F489344
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1064 | 477 | 2128 | 387 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10002188|Ga0105251_100021882 |
| Length | 421 |
| Sequence | MRLAEMPFGGFRAGCHHKKSRRFEGVDMSNTEVFVVSALRTAIGGFGGSLKDVSPIELGTQVSRAAIAKSGLAPEHIGHVVMXXVIPTEVRDAYLSRVIALEAGLTKETPAMNVNRLCGSGLQAIVSAAQSLMLGDANAVLAGGTESMSRGAYIMPQARWGARMGNVQAYDYMLGALHDPFANIHMGITAENIAENYGITRADQDALALTSQQRAARAIAEGRFDGQIVPIEIATRKGTVTFAQDEHVRGDVTAEQLEKMKTAFKKDGTVTAGNASGLNDGAAALVMANGDMVREHGLKPMARLVAYAHAGVEPSMMGLGPIPASRKALERAGLTVADLDVIESNEAFAAQACAVARELGFDPEKVNPNGSGISLGHPVGATGAIIATKAIHELHRTGGRYALVTMCIGGGQGIAVIFERV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 179 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 191 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 192 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 193 | 3300031635 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 194 | 3300031664 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 195 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 196 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 197 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 203 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 229 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 230 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 233 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 234 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 235 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 236 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 237 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 238 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 239 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 240 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 241 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 242 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 243 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 244 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 245 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 246 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 349 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 352 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 353 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 365 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 366 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 369 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 370 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 371 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 372 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 373 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 406 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 407 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 410 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 411 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 412 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 413 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 414 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 415 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 416 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 417 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 418 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 419 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 420 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 421 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 422 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 423 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 424 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 425 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 426 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 427 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 428 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 429 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 430 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 431 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 432 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 433 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 434 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 435 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 436 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 437 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 438 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 439 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 440 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 441 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 442 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 443 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 444 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 445 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 446 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 447 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 448 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 449 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 450 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 451 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 452 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 453 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 454 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 455 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 456 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 457 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 458 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 459 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 460 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 461 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 462 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 463 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 464 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 465 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 466 | 2941479691 | |||
| 467 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 468 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 469 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 470 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 471 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 472 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 473 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 474 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 475 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 476 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 477 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.45 |
| Metatranscriptomes | 2.07 |
| Isolates | 6.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.97 |
| Nodule | 1.41 |
| Rhizoplane | 4.14 |
| Rhizosphere | 84.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105251_10002188 | 3300009011 | Bacteria | 15639 |
| 2 | MRS2a_Contig_16 | 2124908027 | Bacteria | 42770 |
| 3 | JGI24740J21852_10003189 | 3300001979 | Bacteria | 7237 |
| 4 | JGI25162J39368_1000704 | 3300002737 | Bacteria | 23251 |
| 5 | JGI25163J39215_1000295 | 3300002771 | Bacteria | 17052 |
| 6 | JGI25164J39214_1000430 | 3300002772 | Bacteria | 23247 |
| 7 | JGI25165J46597_1000823 | 3300003214 | Bacteria | 23251 |
| 8 | Ga0055530_10002588 | 3300003791 | Bacteria | 11451 |
| 9 | Ga0065714_10000072 | 3300005288 | Bacteria | 12678 |
| 10 | Ga0065714_10005900 | 3300005288 | Bacteria | 3863 |
| 11 | Ga0065714_10022497 | 3300005288 | Bacteria | 1624 |
| 12 | Ga0065714_10064584 | 3300005288 | Bacteria | 32069 |
| 13 | Ga0065714_10066846 | 3300005288 | Bacteria | 6218 |
| 14 | Ga0065704_10001134 | 3300005289 | Bacteria | 14922 |
| 15 | Ga0065704_10088187 | 3300005289 | Bacteria | 2960 |
| 16 | Ga0065712_10001427 | 3300005290 | Bacteria | 10149 |
| 17 | Ga0070683_100088499 | 3300005329 | Bacteria | 2905 |
| 18 | Ga0070690_100011538 | 3300005330 | Bacteria | 5170 |
| 19 | Ga0070677_10029084 | 3300005333 | Bacteria | 2093 |
| 20 | Ga0068869_100001616 | 3300005334 | Bacteria | 13395 |
| 21 | Ga0068869_100130260 | 3300005334 | Bacteria | 1933 |
| 22 | Ga0070666_10123165 | 3300005335 | Bacteria | 1799 |
| 23 | Ga0070680_100110571 | 3300005336 | Bacteria | 2288 |
| 24 | Ga0070682_100009501 | 3300005337 | Bacteria | 5502 |
| 25 | Ga0070682_100072778 | 3300005337 | Bacteria | 2203 |
| 26 | Ga0068868_100000209 | 3300005338 | Bacteria | 39624 |
| 27 | Ga0068868_100027098 | 3300005338 | Bacteria | 4370 |
| 28 | Ga0070687_100000190 | 3300005343 | Bacteria | 21399 |
| 29 | Ga0070661_100000015 | 3300005344 | Bacteria | 156690 |
| 30 | Ga0070692_10048747 | 3300005345 | Bacteria | 2195 |
| 31 | Ga0070674_100049870 | 3300005356 | Bacteria | 2880 |
| 32 | Ga0070659_100099566 | 3300005366 | Bacteria | 2338 |
| 33 | Ga0070709_10098586 | 3300005434 | Bacteria | 1942 |
| 34 | Ga0070709_10165652 | 3300005434 | Bacteria | 1540 |
| 35 | Ga0070714_100012346 | 3300005435 | Bacteria | 6819 |
| 36 | Ga0070714_100143521 | 3300005435 | Bacteria | 2145 |
| 37 | Ga0070714_100283328 | 3300005435 | Bacteria | 1540 |
| 38 | Ga0070713_100051163 | 3300005436 | Bacteria | 3416 |
| 39 | Ga0070713_100097922 | 3300005436 | Bacteria | 2535 |
| 40 | Ga0070713_100109895 | 3300005436 | Bacteria | 2402 |
| 41 | Ga0070713_100177289 | 3300005436 | Bacteria | 1913 |
| 42 | Ga0070713_100200873 | 3300005436 | Bacteria | 1800 |
| 43 | Ga0070710_10020709 | 3300005437 | Bacteria | 3416 |
| 44 | Ga0070710_10081026 | 3300005437 | Bacteria | 1895 |
| 45 | Ga0070710_10089676 | 3300005437 | Bacteria | 1811 |
| 46 | Ga0070711_100033593 | 3300005439 | Bacteria | 3416 |
| 47 | Ga0070711_100123246 | 3300005439 | Bacteria | 1920 |
| 48 | Ga0070711_100138528 | 3300005439 | Bacteria | 1821 |
| 49 | Ga0070705_100016350 | 3300005440 | Bacteria | 3854 |
| 50 | Ga0070700_100001218 | 3300005441 | Bacteria | 12765 |
| 51 | Ga0070700_100020858 | 3300005441 | Bacteria | 3803 |
| 52 | Ga0070694_100000802 | 3300005444 | Bacteria | 17651 |
| 53 | Ga0070694_100024686 | 3300005444 | Bacteria | 3881 |
| 54 | Ga0070708_100014082 | 3300005445 | Bacteria | 6572 |
| 55 | Ga0070708_100046673 | 3300005445 | Bacteria | 3822 |
| 56 | Ga0070708_100056021 | 3300005445 | Bacteria | 3506 |
| 57 | Ga0070708_100178502 | 3300005445 | Bacteria | 1984 |
| 58 | Ga0070708_100204496 | 3300005445 | Bacteria | 1849 |
| 59 | Ga0070663_100074707 | 3300005455 | Bacteria | 2476 |
| 60 | Ga0070678_100023726 | 3300005456 | Bacteria | 4093 |
| 61 | Ga0070662_100018899 | 3300005457 | Bacteria | 4669 |
| 62 | Ga0070681_10000172 | 3300005458 | Bacteria | 49288 |
| 63 | Ga0068867_100000417 | 3300005459 | Bacteria | 28383 |
| 64 | Ga0070706_100005228 | 3300005467 | Bacteria | 12378 |
| 65 | Ga0070706_100006345 | 3300005467 | Bacteria | 11169 |
| 66 | Ga0070707_100008665 | 3300005468 | Bacteria | 9437 |
| 67 | Ga0070707_100043810 | 3300005468 | Bacteria | 4283 |
| 68 | Ga0070707_100249671 | 3300005468 | Bacteria | 1727 |
| 69 | Ga0070698_100008793 | 3300005471 | Bacteria | 10865 |
| 70 | Ga0070698_100017176 | 3300005471 | Bacteria | 7627 |
| 71 | Ga0070698_100147465 | 3300005471 | Bacteria | 2301 |
| 72 | Ga0070698_100322343 | 3300005471 | Bacteria | 1476 |
| 73 | Ga0070699_100028781 | 3300005518 | Bacteria | 4791 |
| 74 | Ga0070699_100051898 | 3300005518 | Bacteria | 3551 |
| 75 | Ga0070699_100179125 | 3300005518 | Bacteria | 1880 |
| 76 | Ga0070679_100049580 | 3300005530 | Bacteria | 4181 |
| 77 | Ga0070684_100035923 | 3300005535 | Bacteria | 4243 |
| 78 | Ga0070697_100001858 | 3300005536 | Bacteria | 16143 |
| 79 | Ga0070697_100074912 | 3300005536 | Bacteria | 2781 |
| 80 | Ga0068853_100000681 | 3300005539 | Bacteria | 23401 |
| 81 | Ga0068853_100014501 | 3300005539 | Bacteria | 6457 |
| 82 | Ga0070672_100047834 | 3300005543 | Bacteria | 3320 |
| 83 | Ga0070686_100010525 | 3300005544 | Bacteria | 5220 |
| 84 | Ga0070686_100213524 | 3300005544 | Bacteria | 1390 |
| 85 | Ga0070695_100045837 | 3300005545 | Bacteria | 2788 |
| 86 | Ga0070695_100057240 | 3300005545 | Bacteria | 2518 |
| 87 | Ga0070695_100233184 | 3300005545 | Bacteria | 1332 |
| 88 | Ga0070696_100002371 | 3300005546 | Bacteria | 12455 |
| 89 | Ga0070693_100038058 | 3300005547 | Bacteria | 2686 |
| 90 | Ga0070693_100042970 | 3300005547 | Bacteria | 2550 |
| 91 | Ga0070665_100037145 | 3300005548 | Bacteria | 4899 |
| 92 | Ga0070704_100003235 | 3300005549 | Bacteria | 9308 |
| 93 | Ga0070704_100005837 | 3300005549 | Bacteria | 7208 |
| 94 | Ga0068855_100055177 | 3300005563 | Bacteria | 4668 |
| 95 | Ga0070664_100000015 | 3300005564 | Bacteria | 128718 |
| 96 | Ga0068857_100008624 | 3300005577 | Bacteria | 8822 |
| 97 | Ga0068857_100028346 | 3300005577 | Bacteria | 4942 |
| 98 | Ga0068854_100004438 | 3300005578 | Bacteria | 8853 |
| 99 | Ga0068854_100220920 | 3300005578 | Bacteria | 1499 |
| 100 | Ga0068856_100003653 | 3300005614 | Bacteria | 15456 |
| 101 | Ga0068856_100007677 | 3300005614 | Bacteria | 10524 |
| 102 | Ga0068856_100036637 | 3300005614 | Bacteria | 4810 |
| 103 | Ga0068856_100047165 | 3300005614 | Bacteria | 4244 |
| 104 | Ga0070702_100000050 | 3300005615 | Bacteria | 32860 |
| 105 | Ga0068852_100049565 | 3300005616 | Bacteria | 3593 |
| 106 | Ga0068852_100228563 | 3300005616 | Bacteria | 1773 |
| 107 | Ga0068864_100170394 | 3300005618 | Bacteria | 1985 |
| 108 | Ga0068866_10000489 | 3300005718 | Bacteria | 18218 |
| 109 | Ga0068866_10113308 | 3300005718 | Bacteria | 1517 |
| 110 | Ga0068861_100013583 | 3300005719 | Bacteria | 5700 |
| 111 | Ga0068851_10000819 | 3300005834 | Bacteria | 13442 |
| 112 | Ga0068870_10068706 | 3300005840 | Bacteria | 1926 |
| 113 | Ga0068863_100048052 | 3300005841 | Bacteria | 4047 |
| 114 | Ga0068858_100050058 | 3300005842 | Bacteria | 3867 |
| 115 | Ga0068860_100031691 | 3300005843 | Bacteria | 5082 |
| 116 | Ga0068862_100004686 | 3300005844 | Bacteria | 11518 |
| 117 | Ga0070717_10008454 | 3300006028 | Bacteria | 7690 |
| 118 | Ga0070717_10050779 | 3300006028 | Bacteria | 3410 |
| 119 | Ga0070717_10094398 | 3300006028 | Bacteria | 2530 |
| 120 | Ga0070717_10103518 | 3300006028 | Bacteria | 2420 |
| 121 | Ga0070717_10175147 | 3300006028 | Bacteria | 1867 |
| 122 | Ga0075432_10001147 | 3300006058 | Bacteria | 8473 |
| 123 | Ga0075432_10001150 | 3300006058 | Bacteria | 8468 |
| 124 | Ga0070715_10035373 | 3300006163 | Bacteria | 2053 |
| 125 | Ga0070716_100021617 | 3300006173 | Bacteria | 3393 |
| 126 | Ga0070716_100141129 | 3300006173 | Bacteria | 1536 |
| 127 | Ga0070712_100034776 | 3300006175 | Bacteria | 3416 |
| 128 | Ga0070712_100042991 | 3300006175 | Bacteria | 3109 |
| 129 | Ga0070712_100056150 | 3300006175 | Bacteria | 2761 |
| 130 | Ga0070712_100064934 | 3300006175 | Bacteria | 2589 |
| 131 | Ga0070712_100129139 | 3300006175 | Bacteria | 1913 |
| 132 | Ga0070712_100184663 | 3300006175 | Bacteria | 1627 |
| 133 | Ga0075362_10029756 | 3300006177 | Bacteria | 2355 |
| 134 | Ga0075367_10050281 | 3300006178 | Bacteria | 2460 |
| 135 | Ga0075366_10020321 | 3300006195 | Bacteria | 3851 |
| 136 | Ga0097621_100000676 | 3300006237 | Bacteria | 23878 |
| 137 | Ga0097621_100014418 | 3300006237 | Bacteria | 5913 |
| 138 | Ga0075370_10028797 | 3300006353 | Bacteria | 3090 |
| 139 | Ga0068871_100002094 | 3300006358 | Bacteria | 13506 |
| 140 | Ga0075433_10001341 | 3300006852 | Bacteria | 18019 |
| 141 | Ga0075433_10086621 | 3300006852 | Bacteria | 2766 |
| 142 | Ga0075434_100001149 | 3300006871 | Bacteria | 21878 |
| 143 | Ga0075434_100281457 | 3300006871 | Bacteria | 1683 |
| 144 | Ga0075436_100003889 | 3300006914 | Bacteria | 10232 |
| 145 | Ga0075436_100015122 | 3300006914 | Bacteria | 5289 |
| 146 | Ga0075436_100033260 | 3300006914 | Bacteria | 3554 |
| 147 | Ga0079104_1000097 | 3300006946 | Bacteria | 129435 |
| 148 | Ga0075435_100000938 | 3300007076 | Bacteria | 18379 |
| 149 | Ga0075435_100005166 | 3300007076 | Bacteria | 9078 |
| 150 | Ga0105251_10004330 | 3300009011 | Bacteria | 9716 |
| 151 | Ga0105251_10016924 | 3300009011 | Bacteria | 3921 |
| 152 | Ga0105251_10029972 | 3300009011 | Bacteria | 2736 |
| 153 | Ga0105244_10001284 | 3300009036 | Bacteria | 20597 |
| 154 | Ga0105244_10002362 | 3300009036 | Bacteria | 14331 |
| 155 | Ga0105244_10013421 | 3300009036 | Bacteria | 4791 |
| 156 | Ga0105240_10018287 | 3300009093 | Bacteria | 9419 |
| 157 | Ga0105240_10072757 | 3300009093 | Bacteria | 4247 |
| 158 | Ga0111539_10142185 | 3300009094 | Bacteria | 2809 |
| 159 | Ga0105245_10000115 | 3300009098 | Bacteria | 77632 |
| 160 | Ga0105245_10078884 | 3300009098 | Bacteria | 3005 |
| 161 | Ga0105247_10022068 | 3300009101 | Bacteria | 3832 |
| 162 | Ga0105243_10090159 | 3300009148 | Bacteria | 2522 |
| 163 | Ga0105243_10231362 | 3300009148 | Bacteria | 1640 |
| 164 | Ga0105241_10000846 | 3300009174 | Bacteria | 23173 |
| 165 | Ga0105241_10071862 | 3300009174 | Bacteria | 2687 |
| 166 | Ga0105242_10000003 | 3300009176 | Bacteria | 226797 |
| 167 | Ga0105242_10023507 | 3300009176 | Bacteria | 4857 |
| 168 | Ga0105242_10333137 | 3300009176 | Bacteria | 1396 |
| 169 | Ga0105248_10220241 | 3300009177 | Bacteria | 2137 |
| 170 | Ga0105237_10000009 | 3300009545 | Bacteria | 337615 |
| 171 | Ga0105237_10007385 | 3300009545 | Bacteria | 12034 |
| 172 | Ga0105237_10009748 | 3300009545 | Bacteria | 10275 |
| 173 | Ga0105238_10014796 | 3300009551 | Bacteria | 7890 |
| 174 | Ga0105238_10106075 | 3300009551 | Bacteria | 2791 |
| 175 | Ga0105249_10001691 | 3300009553 | Bacteria | 19321 |
| 176 | Ga0105249_10087027 | 3300009553 | Bacteria | 2915 |
| 177 | Ga0105249_10099779 | 3300009553 | Bacteria | 2729 |
| 178 | Ga0105239_10005459 | 3300010375 | Bacteria | 14923 |
| 179 | Ga0105239_10018066 | 3300010375 | Bacteria | 7801 |
| 180 | Ga0105246_10000001 | 3300011119 | Bacteria | 200946 |
| 181 | Ga0105246_10031865 | 3300011119 | Bacteria | 3491 |
| 182 | Ga0157373_10000512 | 3300013100 | Bacteria | 30504 |
| 183 | Ga0157373_10001985 | 3300013100 | Bacteria | 15507 |
| 184 | Ga0157370_10002402 | 3300013104 | Bacteria | 22573 |
| 185 | Ga0157370_10010969 | 3300013104 | Bacteria | 9508 |
| 186 | Ga0157370_10029957 | 3300013104 | Bacteria | 5334 |
| 187 | Ga0157370_10035403 | 3300013104 | Bacteria | 4852 |
| 188 | Ga0157369_10002872 | 3300013105 | Bacteria | 20578 |
| 189 | Ga0157378_10034381 | 3300013297 | Bacteria | 4483 |
| 190 | Ga0163162_10006516 | 3300013306 | Bacteria | 11309 |
| 191 | Ga0163162_10018601 | 3300013306 | Bacteria | 6807 |
| 192 | Ga0163162_10115237 | 3300013306 | Bacteria | 2787 |
| 193 | Ga0157375_10049890 | 3300013308 | Bacteria | 4103 |
| 194 | Ga0163163_10098142 | 3300014325 | Bacteria | 2951 |
| 195 | Ga0157380_10033985 | 3300014326 | Bacteria | 3930 |
| 196 | Ga0157380_10043427 | 3300014326 | Bacteria | 3520 |
| 197 | Ga0182008_10003433 | 3300014497 | Bacteria | 9566 |
| 198 | Ga0182008_10003973 | 3300014497 | Bacteria | 8747 |
| 199 | Ga0182008_10004773 | 3300014497 | Bacteria | 7843 |
| 200 | Ga0182008_10013262 | 3300014497 | Bacteria | 4333 |
| 201 | Ga0157376_10059704 | 3300014969 | Bacteria | 3198 |
| 202 | Ga0182006_1009525 | 3300015261 | Bacteria | 4350 |
| 203 | Ga0182006_1052189 | 3300015261 | Bacteria | 1571 |
| 204 | Ga0182007_10000209 | 3300015262 | Bacteria | 39161 |
| 205 | Ga0182007_10008866 | 3300015262 | Bacteria | 4098 |
| 206 | Ga0182005_1001303 | 3300015265 | Bacteria | 10243 |
| 207 | Ga0163161_10001221 | 3300017792 | Bacteria | 19331 |
| 208 | Ga0209760_100109 | 3300025207 | Bacteria | 58898 |
| 209 | Ga0207427_100011 | 3300025231 | Bacteria | 640076 |
| 210 | Ga0209437_100044 | 3300025233 | Bacteria | 430619 |
| 211 | Ga0209233_1000057 | 3300025261 | Bacteria | 430619 |
| 212 | Ga0209676_1001409 | 3300025292 | Bacteria | 23191 |
| 213 | Ga0209050_1000754 | 3300025298 | Bacteria | 46538 |
| 214 | Ga0209051_1007521 | 3300025303 | Bacteria | 5937 |
| 215 | Ga0207656_10003632 | 3300025321 | Bacteria | 5327 |
| 216 | Ga0207655_1000141 | 3300025728 | Bacteria | 138956 |
| 217 | Ga0207655_1004618 | 3300025728 | Bacteria | 9683 |
| 218 | Ga0207655_1004697 | 3300025728 | Bacteria | 9567 |
| 219 | Ga0207713_1001966 | 3300025735 | Bacteria | 15527 |
| 220 | Ga0207713_1006251 | 3300025735 | Bacteria | 7290 |
| 221 | Ga0207713_1019386 | 3300025735 | Bacteria | 3329 |
| 222 | Ga0207682_10088991 | 3300025893 | Bacteria | 1336 |
| 223 | Ga0207692_10001606 | 3300025898 | Bacteria | 8514 |
| 224 | Ga0207692_10014650 | 3300025898 | Bacteria | 3430 |
| 225 | Ga0207692_10040925 | 3300025898 | Bacteria | 2290 |
| 226 | Ga0207692_10055458 | 3300025898 | Bacteria | 2028 |
| 227 | Ga0207692_10057724 | 3300025898 | Bacteria | 1997 |
| 228 | Ga0207642_10003207 | 3300025899 | Bacteria | 5129 |
| 229 | Ga0207699_10000208 | 3300025906 | Bacteria | 35107 |
| 230 | Ga0207699_10003830 | 3300025906 | Bacteria | 7180 |
| 231 | Ga0207643_10024874 | 3300025908 | Bacteria | 3305 |
| 232 | Ga0207684_10001257 | 3300025910 | Bacteria | 28039 |
| 233 | Ga0207684_10012145 | 3300025910 | Bacteria | 7496 |
| 234 | Ga0207684_10026987 | 3300025910 | Bacteria | 4897 |
| 235 | Ga0207654_10000239 | 3300025911 | Bacteria | 33314 |
| 236 | Ga0207707_10003624 | 3300025912 | Bacteria | 13691 |
| 237 | Ga0207695_10001114 | 3300025913 | Bacteria | 46680 |
| 238 | Ga0207671_10000018 | 3300025914 | Bacteria | 318130 |
| 239 | Ga0207693_10008852 | 3300025915 | Bacteria | 8221 |
| 240 | Ga0207693_10022862 | 3300025915 | Bacteria | 4964 |
| 241 | Ga0207693_10047478 | 3300025915 | Bacteria | 3374 |
| 242 | Ga0207693_10064959 | 3300025915 | Bacteria | 2858 |
| 243 | Ga0207693_10090757 | 3300025915 | Bacteria | 2395 |
| 244 | Ga0207693_10109754 | 3300025915 | Bacteria | 2164 |
| 245 | Ga0207693_10164193 | 3300025915 | Bacteria | 1748 |
| 246 | Ga0207663_10000294 | 3300025916 | Bacteria | 21646 |
| 247 | Ga0207663_10113094 | 3300025916 | Bacteria | 1845 |
| 248 | Ga0207660_10055337 | 3300025917 | Bacteria | 2835 |
| 249 | Ga0207662_10000333 | 3300025918 | Bacteria | 21392 |
| 250 | Ga0207649_10000008 | 3300025920 | Bacteria | 315683 |
| 251 | Ga0207652_10257976 | 3300025921 | Bacteria | 1572 |
| 252 | Ga0207646_10000507 | 3300025922 | Bacteria | 52135 |
| 253 | Ga0207646_10265507 | 3300025922 | Bacteria | 1551 |
| 254 | Ga0207681_10000304 | 3300025923 | Bacteria | 36250 |
| 255 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 256 | Ga0207694_10169298 | 3300025924 | Bacteria | 1768 |
| 257 | Ga0207650_10312528 | 3300025925 | Bacteria | 1285 |
| 258 | Ga0207659_10192751 | 3300025926 | Bacteria | 1623 |
| 259 | Ga0207687_10033523 | 3300025927 | Bacteria | 3484 |
| 260 | Ga0207700_10000525 | 3300025928 | Bacteria | 22579 |
| 261 | Ga0207700_10011846 | 3300025928 | Bacteria | 5585 |
| 262 | Ga0207700_10052870 | 3300025928 | Bacteria | 3040 |
| 263 | Ga0207700_10132441 | 3300025928 | Bacteria | 2038 |
| 264 | Ga0207700_10178510 | 3300025928 | Bacteria | 1776 |
| 265 | Ga0207700_10282694 | 3300025928 | Bacteria | 1428 |
| 266 | Ga0207700_10283602 | 3300025928 | Bacteria | 1425 |
| 267 | Ga0207664_10001091 | 3300025929 | Bacteria | 18100 |
| 268 | Ga0207664_10023337 | 3300025929 | Bacteria | 4633 |
| 269 | Ga0207664_10083806 | 3300025929 | Bacteria | 2599 |
| 270 | Ga0207664_10101138 | 3300025929 | Bacteria | 2381 |
| 271 | Ga0207664_10230390 | 3300025929 | Bacteria | 1610 |
| 272 | Ga0207706_10011229 | 3300025933 | Bacteria | 8166 |
| 273 | Ga0207686_10000179 | 3300025934 | Bacteria | 48733 |
| 274 | Ga0207686_10025133 | 3300025934 | Bacteria | 3460 |
| 275 | Ga0207709_10000917 | 3300025935 | Bacteria | 22229 |
| 276 | Ga0207709_10004967 | 3300025935 | Bacteria | 7614 |
| 277 | Ga0207670_10055971 | 3300025936 | Bacteria | 2668 |
| 278 | Ga0207665_10023533 | 3300025939 | Bacteria | 4057 |
| 279 | Ga0207665_10136140 | 3300025939 | Bacteria | 1748 |
| 280 | Ga0207691_10041266 | 3300025940 | Bacteria | 4261 |
| 281 | Ga0207691_10123697 | 3300025940 | Bacteria | 2290 |
| 282 | Ga0207711_10104770 | 3300025941 | Bacteria | 2507 |
| 283 | Ga0207689_10175440 | 3300025942 | Bacteria | 1767 |
| 284 | Ga0207679_10000008 | 3300025945 | Bacteria | 412057 |
| 285 | Ga0207667_10004024 | 3300025949 | Bacteria | 18066 |
| 286 | Ga0207667_10047302 | 3300025949 | Bacteria | 4553 |
| 287 | Ga0207712_10000763 | 3300025961 | Bacteria | 24183 |
| 288 | Ga0207712_10070160 | 3300025961 | Bacteria | 2516 |
| 289 | Ga0207640_10106794 | 3300025981 | Bacteria | 1975 |
| 290 | Ga0207677_10001911 | 3300026023 | Bacteria | 11006 |
| 291 | Ga0207677_10023601 | 3300026023 | Bacteria | 3804 |
| 292 | Ga0207703_10011030 | 3300026035 | Bacteria | 7041 |
| 293 | Ga0207639_10009093 | 3300026041 | Bacteria | 6845 |
| 294 | Ga0207639_10064264 | 3300026041 | Bacteria | 2844 |
| 295 | Ga0207708_10000114 | 3300026075 | Bacteria | 61971 |
| 296 | Ga0207708_10055895 | 3300026075 | Bacteria | 3010 |
| 297 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 298 | Ga0207702_10011858 | 3300026078 | Bacteria | 7255 |
| 299 | Ga0207702_10025761 | 3300026078 | Bacteria | 4883 |
| 300 | Ga0207702_10107123 | 3300026078 | Bacteria | 2478 |
| 301 | Ga0207648_10007536 | 3300026089 | Bacteria | 10681 |
| 302 | Ga0207676_10120324 | 3300026095 | Bacteria | 2213 |
| 303 | Ga0207674_10002309 | 3300026116 | Bacteria | 24153 |
| 304 | Ga0207674_10010901 | 3300026116 | Bacteria | 10234 |
| 305 | Ga0207674_10013314 | 3300026116 | Bacteria | 9137 |
| 306 | Ga0207675_100005429 | 3300026118 | Bacteria | 12215 |
| 307 | Ga0207683_10005872 | 3300026121 | Bacteria | 10527 |
| 308 | Ga0207698_10004701 | 3300026142 | Bacteria | 8352 |
| 309 | Ga0209281_1000136 | 3300027111 | Bacteria | 182153 |
| 310 | Ga0209371_1002682 | 3300027312 | Bacteria | 9652 |
| 311 | Ga0207428_10005561 | 3300027907 | Bacteria | 11735 |
| 312 | Ga0207428_10069373 | 3300027907 | Bacteria | 2772 |
| 313 | Ga0207428_10074807 | 3300027907 | Bacteria | 2656 |
| 314 | Ga0207428_10104965 | 3300027907 | Bacteria | 2180 |
| 315 | Ga0268266_10323138 | 3300028379 | Bacteria | 1445 |
| 316 | Ga0268265_10003785 | 3300028380 | Bacteria | 10725 |
| 317 | Ga0268264_10119336 | 3300028381 | Bacteria | 2322 |
| 318 | Ga0268256_1002491 | 3300030500 | Bacteria | 9356 |
| 319 | Ga0307511_10123375 | 3300030521 | Bacteria | 1591 |
| 320 | Ga0265762_1005087 | 3300030760 | Bacteria | 2355 |
| 321 | Ga0265775_100032 | 3300030762 | Bacteria | 4142 |
| 322 | Ga0265763_1000542 | 3300030763 | Bacteria | 2344 |
| 323 | Ga0265777_100215 | 3300030877 | Bacteria | 2348 |
| 324 | Ga0265776_100095 | 3300030880 | Bacteria | 2383 |
| 325 | Ga0265776_100141 | 3300030880 | Bacteria | 2174 |
| 326 | Ga0265764_100201 | 3300030882 | Bacteria | 2013 |
| 327 | Ga0265761_100364 | 3300030889 | Bacteria | 1685 |
| 328 | Ga0265779_100103 | 3300031043 | Bacteria | 2656 |
| 329 | Ga0265760_10008349 | 3300031090 | Bacteria | 2962 |
| 330 | Ga0265327_10043871 | 3300031251 | Bacteria | 2389 |
| 331 | Ga0307408_100000649 | 3300031548 | Bacteria | 29194 |
| 332 | Ga0310116_102021 | 3300031591 | Bacteria | 2004 |
| 333 | Ga0310117_100027 | 3300031592 | Bacteria | 6208 |
| 334 | Ga0310117_105512 | 3300031592 | Bacteria | 1368 |
| 335 | Ga0310103_100873 | 3300031614 | Bacteria | 2976 |
| 336 | Ga0310115_100183 | 3300031635 | Bacteria | 4542 |
| 337 | Ga0310118_100057 | 3300031664 | Bacteria | 4250 |
| 338 | Ga0310105_100165 | 3300031666 | Bacteria | 4155 |
| 339 | Ga0310119_100483 | 3300031686 | Bacteria | 3507 |
| 340 | Ga0310101_100049 | 3300031690 | Bacteria | 5835 |
| 341 | Ga0307405_10069202 | 3300031731 | Bacteria | 2262 |
| 342 | Ga0307412_10000379 | 3300031911 | Bacteria | 27722 |
| 343 | Ga0307416_100283373 | 3300032002 | Bacteria | 1635 |
| 344 | Ga0307510_10056925 | 3300033180 | Bacteria | 4065 |
| 345 | Ga0316212_1001582 | 3300033547 | Bacteria | 3124 |
| 346 | Ga0373950_0002274 | 3300034818 | Bacteria | 2629 |
| 347 | Ga0373934_0000017 | 3300035086 | Bacteria | 57564 |
| 348 | Ga0373923_0025208 | 3300035111 | Bacteria | 2355 |
| 349 | Ga0373932_0000563 | 3300035112 | Bacteria | 11404 |
| 350 | Ga0373936_0001925 | 3300035113 | Bacteria | 7674 |
| 351 | Ga0373939_0008792 | 3300035114 | Bacteria | 2486 |
| 352 | Ga0373953_0000194 | 3300035117 | Bacteria | 16326 |
| 353 | Ga0373953_0010437 | 3300035117 | Bacteria | 3232 |
| 354 | Ga0373953_0044858 | 3300035117 | Bacteria | 1769 |
| 355 | Ga0373954_0000001 | 3300035118 | Bacteria | 158201 |
| 356 | Ga0373954_0000069 | 3300035118 | Bacteria | 36407 |
| 357 | Ga0373956_0000051 | 3300035119 | Bacteria | 39623 |
| 358 | Ga0373957_0000091 | 3300035120 | Bacteria | 21490 |
| 359 | Ga0373957_0008190 | 3300035120 | Bacteria | 3376 |
| 360 | Ga0373957_0072435 | 3300035120 | Bacteria | 1349 |
| 361 | Ga0373960_0001894 | 3300035121 | Bacteria | 4681 |
| 362 | Ga0373960_0002703 | 3300035121 | Bacteria | 4011 |
| 363 | Ga0373955_0000052 | 3300035172 | Bacteria | 45053 |
| 364 | Ga0373955_0008303 | 3300035172 | Bacteria | 4817 |
| 365 | Ga0373955_0044927 | 3300035172 | Bacteria | 2382 |
| 366 | Ga0373955_0142475 | 3300035172 | Bacteria | 1406 |
| 367 | Ga0373961_0048930 | 3300035241 | Bacteria | 1247 |
| 368 | Ga0373924_0003287 | 3300035410 | Bacteria | 5534 |
| 369 | Ga0373924_0024408 | 3300035410 | Bacteria | 2382 |
| 370 | Ga0373931_0020189 | 3300035691 | Bacteria | 3331 |
| 371 | Ga0373931_0032358 | 3300035691 | Bacteria | 2706 |
| 372 | Ga0373931_0058873 | 3300035691 | Bacteria | 2065 |
| 373 | Ga0373935_0016067 | 3300035692 | Bacteria | 4529 |
| 374 | Ga0373935_0068474 | 3300035692 | Bacteria | 2284 |
| 375 | Ga0373933_0000016 | 3300035724 | Bacteria | 102539 |
| 376 | Ga0373933_0013663 | 3300035724 | Bacteria | 4503 |
| 377 | Ga0373933_0015808 | 3300035724 | Bacteria | 4211 |
| 378 | Ga0373947_0033189 | 3300035725 | Bacteria | 3045 |
| 379 | Ga0373947_0075388 | 3300035725 | Bacteria | 2077 |
| 380 | Ga0310104_01376 | 3300036242 | Bacteria | 1932 |
| 381 | Ga0373937_0000002 | 3300036401 | Bacteria | 304133 |
| 382 | Ga0373937_0000524 | 3300036401 | Bacteria | 34277 |
| 383 | Ga0373937_0008427 | 3300036401 | Bacteria | 8961 |
| 384 | Ga0373937_0081963 | 3300036401 | Bacteria | 2984 |
| 385 | Ga0373937_0240507 | 3300036401 | Bacteria | 1705 |
| 386 | Ga0265778_003628 | 3300036457 | Bacteria | 1563 |
| 387 | Ga0372808_000590 | 3300036459 | Bacteria | 3041 |
| 388 | Ga0373925_0002973 | 3300037068 | Bacteria | 13381 |
| 389 | Ga0373925_0038922 | 3300037068 | Bacteria | 3517 |
| 390 | Ga0373925_0056967 | 3300037068 | Bacteria | 2928 |
| 391 | Ga0395905_0000984 | 3300037471 | Bacteria | 36542 |
| 392 | Ga0395905_0008120 | 3300037471 | Bacteria | 10371 |
| 393 | Ga0395905_0010331 | 3300037471 | Bacteria | 9086 |
| 394 | Ga0395905_0014948 | 3300037471 | Bacteria | 7404 |
| 395 | Ga0395905_0023217 | 3300037471 | Bacteria | 5863 |
| 396 | Ga0395901_0000712 | 3300038443 | Bacteria | 38055 |
| 397 | Ga0439438_005210 | 3300041405 | Bacteria | 4825 |
| 398 | Ga0439438_006473 | 3300041405 | Bacteria | 4123 |
| 399 | Ga0439438_015019 | 3300041405 | Bacteria | 2289 |
| 400 | Ga0439438_025024 | 3300041405 | Bacteria | 1630 |
| 401 | Ga0439447_000054 | 3300041407 | Bacteria | 39346 |
| 402 | Ga0439447_000206 | 3300041407 | Bacteria | 20774 |
| 403 | Ga0439447_029945 | 3300041407 | Bacteria | 1374 |
| 404 | Ga0439466_0000143 | 3300041411 | Bacteria | 28417 |
| 405 | Ga0439466_0003392 | 3300041411 | Bacteria | 6191 |
| 406 | Ga0439466_0011793 | 3300041411 | Bacteria | 3228 |
| 407 | Ga0439466_0012660 | 3300041411 | Bacteria | 3101 |
| 408 | Ga0439466_0016042 | 3300041411 | Bacteria | 2712 |
| 409 | Ga0451853_1055566 | 3300041512 | Bacteria | 1524 |
| 410 | Ga0439432_004568 | 3300042006 | Bacteria | 5051 |
| 411 | Ga0439432_006475 | 3300042006 | Bacteria | 4179 |
| 412 | Ga0439432_009250 | 3300042006 | Bacteria | 3441 |
| 413 | Ga0439451_003063 | 3300042009 | Bacteria | 3395 |
| 414 | Ga0439451_009101 | 3300042009 | Bacteria | 2011 |
| 415 | Ga0439452_000093 | 3300042010 | Bacteria | 77343 |
| 416 | Ga0439452_000367 | 3300042010 | Bacteria | 27474 |
| 417 | Ga0439452_001126 | 3300042010 | Bacteria | 11711 |
| 418 | Ga0439456_000030 | 3300042013 | Bacteria | 53580 |
| 419 | Ga0439456_000117 | 3300042013 | Bacteria | 25268 |
| 420 | Ga0439456_000837 | 3300042013 | Bacteria | 6231 |
| 421 | Ga0439456_003252 | 3300042013 | Bacteria | 3284 |
| 422 | Ga0439456_004872 | 3300042013 | Bacteria | 2721 |
| 423 | Ga0439463_000126 | 3300042016 | Bacteria | 19039 |
| 424 | Ga0439463_001094 | 3300042016 | Bacteria | 7314 |
| 425 | Ga0450911_002925 | 3300042115 | Bacteria | 3168 |
| 426 | Ga0450911_011460 | 3300042115 | Bacteria | 1212 |
| 427 | Ga0450920_001158 | 3300042122 | Bacteria | 4324 |
| 428 | Ga0450923_004969 | 3300042125 | Bacteria | 2120 |
| 429 | Ga0450902_007853 | 3300042137 | Bacteria | 1658 |
| 430 | Ga0450905_004220 | 3300042142 | Bacteria | 1898 |
| 431 | Ga0450907_000001 | 3300042146 | Bacteria | 236562 |
| 432 | Ga0450907_005703 | 3300042146 | Bacteria | 2097 |
| 433 | Ga0450910_000649 | 3300042147 | Bacteria | 4145 |
| 434 | Ga0450909_000083 | 3300042185 | Bacteria | 8784 |
| 435 | Ga0439434_0000128 | 3300042435 | Bacteria | 20331 |
| 436 | Ga0439460_0000010 | 3300042461 | Bacteria | 27637 |
| 437 | Ga0439460_0006534 | 3300042461 | Bacteria | 2898 |
| 438 | Ga0439460_0027435 | 3300042461 | Bacteria | 1599 |
| 439 | Ga0451577_0039033 | 3300042876 | Bacteria | 4267 |
| 440 | Ga0439440_0013509 | 3300042993 | Bacteria | 1752 |
| 441 | Ga0466961_0052250 | 3300044693 | Bacteria | 2608 |
| 442 | Ga0451576_0000220 | 3300045051 | Bacteria | 141261 |
| 443 | Ga0451576_0046200 | 3300045051 | Bacteria | 4585 |
| 444 | Ga0451576_0197594 | 3300045051 | Bacteria | 2101 |
| 445 | Ga0495617_000425 | 3300046452 | Bacteria | 22835 |
| 446 | Ga0495617_001744 | 3300046452 | Bacteria | 9292 |
| 447 | Ga0495617_002378 | 3300046452 | Bacteria | 7505 |
| 448 | Ga0495617_002732 | 3300046452 | Bacteria | 6820 |
| 449 | Ga0495617_010764 | 3300046452 | Bacteria | 3131 |
| 450 | Ga0495617_021005 | 3300046452 | Bacteria | 2206 |
| 451 | Ga0495627_003164 | 3300046453 | Bacteria | 7427 |
| 452 | Ga0495627_005040 | 3300046453 | Bacteria | 5401 |
| 453 | Ga0495627_008940 | 3300046453 | Bacteria | 3707 |
| 454 | Ga0495627_012468 | 3300046453 | Bacteria | 3015 |
| 455 | Ga0495627_037629 | 3300046453 | Bacteria | 1500 |
| 456 | Ga0495592_0000056 | 3300046454 | Bacteria | 103131 |
| 457 | Ga0495592_0000330 | 3300046454 | Bacteria | 39376 |
| 458 | Ga0495603_0003252 | 3300046455 | Bacteria | 9680 |
| 459 | Ga0495590_0000677 | 3300046457 | Bacteria | 15687 |
| 460 | Ga0495590_0002380 | 3300046457 | Bacteria | 7795 |
| 461 | Ga0495590_0002726 | 3300046457 | Bacteria | 7298 |
| 462 | Ga0495590_0008154 | 3300046457 | Bacteria | 4010 |
| 463 | Ga0495590_0010941 | 3300046457 | Bacteria | 3400 |
| 464 | Ga0495590_0025951 | 3300046457 | Bacteria | 2058 |
| 465 | Ga0495591_000026 | 3300046458 | Bacteria | 187482 |
| 466 | Ga0495591_000499 | 3300046458 | Bacteria | 30966 |
| 467 | Ga0495591_000915 | 3300046458 | Bacteria | 20433 |
| 468 | Ga0495591_002276 | 3300046458 | Bacteria | 10887 |
| 469 | Ga0495591_005335 | 3300046458 | Bacteria | 5977 |
| 470 | Ga0495591_006389 | 3300046458 | Bacteria | 5218 |
| 471 | Ga0495591_007541 | 3300046458 | Bacteria | 4609 |
| 472 | Ga0495591_012460 | 3300046458 | Bacteria | 3166 |
| 473 | Ga0495591_019631 | 3300046458 | Bacteria | 2256 |
| 474 | Ga0495629_0034369 | 3300046459 | Bacteria | 3584 |
| 475 | Ga0495638_0000254 | 3300046460 | Bacteria | 72287 |
| 476 | Ga0495638_0002304 | 3300046460 | Bacteria | 15735 |
| 477 | Ga0495638_0002318 | 3300046460 | Bacteria | 15686 |
| 478 | Ga0495638_0004186 | 3300046460 | Bacteria | 10994 |
| 479 | Ga0495638_0004386 | 3300046460 | Bacteria | 10683 |
| 480 | Ga0495638_0008079 | 3300046460 | Bacteria | 7487 |
| 481 | Ga0495638_0013280 | 3300046460 | Bacteria | 5615 |
| 482 | Ga0495638_0016546 | 3300046460 | Bacteria | 4936 |
| 483 | Ga0495638_0017277 | 3300046460 | Bacteria | 4815 |
| 484 | Ga0495638_0025621 | 3300046460 | Bacteria | 3830 |
| 485 | Ga0495641_0034009 | 3300046461 | Bacteria | 2413 |
| 486 | Ga0495651_0000030 | 3300046462 | Bacteria | 103731 |
| 487 | Ga0495651_0057613 | 3300046462 | Bacteria | 2982 |
| 488 | Ga0495651_0133644 | 3300046462 | Bacteria | 1808 |
| 489 | Ga0495651_0149260 | 3300046462 | Bacteria | 1687 |
| 490 | Ga0495653_0028463 | 3300046463 | Bacteria | 4467 |
| 491 | Ga0495653_0129498 | 3300046463 | Bacteria | 1788 |
| 492 | Ga0495650_0001066 | 3300046471 | Bacteria | 30414 |
| 493 | Ga0495650_0013191 | 3300046471 | Bacteria | 4387 |
| 494 | Ga0495650_0050198 | 3300046471 | Bacteria | 1726 |
| 495 | Ga0495580_0010521 | 3300046472 | Bacteria | 7202 |
| 496 | Ga0495582_0001227 | 3300046473 | Bacteria | 14440 |
| 497 | Ga0495582_0006421 | 3300046473 | Bacteria | 6532 |
| 498 | Ga0495605_0000795 | 3300046474 | Bacteria | 22638 |
| 499 | Ga0495605_0001420 | 3300046474 | Bacteria | 15704 |
| 500 | Ga0495605_0003274 | 3300046474 | Bacteria | 9715 |
| 501 | Ga0495605_0003912 | 3300046474 | Bacteria | 8818 |
| 502 | Ga0495605_0005597 | 3300046474 | Bacteria | 7303 |
| 503 | Ga0495605_0044311 | 3300046474 | Bacteria | 2200 |
| 504 | Ga0495639_0000066 | 3300046475 | Bacteria | 48162 |
| 505 | Ga0495639_0004578 | 3300046475 | Bacteria | 5930 |
| 506 | Ga0495639_0024326 | 3300046475 | Bacteria | 2666 |
| 507 | Ga0495662_0002709 | 3300046476 | Bacteria | 8957 |
| 508 | Ga0495662_0011600 | 3300046476 | Bacteria | 4307 |
| 509 | Ga0495662_0032459 | 3300046476 | Bacteria | 2522 |
| 510 | Ga0495664_0002738 | 3300046477 | Bacteria | 9480 |
| 511 | Ga0495664_0010138 | 3300046477 | Bacteria | 5286 |
| 512 | Ga0495584_0000630 | 3300046491 | Bacteria | 23568 |
| 513 | Ga0495584_0001440 | 3300046491 | Bacteria | 14327 |
| 514 | Ga0495584_0004480 | 3300046491 | Bacteria | 7509 |
| 515 | Ga0495584_0004532 | 3300046491 | Bacteria | 7460 |
| 516 | Ga0495584_0005166 | 3300046491 | Bacteria | 6929 |
| 517 | Ga0495585_0000045 | 3300046492 | Bacteria | 123148 |
| 518 | Ga0495585_0001462 | 3300046492 | Bacteria | 18495 |
| 519 | Ga0495585_0003534 | 3300046492 | Bacteria | 10511 |
| 520 | Ga0495585_0005180 | 3300046492 | Bacteria | 8275 |
| 521 | Ga0495585_0006541 | 3300046492 | Bacteria | 7213 |
| 522 | Ga0495594_0003358 | 3300046499 | Bacteria | 8273 |
| 523 | Ga0495594_0038051 | 3300046499 | Bacteria | 2626 |
| 524 | Ga0495596_0000003 | 3300046500 | Bacteria | 186592 |
| 525 | Ga0495607_0000241 | 3300046501 | Bacteria | 58506 |
| 526 | Ga0495607_0001818 | 3300046501 | Bacteria | 18203 |
| 527 | Ga0495607_0007319 | 3300046501 | Bacteria | 7652 |
| 528 | Ga0495607_0011379 | 3300046501 | Bacteria | 5925 |
| 529 | Ga0495607_0012340 | 3300046501 | Bacteria | 5647 |
| 530 | Ga0495607_0020210 | 3300046501 | Bacteria | 4215 |
| 531 | Ga0495607_0028823 | 3300046501 | Bacteria | 3420 |
| 532 | Ga0495607_0041117 | 3300046501 | Bacteria | 2747 |
| 533 | Ga0495583_0000112 | 3300046506 | Bacteria | 138078 |
| 534 | Ga0495583_0000852 | 3300046506 | Bacteria | 37144 |
| 535 | Ga0495583_0001196 | 3300046506 | Bacteria | 27887 |
| 536 | Ga0495583_0001574 | 3300046506 | Bacteria | 22541 |
| 537 | Ga0495583_0001954 | 3300046506 | Bacteria | 18966 |
| 538 | Ga0495583_0022908 | 3300046506 | Bacteria | 3174 |
| 539 | Ga0495606_0000859 | 3300046507 | Bacteria | 45541 |
| 540 | Ga0495606_0000965 | 3300046507 | Bacteria | 42060 |
| 541 | Ga0495606_0001256 | 3300046507 | Bacteria | 35407 |
| 542 | Ga0495606_0001732 | 3300046507 | Bacteria | 28027 |
| 543 | Ga0495606_0003336 | 3300046507 | Bacteria | 17133 |
| 544 | Ga0495606_0009598 | 3300046507 | Bacteria | 8156 |
| 545 | Ga0495606_0015723 | 3300046507 | Bacteria | 5811 |
| 546 | Ga0495606_0034292 | 3300046507 | Bacteria | 3486 |
| 547 | Ga0495608_0000077 | 3300046511 | Bacteria | 73664 |
| 548 | Ga0495608_0002611 | 3300046511 | Bacteria | 12950 |
| 549 | Ga0495608_0043482 | 3300046511 | Bacteria | 3001 |
| 550 | Ga0495608_0058428 | 3300046511 | Bacteria | 2542 |
| 551 | Ga0495610_0003348 | 3300046512 | Bacteria | 12573 |
| 552 | Ga0495610_0004992 | 3300046512 | Bacteria | 9607 |
| 553 | Ga0495610_0016729 | 3300046512 | Bacteria | 4210 |
| 554 | Ga0495610_0017366 | 3300046512 | Bacteria | 4105 |
| 555 | Ga0495610_0023980 | 3300046512 | Bacteria | 3302 |
| 556 | Ga0495610_0037220 | 3300046512 | Bacteria | 2478 |
| 557 | Ga0495610_0094473 | 3300046512 | Bacteria | 1350 |
| 558 | Ga0495610_0113156 | 3300046512 | Bacteria | 1199 |
| 559 | Ga0495616_0001522 | 3300046513 | Bacteria | 15979 |
| 560 | Ga0495616_0007524 | 3300046513 | Bacteria | 6519 |
| 561 | Ga0495616_0118897 | 3300046513 | Bacteria | 1222 |
| 562 | Ga0495618_0073232 | 3300046514 | Bacteria | 2180 |
| 563 | Ga0495620_0000004 | 3300046515 | Bacteria | 344148 |
| 564 | Ga0495620_0000485 | 3300046515 | Bacteria | 25809 |
| 565 | Ga0495620_0002638 | 3300046515 | Bacteria | 10366 |
| 566 | Ga0495620_0015249 | 3300046515 | Bacteria | 3883 |
| 567 | Ga0495620_0023779 | 3300046515 | Bacteria | 2923 |
| 568 | Ga0495620_0027607 | 3300046515 | Bacteria | 2653 |
| 569 | Ga0495620_0029308 | 3300046515 | Bacteria | 2548 |
| 570 | Ga0495628_0000120 | 3300046516 | Bacteria | 64630 |
| 571 | Ga0495628_0021492 | 3300046516 | Bacteria | 5307 |
| 572 | Ga0495628_0027636 | 3300046516 | Bacteria | 4613 |
| 573 | Ga0495630_0002554 | 3300046517 | Bacteria | 12627 |
| 574 | Ga0495630_0003463 | 3300046517 | Bacteria | 10970 |
| 575 | Ga0495630_0004509 | 3300046517 | Bacteria | 9756 |
| 576 | Ga0495630_0007382 | 3300046517 | Bacteria | 7853 |
| 577 | Ga0495630_0014580 | 3300046517 | Bacteria | 5728 |
| 578 | Ga0495631_0000104 | 3300046518 | Bacteria | 55509 |
| 579 | Ga0495631_0010133 | 3300046518 | Bacteria | 4678 |
| 580 | Ga0495631_0018918 | 3300046518 | Bacteria | 3236 |
| 581 | Ga0495632_0000473 | 3300046519 | Bacteria | 38161 |
| 582 | Ga0495632_0000693 | 3300046519 | Bacteria | 30620 |
| 583 | Ga0495632_0001233 | 3300046519 | Bacteria | 21692 |
| 584 | Ga0495632_0001717 | 3300046519 | Bacteria | 17810 |
| 585 | Ga0495632_0008389 | 3300046519 | Bacteria | 6347 |
| 586 | Ga0495632_0009996 | 3300046519 | Bacteria | 5659 |
| 587 | Ga0495632_0011383 | 3300046519 | Bacteria | 5192 |
| 588 | Ga0495632_0014286 | 3300046519 | Bacteria | 4496 |
| 589 | Ga0495632_0016412 | 3300046519 | Bacteria | 4121 |
| 590 | Ga0495632_0025080 | 3300046519 | Bacteria | 3157 |
| 591 | Ga0495632_0027916 | 3300046519 | Bacteria | 2950 |
| 592 | Ga0495637_0000102 | 3300046520 | Bacteria | 63398 |
| 593 | Ga0495637_0000483 | 3300046520 | Bacteria | 29026 |
| 594 | Ga0495637_0000824 | 3300046520 | Bacteria | 20474 |
| 595 | Ga0495637_0000943 | 3300046520 | Bacteria | 18591 |
| 596 | Ga0495637_0001052 | 3300046520 | Bacteria | 17277 |
| 597 | Ga0495637_0002047 | 3300046520 | Bacteria | 11338 |
| 598 | Ga0495637_0012730 | 3300046520 | Bacteria | 4014 |
| 599 | Ga0495637_0038315 | 3300046520 | Bacteria | 2076 |
| 600 | Ga0495643_0000128 | 3300046522 | Bacteria | 122550 |
| 601 | Ga0495643_0019208 | 3300046522 | Bacteria | 3957 |
| 602 | Ga0495643_0023004 | 3300046522 | Bacteria | 3547 |
| 603 | Ga0495643_0023868 | 3300046522 | Bacteria | 3472 |
| 604 | Ga0495643_0035835 | 3300046522 | Bacteria | 2730 |
| 605 | Ga0495643_0056104 | 3300046522 | Bacteria | 2103 |
| 606 | Ga0495644_0000285 | 3300046523 | Bacteria | 23359 |
| 607 | Ga0495644_0003043 | 3300046523 | Bacteria | 6634 |
| 608 | Ga0495644_0005804 | 3300046523 | Bacteria | 4822 |
| 609 | Ga0495644_0011600 | 3300046523 | Bacteria | 3393 |
| 610 | Ga0495648_0000301 | 3300046524 | Bacteria | 54913 |
| 611 | Ga0495648_0001018 | 3300046524 | Bacteria | 28686 |
| 612 | Ga0495648_0001295 | 3300046524 | Bacteria | 24874 |
| 613 | Ga0495648_0001927 | 3300046524 | Bacteria | 19765 |
| 614 | Ga0495648_0002616 | 3300046524 | Bacteria | 16438 |
| 615 | Ga0495648_0014316 | 3300046524 | Bacteria | 5814 |
| 616 | Ga0495648_0015794 | 3300046524 | Bacteria | 5461 |
| 617 | Ga0495648_0032867 | 3300046524 | Bacteria | 3396 |
| 618 | Ga0495648_0080573 | 3300046524 | Bacteria | 1854 |
| 619 | Ga0495648_0123537 | 3300046524 | Bacteria | 1387 |
| 620 | Ga0495666_0000163 | 3300046526 | Bacteria | 28111 |
| 621 | Ga0495666_0004702 | 3300046526 | Bacteria | 6904 |
| 622 | Ga0495666_0009551 | 3300046526 | Bacteria | 4847 |
| 623 | Ga0495666_0028616 | 3300046526 | Bacteria | 2741 |
| 624 | Ga0495642_0000003 | 3300046528 | Bacteria | 185425 |
| 625 | Ga0495642_0003045 | 3300046528 | Bacteria | 6673 |
| 626 | Ga0495652_0000297 | 3300046529 | Bacteria | 59110 |
| 627 | Ga0495652_0026304 | 3300046529 | Bacteria | 5141 |
| 628 | Ga0495652_0043207 | 3300046529 | Bacteria | 3884 |
| 629 | Ga0495652_0144404 | 3300046529 | Bacteria | 1867 |
| 630 | Ga0495652_0269986 | 3300046529 | Bacteria | 1251 |
| 631 | Ga0495652_0306816 | 3300046529 | Bacteria | 1151 |
| 632 | Ga0495654_0004030 | 3300046530 | Bacteria | 8825 |
| 633 | Ga0495654_0006833 | 3300046530 | Bacteria | 6437 |
| 634 | Ga0495654_0026823 | 3300046530 | Bacteria | 2958 |
| 635 | Ga0495654_0082479 | 3300046530 | Bacteria | 1504 |
| 636 | Ga0495654_0095589 | 3300046530 | Bacteria | 1373 |
| 637 | Ga0495665_0005625 | 3300046531 | Bacteria | 6757 |
| 638 | Ga0495640_0003960 | 3300046533 | Bacteria | 11865 |
| 639 | Ga0495640_0037485 | 3300046533 | Bacteria | 3419 |
| 640 | Ga0495586_0003796 | 3300046535 | Bacteria | 8096 |
| 641 | Ga0495586_0004296 | 3300046535 | Bacteria | 7613 |
| 642 | Ga0495586_0005646 | 3300046535 | Bacteria | 6686 |
| 643 | Ga0495586_0081236 | 3300046535 | Bacteria | 1781 |
| 644 | Ga0495587_0000075 | 3300046536 | Bacteria | 78307 |
| 645 | Ga0495587_0007213 | 3300046536 | Bacteria | 7211 |
| 646 | Ga0495587_0035238 | 3300046536 | Bacteria | 3015 |
| 647 | Ga0495587_0072469 | 3300046536 | Bacteria | 2002 |
| 648 | Ga0495587_0088047 | 3300046536 | Bacteria | 1796 |
| 649 | Ga0495609_0000189 | 3300046538 | Bacteria | 61810 |
| 650 | Ga0495609_0000409 | 3300046538 | Bacteria | 35874 |
| 651 | Ga0495609_0005295 | 3300046538 | Bacteria | 6833 |
| 652 | Ga0495597_0001707 | 3300046542 | Bacteria | 15219 |
| 653 | Ga0495597_0003434 | 3300046542 | Bacteria | 9256 |
| 654 | Ga0495597_0017476 | 3300046542 | Bacteria | 3374 |
| 655 | Ga0495597_0054520 | 3300046542 | Bacteria | 1755 |
| 656 | Ga0495645_0012825 | 3300046543 | Bacteria | 5915 |
| 657 | Ga0495645_0014105 | 3300046543 | Bacteria | 5663 |
| 658 | Ga0495645_0018312 | 3300046543 | Bacteria | 5029 |
| 659 | Ga0495645_0078639 | 3300046543 | Bacteria | 2370 |
| 660 | Ga0495645_0142020 | 3300046543 | Bacteria | 1674 |
| 661 | Ga0495645_0148628 | 3300046543 | Bacteria | 1630 |
| 662 | Ga0495622_0000193 | 3300046557 | Bacteria | 48480 |
| 663 | Ga0495622_0016235 | 3300046557 | Bacteria | 3467 |
| 664 | Ga0495622_0016666 | 3300046557 | Bacteria | 3422 |
| 665 | Ga0495622_0021906 | 3300046557 | Bacteria | 2976 |
| 666 | Ga0495622_0096014 | 3300046557 | Bacteria | 1360 |
| 667 | Ga0495633_0145698 | 3300046558 | Bacteria | 1094 |
| 668 | Ga0495667_0000056 | 3300046559 | Bacteria | 102782 |
| 669 | Ga0495667_0004685 | 3300046559 | Bacteria | 9245 |
| 670 | Ga0495656_0002117 | 3300046615 | Bacteria | 6558 |
| 671 | Ga0495668_0000254 | 3300046616 | Bacteria | 76101 |
| 672 | Ga0495668_0041345 | 3300046616 | Bacteria | 2568 |
| 673 | Ga0495668_0093347 | 3300046616 | Bacteria | 1648 |
| 674 | Ga0495634_0002041 | 3300046642 | Bacteria | 17137 |
| 675 | Ga0495634_0019053 | 3300046642 | Bacteria | 4878 |
| 676 | Ga0495634_0024309 | 3300046642 | Bacteria | 4251 |
| 677 | Ga0495634_0108138 | 3300046642 | Bacteria | 1790 |
| 678 | Ga0495611_0000633 | 3300046648 | Bacteria | 20220 |
| 679 | Ga0495611_0011930 | 3300046648 | Bacteria | 3690 |
| 680 | Ga0495625_0000010 | 3300046660 | Bacteria | 381775 |
| 681 | Ga0495625_0001700 | 3300046660 | Bacteria | 25633 |
| 682 | Ga0495625_0003117 | 3300046660 | Bacteria | 16940 |
| 683 | Ga0495625_0004195 | 3300046660 | Bacteria | 13731 |
| 684 | Ga0495625_0004359 | 3300046660 | Bacteria | 13437 |
| 685 | Ga0495625_0012444 | 3300046660 | Bacteria | 6894 |
| 686 | Ga0495625_0078851 | 3300046660 | Bacteria | 2299 |
| 687 | Ga0495625_0087652 | 3300046660 | Bacteria | 2157 |
| 688 | Ga0495635_0001785 | 3300046663 | Bacteria | 14532 |
| 689 | Ga0495635_0023460 | 3300046663 | Bacteria | 4299 |
| 690 | Ga0495635_0038688 | 3300046663 | Bacteria | 3301 |
| 691 | Ga0495659_0000151 | 3300046664 | Bacteria | 30611 |
| 692 | Ga0495659_0000208 | 3300046664 | Bacteria | 25391 |
| 693 | Ga0495661_0000182 | 3300046665 | Bacteria | 72480 |
| 694 | Ga0495661_0011300 | 3300046665 | Bacteria | 6060 |
| 695 | Ga0495661_0014671 | 3300046665 | Bacteria | 5246 |
| 696 | Ga0495661_0024815 | 3300046665 | Bacteria | 3880 |
| 697 | Ga0495661_0027668 | 3300046665 | Bacteria | 3637 |
| 698 | Ga0495661_0060901 | 3300046665 | Bacteria | 2241 |
| 699 | Ga0495588_0019978 | 3300046674 | Bacteria | 3286 |
| 700 | Ga0495588_0022337 | 3300046674 | Bacteria | 3126 |
| 701 | Ga0495657_0000045 | 3300046675 | Bacteria | 106756 |
| 702 | Ga0495657_0020203 | 3300046675 | Bacteria | 4791 |
| 703 | Ga0495657_0052437 | 3300046675 | Bacteria | 2734 |
| 704 | Ga0495657_0148134 | 3300046675 | Bacteria | 1459 |
| 705 | Ga0495599_0000106 | 3300046678 | Bacteria | 56337 |
| 706 | Ga0495599_0004282 | 3300046678 | Bacteria | 8437 |
| 707 | Ga0495599_0086441 | 3300046678 | Bacteria | 1958 |
| 708 | Ga0495623_0000674 | 3300046679 | Bacteria | 22684 |
| 709 | Ga0495623_0001572 | 3300046679 | Bacteria | 15374 |
| 710 | Ga0495623_0030734 | 3300046679 | Bacteria | 3455 |
| 711 | Ga0495623_0032522 | 3300046679 | Bacteria | 3352 |
| 712 | Ga0495623_0047017 | 3300046679 | Bacteria | 2738 |
| 713 | Ga0495623_0161329 | 3300046679 | Bacteria | 1317 |
| 714 | Ga0495646_0001199 | 3300046680 | Bacteria | 15175 |
| 715 | Ga0495646_0002149 | 3300046680 | Bacteria | 11978 |
| 716 | Ga0495646_0018596 | 3300046680 | Bacteria | 4399 |
| 717 | Ga0495646_0019756 | 3300046680 | Bacteria | 4259 |
| 718 | Ga0495647_0000474 | 3300046681 | Bacteria | 11658 |
| 719 | Ga0495658_0004259 | 3300046683 | Bacteria | 7038 |
| 720 | Ga0495658_0009663 | 3300046683 | Bacteria | 4809 |
| 721 | Ga0495658_0021039 | 3300046683 | Bacteria | 3434 |
| 722 | Ga0495669_0009589 | 3300046684 | Bacteria | 4085 |
| 723 | Ga0495613_0008194 | 3300046689 | Bacteria | 7765 |
| 724 | Ga0495613_0008905 | 3300046689 | Bacteria | 7448 |
| 725 | Ga0495613_0014663 | 3300046689 | Bacteria | 5815 |
| 726 | Ga0495613_0016259 | 3300046689 | Bacteria | 5544 |
| 727 | Ga0495624_0006236 | 3300046690 | Bacteria | 8479 |
| 728 | Ga0495624_0016557 | 3300046690 | Bacteria | 4962 |
| 729 | Ga0495670_0000882 | 3300046691 | Bacteria | 14538 |
| 730 | Ga0495670_0002639 | 3300046691 | Bacteria | 8847 |
| 731 | Ga0495670_0004971 | 3300046691 | Bacteria | 6532 |
| 732 | Ga0495670_0011771 | 3300046691 | Bacteria | 4306 |
| 733 | Ga0495670_0104524 | 3300046691 | Bacteria | 1461 |
| 734 | Ga0495671_0000066 | 3300046692 | Bacteria | 105167 |
| 735 | Ga0495671_0003008 | 3300046692 | Bacteria | 10479 |
| 736 | Ga0495671_0004245 | 3300046692 | Bacteria | 8622 |
| 737 | Ga0495671_0006004 | 3300046692 | Bacteria | 7059 |
| 738 | Ga0495671_0009195 | 3300046692 | Bacteria | 5524 |
| 739 | Ga0495671_0020596 | 3300046692 | Bacteria | 3474 |
| 740 | Ga0495671_0025192 | 3300046692 | Bacteria | 3093 |
| 741 | Ga0495671_0037451 | 3300046692 | Bacteria | 2452 |
| 742 | Ga0495671_0109443 | 3300046692 | Bacteria | 1349 |
| 743 | Ga0495649_0001403 | 3300046694 | Bacteria | 18185 |
| 744 | Ga0495649_0005704 | 3300046694 | Bacteria | 7858 |
| 745 | Ga0495649_0005926 | 3300046694 | Bacteria | 7662 |
| 746 | Ga0495649_0019563 | 3300046694 | Bacteria | 3803 |
| 747 | Ga0495649_0025613 | 3300046694 | Bacteria | 3285 |
| 748 | Ga0495649_0110820 | 3300046694 | Bacteria | 1455 |
| 749 | Ga0495589_0001111 | 3300046794 | Bacteria | 16037 |
| 750 | Ga0495589_0001801 | 3300046794 | Bacteria | 12173 |
| 751 | Ga0495589_0002404 | 3300046794 | Bacteria | 10518 |
| 752 | Ga0495589_0009273 | 3300046794 | Bacteria | 5118 |
| 753 | Ga0495589_0026410 | 3300046794 | Bacteria | 2941 |
| 754 | Ga0495600_0001294 | 3300046809 | Bacteria | 13824 |
| 755 | Ga0495600_0001473 | 3300046809 | Bacteria | 13058 |
| 756 | Ga0495660_0005010 | 3300046810 | Bacteria | 7967 |
| 757 | Ga0495660_0006706 | 3300046810 | Bacteria | 6800 |
| 758 | Ga0495660_0007268 | 3300046810 | Bacteria | 6516 |
| 759 | Ga0495660_0010558 | 3300046810 | Bacteria | 5371 |
| 760 | Ga0495660_0013785 | 3300046810 | Bacteria | 4684 |
| 761 | Ga0495660_0017885 | 3300046810 | Bacteria | 4077 |
| 762 | Ga0495660_0052712 | 3300046810 | Bacteria | 2209 |
| 763 | Ga0495660_0053473 | 3300046810 | Bacteria | 2191 |
| 764 | Ga0495660_0086256 | 3300046810 | Bacteria | 1639 |
| 765 | Ga0495581_0006217 | 3300047315 | Bacteria | 6927 |
| 766 | Ga0495604_0000016 | 3300047317 | Bacteria | 193985 |
| 767 | Ga0495604_0004964 | 3300047317 | Bacteria | 10549 |
| 768 | Ga0495604_0039758 | 3300047317 | Bacteria | 3695 |
| 769 | Ga0495604_0040089 | 3300047317 | Bacteria | 3678 |
| 770 | Ga0495674_0001800 | 3300047319 | Bacteria | 21108 |
| 771 | Ga0495674_0017019 | 3300047319 | Bacteria | 6776 |
| 772 | Ga0495674_0081363 | 3300047319 | Bacteria | 2778 |
| 773 | Ga0495674_0184367 | 3300047319 | Bacteria | 1737 |
| 774 | Ga0495672_0001364 | 3300047320 | Bacteria | 24203 |
| 775 | Ga0495672_0001957 | 3300047320 | Bacteria | 19472 |
| 776 | Ga0495672_0002436 | 3300047320 | Bacteria | 17130 |
| 777 | Ga0495672_0006368 | 3300047320 | Bacteria | 9169 |
| 778 | Ga0495672_0009024 | 3300047320 | Bacteria | 7271 |
| 779 | Ga0495672_0014737 | 3300047320 | Bacteria | 5335 |
| 780 | Ga0495672_0033766 | 3300047320 | Bacteria | 3167 |
| 781 | Ga0495672_0037476 | 3300047320 | Bacteria | 2966 |
| 782 | Ga0495672_0039515 | 3300047320 | Bacteria | 2868 |
| 783 | Ga0495676_0000002 | 3300047321 | Bacteria | 373918 |
| 784 | Ga0495676_0063417 | 3300047321 | Bacteria | 2880 |
| 785 | Ga0495680_0000022 | 3300047322 | Bacteria | 117753 |
| 786 | Ga0495680_0001752 | 3300047322 | Bacteria | 23001 |
| 787 | Ga0495680_0002108 | 3300047322 | Bacteria | 20662 |
| 788 | Ga0495680_0004609 | 3300047322 | Bacteria | 13139 |
| 789 | Ga0495680_0028538 | 3300047322 | Bacteria | 4574 |
| 790 | Ga0495680_0045334 | 3300047322 | Bacteria | 3471 |
| 791 | Ga0495680_0051266 | 3300047322 | Bacteria | 3223 |
| 792 | Ga0495680_0073283 | 3300047322 | Bacteria | 2602 |
| 793 | Ga0495683_0000199 | 3300047323 | Bacteria | 56834 |
| 794 | Ga0495683_0000215 | 3300047323 | Bacteria | 54712 |
| 795 | Ga0495683_0006864 | 3300047323 | Bacteria | 6187 |
| 796 | Ga0495683_0018932 | 3300047323 | Bacteria | 3555 |
| 797 | Ga0495683_0049792 | 3300047323 | Bacteria | 2097 |
| 798 | Ga0495687_000160 | 3300047443 | Bacteria | 100989 |
| 799 | Ga0495687_000660 | 3300047443 | Bacteria | 39604 |
| 800 | Ga0495687_000895 | 3300047443 | Bacteria | 31294 |
| 801 | Ga0495687_000983 | 3300047443 | Bacteria | 28695 |
| 802 | Ga0495687_001754 | 3300047443 | Bacteria | 19179 |
| 803 | Ga0495675_0004223 | 3300047444 | Bacteria | 8692 |
| 804 | Ga0495675_0028299 | 3300047444 | Bacteria | 3572 |
| 805 | Ga0495677_0000703 | 3300047445 | Bacteria | 13571 |
| 806 | Ga0495679_000394 | 3300047446 | Bacteria | 33013 |
| 807 | Ga0495679_001206 | 3300047446 | Bacteria | 15325 |
| 808 | Ga0495679_005805 | 3300047446 | Bacteria | 5430 |
| 809 | Ga0495685_017647 | 3300047447 | Bacteria | 2445 |
| 810 | Ga0495673_0000169 | 3300047469 | Bacteria | 107858 |
| 811 | Ga0495673_0000251 | 3300047469 | Bacteria | 75046 |
| 812 | Ga0495673_0000803 | 3300047469 | Bacteria | 29470 |
| 813 | Ga0495673_0001258 | 3300047469 | Bacteria | 20918 |
| 814 | Ga0495673_0002267 | 3300047469 | Bacteria | 13802 |
| 815 | Ga0495673_0002542 | 3300047469 | Bacteria | 12731 |
| 816 | Ga0495673_0002685 | 3300047469 | Bacteria | 12255 |
| 817 | Ga0495673_0003871 | 3300047469 | Bacteria | 9638 |
| 818 | Ga0495673_0003974 | 3300047469 | Bacteria | 9456 |
| 819 | Ga0495673_0004659 | 3300047469 | Bacteria | 8523 |
| 820 | Ga0495673_0006365 | 3300047469 | Bacteria | 6946 |
| 821 | Ga0495673_0006599 | 3300047469 | Bacteria | 6805 |
| 822 | Ga0495673_0014777 | 3300047469 | Bacteria | 4049 |
| 823 | Ga0495673_0036592 | 3300047469 | Bacteria | 2249 |
| 824 | Ga0495673_0039283 | 3300047469 | Bacteria | 2148 |
| 825 | Ga0495673_0041898 | 3300047469 | Bacteria | 2058 |
| 826 | Ga0495681_0000128 | 3300047470 | Bacteria | 66467 |
| 827 | Ga0495681_0000166 | 3300047470 | Bacteria | 55128 |
| 828 | Ga0495681_0000180 | 3300047470 | Bacteria | 53731 |
| 829 | Ga0495681_0000291 | 3300047470 | Bacteria | 40021 |
| 830 | Ga0495681_0001419 | 3300047470 | Bacteria | 18019 |
| 831 | Ga0495681_0004307 | 3300047470 | Bacteria | 9742 |
| 832 | Ga0495681_0005131 | 3300047470 | Bacteria | 8824 |
| 833 | Ga0495681_0010269 | 3300047470 | Bacteria | 5676 |
| 834 | Ga0495681_0023797 | 3300047470 | Bacteria | 3242 |
| 835 | Ga0495681_0027546 | 3300047470 | Bacteria | 2937 |
| 836 | Ga0495681_0027841 | 3300047470 | Bacteria | 2918 |
| 837 | Ga0495681_0028787 | 3300047470 | Bacteria | 2852 |
| 838 | Ga0495681_0029154 | 3300047470 | Bacteria | 2829 |
| 839 | Ga0495681_0036760 | 3300047470 | Bacteria | 2418 |
| 840 | Ga0495684_0069837 | 3300047471 | Bacteria | 2670 |
| 841 | Ga0495684_0102402 | 3300047471 | Bacteria | 2164 |
| 842 | Ga0495684_0102603 | 3300047471 | Bacteria | 2162 |
| 843 | Ga0495686_0002254 | 3300047472 | Bacteria | 18594 |
| 844 | Ga0495686_0023196 | 3300047472 | Bacteria | 4095 |
| 845 | Ga0495593_0000146 | 3300047673 | Bacteria | 34680 |
| 846 | Ga0495593_0008336 | 3300047673 | Bacteria | 6031 |
| 847 | Ga0495593_0021830 | 3300047673 | Bacteria | 3572 |
| 848 | Ga0495593_0124530 | 3300047673 | Bacteria | 1310 |
| 849 | Ga0495602_0000088 | 3300048088 | Bacteria | 89770 |
| 850 | Ga0495602_0054472 | 3300048088 | Bacteria | 3530 |
| 851 | Ga0495602_0112270 | 3300048088 | Bacteria | 2212 |
| 852 | Ga0495626_0000007 | 3300048091 | Bacteria | 276374 |
| 853 | Ga0495626_0000055 | 3300048091 | Bacteria | 154219 |
| 854 | Ga0495626_0000108 | 3300048091 | Bacteria | 108112 |
| 855 | Ga0495626_0000131 | 3300048091 | Bacteria | 94532 |
| 856 | Ga0495626_0000224 | 3300048091 | Bacteria | 66775 |
| 857 | Ga0495626_0001055 | 3300048091 | Bacteria | 23548 |
| 858 | Ga0495626_0002053 | 3300048091 | Bacteria | 14732 |
| 859 | Ga0496100_0006690 | 3300048903 | Bacteria | 6306 |
| 860 | Ga0496101_0064778 | 3300048904 | Bacteria | 2663 |
| 861 | Ga0496102_0000052 | 3300048905 | Bacteria | 177388 |
| 862 | Ga0496102_0039709 | 3300048905 | Bacteria | 4254 |
| 863 | Ga0496102_0218141 | 3300048905 | Bacteria | 1798 |
| 864 | Ga0496102_0352586 | 3300048905 | Bacteria | 1385 |
| 865 | Ga0496103_0001347 | 3300048906 | Bacteria | 16574 |
| 866 | Ga0496104_0002929 | 3300048907 | Bacteria | 14701 |
| 867 | Ga0496104_0014350 | 3300048907 | Bacteria | 7156 |
| 868 | Ga0496105_0198246 | 3300048908 | Bacteria | 1639 |
| 869 | Ga0496105_0206916 | 3300048908 | Bacteria | 1600 |
| 870 | Ga0496106_0012184 | 3300048909 | Bacteria | 6346 |
| 871 | Ga0496106_0102218 | 3300048909 | Bacteria | 2223 |
| 872 | Ga0496107_0042369 | 3300048910 | Bacteria | 3270 |
| 873 | Ga0496108_0001442 | 3300048911 | Bacteria | 18781 |
| 874 | Ga0496108_0034098 | 3300048911 | Bacteria | 4229 |
| 875 | Ga0496108_0098297 | 3300048911 | Bacteria | 2494 |
| 876 | Ga0496109_0015259 | 3300048912 | Bacteria | 6689 |
| 877 | Ga0496110_0016894 | 3300048913 | Bacteria | 6099 |
| 878 | Ga0496110_0019426 | 3300048913 | Bacteria | 5717 |
| 879 | Ga0496110_0024401 | 3300048913 | Bacteria | 5154 |
| 880 | Ga0496110_0024744 | 3300048913 | Bacteria | 5121 |
| 881 | Ga0496110_0134710 | 3300048913 | Bacteria | 2232 |
| 882 | Ga0496110_0216431 | 3300048913 | Bacteria | 1742 |
| 883 | Ga0496111_0081389 | 3300048914 | Bacteria | 2364 |
| 884 | Ga0496111_0197930 | 3300048914 | Bacteria | 1494 |
| 885 | Ga0496112_0083538 | 3300048915 | Bacteria | 3159 |
| 886 | Ga0496112_0088004 | 3300048915 | Bacteria | 3073 |
| 887 | Ga0496112_0136689 | 3300048915 | Bacteria | 2421 |
| 888 | Ga0496113_0002497 | 3300048916 | Bacteria | 10718 |
| 889 | Ga0496114_0005062 | 3300048917 | Bacteria | 10273 |
| 890 | Ga0496114_0023471 | 3300048917 | Bacteria | 5034 |
| 891 | Ga0496115_0007311 | 3300048918 | Bacteria | 8121 |
| 892 | Ga0496115_0027900 | 3300048918 | Bacteria | 4420 |
| 893 | Ga0496116_0001072 | 3300048919 | Bacteria | 32965 |
| 894 | Ga0496116_0002130 | 3300048919 | Bacteria | 21076 |
| 895 | Ga0496116_0003028 | 3300048919 | Bacteria | 17022 |
| 896 | Ga0496116_0016103 | 3300048919 | Bacteria | 5870 |
| 897 | Ga0496116_0022568 | 3300048919 | Bacteria | 4713 |
| 898 | Ga0496116_0135538 | 3300048919 | Bacteria | 1395 |
| 899 | Ga0496117_0000702 | 3300048920 | Bacteria | 53065 |
| 900 | Ga0496117_0000899 | 3300048920 | Bacteria | 45811 |
| 901 | Ga0496117_0127936 | 3300048920 | Bacteria | 1546 |
| 902 | Ga0496118_0004432 | 3300048921 | Bacteria | 16655 |
| 903 | Ga0496118_0023188 | 3300048921 | Bacteria | 5399 |
| 904 | Ga0496118_0048656 | 3300048921 | Bacteria | 3271 |
| 905 | Ga0496118_0100492 | 3300048921 | Bacteria | 1956 |
| 906 | Ga0496119_0018083 | 3300048922 | Bacteria | 5266 |
| 907 | Ga0496120_0002347 | 3300048923 | Bacteria | 19444 |
| 908 | Ga0496121_0003119 | 3300048924 | Bacteria | 23932 |
| 909 | Ga0496121_0005468 | 3300048924 | Bacteria | 16275 |
| 910 | Ga0496121_0006023 | 3300048924 | Bacteria | 15297 |
| 911 | Ga0496121_0016684 | 3300048924 | Bacteria | 7559 |
| 912 | Ga0496121_0052410 | 3300048924 | Bacteria | 3427 |
| 913 | Ga0496121_0084682 | 3300048924 | Bacteria | 2498 |
| 914 | Ga0496122_0000029 | 3300048925 | Bacteria | 336396 |
| 915 | Ga0496122_0002727 | 3300048925 | Bacteria | 24462 |
| 916 | Ga0496122_0023851 | 3300048925 | Bacteria | 5374 |
| 917 | Ga0496122_0025807 | 3300048925 | Bacteria | 5088 |
| 918 | Ga0496122_0042847 | 3300048925 | Bacteria | 3555 |
| 919 | Ga0496123_0001389 | 3300048926 | Bacteria | 33938 |
| 920 | Ga0496123_0002360 | 3300048926 | Bacteria | 23662 |
| 921 | Ga0496123_0024543 | 3300048926 | Bacteria | 4579 |
| 922 | Ga0496123_0025326 | 3300048926 | Bacteria | 4476 |
| 923 | Ga0496123_0112583 | 3300048926 | Bacteria | 1551 |
| 924 | Ga0496124_0000274 | 3300048927 | Bacteria | 99131 |
| 925 | Ga0496124_0001595 | 3300048927 | Bacteria | 32638 |
| 926 | Ga0496124_0002650 | 3300048927 | Bacteria | 22986 |
| 927 | Ga0496124_0007470 | 3300048927 | Bacteria | 11609 |
| 928 | Ga0496124_0012628 | 3300048927 | Bacteria | 8313 |
| 929 | Ga0496124_0040420 | 3300048927 | Bacteria | 4033 |
| 930 | Ga0496124_0100856 | 3300048927 | Bacteria | 2339 |
| 931 | Ga0496125_0000478 | 3300048928 | Bacteria | 70888 |
| 932 | Ga0496125_0004272 | 3300048928 | Bacteria | 16621 |
| 933 | Ga0496125_0015934 | 3300048928 | Bacteria | 7240 |
| 934 | Ga0496125_0021685 | 3300048928 | Bacteria | 5980 |
| 935 | Ga0496125_0028529 | 3300048928 | Bacteria | 5038 |
| 936 | Ga0496125_0048182 | 3300048928 | Bacteria | 3556 |
| 937 | Ga0496125_0111178 | 3300048928 | Bacteria | 1983 |
| 938 | Ga0496126_0052070 | 3300048929 | Bacteria | 3723 |
| 939 | Ga0496126_0104165 | 3300048929 | Bacteria | 2479 |
| 940 | Ga0495678_001170 | 3300049459 | Bacteria | 21653 |
| 941 | Ga0495678_003067 | 3300049459 | Bacteria | 10606 |
| 942 | Ga0495678_004999 | 3300049459 | Bacteria | 7471 |
| 943 | Ga0495678_005032 | 3300049459 | Bacteria | 7435 |
| 944 | Ga0495678_008426 | 3300049459 | Bacteria | 5201 |
| 945 | Ga0495678_010382 | 3300049459 | Bacteria | 4532 |
| 946 | Ga0495678_014533 | 3300049459 | Bacteria | 3656 |
| 947 | Ga0495682_0000072 | 3300049460 | Bacteria | 93119 |
| 948 | Ga0495682_0001935 | 3300049460 | Bacteria | 10283 |
| 949 | Ga0495682_0016677 | 3300049460 | Bacteria | 2778 |
| 950 | Ga0495682_0025577 | 3300049460 | Bacteria | 2196 |
| 951 | Ga0501034_0070429 | 3300049571 | Bacteria | 3508 |
| 952 | Ga0501036_0000592 | 3300049572 | Bacteria | 26278 |
| 953 | Ga0501037_0031001 | 3300049573 | Bacteria | 3948 |
| 954 | Ga0501038_0010432 | 3300049574 | Bacteria | 8498 |
| 955 | Ga0501039_0039404 | 3300049575 | Bacteria | 3649 |
| 956 | Ga0501039_0287824 | 3300049575 | Bacteria | 1292 |
| 957 | Ga0501040_0029439 | 3300049576 | Bacteria | 3706 |
| 958 | Ga0501041_0000044 | 3300049577 | Bacteria | 43476 |
| 959 | Ga0501043_0012572 | 3300049579 | Bacteria | 6620 |
| 960 | Ga0501046_0000460 | 3300049580 | Bacteria | 40737 |
| 961 | Ga0501047_0225143 | 3300049581 | Bacteria | 1731 |
| 962 | Ga0501048_0133167 | 3300049582 | Bacteria | 1756 |
| 963 | Ga0501068_0012868 | 3300049584 | Bacteria | 4753 |
| 964 | Ga0501070_0061748 | 3300049586 | Bacteria | 3105 |
| 965 | Ga0501071_0017099 | 3300049587 | Bacteria | 4996 |
| 966 | Ga0501072_0027879 | 3300049588 | Bacteria | 4408 |
| 967 | Ga0501072_0291825 | 3300049588 | Bacteria | 1297 |
| 968 | Ga0501076_0000973 | 3300049592 | Bacteria | 18756 |
| 969 | Ga0501077_0004904 | 3300049593 | Bacteria | 8121 |
| 970 | Ga0501079_0000447 | 3300049741 | Bacteria | 26895 |
| 971 | Ga0501080_0039938 | 3300049742 | Bacteria | 4379 |
| 972 | Ga0501035_0064677 | 3300049822 | Bacteria | 3250 |
| 973 | nmdc:mga06z11_37854_c1 | 3300050494 | Bacteria | 2391 |
| 974 | nmdc:mga07m45_8732_c1 | 3300050496 | Bacteria | 5222 |
| 975 | nmdc:mga07m45_87532_c1 | 3300050496 | Bacteria | 1782 |
| 976 | nmdc:mga09592_129037_c1 | 3300050508 | Bacteria | 2174 |
| 977 | nmdc:mga08y16_78195_c1 | 3300050511 | Bacteria | 3449 |
| 978 | nmdc:mga08y16_97668_c1 | 3300050511 | Bacteria | 3059 |
| 979 | nmdc:mga0n895_152214_c1 | 3300050512 | Bacteria | 2344 |
| 980 | nmdc:mga0n895_33342_c1 | 3300050512 | Bacteria | 4949 |
| 981 | nmdc:mga0rr50_64193_c1 | 3300050513 | Bacteria | 2777 |
| 982 | nmdc:mga08x19_10865_c1 | 3300050514 | Bacteria | 5475 |
| 983 | nmdc:mga08x19_198147_c1 | 3300050514 | Bacteria | 1376 |
| 984 | nmdc:mga08x19_29126_c1 | 3300050514 | Bacteria | 3462 |
| 985 | nmdc:mga08x19_9983_c1 | 3300050514 | Bacteria | 5692 |
| 986 | nmdc:mga0a205_32630_c1 | 3300050515 | Bacteria | 4992 |
| 987 | nmdc:mga0a205_672_c1 | 3300050515 | Bacteria | 27265 |
| 988 | Ga0495601_0006955 | 3300053077 | Bacteria | 6625 |
| 989 | Ga0495601_0192028 | 3300053077 | Bacteria | 1334 |
| 990 | Ga0495612_0009938 | 3300053078 | Bacteria | 3853 |
| 991 | Ga0500607_001619 | 3300053121 | Bacteria | 19861 |
| 992 | Ga0500618_000352 | 3300053125 | Bacteria | 32078 |
| 993 | Ga0501084_0003932 | 3300054114 | Bacteria | 12101 |
| 994 | Ga0501082_0020960 | 3300060353 | Bacteria | 5637 |
| 995 | Ga0530510_0000149 | 3300061734 | Bacteria | 41720 |
| 996 | 2511274670 | 2511231007 | Bacteria | 6306603 |
| 997 | 2511275861 | 2511231008 | Bacteria | 6624100 |
| 998 | 2511279992 | 2511231008 | Bacteria | 6624100 |
| 999 | 2511303591 | 2511231012 | Bacteria | 6738011 |
| 1000 | 2511312603 | 2511231014 | Bacteria | 6462302 |
| 1001 | 2511323005 | 2511231015 | Bacteria | 6598026 |
| 1002 | 2511335618 | 2511231017 | Bacteria | 6503007 |
| 1003 | 2511340841 | 2511231018 | Bacteria | 6436256 |
| 1004 | 2511346462 | 2511231019 | Bacteria | 6520662 |
| 1005 | 2511350282 | 2511231020 | Bacteria | 6115223 |
| 1006 | 2511354780 | 2511231021 | Bacteria | 7302637 |
| 1007 | 2511377063 | 2511231024 | Bacteria | 5835885 |
| 1008 | 2555248849 | 2554235231 | Bacteria | 5215788 |
| 1009 | 2599905771 | 2599185292 | Bacteria | 6290804 |
| 1010 | 2599944345 | 2599185302 | Bacteria | 5954930 |
| 1011 | 2599954817 | 2599185304 | Bacteria | 5951361 |
| 1012 | 2599958528 | 2599185305 | Bacteria | 6748700 |
| 1013 | 2599971499 | 2599185307 | Bacteria | 6194719 |
| 1014 | 2599984255 | 2599185309 | Bacteria | 5969593 |
| 1015 | 2599991463 | 2599185310 | Bacteria | 6014457 |
| 1016 | 2600001157 | 2599185312 | Bacteria | 5912071 |
| 1017 | 2600048946 | 2599185320 | Bacteria | 5963263 |
| 1018 | 2601625251 | 2600255283 | Bacteria | 6061572 |
| 1019 | 2624491550 | 2623620446 | Bacteria | 6500345 |
| 1020 | 2643843878 | 2643221565 | Bacteria | 6216018 |
| 1021 | 2643860654 | 2643221569 | Bacteria | 6064337 |
| 1022 | 2643953181 | 2643221589 | Bacteria | 6250934 |
| 1023 | 2643981481 | 2643221594 | Bacteria | 5811388 |
| 1024 | 2644025178 | 2643221602 | Bacteria | 6249926 |
| 1025 | 2644028587 | 2643221603 | Bacteria | 6147767 |
| 1026 | 2644119601 | 2643221621 | Bacteria | 6212786 |
| 1027 | 2644188245 | 2643221633 | Bacteria | 6733554 |
| 1028 | 2738691837 | 2738541271 | Bacteria | 5657310 |
| 1029 | 2739201760 | 2738543004 | Bacteria | 6381073 |
| 1030 | 2739261922 | 2738543015 | Bacteria | 6750701 |
| 1031 | 2739267611 | 2738543016 | Bacteria | 5657564 |
| 1032 | 2765584585 | 2765235841 | Bacteria | 6137024 |
| 1033 | 2774118781 | 2773857670 | Bacteria | 6407454 |
| 1034 | 2784312419 | 2784132072 | Bacteria | 6596533 |
| 1035 | 2792834432 | 2791355137 | Bacteria | 9654227 |
| 1036 | 2808942750 | 2808606379 | Bacteria | 5022697 |
| 1037 | 2808958159 | 2808606382 | Bacteria | 6841132 |
| 1038 | 2809035388 | 2808606395 | Bacteria | 6020352 |
| 1039 | 2857541106 | 2857537821 | Bacteria | 5248181 |
| 1040 | 2858953410 | 2858950400 | Bacteria | 6783797 |
| 1041 | 2860345189 | 2860339153 | Bacteria | 6846989 |
| 1042 | 2887379399 | 2887375801 | Bacteria | 5334027 |
| 1043 | 2895503024 | 2895498888 | Bacteria | 5283788 |
| 1044 | 2895513063 | 2895511927 | Bacteria | 6802080 |
| 1045 | 2895523075 | 2895522137 | Bacteria | 3284416 |
| 1046 | 2895526978 | 2895525241 | Bacteria | 3388457 |
| 1047 | 2904554407 | 2904550169 | Bacteria | 6221258 |
| 1048 | 2912966194 | 2912963787 | Bacteria | 5646108 |
| 1049 | 2919461557 | 2919456309 | Bacteria | 6586567 |
| 1050 | 2919700887 | 2919697872 | Bacteria | 6553725 |
| 1051 | 2931403215 | 2931396565 | Bacteria | 7251677 |
| 1052 | 2939642404 | 2939636861 | Bacteria | 6297853 |
| 1053 | 2941483568 | |||
| 1054 | 3007513694 | 3007511990 | Bacteria | 6481491 |
| 1055 | 3007623242 | 3007619802 | Bacteria | 6411688 |
| 1056 | 8019778444 | 8019775933 | Bacteria | 6858656 |
| 1057 | 8054288002 | 8054285046 | Bacteria | 6919322 |
| 1058 | 8054932916 | 8054929484 | Bacteria | 5599761 |
| 1059 | 8055882924 | 8055878733 | Bacteria | 5907058 |
| 1060 | 8056118591 | 8056115690 | Bacteria | 5527654 |
| 1061 | 8056129973 | 8056125926 | Bacteria | 6228218 |
| 1062 | 8056140188 | 8056137416 | Bacteria | 6147080 |
| 1063 | 8056159028 | 8056155041 | Bacteria | 6486948 |
| 1064 | 8056181410 | 8056177738 | Bacteria | 6748268 |
| 1065 | Ga0105251_10002188 | |||
| 1066 | MRS2a_Contig_16 | |||
| 1067 | JGI24740J21852_10003189 | |||
| 1068 | JGI25162J39368_1000704 | |||
| 1069 | JGI25163J39215_1000295 | |||
| 1070 | JGI25164J39214_1000430 | |||
| 1071 | JGI25165J46597_1000823 | |||
| 1072 | Ga0055530_10002588 | |||
| 1073 | Ga0065714_10000072 | |||
| 1074 | Ga0065714_10005900 | |||
| 1075 | Ga0065714_10022497 | |||
| 1076 | Ga0065714_10064584 | |||
| 1077 | Ga0065714_10066846 | |||
| 1078 | Ga0065704_10001134 | |||
| 1079 | Ga0065704_10088187 | |||
| 1080 | Ga0065712_10001427 | |||
| 1081 | Ga0070683_100088499 | |||
| 1082 | Ga0070690_100011538 | |||
| 1083 | Ga0070677_10029084 | |||
| 1084 | Ga0068869_100001616 | |||
| 1085 | Ga0068869_100130260 | |||
| 1086 | Ga0070666_10123165 | |||
| 1087 | Ga0070680_100110571 | |||
| 1088 | Ga0070682_100009501 | |||
| 1089 | Ga0070682_100072778 | |||
| 1090 | Ga0068868_100000209 | |||
| 1091 | Ga0068868_100027098 | |||
| 1092 | Ga0070687_100000190 | |||
| 1093 | Ga0070661_100000015 | |||
| 1094 | Ga0070692_10048747 | |||
| 1095 | Ga0070674_100049870 | |||
| 1096 | Ga0070659_100099566 | |||
| 1097 | Ga0070709_10098586 | |||
| 1098 | Ga0070709_10165652 | |||
| 1099 | Ga0070714_100012346 | |||
| 1100 | Ga0070714_100143521 | |||
| 1101 | Ga0070714_100283328 | |||
| 1102 | Ga0070713_100051163 | |||
| 1103 | Ga0070713_100097922 | |||
| 1104 | Ga0070713_100109895 | |||
| 1105 | Ga0070713_100177289 | |||
| 1106 | Ga0070713_100200873 | |||
| 1107 | Ga0070710_10020709 | |||
| 1108 | Ga0070710_10081026 | |||
| 1109 | Ga0070710_10089676 | |||
| 1110 | Ga0070711_100033593 | |||
| 1111 | Ga0070711_100123246 | |||
| 1112 | Ga0070711_100138528 | |||
| 1113 | Ga0070705_100016350 | |||
| 1114 | Ga0070700_100001218 | |||
| 1115 | Ga0070700_100020858 | |||
| 1116 | Ga0070694_100000802 | |||
| 1117 | Ga0070694_100024686 | |||
| 1118 | Ga0070708_100014082 | |||
| 1119 | Ga0070708_100046673 | |||
| 1120 | Ga0070708_100056021 | |||
| 1121 | Ga0070708_100178502 | |||
| 1122 | Ga0070708_100204496 | |||
| 1123 | Ga0070663_100074707 | |||
| 1124 | Ga0070678_100023726 | |||
| 1125 | Ga0070662_100018899 | |||
| 1126 | Ga0070681_10000172 | |||
| 1127 | Ga0068867_100000417 | |||
| 1128 | Ga0070706_100005228 | |||
| 1129 | Ga0070706_100006345 | |||
| 1130 | Ga0070707_100008665 | |||
| 1131 | Ga0070707_100043810 | |||
| 1132 | Ga0070707_100249671 | |||
| 1133 | Ga0070698_100008793 | |||
| 1134 | Ga0070698_100017176 | |||
| 1135 | Ga0070698_100147465 | |||
| 1136 | Ga0070698_100322343 | |||
| 1137 | Ga0070699_100028781 | |||
| 1138 | Ga0070699_100051898 | |||
| 1139 | Ga0070699_100179125 | |||
| 1140 | Ga0070679_100049580 | |||
| 1141 | Ga0070684_100035923 | |||
| 1142 | Ga0070697_100001858 | |||
| 1143 | Ga0070697_100074912 | |||
| 1144 | Ga0068853_100000681 | |||
| 1145 | Ga0068853_100014501 | |||
| 1146 | Ga0070672_100047834 | |||
| 1147 | Ga0070686_100010525 | |||
| 1148 | Ga0070686_100213524 | |||
| 1149 | Ga0070695_100045837 | |||
| 1150 | Ga0070695_100057240 | |||
| 1151 | Ga0070695_100233184 | |||
| 1152 | Ga0070696_100002371 | |||
| 1153 | Ga0070693_100038058 | |||
| 1154 | Ga0070693_100042970 | |||
| 1155 | Ga0070665_100037145 | |||
| 1156 | Ga0070704_100003235 | |||
| 1157 | Ga0070704_100005837 | |||
| 1158 | Ga0068855_100055177 | |||
| 1159 | Ga0070664_100000015 | |||
| 1160 | Ga0068857_100008624 | |||
| 1161 | Ga0068857_100028346 | |||
| 1162 | Ga0068854_100004438 | |||
| 1163 | Ga0068854_100220920 | |||
| 1164 | Ga0068856_100003653 | |||
| 1165 | Ga0068856_100007677 | |||
| 1166 | Ga0068856_100036637 | |||
| 1167 | Ga0068856_100047165 | |||
| 1168 | Ga0070702_100000050 | |||
| 1169 | Ga0068852_100049565 | |||
| 1170 | Ga0068852_100228563 | |||
| 1171 | Ga0068864_100170394 | |||
| 1172 | Ga0068866_10000489 | |||
| 1173 | Ga0068866_10113308 | |||
| 1174 | Ga0068861_100013583 | |||
| 1175 | Ga0068851_10000819 | |||
| 1176 | Ga0068870_10068706 | |||
| 1177 | Ga0068863_100048052 | |||
| 1178 | Ga0068858_100050058 | |||
| 1179 | Ga0068860_100031691 | |||
| 1180 | Ga0068862_100004686 | |||
| 1181 | Ga0070717_10008454 | |||
| 1182 | Ga0070717_10050779 | |||
| 1183 | Ga0070717_10094398 | |||
| 1184 | Ga0070717_10103518 | |||
| 1185 | Ga0070717_10175147 | |||
| 1186 | Ga0075432_10001147 | |||
| 1187 | Ga0075432_10001150 | |||
| 1188 | Ga0070715_10035373 | |||
| 1189 | Ga0070716_100021617 | |||
| 1190 | Ga0070716_100141129 | |||
| 1191 | Ga0070712_100034776 | |||
| 1192 | Ga0070712_100042991 | |||
| 1193 | Ga0070712_100056150 | |||
| 1194 | Ga0070712_100064934 | |||
| 1195 | Ga0070712_100129139 | |||
| 1196 | Ga0070712_100184663 | |||
| 1197 | Ga0075362_10029756 | |||
| 1198 | Ga0075367_10050281 | |||
| 1199 | Ga0075366_10020321 | |||
| 1200 | Ga0097621_100000676 | |||
| 1201 | Ga0097621_100014418 | |||
| 1202 | Ga0075370_10028797 | |||
| 1203 | Ga0068871_100002094 | |||
| 1204 | Ga0075433_10001341 | |||
| 1205 | Ga0075433_10086621 | |||
| 1206 | Ga0075434_100001149 | |||
| 1207 | Ga0075434_100281457 | |||
| 1208 | Ga0075436_100003889 | |||
| 1209 | Ga0075436_100015122 | |||
| 1210 | Ga0075436_100033260 | |||
| 1211 | Ga0079104_1000097 | |||
| 1212 | Ga0075435_100000938 | |||
| 1213 | Ga0075435_100005166 | |||
| 1214 | Ga0105251_10004330 | |||
| 1215 | Ga0105251_10016924 | |||
| 1216 | Ga0105251_10029972 | |||
| 1217 | Ga0105244_10001284 | |||
| 1218 | Ga0105244_10002362 | |||
| 1219 | Ga0105244_10013421 | |||
| 1220 | Ga0105240_10018287 | |||
| 1221 | Ga0105240_10072757 | |||
| 1222 | Ga0111539_10142185 | |||
| 1223 | Ga0105245_10000115 | |||
| 1224 | Ga0105245_10078884 | |||
| 1225 | Ga0105247_10022068 | |||
| 1226 | Ga0105243_10090159 | |||
| 1227 | Ga0105243_10231362 | |||
| 1228 | Ga0105241_10000846 | |||
| 1229 | Ga0105241_10071862 | |||
| 1230 | Ga0105242_10000003 | |||
| 1231 | Ga0105242_10023507 | |||
| 1232 | Ga0105242_10333137 | |||
| 1233 | Ga0105248_10220241 | |||
| 1234 | Ga0105237_10000009 | |||
| 1235 | Ga0105237_10007385 | |||
| 1236 | Ga0105237_10009748 | |||
| 1237 | Ga0105238_10014796 | |||
| 1238 | Ga0105238_10106075 | |||
| 1239 | Ga0105249_10001691 | |||
| 1240 | Ga0105249_10087027 | |||
| 1241 | Ga0105249_10099779 | |||
| 1242 | Ga0105239_10005459 | |||
| 1243 | Ga0105239_10018066 | |||
| 1244 | Ga0105246_10000001 | |||
| 1245 | Ga0105246_10031865 | |||
| 1246 | Ga0157373_10000512 | |||
| 1247 | Ga0157373_10001985 | |||
| 1248 | Ga0157370_10002402 | |||
| 1249 | Ga0157370_10010969 | |||
| 1250 | Ga0157370_10029957 | |||
| 1251 | Ga0157370_10035403 | |||
| 1252 | Ga0157369_10002872 | |||
| 1253 | Ga0157378_10034381 | |||
| 1254 | Ga0163162_10006516 | |||
| 1255 | Ga0163162_10018601 | |||
| 1256 | Ga0163162_10115237 | |||
| 1257 | Ga0157375_10049890 | |||
| 1258 | Ga0163163_10098142 | |||
| 1259 | Ga0157380_10033985 | |||
| 1260 | Ga0157380_10043427 | |||
| 1261 | Ga0182008_10003433 | |||
| 1262 | Ga0182008_10003973 | |||
| 1263 | Ga0182008_10004773 | |||
| 1264 | Ga0182008_10013262 | |||
| 1265 | Ga0157376_10059704 | |||
| 1266 | Ga0182006_1009525 | |||
| 1267 | Ga0182006_1052189 | |||
| 1268 | Ga0182007_10000209 | |||
| 1269 | Ga0182007_10008866 | |||
| 1270 | Ga0182005_1001303 | |||
| 1271 | Ga0163161_10001221 | |||
| 1272 | Ga0209760_100109 | |||
| 1273 | Ga0207427_100011 | |||
| 1274 | Ga0209437_100044 | |||
| 1275 | Ga0209233_1000057 | |||
| 1276 | Ga0209676_1001409 | |||
| 1277 | Ga0209050_1000754 | |||
| 1278 | Ga0209051_1007521 | |||
| 1279 | Ga0207656_10003632 | |||
| 1280 | Ga0207655_1000141 | |||
| 1281 | Ga0207655_1004618 | |||
| 1282 | Ga0207655_1004697 | |||
| 1283 | Ga0207713_1001966 | |||
| 1284 | Ga0207713_1006251 | |||
| 1285 | Ga0207713_1019386 | |||
| 1286 | Ga0207682_10088991 | |||
| 1287 | Ga0207692_10001606 | |||
| 1288 | Ga0207692_10014650 | |||
| 1289 | Ga0207692_10040925 | |||
| 1290 | Ga0207692_10055458 | |||
| 1291 | Ga0207692_10057724 | |||
| 1292 | Ga0207642_10003207 | |||
| 1293 | Ga0207699_10000208 | |||
| 1294 | Ga0207699_10003830 | |||
| 1295 | Ga0207643_10024874 | |||
| 1296 | Ga0207684_10001257 | |||
| 1297 | Ga0207684_10012145 | |||
| 1298 | Ga0207684_10026987 | |||
| 1299 | Ga0207654_10000239 | |||
| 1300 | Ga0207707_10003624 | |||
| 1301 | Ga0207695_10001114 | |||
| 1302 | Ga0207671_10000018 | |||
| 1303 | Ga0207693_10008852 | |||
| 1304 | Ga0207693_10022862 | |||
| 1305 | Ga0207693_10047478 | |||
| 1306 | Ga0207693_10064959 | |||
| 1307 | Ga0207693_10090757 | |||
| 1308 | Ga0207693_10109754 | |||
| 1309 | Ga0207693_10164193 | |||
| 1310 | Ga0207663_10000294 | |||
| 1311 | Ga0207663_10113094 | |||
| 1312 | Ga0207660_10055337 | |||
| 1313 | Ga0207662_10000333 | |||
| 1314 | Ga0207649_10000008 | |||
| 1315 | Ga0207652_10257976 | |||
| 1316 | Ga0207646_10000507 | |||
| 1317 | Ga0207646_10265507 | |||
| 1318 | Ga0207681_10000304 | |||
| 1319 | Ga0207694_10000050 | |||
| 1320 | Ga0207694_10169298 | |||
| 1321 | Ga0207650_10312528 | |||
| 1322 | Ga0207659_10192751 | |||
| 1323 | Ga0207687_10033523 | |||
| 1324 | Ga0207700_10000525 | |||
| 1325 | Ga0207700_10011846 | |||
| 1326 | Ga0207700_10052870 | |||
| 1327 | Ga0207700_10132441 | |||
| 1328 | Ga0207700_10178510 | |||
| 1329 | Ga0207700_10282694 | |||
| 1330 | Ga0207700_10283602 | |||
| 1331 | Ga0207664_10001091 | |||
| 1332 | Ga0207664_10023337 | |||
| 1333 | Ga0207664_10083806 | |||
| 1334 | Ga0207664_10101138 | |||
| 1335 | Ga0207664_10230390 | |||
| 1336 | Ga0207706_10011229 | |||
| 1337 | Ga0207686_10000179 | |||
| 1338 | Ga0207686_10025133 | |||
| 1339 | Ga0207709_10000917 | |||
| 1340 | Ga0207709_10004967 | |||
| 1341 | Ga0207670_10055971 | |||
| 1342 | Ga0207665_10023533 | |||
| 1343 | Ga0207665_10136140 | |||
| 1344 | Ga0207691_10041266 | |||
| 1345 | Ga0207691_10123697 | |||
| 1346 | Ga0207711_10104770 | |||
| 1347 | Ga0207689_10175440 | |||
| 1348 | Ga0207679_10000008 | |||
| 1349 | Ga0207667_10004024 | |||
| 1350 | Ga0207667_10047302 | |||
| 1351 | Ga0207712_10000763 | |||
| 1352 | Ga0207712_10070160 | |||
| 1353 | Ga0207640_10106794 | |||
| 1354 | Ga0207677_10001911 | |||
| 1355 | Ga0207677_10023601 | |||
| 1356 | Ga0207703_10011030 | |||
| 1357 | Ga0207639_10009093 | |||
| 1358 | Ga0207639_10064264 | |||
| 1359 | Ga0207708_10000114 | |||
| 1360 | Ga0207708_10055895 | |||
| 1361 | Ga0207702_10000002 | |||
| 1362 | Ga0207702_10011858 | |||
| 1363 | Ga0207702_10025761 | |||
| 1364 | Ga0207702_10107123 | |||
| 1365 | Ga0207648_10007536 | |||
| 1366 | Ga0207676_10120324 | |||
| 1367 | Ga0207674_10002309 | |||
| 1368 | Ga0207674_10010901 | |||
| 1369 | Ga0207674_10013314 | |||
| 1370 | Ga0207675_100005429 | |||
| 1371 | Ga0207683_10005872 | |||
| 1372 | Ga0207698_10004701 | |||
| 1373 | Ga0209281_1000136 | |||
| 1374 | Ga0209371_1002682 | |||
| 1375 | Ga0207428_10005561 | |||
| 1376 | Ga0207428_10069373 | |||
| 1377 | Ga0207428_10074807 | |||
| 1378 | Ga0207428_10104965 | |||
| 1379 | Ga0268266_10323138 | |||
| 1380 | Ga0268265_10003785 | |||
| 1381 | Ga0268264_10119336 | |||
| 1382 | Ga0268256_1002491 | |||
| 1383 | Ga0307511_10123375 | |||
| 1384 | Ga0265762_1005087 | |||
| 1385 | Ga0265775_100032 | |||
| 1386 | Ga0265763_1000542 | |||
| 1387 | Ga0265777_100215 | |||
| 1388 | Ga0265776_100095 | |||
| 1389 | Ga0265776_100141 | |||
| 1390 | Ga0265764_100201 | |||
| 1391 | Ga0265761_100364 | |||
| 1392 | Ga0265779_100103 | |||
| 1393 | Ga0265760_10008349 | |||
| 1394 | Ga0265327_10043871 | |||
| 1395 | Ga0307408_100000649 | |||
| 1396 | Ga0310116_102021 | |||
| 1397 | Ga0310117_100027 | |||
| 1398 | Ga0310117_105512 | |||
| 1399 | Ga0310103_100873 | |||
| 1400 | Ga0310115_100183 | |||
| 1401 | Ga0310118_100057 | |||
| 1402 | Ga0310105_100165 | |||
| 1403 | Ga0310119_100483 | |||
| 1404 | Ga0310101_100049 | |||
| 1405 | Ga0307405_10069202 | |||
| 1406 | Ga0307412_10000379 | |||
| 1407 | Ga0307416_100283373 | |||
| 1408 | Ga0307510_10056925 | |||
| 1409 | Ga0316212_1001582 | |||
| 1410 | Ga0373950_0002274 | |||
| 1411 | Ga0373934_0000017 | |||
| 1412 | Ga0373923_0025208 | |||
| 1413 | Ga0373932_0000563 | |||
| 1414 | Ga0373936_0001925 | |||
| 1415 | Ga0373939_0008792 | |||
| 1416 | Ga0373953_0000194 | |||
| 1417 | Ga0373953_0010437 | |||
| 1418 | Ga0373953_0044858 | |||
| 1419 | Ga0373954_0000001 | |||
| 1420 | Ga0373954_0000069 | |||
| 1421 | Ga0373956_0000051 | |||
| 1422 | Ga0373957_0000091 | |||
| 1423 | Ga0373957_0008190 | |||
| 1424 | Ga0373957_0072435 | |||
| 1425 | Ga0373960_0001894 | |||
| 1426 | Ga0373960_0002703 | |||
| 1427 | Ga0373955_0000052 | |||
| 1428 | Ga0373955_0008303 | |||
| 1429 | Ga0373955_0044927 | |||
| 1430 | Ga0373955_0142475 | |||
| 1431 | Ga0373961_0048930 | |||
| 1432 | Ga0373924_0003287 | |||
| 1433 | Ga0373924_0024408 | |||
| 1434 | Ga0373931_0020189 | |||
| 1435 | Ga0373931_0032358 | |||
| 1436 | Ga0373931_0058873 | |||
| 1437 | Ga0373935_0016067 | |||
| 1438 | Ga0373935_0068474 | |||
| 1439 | Ga0373933_0000016 | |||
| 1440 | Ga0373933_0013663 | |||
| 1441 | Ga0373933_0015808 | |||
| 1442 | Ga0373947_0033189 | |||
| 1443 | Ga0373947_0075388 | |||
| 1444 | Ga0310104_01376 | |||
| 1445 | Ga0373937_0000002 | |||
| 1446 | Ga0373937_0000524 | |||
| 1447 | Ga0373937_0008427 | |||
| 1448 | Ga0373937_0081963 | |||
| 1449 | Ga0373937_0240507 | |||
| 1450 | Ga0265778_003628 | |||
| 1451 | Ga0372808_000590 | |||
| 1452 | Ga0373925_0002973 | |||
| 1453 | Ga0373925_0038922 | |||
| 1454 | Ga0373925_0056967 | |||
| 1455 | Ga0395905_0000984 | |||
| 1456 | Ga0395905_0008120 | |||
| 1457 | Ga0395905_0010331 | |||
| 1458 | Ga0395905_0014948 | |||
| 1459 | Ga0395905_0023217 | |||
| 1460 | Ga0395901_0000712 | |||
| 1461 | Ga0439438_005210 | |||
| 1462 | Ga0439438_006473 | |||
| 1463 | Ga0439438_015019 | |||
| 1464 | Ga0439438_025024 | |||
| 1465 | Ga0439447_000054 | |||
| 1466 | Ga0439447_000206 | |||
| 1467 | Ga0439447_029945 | |||
| 1468 | Ga0439466_0000143 | |||
| 1469 | Ga0439466_0003392 | |||
| 1470 | Ga0439466_0011793 | |||
| 1471 | Ga0439466_0012660 | |||
| 1472 | Ga0439466_0016042 | |||
| 1473 | Ga0451853_1055566 | |||
| 1474 | Ga0439432_004568 | |||
| 1475 | Ga0439432_006475 | |||
| 1476 | Ga0439432_009250 | |||
| 1477 | Ga0439451_003063 | |||
| 1478 | Ga0439451_009101 | |||
| 1479 | Ga0439452_000093 | |||
| 1480 | Ga0439452_000367 | |||
| 1481 | Ga0439452_001126 | |||
| 1482 | Ga0439456_000030 | |||
| 1483 | Ga0439456_000117 | |||
| 1484 | Ga0439456_000837 | |||
| 1485 | Ga0439456_003252 | |||
| 1486 | Ga0439456_004872 | |||
| 1487 | Ga0439463_000126 | |||
| 1488 | Ga0439463_001094 | |||
| 1489 | Ga0450911_002925 | |||
| 1490 | Ga0450911_011460 | |||
| 1491 | Ga0450920_001158 | |||
| 1492 | Ga0450923_004969 | |||
| 1493 | Ga0450902_007853 | |||
| 1494 | Ga0450905_004220 | |||
| 1495 | Ga0450907_000001 | |||
| 1496 | Ga0450907_005703 | |||
| 1497 | Ga0450910_000649 | |||
| 1498 | Ga0450909_000083 | |||
| 1499 | Ga0439434_0000128 | |||
| 1500 | Ga0439460_0000010 | |||
| 1501 | Ga0439460_0006534 | |||
| 1502 | Ga0439460_0027435 | |||
| 1503 | Ga0451577_0039033 | |||
| 1504 | Ga0439440_0013509 | |||
| 1505 | Ga0466961_0052250 | |||
| 1506 | Ga0451576_0000220 | |||
| 1507 | Ga0451576_0046200 | |||
| 1508 | Ga0451576_0197594 | |||
| 1509 | Ga0495617_000425 | |||
| 1510 | Ga0495617_001744 | |||
| 1511 | Ga0495617_002378 | |||
| 1512 | Ga0495617_002732 | |||
| 1513 | Ga0495617_010764 | |||
| 1514 | Ga0495617_021005 | |||
| 1515 | Ga0495627_003164 | |||
| 1516 | Ga0495627_005040 | |||
| 1517 | Ga0495627_008940 | |||
| 1518 | Ga0495627_012468 | |||
| 1519 | Ga0495627_037629 | |||
| 1520 | Ga0495592_0000056 | |||
| 1521 | Ga0495592_0000330 | |||
| 1522 | Ga0495603_0003252 | |||
| 1523 | Ga0495590_0000677 | |||
| 1524 | Ga0495590_0002380 | |||
| 1525 | Ga0495590_0002726 | |||
| 1526 | Ga0495590_0008154 | |||
| 1527 | Ga0495590_0010941 | |||
| 1528 | Ga0495590_0025951 | |||
| 1529 | Ga0495591_000026 | |||
| 1530 | Ga0495591_000499 | |||
| 1531 | Ga0495591_000915 | |||
| 1532 | Ga0495591_002276 | |||
| 1533 | Ga0495591_005335 | |||
| 1534 | Ga0495591_006389 | |||
| 1535 | Ga0495591_007541 | |||
| 1536 | Ga0495591_012460 | |||
| 1537 | Ga0495591_019631 | |||
| 1538 | Ga0495629_0034369 | |||
| 1539 | Ga0495638_0000254 | |||
| 1540 | Ga0495638_0002304 | |||
| 1541 | Ga0495638_0002318 | |||
| 1542 | Ga0495638_0004186 | |||
| 1543 | Ga0495638_0004386 | |||
| 1544 | Ga0495638_0008079 | |||
| 1545 | Ga0495638_0013280 | |||
| 1546 | Ga0495638_0016546 | |||
| 1547 | Ga0495638_0017277 | |||
| 1548 | Ga0495638_0025621 | |||
| 1549 | Ga0495641_0034009 | |||
| 1550 | Ga0495651_0000030 | |||
| 1551 | Ga0495651_0057613 | |||
| 1552 | Ga0495651_0133644 | |||
| 1553 | Ga0495651_0149260 | |||
| 1554 | Ga0495653_0028463 | |||
| 1555 | Ga0495653_0129498 | |||
| 1556 | Ga0495650_0001066 | |||
| 1557 | Ga0495650_0013191 | |||
| 1558 | Ga0495650_0050198 | |||
| 1559 | Ga0495580_0010521 | |||
| 1560 | Ga0495582_0001227 | |||
| 1561 | Ga0495582_0006421 | |||
| 1562 | Ga0495605_0000795 | |||
| 1563 | Ga0495605_0001420 | |||
| 1564 | Ga0495605_0003274 | |||
| 1565 | Ga0495605_0003912 | |||
| 1566 | Ga0495605_0005597 | |||
| 1567 | Ga0495605_0044311 | |||
| 1568 | Ga0495639_0000066 | |||
| 1569 | Ga0495639_0004578 | |||
| 1570 | Ga0495639_0024326 | |||
| 1571 | Ga0495662_0002709 | |||
| 1572 | Ga0495662_0011600 | |||
| 1573 | Ga0495662_0032459 | |||
| 1574 | Ga0495664_0002738 | |||
| 1575 | Ga0495664_0010138 | |||
| 1576 | Ga0495584_0000630 | |||
| 1577 | Ga0495584_0001440 | |||
| 1578 | Ga0495584_0004480 | |||
| 1579 | Ga0495584_0004532 | |||
| 1580 | Ga0495584_0005166 | |||
| 1581 | Ga0495585_0000045 | |||
| 1582 | Ga0495585_0001462 | |||
| 1583 | Ga0495585_0003534 | |||
| 1584 | Ga0495585_0005180 | |||
| 1585 | Ga0495585_0006541 | |||
| 1586 | Ga0495594_0003358 | |||
| 1587 | Ga0495594_0038051 | |||
| 1588 | Ga0495596_0000003 | |||
| 1589 | Ga0495607_0000241 | |||
| 1590 | Ga0495607_0001818 | |||
| 1591 | Ga0495607_0007319 | |||
| 1592 | Ga0495607_0011379 | |||
| 1593 | Ga0495607_0012340 | |||
| 1594 | Ga0495607_0020210 | |||
| 1595 | Ga0495607_0028823 | |||
| 1596 | Ga0495607_0041117 | |||
| 1597 | Ga0495583_0000112 | |||
| 1598 | Ga0495583_0000852 | |||
| 1599 | Ga0495583_0001196 | |||
| 1600 | Ga0495583_0001574 | |||
| 1601 | Ga0495583_0001954 | |||
| 1602 | Ga0495583_0022908 | |||
| 1603 | Ga0495606_0000859 | |||
| 1604 | Ga0495606_0000965 | |||
| 1605 | Ga0495606_0001256 | |||
| 1606 | Ga0495606_0001732 | |||
| 1607 | Ga0495606_0003336 | |||
| 1608 | Ga0495606_0009598 | |||
| 1609 | Ga0495606_0015723 | |||
| 1610 | Ga0495606_0034292 | |||
| 1611 | Ga0495608_0000077 | |||
| 1612 | Ga0495608_0002611 | |||
| 1613 | Ga0495608_0043482 | |||
| 1614 | Ga0495608_0058428 | |||
| 1615 | Ga0495610_0003348 | |||
| 1616 | Ga0495610_0004992 | |||
| 1617 | Ga0495610_0016729 | |||
| 1618 | Ga0495610_0017366 | |||
| 1619 | Ga0495610_0023980 | |||
| 1620 | Ga0495610_0037220 | |||
| 1621 | Ga0495610_0094473 | |||
| 1622 | Ga0495610_0113156 | |||
| 1623 | Ga0495616_0001522 | |||
| 1624 | Ga0495616_0007524 | |||
| 1625 | Ga0495616_0118897 | |||
| 1626 | Ga0495618_0073232 | |||
| 1627 | Ga0495620_0000004 | |||
| 1628 | Ga0495620_0000485 | |||
| 1629 | Ga0495620_0002638 | |||
| 1630 | Ga0495620_0015249 | |||
| 1631 | Ga0495620_0023779 | |||
| 1632 | Ga0495620_0027607 | |||
| 1633 | Ga0495620_0029308 | |||
| 1634 | Ga0495628_0000120 | |||
| 1635 | Ga0495628_0021492 | |||
| 1636 | Ga0495628_0027636 | |||
| 1637 | Ga0495630_0002554 | |||
| 1638 | Ga0495630_0003463 | |||
| 1639 | Ga0495630_0004509 | |||
| 1640 | Ga0495630_0007382 | |||
| 1641 | Ga0495630_0014580 | |||
| 1642 | Ga0495631_0000104 | |||
| 1643 | Ga0495631_0010133 | |||
| 1644 | Ga0495631_0018918 | |||
| 1645 | Ga0495632_0000473 | |||
| 1646 | Ga0495632_0000693 | |||
| 1647 | Ga0495632_0001233 | |||
| 1648 | Ga0495632_0001717 | |||
| 1649 | Ga0495632_0008389 | |||
| 1650 | Ga0495632_0009996 | |||
| 1651 | Ga0495632_0011383 | |||
| 1652 | Ga0495632_0014286 | |||
| 1653 | Ga0495632_0016412 | |||
| 1654 | Ga0495632_0025080 | |||
| 1655 | Ga0495632_0027916 | |||
| 1656 | Ga0495637_0000102 | |||
| 1657 | Ga0495637_0000483 | |||
| 1658 | Ga0495637_0000824 | |||
| 1659 | Ga0495637_0000943 | |||
| 1660 | Ga0495637_0001052 | |||
| 1661 | Ga0495637_0002047 | |||
| 1662 | Ga0495637_0012730 | |||
| 1663 | Ga0495637_0038315 | |||
| 1664 | Ga0495643_0000128 | |||
| 1665 | Ga0495643_0019208 | |||
| 1666 | Ga0495643_0023004 | |||
| 1667 | Ga0495643_0023868 | |||
| 1668 | Ga0495643_0035835 | |||
| 1669 | Ga0495643_0056104 | |||
| 1670 | Ga0495644_0000285 | |||
| 1671 | Ga0495644_0003043 | |||
| 1672 | Ga0495644_0005804 | |||
| 1673 | Ga0495644_0011600 | |||
| 1674 | Ga0495648_0000301 | |||
| 1675 | Ga0495648_0001018 | |||
| 1676 | Ga0495648_0001295 | |||
| 1677 | Ga0495648_0001927 | |||
| 1678 | Ga0495648_0002616 | |||
| 1679 | Ga0495648_0014316 | |||
| 1680 | Ga0495648_0015794 | |||
| 1681 | Ga0495648_0032867 | |||
| 1682 | Ga0495648_0080573 | |||
| 1683 | Ga0495648_0123537 | |||
| 1684 | Ga0495666_0000163 | |||
| 1685 | Ga0495666_0004702 | |||
| 1686 | Ga0495666_0009551 | |||
| 1687 | Ga0495666_0028616 | |||
| 1688 | Ga0495642_0000003 | |||
| 1689 | Ga0495642_0003045 | |||
| 1690 | Ga0495652_0000297 | |||
| 1691 | Ga0495652_0026304 | |||
| 1692 | Ga0495652_0043207 | |||
| 1693 | Ga0495652_0144404 | |||
| 1694 | Ga0495652_0269986 | |||
| 1695 | Ga0495652_0306816 | |||
| 1696 | Ga0495654_0004030 | |||
| 1697 | Ga0495654_0006833 | |||
| 1698 | Ga0495654_0026823 | |||
| 1699 | Ga0495654_0082479 | |||
| 1700 | Ga0495654_0095589 | |||
| 1701 | Ga0495665_0005625 | |||
| 1702 | Ga0495640_0003960 | |||
| 1703 | Ga0495640_0037485 | |||
| 1704 | Ga0495586_0003796 | |||
| 1705 | Ga0495586_0004296 | |||
| 1706 | Ga0495586_0005646 | |||
| 1707 | Ga0495586_0081236 | |||
| 1708 | Ga0495587_0000075 | |||
| 1709 | Ga0495587_0007213 | |||
| 1710 | Ga0495587_0035238 | |||
| 1711 | Ga0495587_0072469 | |||
| 1712 | Ga0495587_0088047 | |||
| 1713 | Ga0495609_0000189 | |||
| 1714 | Ga0495609_0000409 | |||
| 1715 | Ga0495609_0005295 | |||
| 1716 | Ga0495597_0001707 | |||
| 1717 | Ga0495597_0003434 | |||
| 1718 | Ga0495597_0017476 | |||
| 1719 | Ga0495597_0054520 | |||
| 1720 | Ga0495645_0012825 | |||
| 1721 | Ga0495645_0014105 | |||
| 1722 | Ga0495645_0018312 | |||
| 1723 | Ga0495645_0078639 | |||
| 1724 | Ga0495645_0142020 | |||
| 1725 | Ga0495645_0148628 | |||
| 1726 | Ga0495622_0000193 | |||
| 1727 | Ga0495622_0016235 | |||
| 1728 | Ga0495622_0016666 | |||
| 1729 | Ga0495622_0021906 | |||
| 1730 | Ga0495622_0096014 | |||
| 1731 | Ga0495633_0145698 | |||
| 1732 | Ga0495667_0000056 | |||
| 1733 | Ga0495667_0004685 | |||
| 1734 | Ga0495656_0002117 | |||
| 1735 | Ga0495668_0000254 | |||
| 1736 | Ga0495668_0041345 | |||
| 1737 | Ga0495668_0093347 | |||
| 1738 | Ga0495634_0002041 | |||
| 1739 | Ga0495634_0019053 | |||
| 1740 | Ga0495634_0024309 | |||
| 1741 | Ga0495634_0108138 | |||
| 1742 | Ga0495611_0000633 | |||
| 1743 | Ga0495611_0011930 | |||
| 1744 | Ga0495625_0000010 | |||
| 1745 | Ga0495625_0001700 | |||
| 1746 | Ga0495625_0003117 | |||
| 1747 | Ga0495625_0004195 | |||
| 1748 | Ga0495625_0004359 | |||
| 1749 | Ga0495625_0012444 | |||
| 1750 | Ga0495625_0078851 | |||
| 1751 | Ga0495625_0087652 | |||
| 1752 | Ga0495635_0001785 | |||
| 1753 | Ga0495635_0023460 | |||
| 1754 | Ga0495635_0038688 | |||
| 1755 | Ga0495659_0000151 | |||
| 1756 | Ga0495659_0000208 | |||
| 1757 | Ga0495661_0000182 | |||
| 1758 | Ga0495661_0011300 | |||
| 1759 | Ga0495661_0014671 | |||
| 1760 | Ga0495661_0024815 | |||
| 1761 | Ga0495661_0027668 | |||
| 1762 | Ga0495661_0060901 | |||
| 1763 | Ga0495588_0019978 | |||
| 1764 | Ga0495588_0022337 | |||
| 1765 | Ga0495657_0000045 | |||
| 1766 | Ga0495657_0020203 | |||
| 1767 | Ga0495657_0052437 | |||
| 1768 | Ga0495657_0148134 | |||
| 1769 | Ga0495599_0000106 | |||
| 1770 | Ga0495599_0004282 | |||
| 1771 | Ga0495599_0086441 | |||
| 1772 | Ga0495623_0000674 | |||
| 1773 | Ga0495623_0001572 | |||
| 1774 | Ga0495623_0030734 | |||
| 1775 | Ga0495623_0032522 | |||
| 1776 | Ga0495623_0047017 | |||
| 1777 | Ga0495623_0161329 | |||
| 1778 | Ga0495646_0001199 | |||
| 1779 | Ga0495646_0002149 | |||
| 1780 | Ga0495646_0018596 | |||
| 1781 | Ga0495646_0019756 | |||
| 1782 | Ga0495647_0000474 | |||
| 1783 | Ga0495658_0004259 | |||
| 1784 | Ga0495658_0009663 | |||
| 1785 | Ga0495658_0021039 | |||
| 1786 | Ga0495669_0009589 | |||
| 1787 | Ga0495613_0008194 | |||
| 1788 | Ga0495613_0008905 | |||
| 1789 | Ga0495613_0014663 | |||
| 1790 | Ga0495613_0016259 | |||
| 1791 | Ga0495624_0006236 | |||
| 1792 | Ga0495624_0016557 | |||
| 1793 | Ga0495670_0000882 | |||
| 1794 | Ga0495670_0002639 | |||
| 1795 | Ga0495670_0004971 | |||
| 1796 | Ga0495670_0011771 | |||
| 1797 | Ga0495670_0104524 | |||
| 1798 | Ga0495671_0000066 | |||
| 1799 | Ga0495671_0003008 | |||
| 1800 | Ga0495671_0004245 | |||
| 1801 | Ga0495671_0006004 | |||
| 1802 | Ga0495671_0009195 | |||
| 1803 | Ga0495671_0020596 | |||
| 1804 | Ga0495671_0025192 | |||
| 1805 | Ga0495671_0037451 | |||
| 1806 | Ga0495671_0109443 | |||
| 1807 | Ga0495649_0001403 | |||
| 1808 | Ga0495649_0005704 | |||
| 1809 | Ga0495649_0005926 | |||
| 1810 | Ga0495649_0019563 | |||
| 1811 | Ga0495649_0025613 | |||
| 1812 | Ga0495649_0110820 | |||
| 1813 | Ga0495589_0001111 | |||
| 1814 | Ga0495589_0001801 | |||
| 1815 | Ga0495589_0002404 | |||
| 1816 | Ga0495589_0009273 | |||
| 1817 | Ga0495589_0026410 | |||
| 1818 | Ga0495600_0001294 | |||
| 1819 | Ga0495600_0001473 | |||
| 1820 | Ga0495660_0005010 | |||
| 1821 | Ga0495660_0006706 | |||
| 1822 | Ga0495660_0007268 | |||
| 1823 | Ga0495660_0010558 | |||
| 1824 | Ga0495660_0013785 | |||
| 1825 | Ga0495660_0017885 | |||
| 1826 | Ga0495660_0052712 | |||
| 1827 | Ga0495660_0053473 | |||
| 1828 | Ga0495660_0086256 | |||
| 1829 | Ga0495581_0006217 | |||
| 1830 | Ga0495604_0000016 | |||
| 1831 | Ga0495604_0004964 | |||
| 1832 | Ga0495604_0039758 | |||
| 1833 | Ga0495604_0040089 | |||
| 1834 | Ga0495674_0001800 | |||
| 1835 | Ga0495674_0017019 | |||
| 1836 | Ga0495674_0081363 | |||
| 1837 | Ga0495674_0184367 | |||
| 1838 | Ga0495672_0001364 | |||
| 1839 | Ga0495672_0001957 | |||
| 1840 | Ga0495672_0002436 | |||
| 1841 | Ga0495672_0006368 | |||
| 1842 | Ga0495672_0009024 | |||
| 1843 | Ga0495672_0014737 | |||
| 1844 | Ga0495672_0033766 | |||
| 1845 | Ga0495672_0037476 | |||
| 1846 | Ga0495672_0039515 | |||
| 1847 | Ga0495676_0000002 | |||
| 1848 | Ga0495676_0063417 | |||
| 1849 | Ga0495680_0000022 | |||
| 1850 | Ga0495680_0001752 | |||
| 1851 | Ga0495680_0002108 | |||
| 1852 | Ga0495680_0004609 | |||
| 1853 | Ga0495680_0028538 | |||
| 1854 | Ga0495680_0045334 | |||
| 1855 | Ga0495680_0051266 | |||
| 1856 | Ga0495680_0073283 | |||
| 1857 | Ga0495683_0000199 | |||
| 1858 | Ga0495683_0000215 | |||
| 1859 | Ga0495683_0006864 | |||
| 1860 | Ga0495683_0018932 | |||
| 1861 | Ga0495683_0049792 | |||
| 1862 | Ga0495687_000160 | |||
| 1863 | Ga0495687_000660 | |||
| 1864 | Ga0495687_000895 | |||
| 1865 | Ga0495687_000983 | |||
| 1866 | Ga0495687_001754 | |||
| 1867 | Ga0495675_0004223 | |||
| 1868 | Ga0495675_0028299 | |||
| 1869 | Ga0495677_0000703 | |||
| 1870 | Ga0495679_000394 | |||
| 1871 | Ga0495679_001206 | |||
| 1872 | Ga0495679_005805 | |||
| 1873 | Ga0495685_017647 | |||
| 1874 | Ga0495673_0000169 | |||
| 1875 | Ga0495673_0000251 | |||
| 1876 | Ga0495673_0000803 | |||
| 1877 | Ga0495673_0001258 | |||
| 1878 | Ga0495673_0002267 | |||
| 1879 | Ga0495673_0002542 | |||
| 1880 | Ga0495673_0002685 | |||
| 1881 | Ga0495673_0003871 | |||
| 1882 | Ga0495673_0003974 | |||
| 1883 | Ga0495673_0004659 | |||
| 1884 | Ga0495673_0006365 | |||
| 1885 | Ga0495673_0006599 | |||
| 1886 | Ga0495673_0014777 | |||
| 1887 | Ga0495673_0036592 | |||
| 1888 | Ga0495673_0039283 | |||
| 1889 | Ga0495673_0041898 | |||
| 1890 | Ga0495681_0000128 | |||
| 1891 | Ga0495681_0000166 | |||
| 1892 | Ga0495681_0000180 | |||
| 1893 | Ga0495681_0000291 | |||
| 1894 | Ga0495681_0001419 | |||
| 1895 | Ga0495681_0004307 | |||
| 1896 | Ga0495681_0005131 | |||
| 1897 | Ga0495681_0010269 | |||
| 1898 | Ga0495681_0023797 | |||
| 1899 | Ga0495681_0027546 | |||
| 1900 | Ga0495681_0027841 | |||
| 1901 | Ga0495681_0028787 | |||
| 1902 | Ga0495681_0029154 | |||
| 1903 | Ga0495681_0036760 | |||
| 1904 | Ga0495684_0069837 | |||
| 1905 | Ga0495684_0102402 | |||
| 1906 | Ga0495684_0102603 | |||
| 1907 | Ga0495686_0002254 | |||
| 1908 | Ga0495686_0023196 | |||
| 1909 | Ga0495593_0000146 | |||
| 1910 | Ga0495593_0008336 | |||
| 1911 | Ga0495593_0021830 | |||
| 1912 | Ga0495593_0124530 | |||
| 1913 | Ga0495602_0000088 | |||
| 1914 | Ga0495602_0054472 | |||
| 1915 | Ga0495602_0112270 | |||
| 1916 | Ga0495626_0000007 | |||
| 1917 | Ga0495626_0000055 | |||
| 1918 | Ga0495626_0000108 | |||
| 1919 | Ga0495626_0000131 | |||
| 1920 | Ga0495626_0000224 | |||
| 1921 | Ga0495626_0001055 | |||
| 1922 | Ga0495626_0002053 | |||
| 1923 | Ga0496100_0006690 | |||
| 1924 | Ga0496101_0064778 | |||
| 1925 | Ga0496102_0000052 | |||
| 1926 | Ga0496102_0039709 | |||
| 1927 | Ga0496102_0218141 | |||
| 1928 | Ga0496102_0352586 | |||
| 1929 | Ga0496103_0001347 | |||
| 1930 | Ga0496104_0002929 | |||
| 1931 | Ga0496104_0014350 | |||
| 1932 | Ga0496105_0198246 | |||
| 1933 | Ga0496105_0206916 | |||
| 1934 | Ga0496106_0012184 | |||
| 1935 | Ga0496106_0102218 | |||
| 1936 | Ga0496107_0042369 | |||
| 1937 | Ga0496108_0001442 | |||
| 1938 | Ga0496108_0034098 | |||
| 1939 | Ga0496108_0098297 | |||
| 1940 | Ga0496109_0015259 | |||
| 1941 | Ga0496110_0016894 | |||
| 1942 | Ga0496110_0019426 | |||
| 1943 | Ga0496110_0024401 | |||
| 1944 | Ga0496110_0024744 | |||
| 1945 | Ga0496110_0134710 | |||
| 1946 | Ga0496110_0216431 | |||
| 1947 | Ga0496111_0081389 | |||
| 1948 | Ga0496111_0197930 | |||
| 1949 | Ga0496112_0083538 | |||
| 1950 | Ga0496112_0088004 | |||
| 1951 | Ga0496112_0136689 | |||
| 1952 | Ga0496113_0002497 | |||
| 1953 | Ga0496114_0005062 | |||
| 1954 | Ga0496114_0023471 | |||
| 1955 | Ga0496115_0007311 | |||
| 1956 | Ga0496115_0027900 | |||
| 1957 | Ga0496116_0001072 | |||
| 1958 | Ga0496116_0002130 | |||
| 1959 | Ga0496116_0003028 | |||
| 1960 | Ga0496116_0016103 | |||
| 1961 | Ga0496116_0022568 | |||
| 1962 | Ga0496116_0135538 | |||
| 1963 | Ga0496117_0000702 | |||
| 1964 | Ga0496117_0000899 | |||
| 1965 | Ga0496117_0127936 | |||
| 1966 | Ga0496118_0004432 | |||
| 1967 | Ga0496118_0023188 | |||
| 1968 | Ga0496118_0048656 | |||
| 1969 | Ga0496118_0100492 | |||
| 1970 | Ga0496119_0018083 | |||
| 1971 | Ga0496120_0002347 | |||
| 1972 | Ga0496121_0003119 | |||
| 1973 | Ga0496121_0005468 | |||
| 1974 | Ga0496121_0006023 | |||
| 1975 | Ga0496121_0016684 | |||
| 1976 | Ga0496121_0052410 | |||
| 1977 | Ga0496121_0084682 | |||
| 1978 | Ga0496122_0000029 | |||
| 1979 | Ga0496122_0002727 | |||
| 1980 | Ga0496122_0023851 | |||
| 1981 | Ga0496122_0025807 | |||
| 1982 | Ga0496122_0042847 | |||
| 1983 | Ga0496123_0001389 | |||
| 1984 | Ga0496123_0002360 | |||
| 1985 | Ga0496123_0024543 | |||
| 1986 | Ga0496123_0025326 | |||
| 1987 | Ga0496123_0112583 | |||
| 1988 | Ga0496124_0000274 | |||
| 1989 | Ga0496124_0001595 | |||
| 1990 | Ga0496124_0002650 | |||
| 1991 | Ga0496124_0007470 | |||
| 1992 | Ga0496124_0012628 | |||
| 1993 | Ga0496124_0040420 | |||
| 1994 | Ga0496124_0100856 | |||
| 1995 | Ga0496125_0000478 | |||
| 1996 | Ga0496125_0004272 | |||
| 1997 | Ga0496125_0015934 | |||
| 1998 | Ga0496125_0021685 | |||
| 1999 | Ga0496125_0028529 | |||
| 2000 | Ga0496125_0048182 | |||
| 2001 | Ga0496125_0111178 | |||
| 2002 | Ga0496126_0052070 | |||
| 2003 | Ga0496126_0104165 | |||
| 2004 | Ga0495678_001170 | |||
| 2005 | Ga0495678_003067 | |||
| 2006 | Ga0495678_004999 | |||
| 2007 | Ga0495678_005032 | |||
| 2008 | Ga0495678_008426 | |||
| 2009 | Ga0495678_010382 | |||
| 2010 | Ga0495678_014533 | |||
| 2011 | Ga0495682_0000072 | |||
| 2012 | Ga0495682_0001935 | |||
| 2013 | Ga0495682_0016677 | |||
| 2014 | Ga0495682_0025577 | |||
| 2015 | Ga0501034_0070429 | |||
| 2016 | Ga0501036_0000592 | |||
| 2017 | Ga0501037_0031001 | |||
| 2018 | Ga0501038_0010432 | |||
| 2019 | Ga0501039_0039404 | |||
| 2020 | Ga0501039_0287824 | |||
| 2021 | Ga0501040_0029439 | |||
| 2022 | Ga0501041_0000044 | |||
| 2023 | Ga0501043_0012572 | |||
| 2024 | Ga0501046_0000460 | |||
| 2025 | Ga0501047_0225143 | |||
| 2026 | Ga0501048_0133167 | |||
| 2027 | Ga0501068_0012868 | |||
| 2028 | Ga0501070_0061748 | |||
| 2029 | Ga0501071_0017099 | |||
| 2030 | Ga0501072_0027879 | |||
| 2031 | Ga0501072_0291825 | |||
| 2032 | Ga0501076_0000973 | |||
| 2033 | Ga0501077_0004904 | |||
| 2034 | Ga0501079_0000447 | |||
| 2035 | Ga0501080_0039938 | |||
| 2036 | Ga0501035_0064677 | |||
| 2037 | nmdc:mga06z11_37854_c1 | |||
| 2038 | nmdc:mga07m45_8732_c1 | |||
| 2039 | nmdc:mga07m45_87532_c1 | |||
| 2040 | nmdc:mga09592_129037_c1 | |||
| 2041 | nmdc:mga08y16_78195_c1 | |||
| 2042 | nmdc:mga08y16_97668_c1 | |||
| 2043 | nmdc:mga0n895_152214_c1 | |||
| 2044 | nmdc:mga0n895_33342_c1 | |||
| 2045 | nmdc:mga0rr50_64193_c1 | |||
| 2046 | nmdc:mga08x19_10865_c1 | |||
| 2047 | nmdc:mga08x19_198147_c1 | |||
| 2048 | nmdc:mga08x19_29126_c1 | |||
| 2049 | nmdc:mga08x19_9983_c1 | |||
| 2050 | nmdc:mga0a205_32630_c1 | |||
| 2051 | nmdc:mga0a205_672_c1 | |||
| 2052 | Ga0495601_0006955 | |||
| 2053 | Ga0495601_0192028 | |||
| 2054 | Ga0495612_0009938 | |||
| 2055 | Ga0500607_001619 | |||
| 2056 | Ga0500618_000352 | |||
| 2057 | Ga0501084_0003932 | |||
| 2058 | Ga0501082_0020960 | |||
| 2059 | Ga0530510_0000149 | |||
| 2060 | 2511274670 | |||
| 2061 | 2511275861 | |||
| 2062 | 2511279992 | |||
| 2063 | 2511303591 | |||
| 2064 | 2511312603 | |||
| 2065 | 2511323005 | |||
| 2066 | 2511335618 | |||
| 2067 | 2511340841 | |||
| 2068 | 2511346462 | |||
| 2069 | 2511350282 | |||
| 2070 | 2511354780 | |||
| 2071 | 2511377063 | |||
| 2072 | 2555248849 | |||
| 2073 | 2599905771 | |||
| 2074 | 2599944345 | |||
| 2075 | 2599954817 | |||
| 2076 | 2599958528 | |||
| 2077 | 2599971499 | |||
| 2078 | 2599984255 | |||
| 2079 | 2599991463 | |||
| 2080 | 2600001157 | |||
| 2081 | 2600048946 | |||
| 2082 | 2601625251 | |||
| 2083 | 2624491550 | |||
| 2084 | 2643843878 | |||
| 2085 | 2643860654 | |||
| 2086 | 2643953181 | |||
| 2087 | 2643981481 | |||
| 2088 | 2644025178 | |||
| 2089 | 2644028587 | |||
| 2090 | 2644119601 | |||
| 2091 | 2644188245 | |||
| 2092 | 2738691837 | |||
| 2093 | 2739201760 | |||
| 2094 | 2739261922 | |||
| 2095 | 2739267611 | |||
| 2096 | 2765584585 | |||
| 2097 | 2774118781 | |||
| 2098 | 2784312419 | |||
| 2099 | 2792834432 | |||
| 2100 | 2808942750 | |||
| 2101 | 2808958159 | |||
| 2102 | 2809035388 | |||
| 2103 | 2857541106 | |||
| 2104 | 2858953410 | |||
| 2105 | 2860345189 | |||
| 2106 | 2887379399 | |||
| 2107 | 2895503024 | |||
| 2108 | 2895513063 | |||
| 2109 | 2895523075 | |||
| 2110 | 2895526978 | |||
| 2111 | 2904554407 | |||
| 2112 | 2912966194 | |||
| 2113 | 2919461557 | |||
| 2114 | 2919700887 | |||
| 2115 | 2931403215 | |||
| 2116 | 2939642404 | |||
| 2117 | 2941483568 | |||
| 2118 | 3007513694 | |||
| 2119 | 3007623242 | |||
| 2120 | 8019778444 | |||
| 2121 | 8054288002 | |||
| 2122 | 8054932916 | |||
| 2123 | 8055882924 | |||
| 2124 | 8056118591 | |||
| 2125 | 8056129973 | |||
| 2126 | 8056140188 | |||
| 2127 | 8056159028 | |||
| 2128 | 8056181410 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nzs-assembly1.cif.gz_A | crystal structure of beta-ketothiolase bktb b from ralstonia eutropha h16 | 0.9876 | 5 | 394 |
| 4w61-assembly4.cif.gz_P | crystal structure of beta-ketoacyl thiolase b (bktb) from ralstonia eutropha | 0.9865 | 5 | 393 |
| 4w61-assembly2.cif.gz_E | crystal structure of beta-ketoacyl thiolase b (bktb) from ralstonia eutropha | 0.9863 | 5 | 394 |
| 4w61-assembly2.cif.gz_H | crystal structure of beta-ketoacyl thiolase b (bktb) from ralstonia eutropha | 0.9857 | 5 | 394 |
| 4w61-assembly3.cif.gz_K | crystal structure of beta-ketoacyl thiolase b (bktb) from ralstonia eutropha | 0.9855 | 5 | 394 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0G2KML7_1_235_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9931 | 159 | 393 | 3.40.47.10 |
| af_A0A0G2KML7_1_235_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9889 | 159 | 393 | 3.40.47.10 |
| af_P76461_265_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9874 | 267 | 394 | 3.40.47.10 |
| af_A0A096MJY8_281_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9867 | 278 | 388 | 3.40.47.10 |
| af_P13437_5_396_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9836 | 5 | 394 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519H2S4-F1-model_v4 | acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.9956 | 261 | 394 |
GO:0003985
GO:0006635 GO:0010124 |
| AF-A0A1H7DGC5-F1-model_v4 | acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.995 | 188 | 394 |
GO:0003988
GO:0006635 GO:0010124 |
| AF-A0A7V4PRG6-F1-model_v4 | acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.9939 | 273 | 394 |
GO:0003988
GO:0006635 GO:0010124 |
| AF-A0A532U5E8-F1-model_v4 | Acetyl-CoA acetyltransferase (EC 2.3.1.9) | 0.9917 | 143 | 392 |
GO:0003985
|
| AF-A0A1F7L7J7-F1-model_v4 | Thiolase C-terminal domain-containing protein | 0.9915 | 283 | 392 |
GO:0003988
GO:0006635 GO:0010124 |