F489337
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1063 | 475 | 2126 | 427 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2548876994|2550692510 |
| Length | 486 |
| Sequence | ILGSGVIGVTSAYYLARAGHQVTVLDRQPGPALETSFANAGQISPGYASPWGAPGIPLKALKWMFEEHAPLAIRPDGTLQQLRWMWQMLRNCSADRYAVNKERMVRLAEYSRDCFRELRAATGIDYEGRQQGTLQLFRTQEQFDGAAKDIAVLRQSGVPFELLSREQLAGAEPALAKVSHKLTGGLRLPNDETGDCQLFTTKLAKMAEELGVQFRYDVDIQASARRCLRGGAGFVLRQLPASHRRHSGVSAEGLFDHRAGGRLPRRAGLDHPRRNLQDRRHPLRQPHPRGRHGGSGRFQQELVRGDAYVVALGSYSANFLRRIVDIPVYPLKGYSITVPVVDSRAAPVSTILDETYKIAVTRFDNRIRVGGMAEVVGFNKELNPKRRATLELVVNDLFPGAGNTAQASFWTGLRPMTPDGTPIVGATPLNNLFLNTGHGTLGWTMSCGSGQLLADLISGKRPAIAADDLSMARYLGQRQFSSAVTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 35 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 52 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 72 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 75 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 130 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 134 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 141 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 142 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 143 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 144 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 145 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 146 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 147 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 148 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 151 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 152 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 153 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 154 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 155 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 156 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 157 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 158 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 159 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 160 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 161 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 162 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 163 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 164 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 270 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 271 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 272 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 273 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 274 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 278 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 298 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 306 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 307 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 308 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 309 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 310 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 311 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 313 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 314 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 316 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 318 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 319 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 326 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 327 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 328 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 329 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 330 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 331 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 332 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 333 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 334 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 335 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 336 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 337 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 338 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 339 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 340 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 341 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 342 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 343 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 344 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 345 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 346 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 347 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 348 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 349 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 350 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 351 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 352 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 353 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 354 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 355 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 356 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 357 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 358 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 359 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 360 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 361 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 362 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 363 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 364 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 365 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 366 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 367 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 368 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 369 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 370 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 371 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 372 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 373 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 374 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 375 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 376 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 377 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 378 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 379 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 380 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 381 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 382 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 383 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 384 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 385 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 386 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 387 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 388 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 389 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 390 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 391 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 392 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 393 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 394 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 395 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 396 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 397 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 398 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 399 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 400 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 401 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 402 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 403 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 404 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 405 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 406 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 407 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 408 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 409 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 410 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 411 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 412 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 413 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 414 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 415 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 416 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 417 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 418 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 419 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 420 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 421 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 422 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 423 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 424 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 425 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 426 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 427 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 428 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 429 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 430 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 431 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 432 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 433 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 434 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 435 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 436 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 437 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 438 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 439 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 440 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 441 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 442 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 443 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 444 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 445 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 446 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 447 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 448 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 449 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 450 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 451 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 452 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 453 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 454 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 455 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 456 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 457 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 458 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 459 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 460 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 461 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 462 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 463 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 464 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 465 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 466 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 467 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 468 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 469 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 470 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 471 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 472 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 473 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 474 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 475 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.38 |
| Metatranscriptomes | 1.51 |
| Isolates | 14.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.35 |
| Nodule | 2.45 |
| Rhizoplane | 3.1 |
| Rhizosphere | 67.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000401 | 3300001915 | Bacteria | 13061 |
| 2 | JGI24740J21852_10000321 | 3300001979 | Bacteria | 20355 |
| 3 | JGI24739J22299_10006043 | 3300001989 | Bacteria | 4582 |
| 4 | JGI24735J21928_10000185 | 3300002067 | Bacteria | 22276 |
| 5 | JGI24735J21928_10000211 | 3300002067 | Bacteria | 20387 |
| 6 | JGI24735J21928_10001957 | 3300002067 | Bacteria | 7236 |
| 7 | JGI24735J21928_10004968 | 3300002067 | Bacteria | 4432 |
| 8 | JGI24735J21928_10008800 | 3300002067 | Bacteria | 3257 |
| 9 | JGI24738J21930_10002074 | 3300002075 | Bacteria | 5368 |
| 10 | JGI25155J39150_1000080 | 3300002704 | Bacteria | 56018 |
| 11 | JGI25156J39149_1000112 | 3300002705 | Bacteria | 59192 |
| 12 | JGI25156J39149_1000128 | 3300002705 | Bacteria | 56012 |
| 13 | JGI25156J39149_1002049 | 3300002705 | Bacteria | 7668 |
| 14 | JGI25156J39149_1002067 | 3300002705 | Bacteria | 7625 |
| 15 | JGI25156J39149_1003272 | 3300002705 | Bacteria | 5375 |
| 16 | JGI25156J39149_1003825 | 3300002705 | Bacteria | 4788 |
| 17 | JGI25154J39366_1000143 | 3300002738 | Bacteria | 56016 |
| 18 | JGI25154J39366_1000228 | 3300002738 | Bacteria | 37567 |
| 19 | JGI25154J39366_1000987 | 3300002738 | Bacteria | 11522 |
| 20 | JGI25154J39366_1002015 | 3300002738 | Bacteria | 5878 |
| 21 | JGI25157J39369_1000134 | 3300002741 | Bacteria | 61613 |
| 22 | JGI25150J39212_1005914 | 3300002774 | Bacteria | 2573 |
| 23 | JGI25159J45721_1000415 | 3300002987 | Bacteria | 19675 |
| 24 | rootH1_10051707 | 3300003316 | Bacteria | 6215 |
| 25 | rootH2_10118416 | 3300003320 | Bacteria | 3450 |
| 26 | rootL2_10096030 | 3300003322 | Bacteria | 1785 |
| 27 | JGI25160J50197_1000818 | 3300003354 | Bacteria | 16694 |
| 28 | Ga0007410J51695_1020040 | 3300003574 | Bacteria | 1329 |
| 29 | Ga0007416J51690_1024636 | 3300003577 | Bacteria | 1647 |
| 30 | Ga0006562J51391_1027748 | 3300003578 | Bacteria | 1400 |
| 31 | Ga0055538_1000045 | 3300003751 | Bacteria | 139066 |
| 32 | Ga0055538_1001125 | 3300003751 | Bacteria | 5779 |
| 33 | Ga0055539_1000064 | 3300003752 | Bacteria | 139066 |
| 34 | Ga0055533_1000074 | 3300003756 | Bacteria | 139066 |
| 35 | Ga0055533_1001120 | 3300003756 | Bacteria | 7618 |
| 36 | Ga0055533_1001259 | 3300003756 | Bacteria | 6969 |
| 37 | Ga0055533_1005185 | 3300003756 | Bacteria | 2149 |
| 38 | Ga0055532_1000039 | 3300003758 | Bacteria | 198049 |
| 39 | Ga0055532_1000101 | 3300003758 | Bacteria | 92881 |
| 40 | Ga0055525_1000008 | 3300003759 | Bacteria | 604287 |
| 41 | Ga0055525_1000092 | 3300003759 | Bacteria | 139066 |
| 42 | Ga0055527_1000024 | 3300003760 | Bacteria | 198049 |
| 43 | Ga0055527_1000493 | 3300003760 | Bacteria | 14159 |
| 44 | Ga0055527_1000532 | 3300003760 | Bacteria | 12837 |
| 45 | Ga0055535_1000028 | 3300003761 | Bacteria | 198049 |
| 46 | Ga0055535_1001248 | 3300003761 | Bacteria | 14159 |
| 47 | Ga0055535_1001362 | 3300003761 | Bacteria | 12837 |
| 48 | Ga0055542_1000047 | 3300003762 | Bacteria | 198049 |
| 49 | Ga0055542_1001239 | 3300003762 | Bacteria | 14176 |
| 50 | Ga0055542_1001248 | 3300003762 | Bacteria | 14073 |
| 51 | Ga0055529_1000054 | 3300003763 | Bacteria | 198049 |
| 52 | Ga0055529_1000068 | 3300003763 | Bacteria | 163911 |
| 53 | Ga0055529_1000492 | 3300003763 | Bacteria | 36023 |
| 54 | Ga0055526_1000050 | 3300003771 | Bacteria | 117283 |
| 55 | Ga0055526_1000266 | 3300003771 | Bacteria | 44005 |
| 56 | Ga0055526_1008612 | 3300003771 | Bacteria | 5054 |
| 57 | Ga0055537_1002528 | 3300003773 | Bacteria | 6062 |
| 58 | Ga0055524_1000008 | 3300003775 | Bacteria | 297761 |
| 59 | Ga0055524_1000757 | 3300003775 | Bacteria | 21800 |
| 60 | Ga0055534_1001148 | 3300003784 | Bacteria | 11208 |
| 61 | Ga0055528_1007588 | 3300003790 | Bacteria | 4777 |
| 62 | Ga0055541_1000046 | 3300003841 | Bacteria | 139066 |
| 63 | Ga0055541_1000338 | 3300003841 | Bacteria | 14759 |
| 64 | Ga0058692_1002178 | 3300003856 | Bacteria | 6693 |
| 65 | Ga0058692_1010584 | 3300003856 | Bacteria | 2274 |
| 66 | Ga0058692_1011276 | 3300003856 | Bacteria | 2167 |
| 67 | Ga0058860_12094178 | 3300004801 | Bacteria | 1385 |
| 68 | Ga0065165_1001552 | 3300005262 | Bacteria | 23926 |
| 69 | Ga0065165_1002547 | 3300005262 | Bacteria | 15111 |
| 70 | Ga0070660_100000016 | 3300005339 | Bacteria | 102648 |
| 71 | Ga0070660_100005437 | 3300005339 | Bacteria | 8822 |
| 72 | Ga0070660_100060822 | 3300005339 | Bacteria | 2932 |
| 73 | Ga0070668_100012227 | 3300005347 | Bacteria | 6395 |
| 74 | Ga0070659_100000014 | 3300005366 | Bacteria | 178272 |
| 75 | Ga0070659_100008470 | 3300005366 | Bacteria | 7514 |
| 76 | Ga0070663_100002932 | 3300005455 | Bacteria | 9709 |
| 77 | Ga0070663_100067188 | 3300005455 | Bacteria | 2600 |
| 78 | Ga0070663_100085631 | 3300005455 | Bacteria | 2326 |
| 79 | Ga0068867_100259328 | 3300005459 | Bacteria | 1417 |
| 80 | Ga0068853_100002082 | 3300005539 | Bacteria | 14838 |
| 81 | Ga0068853_100013775 | 3300005539 | Bacteria | 6607 |
| 82 | Ga0068855_100000072 | 3300005563 | Bacteria | 121486 |
| 83 | Ga0068855_100004807 | 3300005563 | Bacteria | 16490 |
| 84 | Ga0068855_100013735 | 3300005563 | Bacteria | 9761 |
| 85 | Ga0068855_100046114 | 3300005563 | Bacteria | 5153 |
| 86 | Ga0068855_100068318 | 3300005563 | Bacteria | 4137 |
| 87 | Ga0068855_100124015 | 3300005563 | Bacteria | 2955 |
| 88 | Ga0068857_100220021 | 3300005577 | Bacteria | 1734 |
| 89 | Ga0068854_100073808 | 3300005578 | Bacteria | 2501 |
| 90 | Ga0068856_100089098 | 3300005614 | Bacteria | 3068 |
| 91 | Ga0068852_100120980 | 3300005616 | Bacteria | 2397 |
| 92 | Ga0075364_10101476 | 3300006051 | Bacteria | 1916 |
| 93 | Ga0075369_10050767 | 3300006186 | Bacteria | 1795 |
| 94 | Ga0075434_100124417 | 3300006871 | Bacteria | 2596 |
| 95 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 96 | Ga0105251_10001940 | 3300009011 | Bacteria | 16937 |
| 97 | Ga0105251_10003240 | 3300009011 | Bacteria | 11970 |
| 98 | Ga0105251_10003354 | 3300009011 | Bacteria | 11660 |
| 99 | Ga0105244_10001399 | 3300009036 | Bacteria | 19606 |
| 100 | Ga0105244_10006780 | 3300009036 | Bacteria | 7367 |
| 101 | Ga0105250_10008806 | 3300009092 | Bacteria | 4274 |
| 102 | Ga0105240_10003437 | 3300009093 | Bacteria | 24590 |
| 103 | Ga0105240_10007932 | 3300009093 | Bacteria | 15315 |
| 104 | Ga0105240_10020875 | 3300009093 | Bacteria | 8724 |
| 105 | Ga0105240_10108247 | 3300009093 | Bacteria | 3368 |
| 106 | Ga0105241_10110149 | 3300009174 | Bacteria | 2203 |
| 107 | Ga0105241_10135866 | 3300009174 | Bacteria | 1996 |
| 108 | Ga0105237_10007453 | 3300009545 | Bacteria | 11973 |
| 109 | Ga0105238_10008553 | 3300009551 | Bacteria | 10241 |
| 110 | Ga0105238_10046424 | 3300009551 | Bacteria | 4384 |
| 111 | Ga0105238_10327108 | 3300009551 | Bacteria | 1519 |
| 112 | Ga0105239_10012776 | 3300010375 | Bacteria | 9342 |
| 113 | Ga0105246_10033371 | 3300011119 | Bacteria | 3421 |
| 114 | Ga0157371_10000060 | 3300013102 | Bacteria | 170456 |
| 115 | Ga0157371_10060213 | 3300013102 | Bacteria | 2692 |
| 116 | Ga0157370_10008182 | 3300013104 | Bacteria | 11305 |
| 117 | Ga0157369_10001025 | 3300013105 | Bacteria | 35250 |
| 118 | Ga0157369_10002277 | 3300013105 | Bacteria | 23092 |
| 119 | Ga0157369_10017044 | 3300013105 | Bacteria | 8162 |
| 120 | Ga0157374_10000065 | 3300013296 | Bacteria | 108630 |
| 121 | Ga0157374_10154109 | 3300013296 | Bacteria | 2235 |
| 122 | Ga0157378_10304588 | 3300013297 | Bacteria | 1543 |
| 123 | Ga0157372_10005829 | 3300013307 | Bacteria | 13120 |
| 124 | Ga0157372_10373069 | 3300013307 | Bacteria | 1662 |
| 125 | Ga0182008_10017279 | 3300014497 | Bacteria | 3743 |
| 126 | Ga0182006_1000029 | 3300015261 | Bacteria | 247579 |
| 127 | Ga0182006_1001675 | 3300015261 | Bacteria | 13013 |
| 128 | Ga0182006_1011977 | 3300015261 | Bacteria | 3798 |
| 129 | Ga0182007_10022643 | 3300015262 | Bacteria | 2216 |
| 130 | Ga0182005_1000012 | 3300015265 | Bacteria | 396944 |
| 131 | Ga0183361_10039 | 3300016635 | Bacteria | 25237 |
| 132 | Ga0197907_10094810 | 3300020069 | Bacteria | 2302 |
| 133 | Ga0206356_10207775 | 3300020070 | Bacteria | 6647 |
| 134 | Ga0206355_1201316 | 3300020076 | Bacteria | 1527 |
| 135 | Ga0206352_10616037 | 3300020078 | Bacteria | 1387 |
| 136 | Ga0206350_10823393 | 3300020080 | Bacteria | 1322 |
| 137 | Ga0206353_10857790 | 3300020082 | Bacteria | 9460 |
| 138 | Ga0213872_10000078 | 3300021361 | Bacteria | 89790 |
| 139 | Ga0213872_10028116 | 3300021361 | Bacteria | 2580 |
| 140 | Ga0213872_10035227 | 3300021361 | Bacteria | 2289 |
| 141 | Ga0213872_10049988 | 3300021361 | Bacteria | 1898 |
| 142 | Ga0224712_10014477 | 3300022467 | Bacteria | 2541 |
| 143 | Ga0224712_10053556 | 3300022467 | Bacteria | 1580 |
| 144 | Ga0224712_10077390 | 3300022467 | Bacteria | 1365 |
| 145 | Ga0209435_100016 | 3300025206 | Bacteria | 305566 |
| 146 | Ga0209435_101536 | 3300025206 | Bacteria | 2878 |
| 147 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 148 | Ga0209784_100355 | 3300025224 | Bacteria | 22209 |
| 149 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 150 | Ga0209566_100206 | 3300025225 | Bacteria | 60781 |
| 151 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 152 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 153 | Ga0209674_100317 | 3300025226 | Bacteria | 31110 |
| 154 | Ga0209674_100508 | 3300025226 | Bacteria | 16000 |
| 155 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 156 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 157 | Ga0209672_100051 | 3300025228 | Bacteria | 234414 |
| 158 | Ga0209672_100663 | 3300025228 | Bacteria | 17421 |
| 159 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 160 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 161 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 162 | Ga0209147_100192 | 3300025229 | Bacteria | 70162 |
| 163 | Ga0209147_100544 | 3300025229 | Bacteria | 21444 |
| 164 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 165 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 166 | Ga0207427_100524 | 3300025231 | Bacteria | 19948 |
| 167 | Ga0209437_100166 | 3300025233 | Bacteria | 144787 |
| 168 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 169 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 170 | Ga0209258_100345 | 3300025242 | Bacteria | 67870 |
| 171 | Ga0209258_100358 | 3300025242 | Bacteria | 61852 |
| 172 | Ga0207425_1000198 | 3300025245 | Bacteria | 48223 |
| 173 | Ga0209646_1000007 | 3300025246 | Bacteria | 670994 |
| 174 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 175 | Ga0209646_1000033 | 3300025246 | Bacteria | 369507 |
| 176 | Ga0209026_1000031 | 3300025250 | Bacteria | 325747 |
| 177 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 178 | Ga0209677_102782 | 3300025253 | Bacteria | 6219 |
| 179 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 180 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 181 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 182 | Ga0209148_1000400 | 3300025254 | Bacteria | 50569 |
| 183 | Ga0209148_1001190 | 3300025254 | Bacteria | 14889 |
| 184 | Ga0209148_1005336 | 3300025254 | Bacteria | 2969 |
| 185 | Ga0209759_1000160 | 3300025256 | Bacteria | 116290 |
| 186 | Ga0209759_1000227 | 3300025256 | Bacteria | 84278 |
| 187 | Ga0209759_1000830 | 3300025256 | Bacteria | 24405 |
| 188 | Ga0209759_1002634 | 3300025256 | Bacteria | 7717 |
| 189 | Ga0209759_1005851 | 3300025256 | Bacteria | 4219 |
| 190 | Ga0209759_1007134 | 3300025256 | Bacteria | 3643 |
| 191 | Ga0209759_1008597 | 3300025256 | Bacteria | 3166 |
| 192 | Ga0209233_1000135 | 3300025261 | Bacteria | 201057 |
| 193 | Ga0209565_1000136 | 3300025263 | Bacteria | 103019 |
| 194 | Ga0209565_1012467 | 3300025263 | Bacteria | 2028 |
| 195 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 196 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 197 | Ga0209455_1000213 | 3300025272 | Bacteria | 82040 |
| 198 | Ga0209455_1000746 | 3300025272 | Bacteria | 18598 |
| 199 | Ga0209673_1000201 | 3300025273 | Bacteria | 120059 |
| 200 | Ga0209675_1000670 | 3300025291 | Bacteria | 24015 |
| 201 | Ga0209025_1004560 | 3300025294 | Bacteria | 11922 |
| 202 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 203 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 204 | Ga0209564_1002172 | 3300025295 | Bacteria | 16506 |
| 205 | Ga0209564_1003554 | 3300025295 | Bacteria | 10463 |
| 206 | Ga0209564_1030619 | 3300025295 | Bacteria | 1664 |
| 207 | Ga0209758_1001300 | 3300025297 | Bacteria | 30598 |
| 208 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 209 | Ga0207426_1000183 | 3300025302 | Bacteria | 154449 |
| 210 | Ga0207655_1010700 | 3300025728 | Bacteria | 5544 |
| 211 | Ga0207713_1024483 | 3300025735 | Bacteria | 2814 |
| 212 | Ga0207647_10002579 | 3300025904 | Bacteria | 13712 |
| 213 | Ga0207647_10005988 | 3300025904 | Bacteria | 8859 |
| 214 | Ga0207647_10013632 | 3300025904 | Bacteria | 5629 |
| 215 | Ga0207647_10014941 | 3300025904 | Bacteria | 5335 |
| 216 | Ga0207647_10021360 | 3300025904 | Bacteria | 4322 |
| 217 | Ga0207705_10000909 | 3300025909 | Bacteria | 24236 |
| 218 | Ga0207705_10068844 | 3300025909 | Bacteria | 2563 |
| 219 | Ga0207654_10020282 | 3300025911 | Bacteria | 3521 |
| 220 | Ga0207695_10001378 | 3300025913 | Bacteria | 41129 |
| 221 | Ga0207695_10003550 | 3300025913 | Bacteria | 21855 |
| 222 | Ga0207695_10017376 | 3300025913 | Bacteria | 8370 |
| 223 | Ga0207695_10022439 | 3300025913 | Bacteria | 7163 |
| 224 | Ga0207671_10018507 | 3300025914 | Bacteria | 5341 |
| 225 | Ga0207671_10062016 | 3300025914 | Bacteria | 2775 |
| 226 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 227 | Ga0207657_10011207 | 3300025919 | Bacteria | 8914 |
| 228 | Ga0207657_10162278 | 3300025919 | Bacteria | 1815 |
| 229 | Ga0207694_10005502 | 3300025924 | Bacteria | 9721 |
| 230 | Ga0207694_10005690 | 3300025924 | Bacteria | 9559 |
| 231 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 232 | Ga0207690_10062100 | 3300025932 | Bacteria | 2542 |
| 233 | Ga0207686_10106992 | 3300025934 | Bacteria | 1879 |
| 234 | Ga0207689_10256758 | 3300025942 | Bacteria | 1446 |
| 235 | Ga0207667_10000055 | 3300025949 | Bacteria | 223770 |
| 236 | Ga0207667_10005385 | 3300025949 | Bacteria | 15603 |
| 237 | Ga0207667_10009859 | 3300025949 | Bacteria | 11214 |
| 238 | Ga0207667_10023435 | 3300025949 | Bacteria | 6798 |
| 239 | Ga0207667_10026316 | 3300025949 | Bacteria | 6358 |
| 240 | Ga0207667_10102192 | 3300025949 | Bacteria | 2957 |
| 241 | Ga0207668_10023326 | 3300025972 | Bacteria | 3975 |
| 242 | Ga0207639_10011574 | 3300026041 | Bacteria | 6129 |
| 243 | Ga0207678_10000640 | 3300026067 | Bacteria | 32171 |
| 244 | Ga0207702_10215259 | 3300026078 | Bacteria | 1788 |
| 245 | Ga0207648_10073287 | 3300026089 | Bacteria | 2984 |
| 246 | Ga0207698_10136833 | 3300026142 | Bacteria | 2103 |
| 247 | Ga0209371_1000202 | 3300027312 | Bacteria | 85989 |
| 248 | Ga0209371_1002201 | 3300027312 | Bacteria | 11330 |
| 249 | Ga0209371_1006356 | 3300027312 | Bacteria | 4392 |
| 250 | Ga0209371_1013531 | 3300027312 | Bacteria | 2285 |
| 251 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 252 | Ga0307515_10114288 | 3300028794 | Bacteria | 3122 |
| 253 | Ga0265338_10000183 | 3300028800 | Bacteria | 117272 |
| 254 | Ga0265338_10001296 | 3300028800 | Bacteria | 41001 |
| 255 | Ga0268256_1000189 | 3300030500 | Bacteria | 72206 |
| 256 | Ga0268256_1001207 | 3300030500 | Bacteria | 16482 |
| 257 | Ga0268256_1007934 | 3300030500 | Bacteria | 3705 |
| 258 | Ga0268256_1011771 | 3300030500 | Bacteria | 2744 |
| 259 | Ga0265314_10045322 | 3300031711 | Bacteria | 3110 |
| 260 | Ga0307407_10045476 | 3300031903 | Bacteria | 2481 |
| 261 | Ga0307412_10000008 | 3300031911 | Bacteria | 461034 |
| 262 | Ga0307412_10016506 | 3300031911 | Bacteria | 4400 |
| 263 | Ga0316583_10000075 | 3300032133 | Bacteria | 20871 |
| 264 | Ga0373927_0099159 | 3300035695 | Bacteria | 1894 |
| 265 | Ga0395899_0000041 | 3300037312 | Bacteria | 255615 |
| 266 | Ga0395899_0001045 | 3300037312 | Bacteria | 25131 |
| 267 | Ga0395899_0001913 | 3300037312 | Bacteria | 17173 |
| 268 | Ga0395899_0005775 | 3300037312 | Bacteria | 9606 |
| 269 | Ga0395899_0013914 | 3300037312 | Bacteria | 6144 |
| 270 | Ga0395899_0027231 | 3300037312 | Bacteria | 4311 |
| 271 | Ga0395900_0000065 | 3300037418 | Bacteria | 196327 |
| 272 | Ga0395900_0000077 | 3300037418 | Bacteria | 179525 |
| 273 | Ga0395900_0000097 | 3300037418 | Bacteria | 161598 |
| 274 | Ga0395900_0001188 | 3300037418 | Bacteria | 32276 |
| 275 | Ga0395900_0001196 | 3300037418 | Bacteria | 32097 |
| 276 | Ga0395900_0003753 | 3300037418 | Bacteria | 16318 |
| 277 | Ga0395900_0024334 | 3300037418 | Bacteria | 6200 |
| 278 | Ga0395900_0038860 | 3300037418 | Bacteria | 4905 |
| 279 | Ga0395900_0065140 | 3300037418 | Bacteria | 3743 |
| 280 | Ga0395900_0192157 | 3300037418 | Bacteria | 2070 |
| 281 | Ga0395898_0000220 | 3300037466 | Bacteria | 146473 |
| 282 | Ga0395898_0000359 | 3300037466 | Bacteria | 100304 |
| 283 | Ga0395898_0002178 | 3300037466 | Bacteria | 23964 |
| 284 | Ga0395898_0021459 | 3300037466 | Bacteria | 6549 |
| 285 | Ga0395898_0297620 | 3300037466 | Bacteria | 1539 |
| 286 | Ga0395905_0000185 | 3300037471 | Bacteria | 99394 |
| 287 | Ga0395905_0009767 | 3300037471 | Bacteria | 9358 |
| 288 | Ga0395905_0026588 | 3300037471 | Bacteria | 5456 |
| 289 | Ga0395905_0099536 | 3300037471 | Bacteria | 2730 |
| 290 | Ga0395905_0143228 | 3300037471 | Bacteria | 2249 |
| 291 | Ga0395905_0182492 | 3300037471 | Bacteria | 1970 |
| 292 | Ga0395901_0000011 | 3300038443 | Bacteria | 400724 |
| 293 | Ga0395901_0000085 | 3300038443 | Bacteria | 126093 |
| 294 | Ga0395901_0000639 | 3300038443 | Bacteria | 40528 |
| 295 | Ga0395901_0000928 | 3300038443 | Bacteria | 31902 |
| 296 | Ga0395901_0001168 | 3300038443 | Bacteria | 27890 |
| 297 | Ga0395901_0001807 | 3300038443 | Bacteria | 22099 |
| 298 | Ga0395901_0018670 | 3300038443 | Bacteria | 7083 |
| 299 | Ga0395901_0100600 | 3300038443 | Bacteria | 3032 |
| 300 | Ga0436361_0051331 | 3300039447 | Bacteria | 27824 |
| 301 | Ga0436361_0081046 | 3300039447 | Bacteria | 44857 |
| 302 | Ga0436361_0233238 | 3300039447 | Bacteria | 7286 |
| 303 | Ga0436361_0457272 | 3300039447 | Bacteria | 12371 |
| 304 | Ga0436361_0461069 | 3300039447 | Bacteria | 3811 |
| 305 | Ga0436361_0732452 | 3300039447 | Bacteria | 3970 |
| 306 | Ga0436361_0997150 | 3300039447 | Bacteria | 20731 |
| 307 | Ga0436361_1068465 | 3300039447 | Bacteria | 2558 |
| 308 | Ga0439466_0000136 | 3300041411 | Bacteria | 28940 |
| 309 | Ga0439465_0014195 | 3300041413 | Bacteria | 2483 |
| 310 | Ga0439433_0007872 | 3300041999 | Bacteria | 2304 |
| 311 | Ga0439448_0000397 | 3300042005 | Bacteria | 9912 |
| 312 | Ga0439455_0006374 | 3300042012 | Bacteria | 2446 |
| 313 | Ga0439455_0012221 | 3300042012 | Bacteria | 1924 |
| 314 | Ga0450911_003740 | 3300042115 | Bacteria | 2617 |
| 315 | Ga0450907_001052 | 3300042146 | Bacteria | 6453 |
| 316 | Ga0439464_0005502 | 3300042439 | Bacteria | 3277 |
| 317 | Ga0466969_0003870 | 3300044656 | Bacteria | 7945 |
| 318 | Ga0466969_0011061 | 3300044656 | Bacteria | 4778 |
| 319 | Ga0466969_0075275 | 3300044656 | Bacteria | 1618 |
| 320 | Ga0466972_0032058 | 3300044658 | Bacteria | 2582 |
| 321 | Ga0466972_0077901 | 3300044658 | Bacteria | 1578 |
| 322 | Ga0466977_0156671 | 3300044666 | Bacteria | 1471 |
| 323 | Ga0466965_0012256 | 3300044683 | Bacteria | 4029 |
| 324 | Ga0466965_0014090 | 3300044683 | Bacteria | 3782 |
| 325 | Ga0466965_0016894 | 3300044683 | Bacteria | 3480 |
| 326 | Ga0466966_0000002 | 3300044684 | Bacteria | 370962 |
| 327 | Ga0466966_0003020 | 3300044684 | Bacteria | 11101 |
| 328 | Ga0466966_0019301 | 3300044684 | Bacteria | 4487 |
| 329 | Ga0466966_0029417 | 3300044684 | Bacteria | 3574 |
| 330 | Ga0466961_0000061 | 3300044693 | Bacteria | 64795 |
| 331 | Ga0466961_0058701 | 3300044693 | Bacteria | 2447 |
| 332 | Ga0466961_0088868 | 3300044693 | Bacteria | 1952 |
| 333 | Ga0466963_0003013 | 3300044694 | Bacteria | 9526 |
| 334 | Ga0466963_0037902 | 3300044694 | Bacteria | 3151 |
| 335 | Ga0466964_0001523 | 3300044706 | Bacteria | 7970 |
| 336 | Ga0466971_0008015 | 3300044719 | Bacteria | 4604 |
| 337 | Ga0466968_0003359 | 3300044735 | Bacteria | 5915 |
| 338 | Ga0466968_0005763 | 3300044735 | Bacteria | 4647 |
| 339 | Ga0466957_0000075 | 3300044842 | Bacteria | 38931 |
| 340 | Ga0466957_0002815 | 3300044842 | Bacteria | 9408 |
| 341 | Ga0466957_0022510 | 3300044842 | Bacteria | 3719 |
| 342 | Ga0466957_0046544 | 3300044842 | Bacteria | 2634 |
| 343 | Ga0466960_0100405 | 3300044901 | Bacteria | 1489 |
| 344 | Ga0466959_0009742 | 3300045049 | Bacteria | 6843 |
| 345 | Ga0466959_0039385 | 3300045049 | Bacteria | 3492 |
| 346 | Ga0466959_0052406 | 3300045049 | Bacteria | 2988 |
| 347 | Ga0451576_0018798 | 3300045051 | Bacteria | 7555 |
| 348 | Ga0466958_0002064 | 3300045836 | Bacteria | 9933 |
| 349 | Ga0466958_0020934 | 3300045836 | Bacteria | 3818 |
| 350 | Ga0466958_0027882 | 3300045836 | Bacteria | 3344 |
| 351 | Ga0466958_0108779 | 3300045836 | Bacteria | 1729 |
| 352 | Ga0495617_000001 | 3300046452 | Bacteria | 877032 |
| 353 | Ga0495617_000021 | 3300046452 | Bacteria | 215885 |
| 354 | Ga0495617_015762 | 3300046452 | Bacteria | 2558 |
| 355 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 356 | Ga0495627_000026 | 3300046453 | Bacteria | 238494 |
| 357 | Ga0495592_0028762 | 3300046454 | Bacteria | 4206 |
| 358 | Ga0495592_0034333 | 3300046454 | Bacteria | 3824 |
| 359 | Ga0495603_0032716 | 3300046455 | Bacteria | 3128 |
| 360 | Ga0495590_0000010 | 3300046457 | Bacteria | 317890 |
| 361 | Ga0495590_0000028 | 3300046457 | Bacteria | 152333 |
| 362 | Ga0495590_0000083 | 3300046457 | Bacteria | 62385 |
| 363 | Ga0495590_0000820 | 3300046457 | Bacteria | 14123 |
| 364 | Ga0495590_0004307 | 3300046457 | Bacteria | 5751 |
| 365 | Ga0495590_0039625 | 3300046457 | Bacteria | 1643 |
| 366 | Ga0495591_000007 | 3300046458 | Bacteria | 366385 |
| 367 | Ga0495591_000038 | 3300046458 | Bacteria | 157347 |
| 368 | Ga0495629_0000119 | 3300046459 | Bacteria | 69922 |
| 369 | Ga0495629_0005983 | 3300046459 | Bacteria | 9045 |
| 370 | Ga0495629_0007935 | 3300046459 | Bacteria | 7809 |
| 371 | Ga0495629_0012236 | 3300046459 | Bacteria | 6215 |
| 372 | Ga0495629_0012487 | 3300046459 | Bacteria | 6152 |
| 373 | Ga0495629_0021233 | 3300046459 | Bacteria | 4634 |
| 374 | Ga0495638_0000157 | 3300046460 | Bacteria | 107187 |
| 375 | Ga0495638_0006691 | 3300046460 | Bacteria | 8352 |
| 376 | Ga0495638_0034096 | 3300046460 | Bacteria | 3251 |
| 377 | Ga0495638_0047636 | 3300046460 | Bacteria | 2686 |
| 378 | Ga0495641_0030934 | 3300046461 | Bacteria | 2562 |
| 379 | Ga0495651_0026578 | 3300046462 | Bacteria | 4508 |
| 380 | Ga0495653_0000010 | 3300046463 | Bacteria | 274131 |
| 381 | Ga0495653_0000105 | 3300046463 | Bacteria | 69642 |
| 382 | Ga0495653_0001720 | 3300046463 | Bacteria | 17247 |
| 383 | Ga0495653_0004899 | 3300046463 | Bacteria | 10861 |
| 384 | Ga0495653_0005296 | 3300046463 | Bacteria | 10491 |
| 385 | Ga0495653_0010674 | 3300046463 | Bacteria | 7521 |
| 386 | Ga0495653_0014076 | 3300046463 | Bacteria | 6522 |
| 387 | Ga0495653_0034739 | 3300046463 | Bacteria | 3983 |
| 388 | Ga0495653_0114335 | 3300046463 | Bacteria | 1934 |
| 389 | Ga0495653_0119173 | 3300046463 | Bacteria | 1884 |
| 390 | Ga0495650_0000085 | 3300046471 | Bacteria | 235655 |
| 391 | Ga0495650_0000159 | 3300046471 | Bacteria | 152501 |
| 392 | Ga0495650_0000194 | 3300046471 | Bacteria | 131682 |
| 393 | Ga0495650_0000299 | 3300046471 | Bacteria | 90064 |
| 394 | Ga0495650_0000410 | 3300046471 | Bacteria | 70515 |
| 395 | Ga0495650_0000595 | 3300046471 | Bacteria | 49927 |
| 396 | Ga0495650_0001326 | 3300046471 | Bacteria | 24868 |
| 397 | Ga0495650_0008519 | 3300046471 | Bacteria | 5967 |
| 398 | Ga0495650_0022964 | 3300046471 | Bacteria | 2980 |
| 399 | Ga0495580_0000291 | 3300046472 | Bacteria | 40835 |
| 400 | Ga0495580_0001451 | 3300046472 | Bacteria | 20796 |
| 401 | Ga0495580_0002463 | 3300046472 | Bacteria | 16164 |
| 402 | Ga0495580_0005978 | 3300046472 | Bacteria | 9973 |
| 403 | Ga0495580_0010366 | 3300046472 | Bacteria | 7264 |
| 404 | Ga0495580_0018264 | 3300046472 | Bacteria | 5223 |
| 405 | Ga0495580_0056101 | 3300046472 | Bacteria | 2774 |
| 406 | Ga0495582_0004843 | 3300046473 | Bacteria | 7551 |
| 407 | Ga0495582_0007260 | 3300046473 | Bacteria | 6144 |
| 408 | Ga0495582_0009445 | 3300046473 | Bacteria | 5372 |
| 409 | Ga0495582_0011544 | 3300046473 | Bacteria | 4866 |
| 410 | Ga0495605_0000004 | 3300046474 | Bacteria | 395282 |
| 411 | Ga0495605_0000027 | 3300046474 | Bacteria | 220680 |
| 412 | Ga0495605_0000160 | 3300046474 | Bacteria | 86202 |
| 413 | Ga0495605_0003001 | 3300046474 | Bacteria | 10192 |
| 414 | Ga0495605_0005586 | 3300046474 | Bacteria | 7311 |
| 415 | Ga0495605_0044987 | 3300046474 | Bacteria | 2178 |
| 416 | Ga0495639_0006666 | 3300046475 | Bacteria | 4969 |
| 417 | Ga0495662_0064856 | 3300046476 | Bacteria | 1765 |
| 418 | Ga0495664_0000037 | 3300046477 | Bacteria | 70108 |
| 419 | Ga0495664_0052460 | 3300046477 | Bacteria | 2423 |
| 420 | Ga0495584_0000234 | 3300046491 | Bacteria | 39911 |
| 421 | Ga0495584_0000390 | 3300046491 | Bacteria | 30206 |
| 422 | Ga0495584_0013417 | 3300046491 | Bacteria | 4183 |
| 423 | Ga0495585_0000521 | 3300046492 | Bacteria | 36396 |
| 424 | Ga0495585_0001083 | 3300046492 | Bacteria | 22419 |
| 425 | Ga0495585_0036248 | 3300046492 | Bacteria | 2783 |
| 426 | Ga0495594_0019212 | 3300046499 | Bacteria | 3629 |
| 427 | Ga0495594_0039169 | 3300046499 | Bacteria | 2590 |
| 428 | Ga0495596_0000276 | 3300046500 | Bacteria | 34053 |
| 429 | Ga0495596_0005192 | 3300046500 | Bacteria | 6193 |
| 430 | Ga0495596_0012822 | 3300046500 | Bacteria | 3575 |
| 431 | Ga0495596_0027136 | 3300046500 | Bacteria | 2305 |
| 432 | Ga0495596_0027302 | 3300046500 | Bacteria | 2297 |
| 433 | Ga0495596_0041783 | 3300046500 | Bacteria | 1807 |
| 434 | Ga0495607_0000272 | 3300046501 | Bacteria | 55661 |
| 435 | Ga0495607_0002570 | 3300046501 | Bacteria | 14663 |
| 436 | Ga0495607_0010437 | 3300046501 | Bacteria | 6244 |
| 437 | Ga0495607_0016076 | 3300046501 | Bacteria | 4835 |
| 438 | Ga0495607_0041184 | 3300046501 | Bacteria | 2745 |
| 439 | Ga0495583_0000006 | 3300046506 | Bacteria | 436893 |
| 440 | Ga0495583_0000182 | 3300046506 | Bacteria | 107009 |
| 441 | Ga0495583_0013576 | 3300046506 | Bacteria | 4535 |
| 442 | Ga0495583_0013600 | 3300046506 | Bacteria | 4527 |
| 443 | Ga0495583_0014902 | 3300046506 | Bacteria | 4256 |
| 444 | Ga0495606_0000088 | 3300046507 | Bacteria | 155985 |
| 445 | Ga0495606_0000103 | 3300046507 | Bacteria | 145893 |
| 446 | Ga0495606_0000132 | 3300046507 | Bacteria | 126919 |
| 447 | Ga0495606_0000247 | 3300046507 | Bacteria | 95120 |
| 448 | Ga0495606_0002709 | 3300046507 | Bacteria | 19972 |
| 449 | Ga0495606_0005424 | 3300046507 | Bacteria | 12220 |
| 450 | Ga0495606_0013103 | 3300046507 | Bacteria | 6584 |
| 451 | Ga0495606_0013303 | 3300046507 | Bacteria | 6517 |
| 452 | Ga0495606_0013765 | 3300046507 | Bacteria | 6365 |
| 453 | Ga0495606_0014367 | 3300046507 | Bacteria | 6186 |
| 454 | Ga0495606_0018038 | 3300046507 | Bacteria | 5308 |
| 455 | Ga0495606_0049803 | 3300046507 | Bacteria | 2744 |
| 456 | Ga0495606_0083158 | 3300046507 | Bacteria | 1985 |
| 457 | Ga0495606_0099810 | 3300046507 | Bacteria | 1769 |
| 458 | Ga0495608_0041172 | 3300046511 | Bacteria | 3093 |
| 459 | Ga0495610_0000008 | 3300046512 | Bacteria | 622732 |
| 460 | Ga0495610_0002900 | 3300046512 | Bacteria | 13881 |
| 461 | Ga0495610_0004713 | 3300046512 | Bacteria | 9955 |
| 462 | Ga0495610_0005527 | 3300046512 | Bacteria | 8954 |
| 463 | Ga0495610_0007881 | 3300046512 | Bacteria | 6999 |
| 464 | Ga0495610_0009532 | 3300046512 | Bacteria | 6126 |
| 465 | Ga0495616_0001024 | 3300046513 | Bacteria | 20008 |
| 466 | Ga0495616_0002266 | 3300046513 | Bacteria | 12867 |
| 467 | Ga0495616_0005147 | 3300046513 | Bacteria | 8115 |
| 468 | Ga0495618_0003931 | 3300046514 | Bacteria | 9171 |
| 469 | Ga0495620_0028049 | 3300046515 | Bacteria | 2624 |
| 470 | Ga0495628_0006279 | 3300046516 | Bacteria | 10376 |
| 471 | Ga0495628_0010178 | 3300046516 | Bacteria | 8000 |
| 472 | Ga0495628_0025525 | 3300046516 | Bacteria | 4827 |
| 473 | Ga0495628_0047828 | 3300046516 | Bacteria | 3391 |
| 474 | Ga0495628_0084124 | 3300046516 | Bacteria | 2469 |
| 475 | Ga0495630_0005881 | 3300046517 | Bacteria | 8676 |
| 476 | Ga0495631_0000105 | 3300046518 | Bacteria | 55305 |
| 477 | Ga0495631_0003775 | 3300046518 | Bacteria | 8241 |
| 478 | Ga0495631_0024157 | 3300046518 | Bacteria | 2808 |
| 479 | Ga0495632_0000024 | 3300046519 | Bacteria | 179517 |
| 480 | Ga0495632_0000043 | 3300046519 | Bacteria | 143694 |
| 481 | Ga0495632_0000106 | 3300046519 | Bacteria | 85449 |
| 482 | Ga0495632_0006661 | 3300046519 | Bacteria | 7386 |
| 483 | Ga0495637_0000002 | 3300046520 | Bacteria | 629280 |
| 484 | Ga0495637_0003552 | 3300046520 | Bacteria | 8266 |
| 485 | Ga0495637_0013350 | 3300046520 | Bacteria | 3899 |
| 486 | Ga0495643_0000022 | 3300046522 | Bacteria | 289691 |
| 487 | Ga0495643_0000117 | 3300046522 | Bacteria | 129698 |
| 488 | Ga0495643_0000552 | 3300046522 | Bacteria | 46298 |
| 489 | Ga0495643_0008044 | 3300046522 | Bacteria | 6722 |
| 490 | Ga0495643_0017855 | 3300046522 | Bacteria | 4137 |
| 491 | Ga0495643_0024905 | 3300046522 | Bacteria | 3390 |
| 492 | Ga0495643_0074302 | 3300046522 | Bacteria | 1780 |
| 493 | Ga0495644_0030135 | 3300046523 | Bacteria | 2048 |
| 494 | Ga0495648_0000022 | 3300046524 | Bacteria | 242791 |
| 495 | Ga0495648_0000875 | 3300046524 | Bacteria | 31749 |
| 496 | Ga0495648_0001544 | 3300046524 | Bacteria | 22488 |
| 497 | Ga0495648_0002193 | 3300046524 | Bacteria | 18300 |
| 498 | Ga0495648_0002666 | 3300046524 | Bacteria | 16142 |
| 499 | Ga0495648_0004350 | 3300046524 | Bacteria | 12127 |
| 500 | Ga0495648_0009106 | 3300046524 | Bacteria | 7744 |
| 501 | Ga0495648_0016093 | 3300046524 | Bacteria | 5397 |
| 502 | Ga0495648_0027086 | 3300046524 | Bacteria | 3844 |
| 503 | Ga0495648_0035692 | 3300046524 | Bacteria | 3219 |
| 504 | Ga0495666_0003723 | 3300046526 | Bacteria | 7702 |
| 505 | Ga0495666_0007129 | 3300046526 | Bacteria | 5616 |
| 506 | Ga0495666_0026377 | 3300046526 | Bacteria | 2864 |
| 507 | Ga0495666_0028271 | 3300046526 | Bacteria | 2759 |
| 508 | Ga0495666_0028744 | 3300046526 | Bacteria | 2735 |
| 509 | Ga0495666_0070065 | 3300046526 | Bacteria | 1668 |
| 510 | Ga0495642_0000001 | 3300046528 | Bacteria | 389656 |
| 511 | Ga0495642_0000865 | 3300046528 | Bacteria | 14325 |
| 512 | Ga0495642_0001857 | 3300046528 | Bacteria | 9016 |
| 513 | Ga0495642_0003562 | 3300046528 | Bacteria | 6129 |
| 514 | Ga0495642_0006888 | 3300046528 | Bacteria | 4358 |
| 515 | Ga0495642_0018725 | 3300046528 | Bacteria | 2710 |
| 516 | Ga0495652_0018710 | 3300046529 | Bacteria | 6174 |
| 517 | Ga0495652_0022578 | 3300046529 | Bacteria | 5583 |
| 518 | Ga0495652_0047350 | 3300046529 | Bacteria | 3687 |
| 519 | Ga0495652_0110293 | 3300046529 | Bacteria | 2213 |
| 520 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 521 | Ga0495654_0009202 | 3300046530 | Bacteria | 5416 |
| 522 | Ga0495654_0055852 | 3300046530 | Bacteria | 1910 |
| 523 | Ga0495665_0001952 | 3300046531 | Bacteria | 11127 |
| 524 | Ga0495665_0003338 | 3300046531 | Bacteria | 8704 |
| 525 | Ga0495665_0007204 | 3300046531 | Bacteria | 6004 |
| 526 | Ga0495665_0035472 | 3300046531 | Bacteria | 2664 |
| 527 | Ga0495665_0035677 | 3300046531 | Bacteria | 2656 |
| 528 | Ga0495640_0052953 | 3300046533 | Bacteria | 2784 |
| 529 | Ga0495640_0109210 | 3300046533 | Bacteria | 1809 |
| 530 | Ga0495586_0001962 | 3300046535 | Bacteria | 11218 |
| 531 | Ga0495586_0013680 | 3300046535 | Bacteria | 4305 |
| 532 | Ga0495586_0017444 | 3300046535 | Bacteria | 3816 |
| 533 | Ga0495587_0002254 | 3300046536 | Bacteria | 12891 |
| 534 | Ga0495587_0016882 | 3300046536 | Bacteria | 4539 |
| 535 | Ga0495609_0000445 | 3300046538 | Bacteria | 34051 |
| 536 | Ga0495609_0000554 | 3300046538 | Bacteria | 29545 |
| 537 | Ga0495609_0001464 | 3300046538 | Bacteria | 15675 |
| 538 | Ga0495609_0003850 | 3300046538 | Bacteria | 8440 |
| 539 | Ga0495609_0011535 | 3300046538 | Bacteria | 4205 |
| 540 | Ga0495597_0000030 | 3300046542 | Bacteria | 134736 |
| 541 | Ga0495597_0000070 | 3300046542 | Bacteria | 89649 |
| 542 | Ga0495597_0000189 | 3300046542 | Bacteria | 55865 |
| 543 | Ga0495597_0000302 | 3300046542 | Bacteria | 44243 |
| 544 | Ga0495597_0001611 | 3300046542 | Bacteria | 15835 |
| 545 | Ga0495597_0001677 | 3300046542 | Bacteria | 15363 |
| 546 | Ga0495597_0003633 | 3300046542 | Bacteria | 8864 |
| 547 | Ga0495597_0042076 | 3300046542 | Bacteria | 2038 |
| 548 | Ga0495645_0007362 | 3300046543 | Bacteria | 7658 |
| 549 | Ga0495645_0084025 | 3300046543 | Bacteria | 2280 |
| 550 | Ga0495645_0095254 | 3300046543 | Bacteria | 2122 |
| 551 | Ga0495622_0000012 | 3300046557 | Bacteria | 189011 |
| 552 | Ga0495622_0000048 | 3300046557 | Bacteria | 108955 |
| 553 | Ga0495633_0001106 | 3300046558 | Bacteria | 21686 |
| 554 | Ga0495633_0001287 | 3300046558 | Bacteria | 19867 |
| 555 | Ga0495633_0005502 | 3300046558 | Bacteria | 7710 |
| 556 | Ga0495633_0012459 | 3300046558 | Bacteria | 4521 |
| 557 | Ga0495633_0029467 | 3300046558 | Bacteria | 2671 |
| 558 | Ga0495656_0008392 | 3300046615 | Bacteria | 3684 |
| 559 | Ga0495668_0000036 | 3300046616 | Bacteria | 235057 |
| 560 | Ga0495668_0000038 | 3300046616 | Bacteria | 232122 |
| 561 | Ga0495668_0000280 | 3300046616 | Bacteria | 70339 |
| 562 | Ga0495668_0000428 | 3300046616 | Bacteria | 54563 |
| 563 | Ga0495668_0001093 | 3300046616 | Bacteria | 28137 |
| 564 | Ga0495668_0001482 | 3300046616 | Bacteria | 22483 |
| 565 | Ga0495668_0004604 | 3300046616 | Bacteria | 9700 |
| 566 | Ga0495668_0011982 | 3300046616 | Bacteria | 5162 |
| 567 | Ga0495668_0016754 | 3300046616 | Bacteria | 4259 |
| 568 | Ga0495668_0047721 | 3300046616 | Bacteria | 2377 |
| 569 | Ga0495634_0008649 | 3300046642 | Bacteria | 7555 |
| 570 | Ga0495634_0025885 | 3300046642 | Bacteria | 4097 |
| 571 | Ga0495634_0070031 | 3300046642 | Bacteria | 2312 |
| 572 | Ga0495611_0000191 | 3300046648 | Bacteria | 43883 |
| 573 | Ga0495611_0000408 | 3300046648 | Bacteria | 26792 |
| 574 | Ga0495625_0000241 | 3300046660 | Bacteria | 85835 |
| 575 | Ga0495625_0000745 | 3300046660 | Bacteria | 45415 |
| 576 | Ga0495625_0001333 | 3300046660 | Bacteria | 30655 |
| 577 | Ga0495625_0012563 | 3300046660 | Bacteria | 6855 |
| 578 | Ga0495625_0013580 | 3300046660 | Bacteria | 6535 |
| 579 | Ga0495625_0019537 | 3300046660 | Bacteria | 5252 |
| 580 | Ga0495625_0027228 | 3300046660 | Bacteria | 4308 |
| 581 | Ga0495625_0040024 | 3300046660 | Bacteria | 3421 |
| 582 | Ga0495635_0002476 | 3300046663 | Bacteria | 12606 |
| 583 | Ga0495635_0022427 | 3300046663 | Bacteria | 4396 |
| 584 | Ga0495635_0174118 | 3300046663 | Bacteria | 1463 |
| 585 | Ga0495659_0000008 | 3300046664 | Bacteria | 102082 |
| 586 | Ga0495661_0000040 | 3300046665 | Bacteria | 151437 |
| 587 | Ga0495661_0001097 | 3300046665 | Bacteria | 23749 |
| 588 | Ga0495661_0001236 | 3300046665 | Bacteria | 22115 |
| 589 | Ga0495661_0003616 | 3300046665 | Bacteria | 11388 |
| 590 | Ga0495661_0005279 | 3300046665 | Bacteria | 9184 |
| 591 | Ga0495661_0006401 | 3300046665 | Bacteria | 8278 |
| 592 | Ga0495661_0007134 | 3300046665 | Bacteria | 7801 |
| 593 | Ga0495661_0011445 | 3300046665 | Bacteria | 6022 |
| 594 | Ga0495661_0013687 | 3300046665 | Bacteria | 5446 |
| 595 | Ga0495661_0034998 | 3300046665 | Bacteria | 3156 |
| 596 | Ga0495661_0040333 | 3300046665 | Bacteria | 2896 |
| 597 | Ga0495661_0059347 | 3300046665 | Bacteria | 2277 |
| 598 | Ga0495588_0000052 | 3300046674 | Bacteria | 304493 |
| 599 | Ga0495588_0008561 | 3300046674 | Bacteria | 4700 |
| 600 | Ga0495588_0011112 | 3300046674 | Bacteria | 4214 |
| 601 | Ga0495588_0016502 | 3300046674 | Bacteria | 3570 |
| 602 | Ga0495599_0074269 | 3300046678 | Bacteria | 2122 |
| 603 | Ga0495599_0105737 | 3300046678 | Bacteria | 1753 |
| 604 | Ga0495623_0009910 | 3300046679 | Bacteria | 6171 |
| 605 | Ga0495623_0033966 | 3300046679 | Bacteria | 3272 |
| 606 | Ga0495623_0043178 | 3300046679 | Bacteria | 2869 |
| 607 | Ga0495646_0000964 | 3300046680 | Bacteria | 16453 |
| 608 | Ga0495646_0008960 | 3300046680 | Bacteria | 6351 |
| 609 | Ga0495646_0009760 | 3300046680 | Bacteria | 6096 |
| 610 | Ga0495669_0000013 | 3300046684 | Bacteria | 151423 |
| 611 | Ga0495669_0000175 | 3300046684 | Bacteria | 40487 |
| 612 | Ga0495669_0021154 | 3300046684 | Bacteria | 2820 |
| 613 | Ga0495669_0069591 | 3300046684 | Bacteria | 1602 |
| 614 | Ga0495613_0008181 | 3300046689 | Bacteria | 7773 |
| 615 | Ga0495613_0275020 | 3300046689 | Bacteria | 1170 |
| 616 | Ga0495624_0008867 | 3300046690 | Bacteria | 6990 |
| 617 | Ga0495624_0009686 | 3300046690 | Bacteria | 6669 |
| 618 | Ga0495624_0011804 | 3300046690 | Bacteria | 5993 |
| 619 | Ga0495624_0011969 | 3300046690 | Bacteria | 5948 |
| 620 | Ga0495624_0032254 | 3300046690 | Bacteria | 3397 |
| 621 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 622 | Ga0495671_0000155 | 3300046692 | Bacteria | 59986 |
| 623 | Ga0495671_0000313 | 3300046692 | Bacteria | 41127 |
| 624 | Ga0495671_0004065 | 3300046692 | Bacteria | 8832 |
| 625 | Ga0495671_0006095 | 3300046692 | Bacteria | 6999 |
| 626 | Ga0495671_0084363 | 3300046692 | Bacteria | 1556 |
| 627 | Ga0495649_0000085 | 3300046694 | Bacteria | 80698 |
| 628 | Ga0495649_0000469 | 3300046694 | Bacteria | 34749 |
| 629 | Ga0495649_0002029 | 3300046694 | Bacteria | 14644 |
| 630 | Ga0495649_0036293 | 3300046694 | Bacteria | 2708 |
| 631 | Ga0495589_0000058 | 3300046794 | Bacteria | 107640 |
| 632 | Ga0495589_0000227 | 3300046794 | Bacteria | 47488 |
| 633 | Ga0495589_0001047 | 3300046794 | Bacteria | 16678 |
| 634 | Ga0495589_0020385 | 3300046794 | Bacteria | 3390 |
| 635 | Ga0495589_0028869 | 3300046794 | Bacteria | 2798 |
| 636 | Ga0495589_0038261 | 3300046794 | Bacteria | 2402 |
| 637 | Ga0495589_0040762 | 3300046794 | Bacteria | 2318 |
| 638 | Ga0495600_0004893 | 3300046809 | Bacteria | 8046 |
| 639 | Ga0495660_0000050 | 3300046810 | Bacteria | 140329 |
| 640 | Ga0495660_0000285 | 3300046810 | Bacteria | 47026 |
| 641 | Ga0495660_0000339 | 3300046810 | Bacteria | 41484 |
| 642 | Ga0495660_0003258 | 3300046810 | Bacteria | 10085 |
| 643 | Ga0495660_0005819 | 3300046810 | Bacteria | 7360 |
| 644 | Ga0495660_0016426 | 3300046810 | Bacteria | 4268 |
| 645 | Ga0495660_0029698 | 3300046810 | Bacteria | 3083 |
| 646 | Ga0495581_0007807 | 3300047315 | Bacteria | 6197 |
| 647 | Ga0495581_0008391 | 3300047315 | Bacteria | 5988 |
| 648 | Ga0495604_0000220 | 3300047317 | Bacteria | 52204 |
| 649 | Ga0495604_0012680 | 3300047317 | Bacteria | 6706 |
| 650 | Ga0495604_0016491 | 3300047317 | Bacteria | 5906 |
| 651 | Ga0495604_0016819 | 3300047317 | Bacteria | 5850 |
| 652 | Ga0495604_0019475 | 3300047317 | Bacteria | 5432 |
| 653 | Ga0495604_0082873 | 3300047317 | Bacteria | 2397 |
| 654 | Ga0495604_0102648 | 3300047317 | Bacteria | 2099 |
| 655 | Ga0495674_0003517 | 3300047319 | Bacteria | 15254 |
| 656 | Ga0495674_0004385 | 3300047319 | Bacteria | 13569 |
| 657 | Ga0495674_0004393 | 3300047319 | Bacteria | 13550 |
| 658 | Ga0495674_0005533 | 3300047319 | Bacteria | 12118 |
| 659 | Ga0495674_0012988 | 3300047319 | Bacteria | 7839 |
| 660 | Ga0495674_0013595 | 3300047319 | Bacteria | 7647 |
| 661 | Ga0495674_0030002 | 3300047319 | Bacteria | 4947 |
| 662 | Ga0495674_0036553 | 3300047319 | Bacteria | 4419 |
| 663 | Ga0495672_0000015 | 3300047320 | Bacteria | 502855 |
| 664 | Ga0495672_0000325 | 3300047320 | Bacteria | 63353 |
| 665 | Ga0495672_0000677 | 3300047320 | Bacteria | 37926 |
| 666 | Ga0495672_0001219 | 3300047320 | Bacteria | 25944 |
| 667 | Ga0495672_0005093 | 3300047320 | Bacteria | 10496 |
| 668 | Ga0495672_0006470 | 3300047320 | Bacteria | 9062 |
| 669 | Ga0495672_0009080 | 3300047320 | Bacteria | 7249 |
| 670 | Ga0495676_0000029 | 3300047321 | Bacteria | 140281 |
| 671 | Ga0495676_0024837 | 3300047321 | Bacteria | 5179 |
| 672 | Ga0495676_0054971 | 3300047321 | Bacteria | 3160 |
| 673 | Ga0495680_0001059 | 3300047322 | Bacteria | 30455 |
| 674 | Ga0495680_0005882 | 3300047322 | Bacteria | 11476 |
| 675 | Ga0495680_0010964 | 3300047322 | Bacteria | 8053 |
| 676 | Ga0495680_0019270 | 3300047322 | Bacteria | 5768 |
| 677 | Ga0495680_0095210 | 3300047322 | Bacteria | 2226 |
| 678 | Ga0495683_0000012 | 3300047323 | Bacteria | 205754 |
| 679 | Ga0495683_0009313 | 3300047323 | Bacteria | 5233 |
| 680 | Ga0495683_0013078 | 3300047323 | Bacteria | 4346 |
| 681 | Ga0495683_0018236 | 3300047323 | Bacteria | 3630 |
| 682 | Ga0495683_0029389 | 3300047323 | Bacteria | 2809 |
| 683 | Ga0495683_0037256 | 3300047323 | Bacteria | 2466 |
| 684 | Ga0495683_0076643 | 3300047323 | Bacteria | 1635 |
| 685 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 686 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 687 | Ga0495687_000007 | 3300047443 | Bacteria | 552679 |
| 688 | Ga0495687_000025 | 3300047443 | Bacteria | 310498 |
| 689 | Ga0495687_000073 | 3300047443 | Bacteria | 155429 |
| 690 | Ga0495687_000445 | 3300047443 | Bacteria | 51086 |
| 691 | Ga0495687_000489 | 3300047443 | Bacteria | 47669 |
| 692 | Ga0495687_001493 | 3300047443 | Bacteria | 21363 |
| 693 | Ga0495687_020518 | 3300047443 | Bacteria | 3217 |
| 694 | Ga0495687_068084 | 3300047443 | Bacteria | 1438 |
| 695 | Ga0495675_0010007 | 3300047444 | Bacteria | 5914 |
| 696 | Ga0495675_0040644 | 3300047444 | Bacteria | 2963 |
| 697 | Ga0495675_0051409 | 3300047444 | Bacteria | 2617 |
| 698 | Ga0495677_0000144 | 3300047445 | Bacteria | 34126 |
| 699 | Ga0495677_0000152 | 3300047445 | Bacteria | 32933 |
| 700 | Ga0495677_0001812 | 3300047445 | Bacteria | 8544 |
| 701 | Ga0495677_0008040 | 3300047445 | Bacteria | 3917 |
| 702 | Ga0495677_0037019 | 3300047445 | Bacteria | 1782 |
| 703 | Ga0495679_000036 | 3300047446 | Bacteria | 161473 |
| 704 | Ga0495679_000038 | 3300047446 | Bacteria | 157311 |
| 705 | Ga0495679_001340 | 3300047446 | Bacteria | 14236 |
| 706 | Ga0495679_004357 | 3300047446 | Bacteria | 6559 |
| 707 | Ga0495679_010320 | 3300047446 | Bacteria | 3672 |
| 708 | Ga0495679_019679 | 3300047446 | Bacteria | 2365 |
| 709 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 710 | Ga0495673_0000064 | 3300047469 | Bacteria | 225793 |
| 711 | Ga0495673_0000109 | 3300047469 | Bacteria | 166877 |
| 712 | Ga0495673_0024774 | 3300047469 | Bacteria | 2892 |
| 713 | Ga0495673_0046225 | 3300047469 | Bacteria | 1930 |
| 714 | Ga0495681_0000005 | 3300047470 | Bacteria | 225279 |
| 715 | Ga0495681_0000555 | 3300047470 | Bacteria | 28608 |
| 716 | Ga0495681_0004387 | 3300047470 | Bacteria | 9639 |
| 717 | Ga0495681_0008550 | 3300047470 | Bacteria | 6406 |
| 718 | Ga0495684_0055846 | 3300047471 | Bacteria | 3011 |
| 719 | Ga0495686_0000015 | 3300047472 | Bacteria | 471703 |
| 720 | Ga0495686_0000032 | 3300047472 | Bacteria | 345132 |
| 721 | Ga0495686_0000051 | 3300047472 | Bacteria | 263489 |
| 722 | Ga0495686_0016243 | 3300047472 | Bacteria | 5053 |
| 723 | Ga0495686_0104020 | 3300047472 | Bacteria | 1710 |
| 724 | Ga0495593_0001558 | 3300047673 | Bacteria | 13525 |
| 725 | Ga0495593_0008313 | 3300047673 | Bacteria | 6039 |
| 726 | Ga0495593_0009404 | 3300047673 | Bacteria | 5670 |
| 727 | Ga0495593_0014443 | 3300047673 | Bacteria | 4489 |
| 728 | Ga0495593_0056827 | 3300047673 | Bacteria | 2056 |
| 729 | Ga0495602_0020951 | 3300048088 | Bacteria | 6446 |
| 730 | Ga0495602_0022831 | 3300048088 | Bacteria | 6113 |
| 731 | Ga0495602_0025386 | 3300048088 | Bacteria | 5736 |
| 732 | Ga0495602_0066735 | 3300048088 | Bacteria | 3098 |
| 733 | Ga0495602_0167378 | 3300048088 | Bacteria | 1709 |
| 734 | Ga0495614_0005056 | 3300048089 | Bacteria | 5951 |
| 735 | Ga0495614_0037762 | 3300048089 | Bacteria | 2072 |
| 736 | Ga0495626_0000066 | 3300048091 | Bacteria | 141280 |
| 737 | Ga0495626_0000145 | 3300048091 | Bacteria | 89603 |
| 738 | Ga0495626_0010793 | 3300048091 | Bacteria | 4854 |
| 739 | Ga0495626_0020232 | 3300048091 | Bacteria | 3318 |
| 740 | Ga0495626_0059771 | 3300048091 | Bacteria | 1738 |
| 741 | Ga0496100_0244005 | 3300048903 | Bacteria | 1326 |
| 742 | Ga0496101_0001448 | 3300048904 | Bacteria | 14161 |
| 743 | Ga0496101_0076508 | 3300048904 | Bacteria | 2465 |
| 744 | Ga0496101_0154564 | 3300048904 | Bacteria | 1757 |
| 745 | Ga0496102_0000033 | 3300048905 | Bacteria | 213952 |
| 746 | Ga0496102_0004637 | 3300048905 | Bacteria | 11630 |
| 747 | Ga0496102_0106004 | 3300048905 | Bacteria | 2615 |
| 748 | Ga0496102_0108444 | 3300048905 | Bacteria | 2586 |
| 749 | Ga0496103_0001960 | 3300048906 | Bacteria | 13315 |
| 750 | Ga0496103_0002086 | 3300048906 | Bacteria | 12767 |
| 751 | Ga0496103_0002298 | 3300048906 | Bacteria | 12076 |
| 752 | Ga0496104_0074198 | 3300048907 | Bacteria | 3238 |
| 753 | Ga0496105_0049200 | 3300048908 | Bacteria | 3480 |
| 754 | Ga0496106_0000019 | 3300048909 | Bacteria | 174698 |
| 755 | Ga0496106_0022320 | 3300048909 | Bacteria | 4701 |
| 756 | Ga0496106_0042892 | 3300048909 | Bacteria | 3393 |
| 757 | Ga0496107_0163415 | 3300048910 | Bacteria | 1651 |
| 758 | Ga0496109_0006962 | 3300048912 | Bacteria | 9543 |
| 759 | Ga0496109_0181892 | 3300048912 | Bacteria | 1975 |
| 760 | Ga0496110_0000007 | 3300048913 | Bacteria | 114271 |
| 761 | Ga0496110_0095948 | 3300048913 | Bacteria | 2657 |
| 762 | Ga0496112_0037713 | 3300048915 | Bacteria | 4718 |
| 763 | Ga0496112_0063266 | 3300048915 | Bacteria | 3650 |
| 764 | Ga0496112_0164239 | 3300048915 | Bacteria | 2186 |
| 765 | Ga0496113_0007646 | 3300048916 | Bacteria | 6974 |
| 766 | Ga0496114_0032092 | 3300048917 | Bacteria | 4321 |
| 767 | Ga0496114_0177710 | 3300048917 | Bacteria | 1858 |
| 768 | Ga0496116_0008917 | 3300048919 | Bacteria | 8625 |
| 769 | Ga0496116_0013017 | 3300048919 | Bacteria | 6746 |
| 770 | Ga0496116_0013744 | 3300048919 | Bacteria | 6507 |
| 771 | Ga0496116_0080780 | 3300048919 | Bacteria | 2018 |
| 772 | Ga0496117_0000058 | 3300048920 | Bacteria | 264132 |
| 773 | Ga0496117_0007793 | 3300048920 | Bacteria | 10322 |
| 774 | Ga0496117_0015289 | 3300048920 | Bacteria | 6553 |
| 775 | Ga0496117_0025869 | 3300048920 | Bacteria | 4602 |
| 776 | Ga0496117_0078788 | 3300048920 | Bacteria | 2174 |
| 777 | Ga0496117_0090904 | 3300048920 | Bacteria | 1965 |
| 778 | Ga0496118_0003177 | 3300048921 | Bacteria | 20986 |
| 779 | Ga0496118_0004991 | 3300048921 | Bacteria | 15338 |
| 780 | Ga0496118_0005234 | 3300048921 | Bacteria | 14834 |
| 781 | Ga0496118_0041145 | 3300048921 | Bacteria | 3663 |
| 782 | Ga0496118_0052180 | 3300048921 | Bacteria | 3122 |
| 783 | Ga0496118_0070827 | 3300048921 | Bacteria | 2514 |
| 784 | Ga0496119_0000089 | 3300048922 | Bacteria | 134344 |
| 785 | Ga0496119_0034680 | 3300048922 | Bacteria | 3317 |
| 786 | Ga0496120_0000117 | 3300048923 | Bacteria | 134343 |
| 787 | Ga0496120_0001811 | 3300048923 | Bacteria | 23902 |
| 788 | Ga0496120_0025297 | 3300048923 | Bacteria | 3687 |
| 789 | Ga0496121_0000205 | 3300048924 | Bacteria | 130748 |
| 790 | Ga0496121_0000310 | 3300048924 | Bacteria | 101522 |
| 791 | Ga0496121_0003570 | 3300048924 | Bacteria | 21990 |
| 792 | Ga0496121_0006733 | 3300048924 | Bacteria | 14106 |
| 793 | Ga0496121_0007511 | 3300048924 | Bacteria | 13151 |
| 794 | Ga0496121_0010176 | 3300048924 | Bacteria | 10649 |
| 795 | Ga0496121_0147738 | 3300048924 | Bacteria | 1734 |
| 796 | Ga0496122_0000279 | 3300048925 | Bacteria | 114185 |
| 797 | Ga0496122_0000457 | 3300048925 | Bacteria | 84895 |
| 798 | Ga0496122_0002401 | 3300048925 | Bacteria | 26723 |
| 799 | Ga0496122_0005248 | 3300048925 | Bacteria | 15531 |
| 800 | Ga0496122_0012927 | 3300048925 | Bacteria | 8240 |
| 801 | Ga0496123_0000146 | 3300048926 | Bacteria | 143990 |
| 802 | Ga0496123_0000321 | 3300048926 | Bacteria | 91682 |
| 803 | Ga0496123_0001138 | 3300048926 | Bacteria | 39752 |
| 804 | Ga0496123_0010024 | 3300048926 | Bacteria | 8440 |
| 805 | Ga0496123_0015195 | 3300048926 | Bacteria | 6332 |
| 806 | Ga0496123_0120475 | 3300048926 | Bacteria | 1477 |
| 807 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 808 | Ga0496124_0000208 | 3300048927 | Bacteria | 115312 |
| 809 | Ga0496124_0002145 | 3300048927 | Bacteria | 26496 |
| 810 | Ga0496124_0005692 | 3300048927 | Bacteria | 13887 |
| 811 | Ga0496124_0010579 | 3300048927 | Bacteria | 9329 |
| 812 | Ga0496124_0036217 | 3300048927 | Bacteria | 4306 |
| 813 | Ga0496124_0070548 | 3300048927 | Bacteria | 2898 |
| 814 | Ga0496124_0141287 | 3300048927 | Bacteria | 1900 |
| 815 | Ga0496125_0000895 | 3300048928 | Bacteria | 47230 |
| 816 | Ga0496125_0000938 | 3300048928 | Bacteria | 45852 |
| 817 | Ga0496125_0020498 | 3300048928 | Bacteria | 6204 |
| 818 | Ga0496125_0023674 | 3300048928 | Bacteria | 5663 |
| 819 | Ga0496125_0043939 | 3300048928 | Bacteria | 3786 |
| 820 | Ga0496125_0050210 | 3300048928 | Bacteria | 3456 |
| 821 | Ga0496125_0050623 | 3300048928 | Bacteria | 3437 |
| 822 | Ga0496125_0091759 | 3300048928 | Bacteria | 2274 |
| 823 | Ga0496126_0000034 | 3300048929 | Bacteria | 362440 |
| 824 | Ga0496126_0000706 | 3300048929 | Bacteria | 60980 |
| 825 | Ga0496126_0006701 | 3300048929 | Bacteria | 12792 |
| 826 | Ga0496126_0023730 | 3300048929 | Bacteria | 5939 |
| 827 | Ga0496126_0033941 | 3300048929 | Bacteria | 4798 |
| 828 | Ga0496126_0044704 | 3300048929 | Bacteria | 4076 |
| 829 | Ga0496126_0068323 | 3300048929 | Bacteria | 3173 |
| 830 | Ga0496126_0140724 | 3300048929 | Bacteria | 2077 |
| 831 | Ga0501308_000888 | 3300049128 | Bacteria | 2184 |
| 832 | Ga0495678_000004 | 3300049459 | Bacteria | 532920 |
| 833 | Ga0495678_000015 | 3300049459 | Bacteria | 309544 |
| 834 | Ga0495678_000022 | 3300049459 | Bacteria | 237031 |
| 835 | Ga0495678_000103 | 3300049459 | Bacteria | 103891 |
| 836 | Ga0495678_001009 | 3300049459 | Bacteria | 24097 |
| 837 | Ga0495678_001189 | 3300049459 | Bacteria | 21418 |
| 838 | Ga0495678_029569 | 3300049459 | Bacteria | 2299 |
| 839 | Ga0495682_0000038 | 3300049460 | Bacteria | 120212 |
| 840 | Ga0495682_0009396 | 3300049460 | Bacteria | 3816 |
| 841 | Ga0495682_0035115 | 3300049460 | Bacteria | 1847 |
| 842 | Ga0501031_0001921 | 3300049568 | Bacteria | 13100 |
| 843 | Ga0501031_0007771 | 3300049568 | Bacteria | 6979 |
| 844 | Ga0501032_0003027 | 3300049569 | Bacteria | 13035 |
| 845 | Ga0501032_0105607 | 3300049569 | Bacteria | 1866 |
| 846 | Ga0501033_0000665 | 3300049570 | Bacteria | 31783 |
| 847 | Ga0501033_0001358 | 3300049570 | Bacteria | 21808 |
| 848 | Ga0501033_0036882 | 3300049570 | Bacteria | 3662 |
| 849 | Ga0501033_0071779 | 3300049570 | Bacteria | 2543 |
| 850 | Ga0501036_0000045 | 3300049572 | Bacteria | 78277 |
| 851 | Ga0501037_0000236 | 3300049573 | Bacteria | 47586 |
| 852 | Ga0501037_0001205 | 3300049573 | Bacteria | 19110 |
| 853 | Ga0501038_0005951 | 3300049574 | Bacteria | 11281 |
| 854 | Ga0501038_0014317 | 3300049574 | Bacteria | 7228 |
| 855 | Ga0501038_0066255 | 3300049574 | Bacteria | 3076 |
| 856 | Ga0501043_0000065 | 3300049579 | Bacteria | 93521 |
| 857 | Ga0501043_0002979 | 3300049579 | Bacteria | 14103 |
| 858 | Ga0501043_0207481 | 3300049579 | Bacteria | 1519 |
| 859 | Ga0501046_0001304 | 3300049580 | Bacteria | 24149 |
| 860 | Ga0501047_0006181 | 3300049581 | Bacteria | 11261 |
| 861 | Ga0501047_0082840 | 3300049581 | Bacteria | 3083 |
| 862 | Ga0501047_0083059 | 3300049581 | Bacteria | 3079 |
| 863 | Ga0501047_0185404 | 3300049581 | Bacteria | 1946 |
| 864 | Ga0501047_0234088 | 3300049581 | Bacteria | 1689 |
| 865 | Ga0501069_0000002 | 3300049585 | Bacteria | 269636 |
| 866 | Ga0501070_0000339 | 3300049586 | Bacteria | 42523 |
| 867 | Ga0501070_0016944 | 3300049586 | Bacteria | 6115 |
| 868 | Ga0501070_0039176 | 3300049586 | Bacteria | 3953 |
| 869 | Ga0501071_0014589 | 3300049587 | Bacteria | 5376 |
| 870 | Ga0501073_0008914 | 3300049589 | Bacteria | 7414 |
| 871 | Ga0501074_0001070 | 3300049590 | Bacteria | 17857 |
| 872 | Ga0501074_0248541 | 3300049590 | Bacteria | 1265 |
| 873 | Ga0501076_0110333 | 3300049592 | Bacteria | 2224 |
| 874 | Ga0501077_0035933 | 3300049593 | Bacteria | 3155 |
| 875 | Ga0501209_000052 | 3300049656 | Bacteria | 11469 |
| 876 | Ga0501249_003643 | 3300049679 | Bacteria | 3103 |
| 877 | Ga0501079_0139149 | 3300049741 | Bacteria | 1891 |
| 878 | Ga0501080_0000617 | 3300049742 | Bacteria | 28211 |
| 879 | Ga0501080_0019404 | 3300049742 | Bacteria | 6299 |
| 880 | Ga0501083_0185607 | 3300049744 | Bacteria | 1357 |
| 881 | Ga0501083_0214208 | 3300049744 | Bacteria | 1255 |
| 882 | Ga0501035_0000124 | 3300049822 | Bacteria | 93561 |
| 883 | Ga0501035_0000552 | 3300049822 | Bacteria | 41623 |
| 884 | Ga0501035_0004858 | 3300049822 | Bacteria | 12747 |
| 885 | Ga0501035_0007250 | 3300049822 | Bacteria | 10377 |
| 886 | Ga0501035_0010969 | 3300049822 | Bacteria | 8389 |
| 887 | Ga0501044_0000087 | 3300049823 | Bacteria | 112979 |
| 888 | Ga0501044_0001108 | 3300049823 | Bacteria | 32043 |
| 889 | Ga0501044_0003419 | 3300049823 | Bacteria | 17892 |
| 890 | Ga0501044_0030772 | 3300049823 | Bacteria | 5654 |
| 891 | Ga0500644_0012225 | 3300053088 | Bacteria | 2368 |
| 892 | Ga0500581_056119 | 3300053089 | Bacteria | 2001 |
| 893 | Ga0500651_0019866 | 3300053093 | Bacteria | 4180 |
| 894 | Ga0500650_0000508 | 3300053098 | Bacteria | 9861 |
| 895 | Ga0500556_0000016 | 3300053104 | Bacteria | 194958 |
| 896 | Ga0500569_020990 | 3300053109 | Bacteria | 1721 |
| 897 | Ga0500594_0005059 | 3300053118 | Bacteria | 2915 |
| 898 | Ga0500618_000032 | 3300053125 | Bacteria | 126990 |
| 899 | Ga0500642_0000017 | 3300053130 | Bacteria | 167670 |
| 900 | Ga0500652_000306 | 3300053131 | Bacteria | 17755 |
| 901 | Ga0500658_0062856 | 3300053134 | Bacteria | 1548 |
| 902 | Ga0500559_0072688 | 3300053136 | Bacteria | 1550 |
| 903 | Ga0500568_0002231 | 3300053139 | Bacteria | 11614 |
| 904 | Ga0500586_039428 | 3300053145 | Bacteria | 1596 |
| 905 | Ga0500604_0000678 | 3300053151 | Bacteria | 9334 |
| 906 | Ga0500616_0000169 | 3300053153 | Bacteria | 109205 |
| 907 | Ga0500627_0136423 | 3300053158 | Bacteria | 1108 |
| 908 | Ga0500645_000991 | 3300053730 | Bacteria | 16014 |
| 909 | Ga0501084_0036996 | 3300054114 | Bacteria | 4078 |
| 910 | Ga0587077_001466 | 3300059493 | Bacteria | 2542 |
| 911 | Ga0587085_005324 | 3300059506 | Bacteria | 1510 |
| 912 | Ga0466962_0006514 | 3300061719 | Bacteria | 5604 |
| 913 | Ga0466962_0018488 | 3300061719 | Bacteria | 3352 |
| 914 | 2550692510 | 2548876994 | Bacteria | 4904866 |
| 915 | 2501071499 | 2501025501 | Bacteria | 7768574 |
| 916 | 2501081178 | 2501025502 | Bacteria | 9641094 |
| 917 | 2501408349 | 2501025504 | Bacteria | 8008976 |
| 918 | 2509131446 | 2508501125 | Bacteria | 7208311 |
| 919 | 2510251854 | 2510065045 | Bacteria | 7761063 |
| 920 | 2511085953 | 2510917013 | Bacteria | 9951648 |
| 921 | 2511096089 | 2510917014 | Bacteria | 8296963 |
| 922 | 2511103187 | 2510917015 | Bacteria | 7950052 |
| 923 | 2511384505 | 2511231026 | Bacteria | 5225445 |
| 924 | 2512345178 | 2512047030 | Bacteria | 9031815 |
| 925 | 2513555581 | 2513237082 | Bacteria | 8640282 |
| 926 | 2513563475 | 2513237083 | Bacteria | 8410967 |
| 927 | 2513961405 | 2513237151 | Bacteria | 6309801 |
| 928 | 2514053378 | 2513237166 | Bacteria | 10373764 |
| 929 | 2515684268 | 2515154122 | Bacteria | 8609520 |
| 930 | 2515687463 | 2515154123 | Bacteria | 6387382 |
| 931 | 2516022486 | 2515154189 | Bacteria | 9629850 |
| 932 | 2519458198 | 2519103095 | Bacteria | 6629912 |
| 933 | 2521557642 | 2521172590 | Bacteria | 5047645 |
| 934 | 2527080707 | 2526164713 | Bacteria | 6780608 |
| 935 | 2553002760 | 2551306416 | Bacteria | 6152985 |
| 936 | 2563059283 | 2562617112 | Bacteria | 10918404 |
| 937 | 2585294748 | 2582581311 | Bacteria | 6763856 |
| 938 | 2599738060 | 2599185239 | Bacteria | 8686614 |
| 939 | 2599742568 | 2599185240 | Bacteria | 7968121 |
| 940 | 2600204686 | 2599185355 | Bacteria | 7968906 |
| 941 | 2603858197 | 2602042107 | Bacteria | 6226103 |
| 942 | 2643797235 | 2643221556 | Bacteria | 7251154 |
| 943 | 2643814371 | 2643221558 | Bacteria | 5460675 |
| 944 | 2644253215 | 2643221645 | Bacteria | 7207331 |
| 945 | 2644355743 | 2643221664 | Bacteria | 7272945 |
| 946 | 2644474223 | 2643221684 | Bacteria | 7145183 |
| 947 | 2676741672 | 2675903129 | Bacteria | 7964495 |
| 948 | 2713479783 | 2711768613 | Bacteria | 11048459 |
| 949 | 2719640965 | 2718217991 | Bacteria | 7829542 |
| 950 | 2723876924 | 2721755763 | Bacteria | 4464185 |
| 951 | 2738742190 | 2738541280 | Bacteria | 6630198 |
| 952 | 2738745273 | 2738541281 | Bacteria | 5112672 |
| 953 | 2738819043 | 2738541296 | Bacteria | 7285013 |
| 954 | 2738828664 | 2738541297 | Bacteria | 6549566 |
| 955 | 2738830801 | 2738541298 | Bacteria | 7286732 |
| 956 | 2738841361 | 2738541300 | Bacteria | 6675882 |
| 957 | 2738872327 | 2738541306 | Bacteria | 7284992 |
| 958 | 2739152460 | 2738541357 | Bacteria | 6549408 |
| 959 | 2739183958 | 2738543002 | Bacteria | 7284546 |
| 960 | 2739194380 | 2738543003 | Bacteria | 6549560 |
| 961 | 2739218928 | 2738543008 | Bacteria | 7282815 |
| 962 | 2739272231 | 2738543018 | Bacteria | 6718814 |
| 963 | 2739320856 | 2738543026 | Bacteria | 6549408 |
| 964 | 2739339097 | 2738543029 | Bacteria | 6549249 |
| 965 | 2739341275 | 2738543030 | Bacteria | 6719714 |
| 966 | 2739354503 | 2738543032 | Bacteria | 5115625 |
| 967 | 2739610524 | 2739367655 | Bacteria | 4051151 |
| 968 | 2746088225 | 2744054900 | Bacteria | 8399525 |
| 969 | 2746096881 | 2744054901 | Bacteria | 8397047 |
| 970 | 2765570192 | 2765235838 | Bacteria | 5445269 |
| 971 | 2792840548 | 2791355137 | Bacteria | 9654227 |
| 972 | 2808969967 | 2808606384 | Bacteria | 8474373 |
| 973 | 2808981532 | 2808606386 | Bacteria | 4471946 |
| 974 | 2809005186 | 2808606390 | Bacteria | 8476311 |
| 975 | 2809011673 | 2808606391 | Bacteria | 8308166 |
| 976 | 2809129115 | 2808606415 | Bacteria | 4576710 |
| 977 | 2809143657 | 2808606418 | Bacteria | 6724496 |
| 978 | 2809148735 | 2808606419 | Bacteria | 4576925 |
| 979 | 2817260350 | 2816332253 | Bacteria | 6764532 |
| 980 | 2817278038 | 2816332256 | Bacteria | 6891714 |
| 981 | 2817455605 | 2816332286 | Bacteria | 6853759 |
| 982 | 2819591496 | 2818991445 | Bacteria | 4955017 |
| 983 | 2819615215 | 2818991449 | Bacteria | 5518009 |
| 984 | 2819623521 | 2818991450 | Bacteria | 6962147 |
| 985 | 2819632876 | 2818991452 | Bacteria | 8442785 |
| 986 | 2821132907 | 2821131069 | Bacteria | 6108407 |
| 987 | 2839096866 | 2839094727 | Bacteria | 5534556 |
| 988 | 2842325040 | 2842324504 | Bacteria | 9364110 |
| 989 | 2842349318 | 2842348783 | Bacteria | 9002918 |
| 990 | 2842459939 | 2842454564 | Bacteria | 8730687 |
| 991 | 2842714580 | 2842711865 | Bacteria | 7155354 |
| 992 | 2844531156 | 2844528606 | Bacteria | 4733806 |
| 993 | 2852621273 | 2852618963 | Bacteria | 4577824 |
| 994 | 2856292821 | 2856287931 | Bacteria | 7223934 |
| 995 | 2857361055 | 2857357740 | Bacteria | 9937880 |
| 996 | 2857527588 | 2857524615 | Bacteria | 6615449 |
| 997 | 2857554732 | 2857553236 | Bacteria | 6166726 |
| 998 | 2857563577 | 2857558681 | Bacteria | 6617694 |
| 999 | 2857568815 | 2857564685 | Bacteria | 6290584 |
| 1000 | 2863421887 | 2863421361 | Bacteria | 7300805 |
| 1001 | 2865015529 | 2865014394 | Bacteria | 4764573 |
| 1002 | 2870072171 | 2870068957 | Bacteria | 8925310 |
| 1003 | 2881613599 | 2881609920 | Bacteria | 4405319 |
| 1004 | 2883088077 | 2883087390 | Bacteria | 9532701 |
| 1005 | 2884816588 | 2884811622 | Bacteria | 5552861 |
| 1006 | 2884837305 | 2884836552 | Bacteria | 5219991 |
| 1007 | 2884853596 | 2884852848 | Bacteria | 5221161 |
| 1008 | 2885267637 | 2885266251 | Bacteria | 4796748 |
| 1009 | 2885271036 | 2885270888 | Bacteria | 9831543 |
| 1010 | 2896155287 | 2896154374 | Bacteria | 5221518 |
| 1011 | 2900637764 | 2900634093 | Bacteria | 10263517 |
| 1012 | 2902687376 | 2902682994 | Bacteria | 8951596 |
| 1013 | 2904427100 | 2904424332 | Bacteria | 7633521 |
| 1014 | 2904441623 | 2904439833 | Bacteria | 5931679 |
| 1015 | 2904487456 | 2904483920 | Bacteria | 7545285 |
| 1016 | 2904531455 | 2904530477 | Bacteria | 5876334 |
| 1017 | 2904566052 | 2904564687 | Bacteria | 7609577 |
| 1018 | 2904573096 | 2904571731 | Bacteria | 7608790 |
| 1019 | 2904586905 | 2904584206 | Bacteria | 6028872 |
| 1020 | 2904593062 | 2904589729 | Bacteria | 6113573 |
| 1021 | 2904603101 | 2904601388 | Bacteria | 5884906 |
| 1022 | 2904623602 | 2904615490 | Bacteria | 10047340 |
| 1023 | 2919050926 | 2919046199 | Bacteria | 5567169 |
| 1024 | 2919073440 | 2919073203 | Bacteria | 6531949 |
| 1025 | 2919083887 | 2919079590 | Bacteria | 5946433 |
| 1026 | 2919480126 | 2919476304 | Bacteria | 5888696 |
| 1027 | 2919528763 | 2919527303 | Bacteria | 7718827 |
| 1028 | 2921653448 | 2921643360 | Bacteria | 11448031 |
| 1029 | 2923510840 | 2923510766 | Bacteria | 5926163 |
| 1030 | 2928062992 | 2928058823 | Bacteria | 5520022 |
| 1031 | 2928110891 | 2928108538 | Bacteria | 7360024 |
| 1032 | 2928119909 | 2928115317 | Bacteria | 6477646 |
| 1033 | 2928135127 | 2928130867 | Bacteria | 5467269 |
| 1034 | 2928137551 | 2928135762 | Bacteria | 7259641 |
| 1035 | 2928159532 | 2928157003 | Bacteria | 7522202 |
| 1036 | 2928164408 | 2928163908 | Bacteria | 7561269 |
| 1037 | 2928177608 | 2928170801 | Bacteria | 8785406 |
| 1038 | 2928505742 | 2928503688 | Bacteria | 7268108 |
| 1039 | 2928538382 | 2928536128 | Bacteria | 7657547 |
| 1040 | 2939606175 | 2939602548 | Bacteria | 4950493 |
| 1041 | 2945937725 | 2945934425 | Bacteria | 7444609 |
| 1042 | 2945952718 | 2945951305 | Bacteria | 4918162 |
| 1043 | 2981993966 | 2981990288 | Bacteria | 7590678 |
| 1044 | 2990199771 | 2990196909 | Bacteria | 4054280 |
| 1045 | 2990705557 | 2990703756 | Bacteria | 7715990 |
| 1046 | 639789091 | 639633007 | Bacteria | 4376040 |
| 1047 | 642424578 | 641736151 | Bacteria | 7477263 |
| 1048 | 642417917 | 641736154 | Bacteria | 7689995 |
| 1049 | 642592533 | 642555112 | Bacteria | 8676562 |
| 1050 | 642622552 | 642555113 | Bacteria | 8214658 |
| 1051 | 8003957766 | 8003955200 | Bacteria | 8601927 |
| 1052 | 8018850321 | 8018845410 | Bacteria | 8933938 |
| 1053 | 8020808897 | 8020807995 | Bacteria | 6801506 |
| 1054 | 8020939347 | 8020938398 | Bacteria | 7472757 |
| 1055 | 8020947275 | 8020945358 | Bacteria | 8467355 |
| 1056 | 8020954429 | 8020953355 | Bacteria | 7439080 |
| 1057 | 8021122783 | 8021120328 | Bacteria | 8782274 |
| 1058 | 8039099749 | 8039098773 | Bacteria | 6602928 |
| 1059 | 8040169347 | 8040167225 | Bacteria | 6542727 |
| 1060 | 8040174949 | 8040173305 | Bacteria | 6827067 |
| 1061 | 8047674923 | 8047673197 | Bacteria | 7395230 |
| 1062 | 8055267010 | 8055266321 | Bacteria | 7999742 |
| 1063 | 8055301676 | 8055301274 | Bacteria | 8587385 |
| 1064 | JGI24741J21665_1000401 | |||
| 1065 | JGI24740J21852_10000321 | |||
| 1066 | JGI24739J22299_10006043 | |||
| 1067 | JGI24735J21928_10000185 | |||
| 1068 | JGI24735J21928_10000211 | |||
| 1069 | JGI24735J21928_10001957 | |||
| 1070 | JGI24735J21928_10004968 | |||
| 1071 | JGI24735J21928_10008800 | |||
| 1072 | JGI24738J21930_10002074 | |||
| 1073 | JGI25155J39150_1000080 | |||
| 1074 | JGI25156J39149_1000112 | |||
| 1075 | JGI25156J39149_1000128 | |||
| 1076 | JGI25156J39149_1002049 | |||
| 1077 | JGI25156J39149_1002067 | |||
| 1078 | JGI25156J39149_1003272 | |||
| 1079 | JGI25156J39149_1003825 | |||
| 1080 | JGI25154J39366_1000143 | |||
| 1081 | JGI25154J39366_1000228 | |||
| 1082 | JGI25154J39366_1000987 | |||
| 1083 | JGI25154J39366_1002015 | |||
| 1084 | JGI25157J39369_1000134 | |||
| 1085 | JGI25150J39212_1005914 | |||
| 1086 | JGI25159J45721_1000415 | |||
| 1087 | rootH1_10051707 | |||
| 1088 | rootH2_10118416 | |||
| 1089 | rootL2_10096030 | |||
| 1090 | JGI25160J50197_1000818 | |||
| 1091 | Ga0007410J51695_1020040 | |||
| 1092 | Ga0007416J51690_1024636 | |||
| 1093 | Ga0006562J51391_1027748 | |||
| 1094 | Ga0055538_1000045 | |||
| 1095 | Ga0055538_1001125 | |||
| 1096 | Ga0055539_1000064 | |||
| 1097 | Ga0055533_1000074 | |||
| 1098 | Ga0055533_1001120 | |||
| 1099 | Ga0055533_1001259 | |||
| 1100 | Ga0055533_1005185 | |||
| 1101 | Ga0055532_1000039 | |||
| 1102 | Ga0055532_1000101 | |||
| 1103 | Ga0055525_1000008 | |||
| 1104 | Ga0055525_1000092 | |||
| 1105 | Ga0055527_1000024 | |||
| 1106 | Ga0055527_1000493 | |||
| 1107 | Ga0055527_1000532 | |||
| 1108 | Ga0055535_1000028 | |||
| 1109 | Ga0055535_1001248 | |||
| 1110 | Ga0055535_1001362 | |||
| 1111 | Ga0055542_1000047 | |||
| 1112 | Ga0055542_1001239 | |||
| 1113 | Ga0055542_1001248 | |||
| 1114 | Ga0055529_1000054 | |||
| 1115 | Ga0055529_1000068 | |||
| 1116 | Ga0055529_1000492 | |||
| 1117 | Ga0055526_1000050 | |||
| 1118 | Ga0055526_1000266 | |||
| 1119 | Ga0055526_1008612 | |||
| 1120 | Ga0055537_1002528 | |||
| 1121 | Ga0055524_1000008 | |||
| 1122 | Ga0055524_1000757 | |||
| 1123 | Ga0055534_1001148 | |||
| 1124 | Ga0055528_1007588 | |||
| 1125 | Ga0055541_1000046 | |||
| 1126 | Ga0055541_1000338 | |||
| 1127 | Ga0058692_1002178 | |||
| 1128 | Ga0058692_1010584 | |||
| 1129 | Ga0058692_1011276 | |||
| 1130 | Ga0058860_12094178 | |||
| 1131 | Ga0065165_1001552 | |||
| 1132 | Ga0065165_1002547 | |||
| 1133 | Ga0070660_100000016 | |||
| 1134 | Ga0070660_100005437 | |||
| 1135 | Ga0070660_100060822 | |||
| 1136 | Ga0070668_100012227 | |||
| 1137 | Ga0070659_100000014 | |||
| 1138 | Ga0070659_100008470 | |||
| 1139 | Ga0070663_100002932 | |||
| 1140 | Ga0070663_100067188 | |||
| 1141 | Ga0070663_100085631 | |||
| 1142 | Ga0068867_100259328 | |||
| 1143 | Ga0068853_100002082 | |||
| 1144 | Ga0068853_100013775 | |||
| 1145 | Ga0068855_100000072 | |||
| 1146 | Ga0068855_100004807 | |||
| 1147 | Ga0068855_100013735 | |||
| 1148 | Ga0068855_100046114 | |||
| 1149 | Ga0068855_100068318 | |||
| 1150 | Ga0068855_100124015 | |||
| 1151 | Ga0068857_100220021 | |||
| 1152 | Ga0068854_100073808 | |||
| 1153 | Ga0068856_100089098 | |||
| 1154 | Ga0068852_100120980 | |||
| 1155 | Ga0075364_10101476 | |||
| 1156 | Ga0075369_10050767 | |||
| 1157 | Ga0075434_100124417 | |||
| 1158 | Ga0099826_10000001 | |||
| 1159 | Ga0105251_10001940 | |||
| 1160 | Ga0105251_10003240 | |||
| 1161 | Ga0105251_10003354 | |||
| 1162 | Ga0105244_10001399 | |||
| 1163 | Ga0105244_10006780 | |||
| 1164 | Ga0105250_10008806 | |||
| 1165 | Ga0105240_10003437 | |||
| 1166 | Ga0105240_10007932 | |||
| 1167 | Ga0105240_10020875 | |||
| 1168 | Ga0105240_10108247 | |||
| 1169 | Ga0105241_10110149 | |||
| 1170 | Ga0105241_10135866 | |||
| 1171 | Ga0105237_10007453 | |||
| 1172 | Ga0105238_10008553 | |||
| 1173 | Ga0105238_10046424 | |||
| 1174 | Ga0105238_10327108 | |||
| 1175 | Ga0105239_10012776 | |||
| 1176 | Ga0105246_10033371 | |||
| 1177 | Ga0157371_10000060 | |||
| 1178 | Ga0157371_10060213 | |||
| 1179 | Ga0157370_10008182 | |||
| 1180 | Ga0157369_10001025 | |||
| 1181 | Ga0157369_10002277 | |||
| 1182 | Ga0157369_10017044 | |||
| 1183 | Ga0157374_10000065 | |||
| 1184 | Ga0157374_10154109 | |||
| 1185 | Ga0157378_10304588 | |||
| 1186 | Ga0157372_10005829 | |||
| 1187 | Ga0157372_10373069 | |||
| 1188 | Ga0182008_10017279 | |||
| 1189 | Ga0182006_1000029 | |||
| 1190 | Ga0182006_1001675 | |||
| 1191 | Ga0182006_1011977 | |||
| 1192 | Ga0182007_10022643 | |||
| 1193 | Ga0182005_1000012 | |||
| 1194 | Ga0183361_10039 | |||
| 1195 | Ga0197907_10094810 | |||
| 1196 | Ga0206356_10207775 | |||
| 1197 | Ga0206355_1201316 | |||
| 1198 | Ga0206352_10616037 | |||
| 1199 | Ga0206350_10823393 | |||
| 1200 | Ga0206353_10857790 | |||
| 1201 | Ga0213872_10000078 | |||
| 1202 | Ga0213872_10028116 | |||
| 1203 | Ga0213872_10035227 | |||
| 1204 | Ga0213872_10049988 | |||
| 1205 | Ga0224712_10014477 | |||
| 1206 | Ga0224712_10053556 | |||
| 1207 | Ga0224712_10077390 | |||
| 1208 | Ga0209435_100016 | |||
| 1209 | Ga0209435_101536 | |||
| 1210 | Ga0209784_100002 | |||
| 1211 | Ga0209784_100355 | |||
| 1212 | Ga0209566_100003 | |||
| 1213 | Ga0209566_100206 | |||
| 1214 | Ga0209674_100004 | |||
| 1215 | Ga0209674_100013 | |||
| 1216 | Ga0209674_100317 | |||
| 1217 | Ga0209674_100508 | |||
| 1218 | Ga0209672_100010 | |||
| 1219 | Ga0209672_100019 | |||
| 1220 | Ga0209672_100051 | |||
| 1221 | Ga0209672_100663 | |||
| 1222 | Ga0209147_100006 | |||
| 1223 | Ga0209147_100023 | |||
| 1224 | Ga0209147_100026 | |||
| 1225 | Ga0209147_100192 | |||
| 1226 | Ga0209147_100544 | |||
| 1227 | Ga0209563_100003 | |||
| 1228 | Ga0209563_100006 | |||
| 1229 | Ga0207427_100524 | |||
| 1230 | Ga0209437_100166 | |||
| 1231 | Ga0209258_100010 | |||
| 1232 | Ga0209258_100031 | |||
| 1233 | Ga0209258_100345 | |||
| 1234 | Ga0209258_100358 | |||
| 1235 | Ga0207425_1000198 | |||
| 1236 | Ga0209646_1000007 | |||
| 1237 | Ga0209646_1000022 | |||
| 1238 | Ga0209646_1000033 | |||
| 1239 | Ga0209026_1000031 | |||
| 1240 | Ga0209677_100003 | |||
| 1241 | Ga0209677_102782 | |||
| 1242 | Ga0209148_1000018 | |||
| 1243 | Ga0209148_1000021 | |||
| 1244 | Ga0209148_1000027 | |||
| 1245 | Ga0209148_1000400 | |||
| 1246 | Ga0209148_1001190 | |||
| 1247 | Ga0209148_1005336 | |||
| 1248 | Ga0209759_1000160 | |||
| 1249 | Ga0209759_1000227 | |||
| 1250 | Ga0209759_1000830 | |||
| 1251 | Ga0209759_1002634 | |||
| 1252 | Ga0209759_1005851 | |||
| 1253 | Ga0209759_1007134 | |||
| 1254 | Ga0209759_1008597 | |||
| 1255 | Ga0209233_1000135 | |||
| 1256 | Ga0209565_1000136 | |||
| 1257 | Ga0209565_1012467 | |||
| 1258 | Ga0209455_1000015 | |||
| 1259 | Ga0209455_1000026 | |||
| 1260 | Ga0209455_1000213 | |||
| 1261 | Ga0209455_1000746 | |||
| 1262 | Ga0209673_1000201 | |||
| 1263 | Ga0209675_1000670 | |||
| 1264 | Ga0209025_1004560 | |||
| 1265 | Ga0209564_1000002 | |||
| 1266 | Ga0209564_1000007 | |||
| 1267 | Ga0209564_1002172 | |||
| 1268 | Ga0209564_1003554 | |||
| 1269 | Ga0209564_1030619 | |||
| 1270 | Ga0209758_1001300 | |||
| 1271 | Ga0209256_1000005 | |||
| 1272 | Ga0207426_1000183 | |||
| 1273 | Ga0207655_1010700 | |||
| 1274 | Ga0207713_1024483 | |||
| 1275 | Ga0207647_10002579 | |||
| 1276 | Ga0207647_10005988 | |||
| 1277 | Ga0207647_10013632 | |||
| 1278 | Ga0207647_10014941 | |||
| 1279 | Ga0207647_10021360 | |||
| 1280 | Ga0207705_10000909 | |||
| 1281 | Ga0207705_10068844 | |||
| 1282 | Ga0207654_10020282 | |||
| 1283 | Ga0207695_10001378 | |||
| 1284 | Ga0207695_10003550 | |||
| 1285 | Ga0207695_10017376 | |||
| 1286 | Ga0207695_10022439 | |||
| 1287 | Ga0207671_10018507 | |||
| 1288 | Ga0207671_10062016 | |||
| 1289 | Ga0207657_10000001 | |||
| 1290 | Ga0207657_10011207 | |||
| 1291 | Ga0207657_10162278 | |||
| 1292 | Ga0207694_10005502 | |||
| 1293 | Ga0207694_10005690 | |||
| 1294 | Ga0207690_10000006 | |||
| 1295 | Ga0207690_10062100 | |||
| 1296 | Ga0207686_10106992 | |||
| 1297 | Ga0207689_10256758 | |||
| 1298 | Ga0207667_10000055 | |||
| 1299 | Ga0207667_10005385 | |||
| 1300 | Ga0207667_10009859 | |||
| 1301 | Ga0207667_10023435 | |||
| 1302 | Ga0207667_10026316 | |||
| 1303 | Ga0207667_10102192 | |||
| 1304 | Ga0207668_10023326 | |||
| 1305 | Ga0207639_10011574 | |||
| 1306 | Ga0207678_10000640 | |||
| 1307 | Ga0207702_10215259 | |||
| 1308 | Ga0207648_10073287 | |||
| 1309 | Ga0207698_10136833 | |||
| 1310 | Ga0209371_1000202 | |||
| 1311 | Ga0209371_1002201 | |||
| 1312 | Ga0209371_1006356 | |||
| 1313 | Ga0209371_1013531 | |||
| 1314 | Ga0209282_1000001 | |||
| 1315 | Ga0307515_10114288 | |||
| 1316 | Ga0265338_10000183 | |||
| 1317 | Ga0265338_10001296 | |||
| 1318 | Ga0268256_1000189 | |||
| 1319 | Ga0268256_1001207 | |||
| 1320 | Ga0268256_1007934 | |||
| 1321 | Ga0268256_1011771 | |||
| 1322 | Ga0265314_10045322 | |||
| 1323 | Ga0307407_10045476 | |||
| 1324 | Ga0307412_10000008 | |||
| 1325 | Ga0307412_10016506 | |||
| 1326 | Ga0316583_10000075 | |||
| 1327 | Ga0373927_0099159 | |||
| 1328 | Ga0395899_0000041 | |||
| 1329 | Ga0395899_0001045 | |||
| 1330 | Ga0395899_0001913 | |||
| 1331 | Ga0395899_0005775 | |||
| 1332 | Ga0395899_0013914 | |||
| 1333 | Ga0395899_0027231 | |||
| 1334 | Ga0395900_0000065 | |||
| 1335 | Ga0395900_0000077 | |||
| 1336 | Ga0395900_0000097 | |||
| 1337 | Ga0395900_0001188 | |||
| 1338 | Ga0395900_0001196 | |||
| 1339 | Ga0395900_0003753 | |||
| 1340 | Ga0395900_0024334 | |||
| 1341 | Ga0395900_0038860 | |||
| 1342 | Ga0395900_0065140 | |||
| 1343 | Ga0395900_0192157 | |||
| 1344 | Ga0395898_0000220 | |||
| 1345 | Ga0395898_0000359 | |||
| 1346 | Ga0395898_0002178 | |||
| 1347 | Ga0395898_0021459 | |||
| 1348 | Ga0395898_0297620 | |||
| 1349 | Ga0395905_0000185 | |||
| 1350 | Ga0395905_0009767 | |||
| 1351 | Ga0395905_0026588 | |||
| 1352 | Ga0395905_0099536 | |||
| 1353 | Ga0395905_0143228 | |||
| 1354 | Ga0395905_0182492 | |||
| 1355 | Ga0395901_0000011 | |||
| 1356 | Ga0395901_0000085 | |||
| 1357 | Ga0395901_0000639 | |||
| 1358 | Ga0395901_0000928 | |||
| 1359 | Ga0395901_0001168 | |||
| 1360 | Ga0395901_0001807 | |||
| 1361 | Ga0395901_0018670 | |||
| 1362 | Ga0395901_0100600 | |||
| 1363 | Ga0436361_0051331 | |||
| 1364 | Ga0436361_0081046 | |||
| 1365 | Ga0436361_0233238 | |||
| 1366 | Ga0436361_0457272 | |||
| 1367 | Ga0436361_0461069 | |||
| 1368 | Ga0436361_0732452 | |||
| 1369 | Ga0436361_0997150 | |||
| 1370 | Ga0436361_1068465 | |||
| 1371 | Ga0439466_0000136 | |||
| 1372 | Ga0439465_0014195 | |||
| 1373 | Ga0439433_0007872 | |||
| 1374 | Ga0439448_0000397 | |||
| 1375 | Ga0439455_0006374 | |||
| 1376 | Ga0439455_0012221 | |||
| 1377 | Ga0450911_003740 | |||
| 1378 | Ga0450907_001052 | |||
| 1379 | Ga0439464_0005502 | |||
| 1380 | Ga0466969_0003870 | |||
| 1381 | Ga0466969_0011061 | |||
| 1382 | Ga0466969_0075275 | |||
| 1383 | Ga0466972_0032058 | |||
| 1384 | Ga0466972_0077901 | |||
| 1385 | Ga0466977_0156671 | |||
| 1386 | Ga0466965_0012256 | |||
| 1387 | Ga0466965_0014090 | |||
| 1388 | Ga0466965_0016894 | |||
| 1389 | Ga0466966_0000002 | |||
| 1390 | Ga0466966_0003020 | |||
| 1391 | Ga0466966_0019301 | |||
| 1392 | Ga0466966_0029417 | |||
| 1393 | Ga0466961_0000061 | |||
| 1394 | Ga0466961_0058701 | |||
| 1395 | Ga0466961_0088868 | |||
| 1396 | Ga0466963_0003013 | |||
| 1397 | Ga0466963_0037902 | |||
| 1398 | Ga0466964_0001523 | |||
| 1399 | Ga0466971_0008015 | |||
| 1400 | Ga0466968_0003359 | |||
| 1401 | Ga0466968_0005763 | |||
| 1402 | Ga0466957_0000075 | |||
| 1403 | Ga0466957_0002815 | |||
| 1404 | Ga0466957_0022510 | |||
| 1405 | Ga0466957_0046544 | |||
| 1406 | Ga0466960_0100405 | |||
| 1407 | Ga0466959_0009742 | |||
| 1408 | Ga0466959_0039385 | |||
| 1409 | Ga0466959_0052406 | |||
| 1410 | Ga0451576_0018798 | |||
| 1411 | Ga0466958_0002064 | |||
| 1412 | Ga0466958_0020934 | |||
| 1413 | Ga0466958_0027882 | |||
| 1414 | Ga0466958_0108779 | |||
| 1415 | Ga0495617_000001 | |||
| 1416 | Ga0495617_000021 | |||
| 1417 | Ga0495617_015762 | |||
| 1418 | Ga0495627_000007 | |||
| 1419 | Ga0495627_000026 | |||
| 1420 | Ga0495592_0028762 | |||
| 1421 | Ga0495592_0034333 | |||
| 1422 | Ga0495603_0032716 | |||
| 1423 | Ga0495590_0000010 | |||
| 1424 | Ga0495590_0000028 | |||
| 1425 | Ga0495590_0000083 | |||
| 1426 | Ga0495590_0000820 | |||
| 1427 | Ga0495590_0004307 | |||
| 1428 | Ga0495590_0039625 | |||
| 1429 | Ga0495591_000007 | |||
| 1430 | Ga0495591_000038 | |||
| 1431 | Ga0495629_0000119 | |||
| 1432 | Ga0495629_0005983 | |||
| 1433 | Ga0495629_0007935 | |||
| 1434 | Ga0495629_0012236 | |||
| 1435 | Ga0495629_0012487 | |||
| 1436 | Ga0495629_0021233 | |||
| 1437 | Ga0495638_0000157 | |||
| 1438 | Ga0495638_0006691 | |||
| 1439 | Ga0495638_0034096 | |||
| 1440 | Ga0495638_0047636 | |||
| 1441 | Ga0495641_0030934 | |||
| 1442 | Ga0495651_0026578 | |||
| 1443 | Ga0495653_0000010 | |||
| 1444 | Ga0495653_0000105 | |||
| 1445 | Ga0495653_0001720 | |||
| 1446 | Ga0495653_0004899 | |||
| 1447 | Ga0495653_0005296 | |||
| 1448 | Ga0495653_0010674 | |||
| 1449 | Ga0495653_0014076 | |||
| 1450 | Ga0495653_0034739 | |||
| 1451 | Ga0495653_0114335 | |||
| 1452 | Ga0495653_0119173 | |||
| 1453 | Ga0495650_0000085 | |||
| 1454 | Ga0495650_0000159 | |||
| 1455 | Ga0495650_0000194 | |||
| 1456 | Ga0495650_0000299 | |||
| 1457 | Ga0495650_0000410 | |||
| 1458 | Ga0495650_0000595 | |||
| 1459 | Ga0495650_0001326 | |||
| 1460 | Ga0495650_0008519 | |||
| 1461 | Ga0495650_0022964 | |||
| 1462 | Ga0495580_0000291 | |||
| 1463 | Ga0495580_0001451 | |||
| 1464 | Ga0495580_0002463 | |||
| 1465 | Ga0495580_0005978 | |||
| 1466 | Ga0495580_0010366 | |||
| 1467 | Ga0495580_0018264 | |||
| 1468 | Ga0495580_0056101 | |||
| 1469 | Ga0495582_0004843 | |||
| 1470 | Ga0495582_0007260 | |||
| 1471 | Ga0495582_0009445 | |||
| 1472 | Ga0495582_0011544 | |||
| 1473 | Ga0495605_0000004 | |||
| 1474 | Ga0495605_0000027 | |||
| 1475 | Ga0495605_0000160 | |||
| 1476 | Ga0495605_0003001 | |||
| 1477 | Ga0495605_0005586 | |||
| 1478 | Ga0495605_0044987 | |||
| 1479 | Ga0495639_0006666 | |||
| 1480 | Ga0495662_0064856 | |||
| 1481 | Ga0495664_0000037 | |||
| 1482 | Ga0495664_0052460 | |||
| 1483 | Ga0495584_0000234 | |||
| 1484 | Ga0495584_0000390 | |||
| 1485 | Ga0495584_0013417 | |||
| 1486 | Ga0495585_0000521 | |||
| 1487 | Ga0495585_0001083 | |||
| 1488 | Ga0495585_0036248 | |||
| 1489 | Ga0495594_0019212 | |||
| 1490 | Ga0495594_0039169 | |||
| 1491 | Ga0495596_0000276 | |||
| 1492 | Ga0495596_0005192 | |||
| 1493 | Ga0495596_0012822 | |||
| 1494 | Ga0495596_0027136 | |||
| 1495 | Ga0495596_0027302 | |||
| 1496 | Ga0495596_0041783 | |||
| 1497 | Ga0495607_0000272 | |||
| 1498 | Ga0495607_0002570 | |||
| 1499 | Ga0495607_0010437 | |||
| 1500 | Ga0495607_0016076 | |||
| 1501 | Ga0495607_0041184 | |||
| 1502 | Ga0495583_0000006 | |||
| 1503 | Ga0495583_0000182 | |||
| 1504 | Ga0495583_0013576 | |||
| 1505 | Ga0495583_0013600 | |||
| 1506 | Ga0495583_0014902 | |||
| 1507 | Ga0495606_0000088 | |||
| 1508 | Ga0495606_0000103 | |||
| 1509 | Ga0495606_0000132 | |||
| 1510 | Ga0495606_0000247 | |||
| 1511 | Ga0495606_0002709 | |||
| 1512 | Ga0495606_0005424 | |||
| 1513 | Ga0495606_0013103 | |||
| 1514 | Ga0495606_0013303 | |||
| 1515 | Ga0495606_0013765 | |||
| 1516 | Ga0495606_0014367 | |||
| 1517 | Ga0495606_0018038 | |||
| 1518 | Ga0495606_0049803 | |||
| 1519 | Ga0495606_0083158 | |||
| 1520 | Ga0495606_0099810 | |||
| 1521 | Ga0495608_0041172 | |||
| 1522 | Ga0495610_0000008 | |||
| 1523 | Ga0495610_0002900 | |||
| 1524 | Ga0495610_0004713 | |||
| 1525 | Ga0495610_0005527 | |||
| 1526 | Ga0495610_0007881 | |||
| 1527 | Ga0495610_0009532 | |||
| 1528 | Ga0495616_0001024 | |||
| 1529 | Ga0495616_0002266 | |||
| 1530 | Ga0495616_0005147 | |||
| 1531 | Ga0495618_0003931 | |||
| 1532 | Ga0495620_0028049 | |||
| 1533 | Ga0495628_0006279 | |||
| 1534 | Ga0495628_0010178 | |||
| 1535 | Ga0495628_0025525 | |||
| 1536 | Ga0495628_0047828 | |||
| 1537 | Ga0495628_0084124 | |||
| 1538 | Ga0495630_0005881 | |||
| 1539 | Ga0495631_0000105 | |||
| 1540 | Ga0495631_0003775 | |||
| 1541 | Ga0495631_0024157 | |||
| 1542 | Ga0495632_0000024 | |||
| 1543 | Ga0495632_0000043 | |||
| 1544 | Ga0495632_0000106 | |||
| 1545 | Ga0495632_0006661 | |||
| 1546 | Ga0495637_0000002 | |||
| 1547 | Ga0495637_0003552 | |||
| 1548 | Ga0495637_0013350 | |||
| 1549 | Ga0495643_0000022 | |||
| 1550 | Ga0495643_0000117 | |||
| 1551 | Ga0495643_0000552 | |||
| 1552 | Ga0495643_0008044 | |||
| 1553 | Ga0495643_0017855 | |||
| 1554 | Ga0495643_0024905 | |||
| 1555 | Ga0495643_0074302 | |||
| 1556 | Ga0495644_0030135 | |||
| 1557 | Ga0495648_0000022 | |||
| 1558 | Ga0495648_0000875 | |||
| 1559 | Ga0495648_0001544 | |||
| 1560 | Ga0495648_0002193 | |||
| 1561 | Ga0495648_0002666 | |||
| 1562 | Ga0495648_0004350 | |||
| 1563 | Ga0495648_0009106 | |||
| 1564 | Ga0495648_0016093 | |||
| 1565 | Ga0495648_0027086 | |||
| 1566 | Ga0495648_0035692 | |||
| 1567 | Ga0495666_0003723 | |||
| 1568 | Ga0495666_0007129 | |||
| 1569 | Ga0495666_0026377 | |||
| 1570 | Ga0495666_0028271 | |||
| 1571 | Ga0495666_0028744 | |||
| 1572 | Ga0495666_0070065 | |||
| 1573 | Ga0495642_0000001 | |||
| 1574 | Ga0495642_0000865 | |||
| 1575 | Ga0495642_0001857 | |||
| 1576 | Ga0495642_0003562 | |||
| 1577 | Ga0495642_0006888 | |||
| 1578 | Ga0495642_0018725 | |||
| 1579 | Ga0495652_0018710 | |||
| 1580 | Ga0495652_0022578 | |||
| 1581 | Ga0495652_0047350 | |||
| 1582 | Ga0495652_0110293 | |||
| 1583 | Ga0495654_0000002 | |||
| 1584 | Ga0495654_0009202 | |||
| 1585 | Ga0495654_0055852 | |||
| 1586 | Ga0495665_0001952 | |||
| 1587 | Ga0495665_0003338 | |||
| 1588 | Ga0495665_0007204 | |||
| 1589 | Ga0495665_0035472 | |||
| 1590 | Ga0495665_0035677 | |||
| 1591 | Ga0495640_0052953 | |||
| 1592 | Ga0495640_0109210 | |||
| 1593 | Ga0495586_0001962 | |||
| 1594 | Ga0495586_0013680 | |||
| 1595 | Ga0495586_0017444 | |||
| 1596 | Ga0495587_0002254 | |||
| 1597 | Ga0495587_0016882 | |||
| 1598 | Ga0495609_0000445 | |||
| 1599 | Ga0495609_0000554 | |||
| 1600 | Ga0495609_0001464 | |||
| 1601 | Ga0495609_0003850 | |||
| 1602 | Ga0495609_0011535 | |||
| 1603 | Ga0495597_0000030 | |||
| 1604 | Ga0495597_0000070 | |||
| 1605 | Ga0495597_0000189 | |||
| 1606 | Ga0495597_0000302 | |||
| 1607 | Ga0495597_0001611 | |||
| 1608 | Ga0495597_0001677 | |||
| 1609 | Ga0495597_0003633 | |||
| 1610 | Ga0495597_0042076 | |||
| 1611 | Ga0495645_0007362 | |||
| 1612 | Ga0495645_0084025 | |||
| 1613 | Ga0495645_0095254 | |||
| 1614 | Ga0495622_0000012 | |||
| 1615 | Ga0495622_0000048 | |||
| 1616 | Ga0495633_0001106 | |||
| 1617 | Ga0495633_0001287 | |||
| 1618 | Ga0495633_0005502 | |||
| 1619 | Ga0495633_0012459 | |||
| 1620 | Ga0495633_0029467 | |||
| 1621 | Ga0495656_0008392 | |||
| 1622 | Ga0495668_0000036 | |||
| 1623 | Ga0495668_0000038 | |||
| 1624 | Ga0495668_0000280 | |||
| 1625 | Ga0495668_0000428 | |||
| 1626 | Ga0495668_0001093 | |||
| 1627 | Ga0495668_0001482 | |||
| 1628 | Ga0495668_0004604 | |||
| 1629 | Ga0495668_0011982 | |||
| 1630 | Ga0495668_0016754 | |||
| 1631 | Ga0495668_0047721 | |||
| 1632 | Ga0495634_0008649 | |||
| 1633 | Ga0495634_0025885 | |||
| 1634 | Ga0495634_0070031 | |||
| 1635 | Ga0495611_0000191 | |||
| 1636 | Ga0495611_0000408 | |||
| 1637 | Ga0495625_0000241 | |||
| 1638 | Ga0495625_0000745 | |||
| 1639 | Ga0495625_0001333 | |||
| 1640 | Ga0495625_0012563 | |||
| 1641 | Ga0495625_0013580 | |||
| 1642 | Ga0495625_0019537 | |||
| 1643 | Ga0495625_0027228 | |||
| 1644 | Ga0495625_0040024 | |||
| 1645 | Ga0495635_0002476 | |||
| 1646 | Ga0495635_0022427 | |||
| 1647 | Ga0495635_0174118 | |||
| 1648 | Ga0495659_0000008 | |||
| 1649 | Ga0495661_0000040 | |||
| 1650 | Ga0495661_0001097 | |||
| 1651 | Ga0495661_0001236 | |||
| 1652 | Ga0495661_0003616 | |||
| 1653 | Ga0495661_0005279 | |||
| 1654 | Ga0495661_0006401 | |||
| 1655 | Ga0495661_0007134 | |||
| 1656 | Ga0495661_0011445 | |||
| 1657 | Ga0495661_0013687 | |||
| 1658 | Ga0495661_0034998 | |||
| 1659 | Ga0495661_0040333 | |||
| 1660 | Ga0495661_0059347 | |||
| 1661 | Ga0495588_0000052 | |||
| 1662 | Ga0495588_0008561 | |||
| 1663 | Ga0495588_0011112 | |||
| 1664 | Ga0495588_0016502 | |||
| 1665 | Ga0495599_0074269 | |||
| 1666 | Ga0495599_0105737 | |||
| 1667 | Ga0495623_0009910 | |||
| 1668 | Ga0495623_0033966 | |||
| 1669 | Ga0495623_0043178 | |||
| 1670 | Ga0495646_0000964 | |||
| 1671 | Ga0495646_0008960 | |||
| 1672 | Ga0495646_0009760 | |||
| 1673 | Ga0495669_0000013 | |||
| 1674 | Ga0495669_0000175 | |||
| 1675 | Ga0495669_0021154 | |||
| 1676 | Ga0495669_0069591 | |||
| 1677 | Ga0495613_0008181 | |||
| 1678 | Ga0495613_0275020 | |||
| 1679 | Ga0495624_0008867 | |||
| 1680 | Ga0495624_0009686 | |||
| 1681 | Ga0495624_0011804 | |||
| 1682 | Ga0495624_0011969 | |||
| 1683 | Ga0495624_0032254 | |||
| 1684 | Ga0495671_0000002 | |||
| 1685 | Ga0495671_0000155 | |||
| 1686 | Ga0495671_0000313 | |||
| 1687 | Ga0495671_0004065 | |||
| 1688 | Ga0495671_0006095 | |||
| 1689 | Ga0495671_0084363 | |||
| 1690 | Ga0495649_0000085 | |||
| 1691 | Ga0495649_0000469 | |||
| 1692 | Ga0495649_0002029 | |||
| 1693 | Ga0495649_0036293 | |||
| 1694 | Ga0495589_0000058 | |||
| 1695 | Ga0495589_0000227 | |||
| 1696 | Ga0495589_0001047 | |||
| 1697 | Ga0495589_0020385 | |||
| 1698 | Ga0495589_0028869 | |||
| 1699 | Ga0495589_0038261 | |||
| 1700 | Ga0495589_0040762 | |||
| 1701 | Ga0495600_0004893 | |||
| 1702 | Ga0495660_0000050 | |||
| 1703 | Ga0495660_0000285 | |||
| 1704 | Ga0495660_0000339 | |||
| 1705 | Ga0495660_0003258 | |||
| 1706 | Ga0495660_0005819 | |||
| 1707 | Ga0495660_0016426 | |||
| 1708 | Ga0495660_0029698 | |||
| 1709 | Ga0495581_0007807 | |||
| 1710 | Ga0495581_0008391 | |||
| 1711 | Ga0495604_0000220 | |||
| 1712 | Ga0495604_0012680 | |||
| 1713 | Ga0495604_0016491 | |||
| 1714 | Ga0495604_0016819 | |||
| 1715 | Ga0495604_0019475 | |||
| 1716 | Ga0495604_0082873 | |||
| 1717 | Ga0495604_0102648 | |||
| 1718 | Ga0495674_0003517 | |||
| 1719 | Ga0495674_0004385 | |||
| 1720 | Ga0495674_0004393 | |||
| 1721 | Ga0495674_0005533 | |||
| 1722 | Ga0495674_0012988 | |||
| 1723 | Ga0495674_0013595 | |||
| 1724 | Ga0495674_0030002 | |||
| 1725 | Ga0495674_0036553 | |||
| 1726 | Ga0495672_0000015 | |||
| 1727 | Ga0495672_0000325 | |||
| 1728 | Ga0495672_0000677 | |||
| 1729 | Ga0495672_0001219 | |||
| 1730 | Ga0495672_0005093 | |||
| 1731 | Ga0495672_0006470 | |||
| 1732 | Ga0495672_0009080 | |||
| 1733 | Ga0495676_0000029 | |||
| 1734 | Ga0495676_0024837 | |||
| 1735 | Ga0495676_0054971 | |||
| 1736 | Ga0495680_0001059 | |||
| 1737 | Ga0495680_0005882 | |||
| 1738 | Ga0495680_0010964 | |||
| 1739 | Ga0495680_0019270 | |||
| 1740 | Ga0495680_0095210 | |||
| 1741 | Ga0495683_0000012 | |||
| 1742 | Ga0495683_0009313 | |||
| 1743 | Ga0495683_0013078 | |||
| 1744 | Ga0495683_0018236 | |||
| 1745 | Ga0495683_0029389 | |||
| 1746 | Ga0495683_0037256 | |||
| 1747 | Ga0495683_0076643 | |||
| 1748 | Ga0495687_000002 | |||
| 1749 | Ga0495687_000003 | |||
| 1750 | Ga0495687_000007 | |||
| 1751 | Ga0495687_000025 | |||
| 1752 | Ga0495687_000073 | |||
| 1753 | Ga0495687_000445 | |||
| 1754 | Ga0495687_000489 | |||
| 1755 | Ga0495687_001493 | |||
| 1756 | Ga0495687_020518 | |||
| 1757 | Ga0495687_068084 | |||
| 1758 | Ga0495675_0010007 | |||
| 1759 | Ga0495675_0040644 | |||
| 1760 | Ga0495675_0051409 | |||
| 1761 | Ga0495677_0000144 | |||
| 1762 | Ga0495677_0000152 | |||
| 1763 | Ga0495677_0001812 | |||
| 1764 | Ga0495677_0008040 | |||
| 1765 | Ga0495677_0037019 | |||
| 1766 | Ga0495679_000036 | |||
| 1767 | Ga0495679_000038 | |||
| 1768 | Ga0495679_001340 | |||
| 1769 | Ga0495679_004357 | |||
| 1770 | Ga0495679_010320 | |||
| 1771 | Ga0495679_019679 | |||
| 1772 | Ga0495673_0000005 | |||
| 1773 | Ga0495673_0000064 | |||
| 1774 | Ga0495673_0000109 | |||
| 1775 | Ga0495673_0024774 | |||
| 1776 | Ga0495673_0046225 | |||
| 1777 | Ga0495681_0000005 | |||
| 1778 | Ga0495681_0000555 | |||
| 1779 | Ga0495681_0004387 | |||
| 1780 | Ga0495681_0008550 | |||
| 1781 | Ga0495684_0055846 | |||
| 1782 | Ga0495686_0000015 | |||
| 1783 | Ga0495686_0000032 | |||
| 1784 | Ga0495686_0000051 | |||
| 1785 | Ga0495686_0016243 | |||
| 1786 | Ga0495686_0104020 | |||
| 1787 | Ga0495593_0001558 | |||
| 1788 | Ga0495593_0008313 | |||
| 1789 | Ga0495593_0009404 | |||
| 1790 | Ga0495593_0014443 | |||
| 1791 | Ga0495593_0056827 | |||
| 1792 | Ga0495602_0020951 | |||
| 1793 | Ga0495602_0022831 | |||
| 1794 | Ga0495602_0025386 | |||
| 1795 | Ga0495602_0066735 | |||
| 1796 | Ga0495602_0167378 | |||
| 1797 | Ga0495614_0005056 | |||
| 1798 | Ga0495614_0037762 | |||
| 1799 | Ga0495626_0000066 | |||
| 1800 | Ga0495626_0000145 | |||
| 1801 | Ga0495626_0010793 | |||
| 1802 | Ga0495626_0020232 | |||
| 1803 | Ga0495626_0059771 | |||
| 1804 | Ga0496100_0244005 | |||
| 1805 | Ga0496101_0001448 | |||
| 1806 | Ga0496101_0076508 | |||
| 1807 | Ga0496101_0154564 | |||
| 1808 | Ga0496102_0000033 | |||
| 1809 | Ga0496102_0004637 | |||
| 1810 | Ga0496102_0106004 | |||
| 1811 | Ga0496102_0108444 | |||
| 1812 | Ga0496103_0001960 | |||
| 1813 | Ga0496103_0002086 | |||
| 1814 | Ga0496103_0002298 | |||
| 1815 | Ga0496104_0074198 | |||
| 1816 | Ga0496105_0049200 | |||
| 1817 | Ga0496106_0000019 | |||
| 1818 | Ga0496106_0022320 | |||
| 1819 | Ga0496106_0042892 | |||
| 1820 | Ga0496107_0163415 | |||
| 1821 | Ga0496109_0006962 | |||
| 1822 | Ga0496109_0181892 | |||
| 1823 | Ga0496110_0000007 | |||
| 1824 | Ga0496110_0095948 | |||
| 1825 | Ga0496112_0037713 | |||
| 1826 | Ga0496112_0063266 | |||
| 1827 | Ga0496112_0164239 | |||
| 1828 | Ga0496113_0007646 | |||
| 1829 | Ga0496114_0032092 | |||
| 1830 | Ga0496114_0177710 | |||
| 1831 | Ga0496116_0008917 | |||
| 1832 | Ga0496116_0013017 | |||
| 1833 | Ga0496116_0013744 | |||
| 1834 | Ga0496116_0080780 | |||
| 1835 | Ga0496117_0000058 | |||
| 1836 | Ga0496117_0007793 | |||
| 1837 | Ga0496117_0015289 | |||
| 1838 | Ga0496117_0025869 | |||
| 1839 | Ga0496117_0078788 | |||
| 1840 | Ga0496117_0090904 | |||
| 1841 | Ga0496118_0003177 | |||
| 1842 | Ga0496118_0004991 | |||
| 1843 | Ga0496118_0005234 | |||
| 1844 | Ga0496118_0041145 | |||
| 1845 | Ga0496118_0052180 | |||
| 1846 | Ga0496118_0070827 | |||
| 1847 | Ga0496119_0000089 | |||
| 1848 | Ga0496119_0034680 | |||
| 1849 | Ga0496120_0000117 | |||
| 1850 | Ga0496120_0001811 | |||
| 1851 | Ga0496120_0025297 | |||
| 1852 | Ga0496121_0000205 | |||
| 1853 | Ga0496121_0000310 | |||
| 1854 | Ga0496121_0003570 | |||
| 1855 | Ga0496121_0006733 | |||
| 1856 | Ga0496121_0007511 | |||
| 1857 | Ga0496121_0010176 | |||
| 1858 | Ga0496121_0147738 | |||
| 1859 | Ga0496122_0000279 | |||
| 1860 | Ga0496122_0000457 | |||
| 1861 | Ga0496122_0002401 | |||
| 1862 | Ga0496122_0005248 | |||
| 1863 | Ga0496122_0012927 | |||
| 1864 | Ga0496123_0000146 | |||
| 1865 | Ga0496123_0000321 | |||
| 1866 | Ga0496123_0001138 | |||
| 1867 | Ga0496123_0010024 | |||
| 1868 | Ga0496123_0015195 | |||
| 1869 | Ga0496123_0120475 | |||
| 1870 | Ga0496124_0000007 | |||
| 1871 | Ga0496124_0000208 | |||
| 1872 | Ga0496124_0002145 | |||
| 1873 | Ga0496124_0005692 | |||
| 1874 | Ga0496124_0010579 | |||
| 1875 | Ga0496124_0036217 | |||
| 1876 | Ga0496124_0070548 | |||
| 1877 | Ga0496124_0141287 | |||
| 1878 | Ga0496125_0000895 | |||
| 1879 | Ga0496125_0000938 | |||
| 1880 | Ga0496125_0020498 | |||
| 1881 | Ga0496125_0023674 | |||
| 1882 | Ga0496125_0043939 | |||
| 1883 | Ga0496125_0050210 | |||
| 1884 | Ga0496125_0050623 | |||
| 1885 | Ga0496125_0091759 | |||
| 1886 | Ga0496126_0000034 | |||
| 1887 | Ga0496126_0000706 | |||
| 1888 | Ga0496126_0006701 | |||
| 1889 | Ga0496126_0023730 | |||
| 1890 | Ga0496126_0033941 | |||
| 1891 | Ga0496126_0044704 | |||
| 1892 | Ga0496126_0068323 | |||
| 1893 | Ga0496126_0140724 | |||
| 1894 | Ga0501308_000888 | |||
| 1895 | Ga0495678_000004 | |||
| 1896 | Ga0495678_000015 | |||
| 1897 | Ga0495678_000022 | |||
| 1898 | Ga0495678_000103 | |||
| 1899 | Ga0495678_001009 | |||
| 1900 | Ga0495678_001189 | |||
| 1901 | Ga0495678_029569 | |||
| 1902 | Ga0495682_0000038 | |||
| 1903 | Ga0495682_0009396 | |||
| 1904 | Ga0495682_0035115 | |||
| 1905 | Ga0501031_0001921 | |||
| 1906 | Ga0501031_0007771 | |||
| 1907 | Ga0501032_0003027 | |||
| 1908 | Ga0501032_0105607 | |||
| 1909 | Ga0501033_0000665 | |||
| 1910 | Ga0501033_0001358 | |||
| 1911 | Ga0501033_0036882 | |||
| 1912 | Ga0501033_0071779 | |||
| 1913 | Ga0501036_0000045 | |||
| 1914 | Ga0501037_0000236 | |||
| 1915 | Ga0501037_0001205 | |||
| 1916 | Ga0501038_0005951 | |||
| 1917 | Ga0501038_0014317 | |||
| 1918 | Ga0501038_0066255 | |||
| 1919 | Ga0501043_0000065 | |||
| 1920 | Ga0501043_0002979 | |||
| 1921 | Ga0501043_0207481 | |||
| 1922 | Ga0501046_0001304 | |||
| 1923 | Ga0501047_0006181 | |||
| 1924 | Ga0501047_0082840 | |||
| 1925 | Ga0501047_0083059 | |||
| 1926 | Ga0501047_0185404 | |||
| 1927 | Ga0501047_0234088 | |||
| 1928 | Ga0501069_0000002 | |||
| 1929 | Ga0501070_0000339 | |||
| 1930 | Ga0501070_0016944 | |||
| 1931 | Ga0501070_0039176 | |||
| 1932 | Ga0501071_0014589 | |||
| 1933 | Ga0501073_0008914 | |||
| 1934 | Ga0501074_0001070 | |||
| 1935 | Ga0501074_0248541 | |||
| 1936 | Ga0501076_0110333 | |||
| 1937 | Ga0501077_0035933 | |||
| 1938 | Ga0501209_000052 | |||
| 1939 | Ga0501249_003643 | |||
| 1940 | Ga0501079_0139149 | |||
| 1941 | Ga0501080_0000617 | |||
| 1942 | Ga0501080_0019404 | |||
| 1943 | Ga0501083_0185607 | |||
| 1944 | Ga0501083_0214208 | |||
| 1945 | Ga0501035_0000124 | |||
| 1946 | Ga0501035_0000552 | |||
| 1947 | Ga0501035_0004858 | |||
| 1948 | Ga0501035_0007250 | |||
| 1949 | Ga0501035_0010969 | |||
| 1950 | Ga0501044_0000087 | |||
| 1951 | Ga0501044_0001108 | |||
| 1952 | Ga0501044_0003419 | |||
| 1953 | Ga0501044_0030772 | |||
| 1954 | Ga0500644_0012225 | |||
| 1955 | Ga0500581_056119 | |||
| 1956 | Ga0500651_0019866 | |||
| 1957 | Ga0500650_0000508 | |||
| 1958 | Ga0500556_0000016 | |||
| 1959 | Ga0500569_020990 | |||
| 1960 | Ga0500594_0005059 | |||
| 1961 | Ga0500618_000032 | |||
| 1962 | Ga0500642_0000017 | |||
| 1963 | Ga0500652_000306 | |||
| 1964 | Ga0500658_0062856 | |||
| 1965 | Ga0500559_0072688 | |||
| 1966 | Ga0500568_0002231 | |||
| 1967 | Ga0500586_039428 | |||
| 1968 | Ga0500604_0000678 | |||
| 1969 | Ga0500616_0000169 | |||
| 1970 | Ga0500627_0136423 | |||
| 1971 | Ga0500645_000991 | |||
| 1972 | Ga0501084_0036996 | |||
| 1973 | Ga0587077_001466 | |||
| 1974 | Ga0587085_005324 | |||
| 1975 | Ga0466962_0006514 | |||
| 1976 | Ga0466962_0018488 | |||
| 1977 | 2550692510 | |||
| 1978 | 2501071499 | |||
| 1979 | 2501081178 | |||
| 1980 | 2501408349 | |||
| 1981 | 2509131446 | |||
| 1982 | 2510251854 | |||
| 1983 | 2511085953 | |||
| 1984 | 2511096089 | |||
| 1985 | 2511103187 | |||
| 1986 | 2511384505 | |||
| 1987 | 2512345178 | |||
| 1988 | 2513555581 | |||
| 1989 | 2513563475 | |||
| 1990 | 2513961405 | |||
| 1991 | 2514053378 | |||
| 1992 | 2515684268 | |||
| 1993 | 2515687463 | |||
| 1994 | 2516022486 | |||
| 1995 | 2519458198 | |||
| 1996 | 2521557642 | |||
| 1997 | 2527080707 | |||
| 1998 | 2553002760 | |||
| 1999 | 2563059283 | |||
| 2000 | 2585294748 | |||
| 2001 | 2599738060 | |||
| 2002 | 2599742568 | |||
| 2003 | 2600204686 | |||
| 2004 | 2603858197 | |||
| 2005 | 2643797235 | |||
| 2006 | 2643814371 | |||
| 2007 | 2644253215 | |||
| 2008 | 2644355743 | |||
| 2009 | 2644474223 | |||
| 2010 | 2676741672 | |||
| 2011 | 2713479783 | |||
| 2012 | 2719640965 | |||
| 2013 | 2723876924 | |||
| 2014 | 2738742190 | |||
| 2015 | 2738745273 | |||
| 2016 | 2738819043 | |||
| 2017 | 2738828664 | |||
| 2018 | 2738830801 | |||
| 2019 | 2738841361 | |||
| 2020 | 2738872327 | |||
| 2021 | 2739152460 | |||
| 2022 | 2739183958 | |||
| 2023 | 2739194380 | |||
| 2024 | 2739218928 | |||
| 2025 | 2739272231 | |||
| 2026 | 2739320856 | |||
| 2027 | 2739339097 | |||
| 2028 | 2739341275 | |||
| 2029 | 2739354503 | |||
| 2030 | 2739610524 | |||
| 2031 | 2746088225 | |||
| 2032 | 2746096881 | |||
| 2033 | 2765570192 | |||
| 2034 | 2792840548 | |||
| 2035 | 2808969967 | |||
| 2036 | 2808981532 | |||
| 2037 | 2809005186 | |||
| 2038 | 2809011673 | |||
| 2039 | 2809129115 | |||
| 2040 | 2809143657 | |||
| 2041 | 2809148735 | |||
| 2042 | 2817260350 | |||
| 2043 | 2817278038 | |||
| 2044 | 2817455605 | |||
| 2045 | 2819591496 | |||
| 2046 | 2819615215 | |||
| 2047 | 2819623521 | |||
| 2048 | 2819632876 | |||
| 2049 | 2821132907 | |||
| 2050 | 2839096866 | |||
| 2051 | 2842325040 | |||
| 2052 | 2842349318 | |||
| 2053 | 2842459939 | |||
| 2054 | 2842714580 | |||
| 2055 | 2844531156 | |||
| 2056 | 2852621273 | |||
| 2057 | 2856292821 | |||
| 2058 | 2857361055 | |||
| 2059 | 2857527588 | |||
| 2060 | 2857554732 | |||
| 2061 | 2857563577 | |||
| 2062 | 2857568815 | |||
| 2063 | 2863421887 | |||
| 2064 | 2865015529 | |||
| 2065 | 2870072171 | |||
| 2066 | 2881613599 | |||
| 2067 | 2883088077 | |||
| 2068 | 2884816588 | |||
| 2069 | 2884837305 | |||
| 2070 | 2884853596 | |||
| 2071 | 2885267637 | |||
| 2072 | 2885271036 | |||
| 2073 | 2896155287 | |||
| 2074 | 2900637764 | |||
| 2075 | 2902687376 | |||
| 2076 | 2904427100 | |||
| 2077 | 2904441623 | |||
| 2078 | 2904487456 | |||
| 2079 | 2904531455 | |||
| 2080 | 2904566052 | |||
| 2081 | 2904573096 | |||
| 2082 | 2904586905 | |||
| 2083 | 2904593062 | |||
| 2084 | 2904603101 | |||
| 2085 | 2904623602 | |||
| 2086 | 2919050926 | |||
| 2087 | 2919073440 | |||
| 2088 | 2919083887 | |||
| 2089 | 2919480126 | |||
| 2090 | 2919528763 | |||
| 2091 | 2921653448 | |||
| 2092 | 2923510840 | |||
| 2093 | 2928062992 | |||
| 2094 | 2928110891 | |||
| 2095 | 2928119909 | |||
| 2096 | 2928135127 | |||
| 2097 | 2928137551 | |||
| 2098 | 2928159532 | |||
| 2099 | 2928164408 | |||
| 2100 | 2928177608 | |||
| 2101 | 2928505742 | |||
| 2102 | 2928538382 | |||
| 2103 | 2939606175 | |||
| 2104 | 2945937725 | |||
| 2105 | 2945952718 | |||
| 2106 | 2981993966 | |||
| 2107 | 2990199771 | |||
| 2108 | 2990705557 | |||
| 2109 | 639789091 | |||
| 2110 | 642424578 | |||
| 2111 | 642417917 | |||
| 2112 | 642592533 | |||
| 2113 | 642622552 | |||
| 2114 | 8003957766 | |||
| 2115 | 8018850321 | |||
| 2116 | 8020808897 | |||
| 2117 | 8020939347 | |||
| 2118 | 8020947275 | |||
| 2119 | 8020954429 | |||
| 2120 | 8021122783 | |||
| 2121 | 8039099749 | |||
| 2122 | 8040169347 | |||
| 2123 | 8040174949 | |||
| 2124 | 8047674923 | |||
| 2125 | 8055267010 | |||
| 2126 | 8055301676 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j0e-assembly1.cif.gz_B | crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group | 0.9943 | 2 | 32 |
| 4j0e-assembly1.cif.gz_A | crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group | 0.9921 | 2 | 32 |
| 7bkd-assembly1.cif.gz_a | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) | 0.9892 | 2 | 32 |
| 7o4q-assembly1.cif.gz_B-2 | structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in space group c2221 (unliganded) | 0.9887 | 2 | 32 |
| 7o4t-assembly1.cif.gz_A | structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) | 0.9862 | 2 | 32 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y4U4_173_293_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9879 | 2 | 37 | 3.50.50.60 |
| af_A0A1D6LYX0_29_117_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9835 | 2 | 35 | 3.50.50.60 |
| 4bjyA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9833 | 2 | 32 | 3.50.50.60 |
| af_Q2G041_6_109_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9797 | 3 | 31 | 3.50.50.60 |
| 4i58A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9789 | 2 | 32 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J0VQE7-F1-model_v4 | deleted | 0.9836 | 1 | 415 |
|
| AF-A0A527HAE0-F1-model_v4 | D-amino acid dehydrogenase | 0.9832 | 1 | 329 |
GO:0005737
GO:0005886 GO:0008718 GO:0055130 |
| AF-A0A2N3CD51-F1-model_v4 | D-amino acid dehydrogenase small subunit (EC 1.4.99.6) | 0.9814 | 1 | 406 |
GO:0005737
GO:0005886 GO:0008718 GO:0055130 |
| AF-A0A2E5MX84-F1-model_v4 | Amino acid dehydrogenase | 0.9806 | 1 | 415 |
GO:0005737
GO:0005886 GO:0008718 GO:0055130 |
| AF-A0A419WFR6-F1-model_v4 | deleted | 0.9804 | 1 | 414 |
|