1993 2515687463
1994 2516022486
1995 2519458198
1996 2521557642
1997 2527080707
1998 2553002760
1999 2563059283
2000 2585294748
2001 2599738060
2002 2599742568
2003 2600204686
2004 2603858197
2005 2643797235
2006 2643814371
2007 2644253215
2008 2644355743
2009 2644474223
2010 2676741672
2011 2713479783
2012 2719640965
2013 2723876924
2014 2738742190
2015 2738745273
2016 2738819043
2017 2738828664
2018 2738830801
2019 2738841361
2020 2738872327
2021 2739152460
2022 2739183958
2023 2739194380
2024 2739218928
2025 2739272231
2026 2739320856
2027 2739339097
2028 2739341275
2029 2739354503
2030 2739610524
2031 2746088225
2032 2746096881
2033 2765570192
2034 2792840548
2035 2808969967
2036 2808981532
2037 2809005186
2038 2809011673
2039 2809129115
2040 2809143657
2041 2809148735
2042 2817260350
2043 2817278038
2044 2817455605
2045 2819591496
2046 2819615215
2047 2819623521
2048 2819632876
2049 2821132907
2050 2839096866
2051 2842325040
2052 2842349318
2053 2842459939
2054 2842714580
2055 2844531156
2056 2852621273
2057 2856292821
2058 2857361055
2059 2857527588
2060 2857554732
2061 2857563577
2062 2857568815
2063 2863421887
2064 2865015529
2065 2870072171
2066 2881613599
2067 2883088077
2068 2884816588
2069 2884837305
2070 2884853596
2071 2885267637
2072 2885271036
2073 2896155287
2074 2900637764
2075 2902687376
2076 2904427100
2077 2904441623
2078 2904487456
2079 2904531455
2080 2904566052
2081 2904573096
2082 2904586905
2083 2904593062
2084 2904603101
2085 2904623602
2086 2919050926
2087 2919073440
2088 2919083887
2089 2919480126
2090 2919528763
2091 2921653448
2092 2923510840
2093 2928062992
2094 2928110891
2095 2928119909
2096 2928135127
2097 2928137551
2098 2928159532
2099 2928164408
2100 2928177608
2101 2928505742
2102 2928538382
2103 2939606175
2104 2945937725
2105 2945952718
2106 2981993966
2107 2990199771
2108 2990705557
2109 639789091
2110 642424578
2111 642417917
2112 642592533
2113 642622552
2114 8003957766
2115 8018850321
2116 8020808897
2117 8020939347
2118 8020947275
2119 8020954429
2120 8021122783
2121 8039099749
2122 8040169347
2123 8040174949
2124 8047674923
2125 8055267010
2126 8055301676

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

279

456

0.88

PF01266

DAO

FAD dependent oxidoreductase

1

277

0.88

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

1

62

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j0e-assembly1.cif.gz_B crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group 0.9943 2 32
4j0e-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group 0.9921 2 32
7bkd-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) 0.9892 2 32
7o4q-assembly1.cif.gz_B-2 structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in space group c2221 (unliganded) 0.9887 2 32
7o4t-assembly1.cif.gz_A structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) 0.9862 2 32
ID Description Score Start End Superfamily
af_I6Y4U4_173_293_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9879 2 37 3.50.50.60
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9835 2 35 3.50.50.60
4bjyA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9833 2 32 3.50.50.60
af_Q2G041_6_109_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9797 3 31 3.50.50.60
4i58A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9789 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-J0VQE7-F1-model_v4 deleted 0.9836 1 415
AF-A0A527HAE0-F1-model_v4 D-amino acid dehydrogenase 0.9832 1 329 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A0A2N3CD51-F1-model_v4 D-amino acid dehydrogenase small subunit (EC 1.4.99.6) 0.9814 1 406 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A0A2E5MX84-F1-model_v4 Amino acid dehydrogenase 0.9806 1 415 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A0A419WFR6-F1-model_v4 deleted 0.9804 1 414

Map