F489356

General Info

Members Datasets Scaffolds Average Seq Length
1064 740 2126 578

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0000770|Ga0495610_0000770_20372_22162
Length 596
Sequence MPRNGSFCLPIAYRVPSCAIMSIIQTLAARSGRLVSLDFGARGGGRRLIKPRRKSASPRSRLAIVGGAIVVAYSVIFGKLVYYAEQGGIDISSIPPGPSMMASRPEIDDRNGQVLATDIRTVSMFAEPIKIVDVDDAVEKLSSVFPDLDRKTMYERLSNKRSHFAWLKRQLSPKQQSEVLKLGIPAIGFRPEVKRFYPGGSTAAHILGYVDIDNHGVAGMEKYLDDQGLSALASTGLAASDSLAPVRLSIDLRVQNIVHDVVVDALTRYQSKAAGAVILDVHTGEVLAMASAPDFDPNDPNAAGSRDGWLNRMSNGTDEMGSVFKTFSMAMAFDTGTVKMSDSFDASTPLHYGGFTIHDDRDVPRRVLSVAEIFRYSSNVGTAKMMEKVGMDNQRAYLTRFGLLSKMQTELPEVKTPSQPRVWKMINSLTAAFGHGVATTPMQTAVAGAALMDGGKLIEPTFLPRTEEEAEKTATVVVKKSTSDVIKSLFKLNGEQGSGRFADVPGFHVGGKTGTANKVINGHYSHTLSFNSFLGAFPIDNPKYVILSYIDQPLTGLYNLNLAAETAAPMVADIVKRSAPILGVQPDFSKNLLVGY

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
41 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
50 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
51 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
52 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
53 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
54 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
55 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
91 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
92 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
172 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
173 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
179 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
182 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
183 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
184 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
185 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
186 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
187 2509276019 Ensifer aridi TW10 Isolate Nodule
188 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
189 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
190 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
191 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
192 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
193 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
194 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
195 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
196 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
197 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
198 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
199 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
200 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
201 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
202 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
203 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
204 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
205 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
206 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
207 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
208 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
209 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
210 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
211 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
212 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
213 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
214 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
215 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
216 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
217 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
218 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
219 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
220 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
221 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
222 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
223 2516143018 Ensifer sp. BR816 Isolate Nodule
224 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
225 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
226 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
227 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
228 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
229 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
230 2519899620 Rhizobium sp. Pop5 Isolate Nodule
231 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
232 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
233 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
234 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
235 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
236 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
237 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
238 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
239 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
240 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
241 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
242 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
243 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
244 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
245 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
246 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
247 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
248 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
249 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
250 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
251 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
252 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
253 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
254 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
255 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
256 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
257 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
258 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
259 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
260 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
261 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
262 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
263 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
264 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
265 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
266 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
267 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
268 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
269 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
270 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
271 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
272 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
273 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
274 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
275 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
276 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
277 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
278 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
279 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
280 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
281 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
282 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
283 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
284 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
285 2643221557 Ensifer sp. Root558 Isolate Unclassified
286 2643221558 Rhizobium sp. Root149 Isolate Unclassified
287 2643221568 Rhizobium sp. Root564 Isolate Unclassified
288 2643221582 Rhizobium sp. Root651 Isolate Unclassified
289 2643221599 Rhizobium sp. Root708 Isolate Unclassified
290 2643221607 Rhizobium sp. Root73 Isolate Unclassified
291 2643221610 Ensifer sp. Root74 Isolate Unclassified
292 2643221618 Ensifer sp. Root231 Isolate Unclassified
293 2643221626 Ensifer sp. Root31 Isolate Unclassified
294 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
295 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
296 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
297 2643221655 Ensifer sp. Root1252 Isolate Unclassified
298 2643221659 Ensifer sp. Root127 Isolate Unclassified
299 2643221668 Ensifer sp. Root423 Isolate Unclassified
300 2643221675 Ensifer sp. Root1298 Isolate Unclassified
301 2643221680 Ensifer sp. Root1312 Isolate Unclassified
302 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
303 2643221688 Rhizobium sp. Root482 Isolate Unclassified
304 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
305 2643221693 Rhizobium sp. Root491 Isolate Unclassified
306 2643221698 Ensifer sp. Root142 Isolate Unclassified
307 2643221712 Ensifer sp. Root258 Isolate Unclassified
308 2643221723 Ensifer sp. Root278 Isolate Unclassified
309 2643221726 Ensifer sp. Root954 Isolate Unclassified
310 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
311 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
312 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
313 2718217882 Rhizobium sp. N741 Isolate Nodule
314 2718217927 Rhizobium sp. N324 Isolate Nodule
315 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
316 2718218009 Rhizobium sp. N561 Isolate Nodule
317 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
318 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
319 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
320 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
321 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
322 2718218363 Rhizobium sp. N113 Isolate Nodule
323 2718218365 Rhizobium sp. N731 Isolate Nodule
324 2718218366 Rhizobium sp. N621 Isolate Nodule
325 2718218423 Rhizobium sp. N941 Isolate Nodule
326 2721755514 Rhizobium sp. N6212 Isolate Nodule
327 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
328 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
329 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
330 2721755809 Rhizobium sp. N541 Isolate Nodule
331 2721755810 Rhizobium sp. N871 Isolate Nodule
332 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
333 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
334 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
335 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
336 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
337 2728369365 Rhizobium sp. N1341 Isolate Nodule
338 2728369397 Rhizobium sp. N1314 Isolate Nodule
339 2738541293 Rhizobium sp. GV031 Isolate Unclassified
340 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
341 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
342 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
343 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
344 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
345 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
346 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
347 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
348 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
349 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
350 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
351 2791355256 Rhizobium sp. M10 Isolate Nodule
352 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
353 2791355260 Rhizobium sp. L9 Isolate Nodule
354 2791355261 Rhizobium sp. J15 Isolate Nodule
355 2791355262 Rhizobium sp. M1 Isolate Nodule
356 2791355263 Rhizobium chutanense C5 Isolate Nodule
357 2791355264 Rhizobium sp. S9 Isolate Nodule
358 2791355265 Rhizobium sp. H4 Isolate Nodule
359 2791355266 Rhizobium sp. L43 Isolate Nodule
360 2791355267 Rhizobium sp. L18 Isolate Nodule
361 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
362 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
363 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
364 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
365 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
366 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
367 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
368 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
369 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
370 2802429633 Rhizobium anhuiense J3 Isolate Nodule
371 2802429634 Rhizobium anhuiense S10 Isolate Nodule
372 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
373 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
374 2802429637 Rhizobium anhuiense C15 Isolate Nodule
375 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
376 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
377 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
378 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
379 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
380 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
381 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
382 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
383 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
384 2838048938 Rhizobium pisi 27/80 Isolate Nodule
385 2838061910 Rhizobium phaseoli L15 Isolate Nodule
386 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
387 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
388 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
389 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
390 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
391 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
392 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
393 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
394 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
395 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
396 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
397 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
398 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
399 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
400 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
401 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
402 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
403 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
404 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
405 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
406 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
407 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
408 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
409 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
410 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
411 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
412 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
413 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
414 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
415 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
416 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
417 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
418 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
419 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
420 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
421 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
422 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
423 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
424 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
425 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
426 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
427 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
428 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
429 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
430 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
431 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
432 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
433 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
434 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
435 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
436 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
437 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
438 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
439 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
440 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
441 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
442 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
443 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
444 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
445 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
446 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
447 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
448 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
449 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
450 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
451 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
452 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
453 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
454 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
455 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
456 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
457 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
458 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
459 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
460 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
461 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
462 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
463 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
464 2844163670 Ensifer sp. 1H6 Isolate Unclassified
465 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
466 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
467 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
468 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
469 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
470 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
471 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
472 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
473 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
474 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
475 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
476 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
477 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
478 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
479 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
480 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
481 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
482 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
483 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
484 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
485 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
486 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
487 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
488 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
489 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
490 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
491 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
492 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
493 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
494 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
495 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
496 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
497 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
498 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
499 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
500 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
501 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
502 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
503 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
504 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
505 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
506 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
507 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
508 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
509 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
510 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
511 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
512 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
513 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
514 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
515 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
516 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
517 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
518 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
519 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
520 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
521 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
522 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
523 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
524 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
525 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
526 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
527 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
528 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
529 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
530 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
531 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
532 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
533 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
534 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
535 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
536 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
537 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
538 2933599457 Rhizobium phaseoli M3 Isolate Nodule
539 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
540 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
541 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
542 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
543 2936381700 Rhizobium chutanense C16 Isolate Unclassified
544 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
545 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
546 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
547 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
548 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
549 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
550 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
551 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
552 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
553 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
554 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
555 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
556 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
557 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
558 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
559 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
560 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
561 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
562 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
563 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
564 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
565 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
566 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
567 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
568 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
569 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
570 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
571 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
572 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
573 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
574 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
575 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
576 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
577 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
578 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
579 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
580 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
581 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
582 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
583 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
584 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
585 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
586 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
587 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
588 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
589 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
590 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
591 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
592 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
593 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
594 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
595 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
596 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
597 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
598 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
599 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
600 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
601 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
602 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
603 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
604 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
605 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
606 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
607 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
608 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
609 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
610 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
611 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
612 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
613 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
614 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
615 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
616 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
617 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
618 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
619 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
620 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
621 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
622 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
623 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
624 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
625 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
626 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
627 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
628 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
629 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
630 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
631 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
632 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
633 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
634 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
635 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
636 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
637 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
638 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
639 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
640 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
641 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
642 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
643 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
644 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
645 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
646 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
647 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
648 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
649 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
650 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
651 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
652 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
653 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
654 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
655 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
656 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
657 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
658 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
659 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
660 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
661 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
662 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
663 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
664 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
665 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
666 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
667 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
668 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
669 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
670 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
671 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
672 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
673 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
674 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
675 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
676 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
677 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
678 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
679 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
680 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
681 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
682 2996887358 Rhizobium sp. R711 Isolate Nodule
683 2996893221 Rhizobium sp. R635 Isolate Nodule
684 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
685 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
686 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
687 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
688 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
689 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
690 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
691 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
692 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
693 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
694 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
695 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
696 8005258706 Rhizobium sp. R693 Isolate Nodule
697 8005275841 Rhizobium sp. N4311 Isolate Nodule
698 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
699 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
700 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
701 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
702 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
703 8005321885 Rhizobium sp. R72 Isolate Nodule
704 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
705 8005382845 Rhizobium sp. R634 Isolate Nodule
706 8005395548 Rhizobium sp. R339 Isolate Nodule
707 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
708 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
709 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
710 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
711 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
712 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
713 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
714 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
715 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
716 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
717 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
718 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
719 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
720 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
721 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
722 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
723 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
724 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
725 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
726 8018176218 Rhizobium sp. N122 Isolate Nodule
727 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
728 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
729 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
730 8024501048 Rhizobium sp. H4 Isolate Nodule
731 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
732 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
733 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
734 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
735 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
736 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
737 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
738 8056382006 Rhizobium croatiense 13T Isolate Nodule
739 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
740 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.08
Metatranscriptomes 0
Isolates 55.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 20.11
Nodule 41.17
Rhizoplane 1.79
Rhizosphere 18.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0000770 3300046512 Bacteria 30242
2 JGI24740J21852_10000015 3300001979 Bacteria 58951
3 JGI24740J21852_10000464 3300001979 Bacteria 17398
4 JGI25155J39150_1000001 3300002704 Bacteria 354543
5 JGI25155J39150_1000195 3300002704 Bacteria 25809
6 JGI25156J39149_1000001 3300002705 Bacteria 354557
7 JGI25156J39149_1000433 3300002705 Bacteria 25809
8 JGI25162J39368_1000366 3300002737 Bacteria 38535
9 JGI25162J39368_1000368 3300002737 Bacteria 38495
10 JGI25162J39368_1000477 3300002737 Bacteria 30773
11 JGI25162J39368_1000802 3300002737 Bacteria 20890
12 JGI25154J39366_1000122 3300002738 Bacteria 61892
13 JGI25154J39366_1000360 3300002738 Bacteria 25809
14 JGI25158J39367_1000038 3300002739 Bacteria 30017
15 JGI25158J39367_1000694 3300002739 Bacteria 6532
16 JGI25158J39367_1004417 3300002739 Bacteria 2112
17 JGI25157J39369_1000044 3300002741 Bacteria 122466
18 JGI25157J39369_1000458 3300002741 Bacteria 25809
19 JGI25152J39213_1000636 3300002773 Bacteria 18557
20 JGI25152J39213_1001023 3300002773 Bacteria 13396
21 JGI25152J39213_1005336 3300002773 Bacteria 3780
22 JGI25152J39213_1011099 3300002773 Bacteria 2013
23 JGI25152J39213_1011145 3300002773 Bacteria 2007
24 JGI25150J39212_1000026 3300002774 Bacteria 107804
25 JGI25150J39212_1000107 3300002774 Bacteria 48306
26 JGI25150J39212_1005870 3300002774 Bacteria 2582
27 JGI25159J45721_1000014 3300002987 Bacteria 147809
28 JGI25159J45721_1000424 3300002987 Bacteria 19457
29 JGI25159J45721_1000493 3300002987 Bacteria 18075
30 JGI25151J46595_10000053 3300003187 Bacteria 156841
31 JGI25151J46595_10000374 3300003187 Bacteria 46807
32 JGI25151J46595_10000839 3300003187 Bacteria 24488
33 JGI25151J46595_10003886 3300003187 Bacteria 8064
34 JGI25151J46595_10008401 3300003187 Bacteria 4969
35 JGI25151J46595_10033516 3300003187 Bacteria 1978
36 JGI25165J46597_1000516 3300003214 Bacteria 36635
37 JGI25165J46597_1000603 3300003214 Bacteria 30773
38 JGI25165J46597_1001042 3300003214 Bacteria 18102
39 JGI25165J46597_1001132 3300003214 Bacteria 16749
40 JGI25165J46597_1002650 3300003214 Bacteria 5382
41 JGI25153J46596_10000696 3300003215 Bacteria 20557
42 JGI25153J46596_10005690 3300003215 Bacteria 6503
43 JGI25153J46596_10009242 3300003215 Bacteria 4611
44 JGI25153J46596_10012015 3300003215 Bacteria 3781
45 JGI25153J46596_10027126 3300003215 Bacteria 2013
46 JGI25153J46596_10027232 3300003215 Bacteria 2007
47 JGI25160J50197_1000001 3300003354 Bacteria 782301
48 JGI25160J50197_1000020 3300003354 Bacteria 232739
49 JGI25160J50197_1002863 3300003354 Bacteria 7895
50 JGI25160J50197_1018252 3300003354 Bacteria 2192
51 JGI25161J50226_1000001 3300003374 Bacteria 655036
52 JGI25161J50226_1000010 3300003374 Bacteria 214823
53 JGI25161J50226_1000174 3300003374 Bacteria 43080
54 JGI25161J50226_1001138 3300003374 Bacteria 8895
55 JGI25161J50226_1003445 3300003374 Bacteria 3611
56 Ga0055526_1001490 3300003771 Bacteria 16607
57 Ga0055526_1003506 3300003771 Bacteria 9921
58 Ga0055526_1003741 3300003771 Bacteria 9498
59 Ga0055524_1002170 3300003775 Bacteria 10327
60 Ga0055524_1004376 3300003775 Bacteria 6520
61 Ga0055524_1007091 3300003775 Bacteria 4805
62 Ga0055536_1001187 3300003781 Bacteria 16224
63 Ga0055536_1002960 3300003781 Bacteria 9313
64 Ga0055528_1000584 3300003790 Bacteria 27492
65 Ga0055528_1001199 3300003790 Bacteria 16717
66 Ga0055528_1001734 3300003790 Bacteria 12611
67 Ga0055528_1002830 3300003790 Bacteria 9076
68 Ga0055528_1008190 3300003790 Bacteria 4519
69 Ga0055528_1021493 3300003790 Bacteria 2046
70 Ga0055530_10016062 3300003791 Bacteria 2410
71 Ga0055540_1000929 3300003792 Bacteria 19079
72 Ga0055540_1005992 3300003792 Bacteria 4928
73 Ga0055540_1007010 3300003792 Bacteria 4345
74 Ga0055540_1009093 3300003792 Bacteria 3482
75 Ga0055540_1015257 3300003792 Bacteria 2247
76 Ga0055531_10004794 3300003794 Bacteria 8079
77 Ga0055531_10007721 3300003794 Bacteria 5807
78 Ga0058692_1008129 3300003856 Bacteria 2720
79 Ga0055543_1000003 3300004625 Bacteria 358656
80 Ga0055543_1000047 3300004625 Bacteria 111073
81 Ga0055543_1000353 3300004625 Bacteria 31219
82 Ga0055543_1000500 3300004625 Bacteria 22620
83 Ga0055543_1001281 3300004625 Bacteria 10341
84 Ga0065165_1000013 3300005262 Bacteria 301887
85 Ga0065165_1000068 3300005262 Bacteria 170609
86 Ga0065165_1008678 3300005262 Bacteria 4705
87 Ga0065165_1009678 3300005262 Bacteria 4277
88 Ga0070670_100000515 3300005331 Bacteria 30924
89 Ga0070670_100002993 3300005331 Bacteria 13983
90 Ga0070665_100040748 3300005548 Bacteria 4668
91 Ga0068856_100007936 3300005614 Bacteria 10367
92 Ga0075365_10005814 3300006038 Bacteria 6702
93 Ga0075363_100027951 3300006048 Bacteria 2897
94 Ga0075364_10012850 3300006051 Bacteria 5136
95 Ga0075367_10063647 3300006178 Bacteria 2205
96 Ga0075369_10013843 3300006186 Bacteria 3211
97 Ga0075370_10010432 3300006353 Bacteria 4858
98 Ga0075370_10010686 3300006353 Bacteria 4811
99 Ga0079104_1001253 3300006946 Bacteria 17716
100 Ga0079104_1006084 3300006946 Bacteria 4665
101 Ga0105240_10000076 3300009093 Bacteria 198848
102 Ga0105240_10000201 3300009093 Bacteria 121112
103 Ga0105248_10077623 3300009177 Bacteria 3734
104 Ga0105237_10000226 3300009545 Bacteria 79798
105 Ga0105237_10010705 3300009545 Bacteria 9734
106 Ga0123341_1000007 3300009765 Bacteria 147072
107 Ga0123342_1004784 3300009766 Bacteria 20320
108 Ga0123342_1013992 3300009766 Bacteria 7821
109 Ga0105239_10000641 3300010375 Bacteria 49765
110 Ga0105239_10009932 3300010375 Bacteria 10687
111 Ga0157371_10000017 3300013102 Bacteria 320830
112 Ga0157370_10000455 3300013104 Bacteria 51231
113 Ga0157370_10000461 3300013104 Bacteria 50850
114 Ga0157370_10005282 3300013104 Bacteria 14508
115 Ga0157369_10016027 3300013105 Bacteria 8433
116 Ga0157369_10039605 3300013105 Bacteria 5149
117 Ga0171463_1003 3300013249 Bacteria 695693
118 Ga0182007_10000314 3300015262 Bacteria 30873
119 Ga0182007_10004384 3300015262 Bacteria 6406
120 Ga0182005_1001330 3300015265 Bacteria 10088
121 Ga0182005_1003578 3300015265 Bacteria 5231
122 Ga0183363_1156 3300015690 Bacteria 16690
123 Ga0214544_1001800 3300021320 Bacteria 45046
124 Ga0214542_1000012 3300021321 Bacteria 235800
125 Ga0214543_1000024 3300021327 Bacteria 235745
126 Ga0214543_1000038 3300021327 Bacteria 182106
127 Ga0228711_1000008 3300022739 Bacteria 169893
128 Ga0228710_1000009 3300022740 Bacteria 169770
129 Ga0209435_100012 3300025206 Bacteria 401621
130 Ga0209435_100122 3300025206 Bacteria 28422
131 Ga0209436_100025 3300025208 Bacteria 93575
132 Ga0209436_100150 3300025208 Bacteria 33510
133 Ga0209436_101065 3300025208 Bacteria 10387
134 Ga0209437_100051 3300025233 Bacteria 392523
135 Ga0209437_100064 3300025233 Bacteria 334360
136 Ga0209437_100098 3300025233 Bacteria 229766
137 Ga0209437_100469 3300025233 Bacteria 30961
138 Ga0207425_1000075 3300025245 Bacteria 107452
139 Ga0207425_1000113 3300025245 Bacteria 77236
140 Ga0207425_1005180 3300025245 Bacteria 3756
141 Ga0207425_1006502 3300025245 Bacteria 3190
142 Ga0207425_1009350 3300025245 Bacteria 2441
143 Ga0209646_1000026 3300025246 Bacteria 401621
144 Ga0209646_1000385 3300025246 Bacteria 28422
145 Ga0209026_1000014 3300025250 Bacteria 401621
146 Ga0209026_1000501 3300025250 Bacteria 28422
147 Ga0209759_1000012 3300025256 Bacteria 401621
148 Ga0209759_1000743 3300025256 Bacteria 28422
149 Ga0209129_1000156 3300025258 Bacteria 107484
150 Ga0209129_1000181 3300025258 Bacteria 89982
151 Ga0209129_1000218 3300025258 Bacteria 66076
152 Ga0209129_1000348 3300025258 Bacteria 39224
153 Ga0209129_1001767 3300025258 Bacteria 11565
154 Ga0209129_1005932 3300025258 Bacteria 4125
155 Ga0209129_1006736 3300025258 Bacteria 3622
156 Ga0209129_1007796 3300025258 Bacteria 3100
157 Ga0209129_1008863 3300025258 Bacteria 2734
158 Ga0209233_1000081 3300025261 Bacteria 336832
159 Ga0209233_1000095 3300025261 Bacteria 303783
160 Ga0209233_1000113 3300025261 Bacteria 253455
161 Ga0209233_1000217 3300025261 Bacteria 106187
162 Ga0209233_1000375 3300025261 Bacteria 39219
163 Ga0209233_1000427 3300025261 Bacteria 30799
164 Ga0209673_1000010 3300025273 Bacteria 596656
165 Ga0209673_1000117 3300025273 Bacteria 172081
166 Ga0209673_1000151 3300025273 Bacteria 148103
167 Ga0209673_1000863 3300025273 Bacteria 39346
168 Ga0209673_1001685 3300025273 Bacteria 18869
169 Ga0209673_1002134 3300025273 Bacteria 14747
170 Ga0209673_1009188 3300025273 Bacteria 4312
171 Ga0209673_1009281 3300025273 Bacteria 4285
172 Ga0209673_1021742 3300025273 Bacteria 2234
173 Ga0209130_1000001 3300025284 Bacteria 831557
174 Ga0209130_1000003 3300025284 Bacteria 677988
175 Ga0209130_1000020 3300025284 Bacteria 379297
176 Ga0209130_1000034 3300025284 Bacteria 302439
177 Ga0209676_1000482 3300025292 Bacteria 65372
178 Ga0209676_1010300 3300025292 Bacteria 3917
179 Ga0209025_1000070 3300025294 Bacteria 287776
180 Ga0209025_1000140 3300025294 Bacteria 184765
181 Ga0209025_1000181 3300025294 Bacteria 156894
182 Ga0209025_1000314 3300025294 Bacteria 107720
183 Ga0209025_1000506 3300025294 Bacteria 74798
184 Ga0209025_1001813 3300025294 Bacteria 25245
185 Ga0209025_1001869 3300025294 Bacteria 24674
186 Ga0209025_1004380 3300025294 Bacteria 12294
187 Ga0209025_1005193 3300025294 Bacteria 10759
188 Ga0209025_1008432 3300025294 Bacteria 7420
189 Ga0209025_1015317 3300025294 Bacteria 4635
190 Ga0209025_1016060 3300025294 Bacteria 4456
191 Ga0209025_1022888 3300025294 Bacteria 3293
192 Ga0209564_1000013 3300025295 Bacteria 775755
193 Ga0209564_1000647 3300025295 Bacteria 52658
194 Ga0209564_1001131 3300025295 Bacteria 31317
195 Ga0209564_1001780 3300025295 Bacteria 19956
196 Ga0209564_1004823 3300025295 Bacteria 8030
197 Ga0209758_1000156 3300025297 Bacteria 156894
198 Ga0209758_1000405 3300025297 Bacteria 73971
199 Ga0209758_1000413 3300025297 Bacteria 72744
200 Ga0209758_1000655 3300025297 Bacteria 52188
201 Ga0209758_1000758 3300025297 Bacteria 46817
202 Ga0209758_1001882 3300025297 Bacteria 22974
203 Ga0209758_1002154 3300025297 Bacteria 20718
204 Ga0209758_1002252 3300025297 Bacteria 20026
205 Ga0209758_1004734 3300025297 Bacteria 11072
206 Ga0209758_1006389 3300025297 Bacteria 8497
207 Ga0209758_1014125 3300025297 Bacteria 4279
208 Ga0209050_1000646 3300025298 Bacteria 54050
209 Ga0209050_1008819 3300025298 Bacteria 5293
210 Ga0209256_1000396 3300025299 Bacteria 69216
211 Ga0209256_1001653 3300025299 Bacteria 21690
212 Ga0209256_1001736 3300025299 Bacteria 20844
213 Ga0209256_1002721 3300025299 Bacteria 13712
214 Ga0209256_1005804 3300025299 Bacteria 6883
215 Ga0209256_1006650 3300025299 Bacteria 6025
216 Ga0209256_1012329 3300025299 Bacteria 3293
217 Ga0207426_1000006 3300025302 Bacteria 1025969
218 Ga0207426_1000008 3300025302 Bacteria 848730
219 Ga0207426_1000011 3300025302 Bacteria 791203
220 Ga0207426_1000045 3300025302 Bacteria 422847
221 Ga0207426_1000221 3300025302 Bacteria 134756
222 Ga0207426_1000869 3300025302 Bacteria 31530
223 Ga0209051_1000097 3300025303 Bacteria 167378
224 Ga0209051_1000314 3300025303 Bacteria 74316
225 Ga0209051_1001414 3300025303 Bacteria 20618
226 Ga0209051_1003927 3300025303 Bacteria 9473
227 Ga0209051_1007515 3300025303 Bacteria 5940
228 Ga0209051_1013189 3300025303 Bacteria 3948
229 Ga0209257_1001142 3300025304 Bacteria 33931
230 Ga0209257_1002070 3300025304 Bacteria 21158
231 Ga0209257_1003315 3300025304 Bacteria 13958
232 Ga0207695_10000011 3300025913 Bacteria 910221
233 Ga0207695_10000118 3300025913 Bacteria 237085
234 Ga0207671_10000093 3300025914 Bacteria 138939
235 Ga0207671_10000175 3300025914 Bacteria 98920
236 Ga0207650_10000837 3300025925 Bacteria 23356
237 Ga0207650_10002272 3300025925 Bacteria 13416
238 Ga0207711_10075060 3300025941 Bacteria 2942
239 Ga0207668_10107108 3300025972 Bacteria 2090
240 Ga0207702_10044361 3300026078 Bacteria 3737
241 Ga0209281_1000106 3300027111 Bacteria 219666
242 Ga0209281_1000318 3300027111 Bacteria 85039
243 Ga0209371_1000022 3300027312 Bacteria 536342
244 Ga0209371_1002282 3300027312 Bacteria 10948
245 Ga0209371_1006788 3300027312 Bacteria 4150
246 Ga0209371_1007555 3300027312 Bacteria 3763
247 Ga0209282_1000024 3300027666 Bacteria 170348
248 Ga0209282_1004803 3300027666 Bacteria 8196
249 Ga0307515_10001559 3300028794 Bacteria 51153
250 Ga0307515_10007368 3300028794 Bacteria 21770
251 Ga0268256_1000019 3300030500 Bacteria 587949
252 Ga0268256_1004953 3300030500 Bacteria 5374
253 Ga0268256_1006891 3300030500 Bacteria 4150
254 Ga0268256_1007789 3300030500 Bacteria 3763
255 Ga0265325_10016256 3300031241 Bacteria 4162
256 Ga0307513_10119150 3300031456 Bacteria 2612
257 Ga0307405_10000857 3300031731 Bacteria 11991
258 Ga0307405_10002833 3300031731 Bacteria 7789
259 Ga0307412_10000493 3300031911 Bacteria 23544
260 Ga0315914_1000012 3300031967 Bacteria 169896
261 Ga0315913_1000006 3300033430 Bacteria 169893
262 Ga0315915_1000010 3300033464 Bacteria 240214
263 Ga0373927_0000350 3300035695 Bacteria 36173
264 Ga0373925_0052624 3300037068 Bacteria 3042
265 Ga0395900_0010176 3300037418 Bacteria 9621
266 Ga0395905_0000867 3300037471 Bacteria 39452
267 Ga0395905_0005044 3300037471 Bacteria 13597
268 Ga0395901_0154081 3300038443 Bacteria 2414
269 Ga0439465_0003817 3300041413 Bacteria 4914
270 Ga0439465_0007101 3300041413 Bacteria 3560
271 Ga0439465_0013037 3300041413 Bacteria 2597
272 Ga0451853_2433547 3300041512 Bacteria 2216
273 Ga0466963_0037894 3300044694 Bacteria 3151
274 Ga0466970_0000026 3300044765 Bacteria 56864
275 Ga0466957_0010513 3300044842 Bacteria 5319
276 Ga0466957_0021187 3300044842 Bacteria 3829
277 Ga0466958_0062046 3300045836 Bacteria 2278
278 Ga0495638_0001181 3300046460 Bacteria 25058
279 Ga0495638_0024145 3300046460 Bacteria 3967
280 Ga0495605_0001952 3300046474 Bacteria 13095
281 Ga0495607_0022946 3300046501 Bacteria 3912
282 Ga0495583_0013196 3300046506 Bacteria 4623
283 Ga0495583_0019889 3300046506 Bacteria 3494
284 Ga0495606_0001601 3300046507 Bacteria 29530
285 Ga0495606_0002324 3300046507 Bacteria 22407
286 Ga0495606_0007174 3300046507 Bacteria 10058
287 Ga0495606_0025623 3300046507 Bacteria 4220
288 Ga0495606_0038135 3300046507 Bacteria 3254
289 Ga0495610_0001969 3300046512 Bacteria 17628
290 Ga0495610_0002191 3300046512 Bacteria 16560
291 Ga0495610_0003825 3300046512 Bacteria 11469
292 Ga0495610_0027406 3300046512 Bacteria 3028
293 Ga0495616_0008906 3300046513 Bacteria 5898
294 Ga0495620_0012690 3300046515 Bacteria 4338
295 Ga0495631_0003360 3300046518 Bacteria 8775
296 Ga0495632_0001278 3300046519 Bacteria 21310
297 Ga0495632_0005104 3300046519 Bacteria 8775
298 Ga0495632_0007228 3300046519 Bacteria 7009
299 Ga0495632_0050993 3300046519 Bacteria 2038
300 Ga0495643_0002802 3300046522 Bacteria 13314
301 Ga0495643_0012570 3300046522 Bacteria 5102
302 Ga0495643_0027634 3300046522 Bacteria 3186
303 Ga0495648_0013780 3300046524 Bacteria 5956
304 Ga0495663_0014361 3300046525 Bacteria 2220
305 Ga0495654_0000045 3300046530 Bacteria 150593
306 Ga0495654_0035169 3300046530 Bacteria 2525
307 Ga0495609_0013320 3300046538 Bacteria 3888
308 Ga0495597_0014741 3300046542 Bacteria 3717
309 Ga0495622_0006123 3300046557 Bacteria 5589
310 Ga0495633_0026822 3300046558 Bacteria 2822
311 Ga0495668_0008091 3300046616 Bacteria 6621
312 Ga0495625_0001387 3300046660 Bacteria 29722
313 Ga0495625_0051086 3300046660 Bacteria 2965
314 Ga0495588_0000895 3300046674 Bacteria 13095
315 Ga0495657_0013648 3300046675 Bacteria 5986
316 Ga0495670_0007690 3300046691 Bacteria 5299
317 Ga0495649_0035998 3300046694 Bacteria 2721
318 Ga0495600_0044740 3300046809 Bacteria 2887
319 Ga0495660_0013338 3300046810 Bacteria 4763
320 Ga0495604_0029637 3300047317 Bacteria 4354
321 Ga0495672_0011266 3300047320 Bacteria 6319
322 Ga0495683_0009820 3300047323 Bacteria 5086
323 Ga0495681_0004658 3300047470 Bacteria 9301
324 Ga0495686_0001455 3300047472 Bacteria 25795
325 Ga0495686_0004688 3300047472 Bacteria 11089
326 Ga0495686_0006538 3300047472 Bacteria 8896
327 Ga0495686_0013660 3300047472 Bacteria 5627
328 Ga0495686_0062023 3300047472 Bacteria 2319
329 Ga0496100_0006892 3300048903 Bacteria 6221
330 Ga0496101_0009796 3300048904 Bacteria 6310
331 Ga0496102_0008153 3300048905 Bacteria 8964
332 Ga0496102_0017086 3300048905 Bacteria 6351
333 Ga0496103_0008310 3300048906 Bacteria 6166
334 Ga0496106_0000957 3300048909 Bacteria 21015
335 Ga0496106_0000982 3300048909 Bacteria 20805
336 Ga0496111_0001270 3300048914 Bacteria 14143
337 Ga0496113_0010326 3300048916 Bacteria 6171
338 Ga0496116_0000142 3300048919 Bacteria 150342
339 Ga0496116_0009760 3300048919 Bacteria 8146
340 Ga0496116_0013505 3300048919 Bacteria 6578
341 Ga0496116_0015034 3300048919 Bacteria 6137
342 Ga0496116_0015182 3300048919 Bacteria 6101
343 Ga0496116_0021260 3300048919 Bacteria 4899
344 Ga0496116_0022090 3300048919 Bacteria 4782
345 Ga0496116_0052557 3300048919 Bacteria 2698
346 Ga0496117_0000002 3300048920 Bacteria 2483758
347 Ga0496117_0001574 3300048920 Bacteria 32408
348 Ga0496117_0002367 3300048920 Bacteria 24048
349 Ga0496117_0004520 3300048920 Bacteria 15278
350 Ga0496117_0006762 3300048920 Bacteria 11452
351 Ga0496117_0018869 3300048920 Bacteria 5691
352 Ga0496117_0019692 3300048920 Bacteria 5532
353 Ga0496117_0023835 3300048920 Bacteria 4860
354 Ga0496117_0024641 3300048920 Bacteria 4750
355 Ga0496118_0000087 3300048921 Bacteria 176693
356 Ga0496118_0003357 3300048921 Bacteria 20255
357 Ga0496118_0004297 3300048921 Bacteria 17031
358 Ga0496118_0005314 3300048921 Bacteria 14681
359 Ga0496118_0017417 3300048921 Bacteria 6541
360 Ga0496118_0024847 3300048921 Bacteria 5158
361 Ga0496118_0025539 3300048921 Bacteria 5060
362 Ga0496119_0005947 3300048922 Bacteria 11472
363 Ga0496119_0011615 3300048922 Bacteria 7265
364 Ga0496119_0015392 3300048922 Bacteria 5893
365 Ga0496119_0040522 3300048922 Bacteria 2977
366 Ga0496120_0000413 3300048923 Bacteria 68125
367 Ga0496120_0004953 3300048923 Bacteria 10819
368 Ga0496120_0006147 3300048923 Bacteria 9309
369 Ga0496121_0000003 3300048924 Bacteria 1191431
370 Ga0496121_0002536 3300048924 Bacteria 27686
371 Ga0496121_0010503 3300048924 Bacteria 10430
372 Ga0496121_0015847 3300048924 Bacteria 7837
373 Ga0496121_0020370 3300048924 Bacteria 6572
374 Ga0496121_0023681 3300048924 Bacteria 5902
375 Ga0496121_0036685 3300048924 Bacteria 4364
376 Ga0496121_0039518 3300048924 Bacteria 4155
377 Ga0496121_0039603 3300048924 Bacteria 4148
378 Ga0496121_0106562 3300048924 Bacteria 2148
379 Ga0496122_0000004 3300048925 Bacteria 645283
380 Ga0496122_0000190 3300048925 Bacteria 140376
381 Ga0496122_0005980 3300048925 Bacteria 14236
382 Ga0496122_0008521 3300048925 Bacteria 11037
383 Ga0496122_0008959 3300048925 Bacteria 10641
384 Ga0496122_0010294 3300048925 Bacteria 9677
385 Ga0496122_0017023 3300048925 Bacteria 6825
386 Ga0496122_0018314 3300048925 Bacteria 6481
387 Ga0496122_0042821 3300048925 Bacteria 3556
388 Ga0496123_0000007 3300048926 Bacteria 645283
389 Ga0496123_0000336 3300048926 Bacteria 89161
390 Ga0496123_0010318 3300048926 Bacteria 8280
391 Ga0496123_0012104 3300048926 Bacteria 7391
392 Ga0496123_0033840 3300048926 Bacteria 3671
393 Ga0496124_0000285 3300048927 Bacteria 95893
394 Ga0496124_0001040 3300048927 Bacteria 43813
395 Ga0496124_0014720 3300048927 Bacteria 7549
396 Ga0496124_0026382 3300048927 Bacteria 5240
397 Ga0496124_0050763 3300048927 Bacteria 3532
398 Ga0496124_0090675 3300048927 Bacteria 2492
399 Ga0496125_0000039 3300048928 Bacteria 318665
400 Ga0496125_0000248 3300048928 Bacteria 110840
401 Ga0496125_0004925 3300048928 Bacteria 15116
402 Ga0496125_0016232 3300048928 Bacteria 7158
403 Ga0496125_0017415 3300048928 Bacteria 6850
404 Ga0496125_0018773 3300048928 Bacteria 6553
405 Ga0496125_0019671 3300048928 Bacteria 6358
406 Ga0496125_0027607 3300048928 Bacteria 5142
407 Ga0496126_0000866 3300048929 Bacteria 53241
408 Ga0496126_0001294 3300048929 Bacteria 39967
409 Ga0496126_0017426 3300048929 Bacteria 7157
410 Ga0496126_0047995 3300048929 Bacteria 3907
411 Ga0496126_0085604 3300048929 Bacteria 2778
412 Ga0496126_0144505 3300048929 Bacteria 2044
413 Ga0501031_0035722 3300049568 Bacteria 3242
414 Ga0501032_0036811 3300049569 Bacteria 3339
415 Ga0501033_0027473 3300049570 Bacteria 4277
416 Ga0501034_0097012 3300049571 Bacteria 2943
417 Ga0501036_0020924 3300049572 Bacteria 5494
418 Ga0501036_0070972 3300049572 Bacteria 2945
419 Ga0501037_0041769 3300049573 Bacteria 3371
420 Ga0501037_0075558 3300049573 Bacteria 2447
421 Ga0501043_0104581 3300049579 Bacteria 2225
422 Ga0501047_0198606 3300049581 Bacteria 1867
423 Ga0501068_0030071 3300049584 Bacteria 3220
424 Ga0501080_0055887 3300049742 Bacteria 3676
425 Ga0501080_0148226 3300049742 Bacteria 2169
426 Ga0501083_0017170 3300049744 Bacteria 5047
427 Ga0501083_0028925 3300049744 Bacteria 3816
428 Ga0501280_002144 3300049776 Bacteria 3393
429 Ga0501035_0071346 3300049822 Bacteria 3075
430 Ga0501044_0020289 3300049823 Bacteria 7093
431 Ga0501044_0077051 3300049823 Bacteria 3382
432 Ga0501044_0132993 3300049823 Bacteria 2480
433 nmdc:mga03683_4496_c1 3300050489 Bacteria 4636
434 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
435 nmdc:mga0yw44_291_c1 3300050492 Bacteria 17253
436 nmdc:mga0yw44_3456_c1 3300050492 Bacteria 6517
437 nmdc:mga07m45_36619_c1 3300050496 Bacteria 2734
438 nmdc:mga0sz30_23498_c1 3300050516 Bacteria 2509
439 nmdc:mga0sz30_3736_c1 3300050516 Bacteria 5488
440 nmdc:mga0sz30_7957_c1 3300050516 Bacteria 3989
441 Ga0500578_0046899 3300053086 Bacteria 2772
442 Ga0500560_002077 3300053107 Bacteria 3723
443 Ga0500569_012298 3300053109 Bacteria 2066
444 Ga0500618_000184 3300053125 Bacteria 51349
445 Ga0500618_000453 3300053125 Bacteria 26803
446 Ga0500618_000677 3300053125 Bacteria 20060
447 Ga0500618_001080 3300053125 Bacteria 13415
448 Ga0500618_001232 3300053125 Bacteria 11994
449 Ga0500618_008674 3300053125 Bacteria 2821
450 Ga0500658_0000526 3300053134 Bacteria 16212
451 Ga0500658_0002581 3300053134 Bacteria 6999
452 Ga0500658_0015165 3300053134 Bacteria 2858
453 Ga0500561_0000098 3300053137 Bacteria 16671
454 Ga0500568_0000076 3300053139 Bacteria 94411
455 Ga0500568_0004818 3300053139 Bacteria 7132
456 Ga0500573_0003980 3300053140 Bacteria 7714
457 Ga0500573_0005041 3300053140 Bacteria 7024
458 Ga0500590_003631 3300053148 Bacteria 7157
459 Ga0500616_0001018 3300053153 Bacteria 29841
460 Ga0500616_0005682 3300053153 Bacteria 8405
461 Ga0500622_0000215 3300053156 Bacteria 61272
462 Ga0500622_0000458 3300053156 Bacteria 38693
463 Ga0500624_000768 3300053157 Bacteria 7677
464 Ga0500633_0000082 3300053160 Bacteria 14067
465 Ga0500634_0000261 3300053161 Bacteria 16846
466 Ga0500634_0011617 3300053161 Bacteria 4553
467 Ga0500636_0000180 3300053177 Bacteria 33813
468 Ga0500636_0006724 3300053177 Bacteria 6616
469 2509108397 2508501122 Bacteria 6292184
470 2509376470 2509276019 Bacteria 6802256
471 2509392057 2509276021 Bacteria 7634384
472 2509445648 2509276033 Bacteria 7180565
473 2509447051 2509276033 Bacteria 7180565
474 2510133953 2510065019 Bacteria 6903379
475 2510306454 2510065057 Bacteria 6649661
476 2510895371 2510461076 Bacteria 8618824
477 2511131327 2510917022 Bacteria 6504556
478 2511135400 2510917022 Bacteria 6504556
479 2511174423 2510917026 Bacteria 7046020
480 2511187053 2510917028 Bacteria 6185411
481 2511193907 2510917030 Bacteria 7460662
482 2511199027 2510917030 Bacteria 7460662
483 2511502244 2511231052 Bacteria 6974333
484 2512533617 2512047086 Bacteria 6850303
485 2512970694 2512875026 Bacteria 6861065
486 2513567974 2513237084 Bacteria 7231967
487 2513576940 2513237085 Bacteria 7695351
488 2513584384 2513237086 Bacteria 7265287
489 2513596473 2513237088 Bacteria 6927906
490 2513604262 2513237089 Bacteria 6553624
491 2513618804 2513237091 Bacteria 6900273
492 2513633388 2513237093 Bacteria 7545552
493 2513708050 2513237103 Bacteria 7647401
494 2513865598 2513237138 Bacteria 7368160
495 2513884405 2513237140 Bacteria 7076289
496 2513905009 2513237143 Bacteria 6664116
497 2513909003 2513237144 Bacteria 7530820
498 2513925385 2513237146 Bacteria 7166346
499 2513986825 2513237156 Bacteria 6402557
500 2514001504 2513237159 Bacteria 6810126
501 2514006389 2513237160 Bacteria 6650282
502 2514020009 2513237162 Bacteria 7468464
503 2515113002 2515075009 Bacteria 7288508
504 2515609020 2515154107 Bacteria 6795637
505 2515638512 2515154113 Bacteria 7807172
506 2515640961 2515154114 Bacteria 7848616
507 2515655357 2515154116 Bacteria 7552979
508 2515739480 2515154134 Bacteria 7220242
509 2516204144 2516143018 Bacteria 6951533
510 2516893623 2516653046 Bacteria 6989037
511 2517036702 2516653077 Bacteria 7555578
512 2517077061 2516653085 Bacteria 7346596
513 2517095829 2517093000 Bacteria 7412387
514 2517407401 2517287029 Bacteria 6905599
515 2517570335 2517487022 Bacteria 7227575
516 2520377194 2519899620 Bacteria 6499161
517 2524448556 2524023207 Bacteria 6813453
518 2524459587 2524023209 Bacteria 6679728
519 2530645955 2529292951 Bacteria 6916614
520 2535516864 2534681796 Bacteria 7146037
521 2537875435 2537561587 Bacteria 5425293
522 2551674544 2551306084 Bacteria 8942552
523 2551677925 2551306084 Bacteria 8942552
524 2551687738 2551306085 Bacteria 7347181
525 2551698979 2551306087 Bacteria 7351905
526 2551715576 2551306089 Bacteria 7162724
527 2551715881 2551306090 Bacteria 7953713
528 2551744428 2551306093 Bacteria 7064773
529 2554248231 2554235003 Bacteria 5877155
530 2558864463 2558860100 Bacteria 8458965
531 2559295347 2558860242 Bacteria 5568029
532 2561468372 2558860983 Bacteria 4133860
533 2585166347 2582581283 Bacteria 6030556
534 2585202272 2582581294 Bacteria 6626667
535 2585222830 2582581298 Bacteria 7315509
536 2585226996 2582581298 Bacteria 7315509
537 2585231741 2582581299 Bacteria 6518058
538 2585255082 2582581304 Bacteria 5831370
539 2585257697 2582581304 Bacteria 5831370
540 2585267425 2582581306 Bacteria 6450535
541 2585271137 2582581307 Bacteria 6597605
542 2585274460 2582581307 Bacteria 6597605
543 2585277481 2582581308 Bacteria 7413247
544 2585280869 2582581308 Bacteria 7413247
545 2585323335 2582581315 Bacteria 7318924
546 2585324390 2582581315 Bacteria 7318924
547 2585331477 2582581316 Bacteria 7774528
548 2585335929 2582581316 Bacteria 7774528
549 2585386493 2582581865 Bacteria 6644329
550 2585393255 2582581866 Bacteria 6859583
551 2585402399 2582581867 Bacteria 7184437
552 2585527441 2585427526 Bacteria 7258840
553 2585530573 2585427527 Bacteria 7273426
554 2585535108 2585427527 Bacteria 7273426
555 2585538182 2585427528 Bacteria 6842387
556 2585545413 2585427529 Bacteria 7395659
557 2585550411 2585427529 Bacteria 7395659
558 2585554748 2585427530 Bacteria 7383882
559 2585555958 2585427530 Bacteria 7383882
560 2585558861 2585427531 Bacteria 6992870
561 2585561819 2585427531 Bacteria 6992870
562 2585822914 2585427590 Bacteria 6824633
563 2585836131 2585427593 Bacteria 7141551
564 2585842893 2585427594 Bacteria 6180594
565 2585843225 2585427594 Bacteria 6180594
566 2585898243 2585427608 Bacteria 6544331
567 2585902426 2585427608 Bacteria 6544331
568 2585904169 2585427609 Bacteria 6667127
569 2585907551 2585427609 Bacteria 6667127
570 2585996202 2585427633 Bacteria 6413184
571 2586000812 2585427634 Bacteria 6455027
572 2587980714 2585428125 Bacteria 6662905
573 2587982972 2585428125 Bacteria 6662905
574 2599331750 2599185156 Bacteria 5403036
575 2599417301 2599185170 Bacteria 7295545
576 2599601659 2599185210 Bacteria 5624189
577 2599721913 2599185236 Bacteria 6875203
578 2600194392 2599185352 Bacteria 7228948
579 2600374360 2600254933 Bacteria 4750527
580 2601610081 2600255279 Bacteria 5605316
581 2601746856 2600255308 Bacteria 5611129
582 2616293366 2615840624 Bacteria 6557588
583 2616308956 2615840626 Bacteria 7921970
584 2616310748 2615840626 Bacteria 7921970
585 2616554227 2615840698 Bacteria 7319877
586 2616557383 2615840698 Bacteria 7319877
587 2617382085 2617270742 Bacteria 6808054
588 2617384719 2617270742 Bacteria 6808054
589 2643803089 2643221557 Bacteria 7184309
590 2643811533 2643221558 Bacteria 5460675
591 2643856772 2643221568 Bacteria 5187270
592 2643920345 2643221582 Bacteria 5804683
593 2644003159 2643221599 Bacteria 6292121
594 2644050520 2643221607 Bacteria 6314006
595 2644063451 2643221610 Bacteria 7480339
596 2644107280 2643221618 Bacteria 7717186
597 2644150846 2643221626 Bacteria 8069654
598 2644191573 2643221634 Bacteria 6705461
599 2644193507 2643221634 Bacteria 6705461
600 2644205748 2643221636 Bacteria 6583769
601 2644238681 2643221643 Bacteria 5749658
602 2644308675 2643221655 Bacteria 7722067
603 2644335493 2643221659 Bacteria 7890716
604 2644374734 2643221668 Bacteria 7306521
605 2644414214 2643221675 Bacteria 7473456
606 2644447742 2643221680 Bacteria 7473610
607 2644483438 2643221686 Bacteria 6310811
608 2644492029 2643221688 Bacteria 5260751
609 2644499649 2643221689 Bacteria 6042950
610 2644521959 2643221693 Bacteria 5513853
611 2644539898 2643221698 Bacteria 7756764
612 2644614616 2643221712 Bacteria 7729434
613 2644676080 2643221723 Bacteria 7095460
614 2644690215 2643221726 Bacteria 7455827
615 2657681560 2657244999 Bacteria 5946535
616 2671111431 2667528174 Bacteria 6435400
617 2671117062 2667528174 Bacteria 6435400
618 2692315542 2690316117 Bacteria 6800650
619 2719181804 2718217882 Bacteria 6556348
620 2719386407 2718217927 Bacteria 6972593
621 2719666155 2718217997 Bacteria 6740740
622 2719732468 2718218009 Bacteria 6478651
623 2720492575 2718218199 Bacteria 6740745
624 2720614010 2718218232 Bacteria 6720332
625 2720620815 2718218233 Bacteria 6662049
626 2720632140 2718218235 Bacteria 6630699
627 2720775868 2718218269 Bacteria 6906114
628 2721147895 2718218363 Bacteria 6524337
629 2721159346 2718218365 Bacteria 6274507
630 2721164731 2718218366 Bacteria 6425255
631 2721400111 2718218423 Bacteria 6438183
632 2722840901 2721755514 Bacteria 6424414
633 2723027472 2721755556 Bacteria 6745503
634 2723561091 2721755684 Bacteria 6859907
635 2723567687 2721755685 Bacteria 6704835
636 2724038924 2721755809 Bacteria 6438790
637 2724045224 2721755810 Bacteria 6479005
638 2724090475 2721755819 Bacteria 6906405
639 2724104952 2721755822 Bacteria 6726041
640 2724110811 2721755823 Bacteria 6752556
641 2725952563 2724679232 Bacteria 7646494
642 2730108408 2728369352 Bacteria 6745171
643 2730165039 2728369365 Bacteria 6555560
644 2730298978 2728369397 Bacteria 6274511
645 2738800083 2738541293 Bacteria 7065685
646 2738801503 2738541293 Bacteria 7065685
647 2738945523 2738541317 Bacteria 5340176
648 2738947336 2738541317 Bacteria 5340176
649 2739032839 2738541333 Bacteria 7106503
650 2753462027 2751185821 Bacteria 6189929
651 2766065867 2765235942 Bacteria 7445910
652 2776913923 2775507049 Bacteria 6284736
653 2778173558 2775507266 Bacteria 7392367
654 2778175414 2775507266 Bacteria 7392367
655 2792585128 2791355082 Bacteria 5973319
656 2792620772 2791355091 Bacteria 6135441
657 2792626131 2791355092 Bacteria 6248105
658 2792639067 2791355094 Bacteria 7011481
659 2793280305 2791355253 Bacteria 5171699
660 2793294439 2791355256 Bacteria 6798008
661 2793314545 2791355259 Bacteria 7254731
662 2793320373 2791355260 Bacteria 6598818
663 2793329542 2791355261 Bacteria 6661293
664 2793334488 2791355262 Bacteria 6774204
665 2793339205 2791355263 Bacteria 6872478
666 2793348878 2791355264 Bacteria 6429314
667 2793351834 2791355265 Bacteria 6539969
668 2793362586 2791355266 Bacteria 7116587
669 2793368876 2791355267 Bacteria 7222458
670 2802720030 2802428858 Bacteria 6636079
671 2802727037 2802428859 Bacteria 6667919
672 2802731960 2802428860 Bacteria 6525526
673 2802739291 2802428861 Bacteria 6534206
674 2802745728 2802428862 Bacteria 6633353
675 2802752329 2802428863 Bacteria 6410669
676 2804752751 2802429268 Bacteria 6094027
677 2805928803 2802429605 Bacteria 6875453
678 2805935085 2802429606 Bacteria 6346811
679 2806043819 2802429633 Bacteria 7341974
680 2806050250 2802429634 Bacteria 7083200
681 2806057066 2802429635 Bacteria 7650140
682 2806064448 2802429636 Bacteria 7597525
683 2806071715 2802429637 Bacteria 7067217
684 2808987919 2808606387 Bacteria 5697198
685 2819559060 2818991439 Bacteria 6907412
686 2819609147 2818991448 Bacteria 6772224
687 2819637625 2818991453 Bacteria 7181617
688 2819641125 2818991453 Bacteria 7181617
689 2838017655 2838016132 Bacteria 6577831
690 2838027544 2838022645 Bacteria 6494267
691 2838029807 2838029111 Bacteria 6603031
692 2838034861 2838029111 Bacteria 6603031
693 2838038499 2838035591 Bacteria 7166484
694 2838043966 2838042994 Bacteria 6046894
695 2838054388 2838048938 Bacteria 6044578
696 2838068017 2838061910 Bacteria 6794874
697 2838070145 2838068647 Bacteria 6208656
698 2838076860 2838074704 Bacteria 6785777
699 2838661590 2838661181 Bacteria 7385261
700 2838670358 2838668709 Bacteria 6671819
701 2838675778 2838675328 Bacteria 4909118
702 2838683470 2838680041 Bacteria 6545511
703 2838687057 2838686498 Bacteria 7807632
704 2838697587 2838694306 Bacteria 6853137
705 2838702729 2838701080 Bacteria 6669771
706 2838710703 2838707686 Bacteria 6619912
707 2838714660 2838714209 Bacteria 5525906
708 2838721539 2838719591 Bacteria 5523910
709 2838725420 2838724970 Bacteria 4908691
710 2838729970 2838729681 Bacteria 7400765
711 2838743015 2838742623 Bacteria 7396178
712 2841848491 2841846520 Bacteria 5345850
713 2841852501 2841851746 Bacteria 7532261
714 2841862122 2841859092 Bacteria 5436171
715 2841870780 2841864319 Bacteria 6742987
716 2842078876 2842077413 Bacteria 6508645
717 2842113272 2842110456 Bacteria 7656360
718 2842118614 2842118031 Bacteria 7033875
719 2842125478 2842124991 Bacteria 5346824
720 2842130673 2842130223 Bacteria 4909145
721 2842148013 2842146304 Bacteria 5957337
722 2842154157 2842152218 Bacteria 4908957
723 2842158039 2842156927 Bacteria 6894975
724 2842168797 2842163707 Bacteria 6916235
725 2842170904 2842170452 Bacteria 5525737
726 2842177777 2842175837 Bacteria 4908771
727 2842181658 2842180545 Bacteria 6888678
728 2842187769 2842187318 Bacteria 5524014
729 2842197355 2842192696 Bacteria 6147454
730 2842203554 2842198810 Bacteria 6608673
731 2842205482 2842205361 Bacteria 6340321
732 2842212080 2842211629 Bacteria 5523832
733 2842217934 2842217011 Bacteria 7497767
734 2842226301 2842224351 Bacteria 5524473
735 2842230291 2842229732 Bacteria 7475766
736 2842240526 2842237096 Bacteria 6620661
737 2842244193 2842243621 Bacteria 7421798
738 2842253079 2842250916 Bacteria 6579627
739 2842257721 2842257432 Bacteria 7401195
740 2842266264 2842264693 Bacteria 6472963
741 2842271405 2842271015 Bacteria 7807131
742 2842278939 2842278818 Bacteria 6340002
743 2842285603 2842285085 Bacteria 6011953
744 2842292538 2842291075 Bacteria 7076806
745 2842301368 2842298080 Bacteria 6123127
746 2842305033 2842304105 Bacteria 7023636
747 2842314915 2842311132 Bacteria 6616990
748 2842320707 2842317721 Bacteria 6793725
749 2842346456 2842341865 Bacteria 7003929
750 2842357905 2842357229 Bacteria 6485165
751 2842368965 2842363717 Bacteria 6844742
752 2842374101 2842370503 Bacteria 7038661
753 2842378936 2842377471 Bacteria 7140707
754 2842385125 2842384541 Bacteria 7057858
755 2842399886 2842395702 Bacteria 6780583
756 2842402963 2842402390 Bacteria 6681310
757 2842409665 2842409023 Bacteria 6687331
758 2842416316 2842415677 Bacteria 6596907
759 2842423759 2842422224 Bacteria 6239196
760 2842430727 2842428310 Bacteria 6767288
761 2842437286 2842434925 Bacteria 6502746
762 2842443656 2842441272 Bacteria 6769273
763 2842454049 2842447887 Bacteria 6754142
764 2842464870 2842462802 Bacteria 6588055
765 2842471904 2842469257 Bacteria 6752936
766 2842476908 2842475841 Bacteria 6603183
767 2842481645 2842475841 Bacteria 6603183
768 2842484432 2842482326 Bacteria 7212537
769 2842484562 2842482326 Bacteria 7212537
770 2842491975 2842489311 Bacteria 6620893
771 2842496829 2842495871 Bacteria 6820686
772 2842503335 2842502639 Bacteria 6604161
773 2842508004 2842502639 Bacteria 6604161
774 2842511131 2842509118 Bacteria 6850950
775 2842518906 2842515876 Bacteria 5436280
776 2842521813 2842521101 Bacteria 6569494
777 2842924155 2842922631 Bacteria 5824079
778 2844164572 2844163670 Bacteria 7266046
779 2844458424 2844454524 Bacteria 7952546
780 2847419396 2847417321 Bacteria 6913799
781 2848994423 2848992105 Bacteria 6810864
782 2850081466 2850079185 Bacteria 6848280
783 2852390223 2852387548 Bacteria 8025568
784 2854899587 2854896431 Bacteria 5869725
785 2854918412 2854916844 Bacteria 5725939
786 2855826343 2855825444 Bacteria 6785811
787 2855841733 2855839649 Bacteria 7135830
788 2855872522 2855872281 Bacteria 6964271
789 2857517436 2857516855 Bacteria 7787325
790 2858802518 2858800743 Bacteria 6603254
791 2891373346 2891373044 Bacteria 5202277
792 2896389027 2896384573 Bacteria 7700774
793 2899796054 2899792073 Bacteria 4926588
794 2899807270 2899803654 Bacteria 5577784
795 2899850632 2899845264 Bacteria 5672268
796 2913299312 2913295892 Bacteria 6333755
797 2913310229 2913308742 Bacteria 5350706
798 2913312566 2913308742 Bacteria 5350706
799 2915981442 2915980308 Bacteria 6624279
800 2915991446 2915986958 Bacteria 6739310
801 2915998703 2915993759 Bacteria 7016183
802 2916003483 2916000859 Bacteria 6865702
803 2916011654 2916007675 Bacteria 6898660
804 2916020780 2916014648 Bacteria 6946486
805 2916024955 2916021584 Bacteria 6854472
806 2916033768 2916028427 Bacteria 6748433
807 2916037869 2916035215 Bacteria 6755766
808 2916045331 2916041962 Bacteria 6820487
809 2916049045 2916048683 Bacteria 6543552
810 2916055717 2916055098 Bacteria 6758838
811 2916064901 2916061851 Bacteria 6737736
812 2916083200 2916076590 Bacteria 6596108
813 2919107458 2919100787 Bacteria 7710546
814 2919107659 2919100787 Bacteria 7710546
815 2919114698 2919114240 Bacteria 5700270
816 2919169241 2919166419 Bacteria 4952238
817 2919174712 2919171160 Bacteria 6499771
818 2919409978 2919408235 Bacteria 6149349
819 2919413875 2919408235 Bacteria 6149349
820 2920761521 2920760137 Bacteria 7427611
821 2920825213 2920822456 Bacteria 6897201
822 2921201867 2921201388 Bacteria 6926299
823 2921211109 2921208531 Bacteria 6745326
824 2921240927 2921237296 Bacteria 6876710
825 2921246771 2921244191 Bacteria 6568419
826 2921252089 2921250672 Bacteria 6677771
827 2921263768 2921257292 Bacteria 6808382
828 2921266212 2921263974 Bacteria 6864552
829 2921287978 2921282425 Bacteria 6826397
830 2921290953 2921289301 Bacteria 7316391
831 2921299040 2921296804 Bacteria 7176999
832 2923558571 2923556063 Bacteria 6793593
833 2924146751 2924144063 Bacteria 6883928
834 2924157989 2924150972 Bacteria 7169444
835 2924159277 2924158325 Bacteria 7188855
836 2924169157 2924165586 Bacteria 7260590
837 2924174566 2924172951 Bacteria 6749356
838 2924182997 2924179722 Bacteria 6843264
839 2924192708 2924186466 Bacteria 6876637
840 2924195387 2924193448 Bacteria 6955718
841 2924203322 2924200457 Bacteria 6757188
842 2924210741 2924207177 Bacteria 6917007
843 2924217126 2924214083 Bacteria 7080103
844 2924223291 2924221636 Bacteria 7113495
845 2924230523 2924228884 Bacteria 6633132
846 2926755714 2926754445 Bacteria 5964435
847 2926762829 2926760298 Bacteria 5505990
848 2929140869 2929138655 Bacteria 5810547
849 2933008802 2933006813 Bacteria 4912075
850 2933014920 2933011516 Bacteria 5439334
851 2933022323 2933016740 Bacteria 6355406
852 2933570841 2933570622 Bacteria 7023390
853 2933588672 2933586486 Bacteria 7667493
854 2933596597 2933594066 Bacteria 5594265
855 2933600951 2933599457 Bacteria 5858799
856 2935897028 2935894831 Bacteria 6620579
857 2935901961 2935901341 Bacteria 7341747
858 2936372040 2936367885 Bacteria 7324495
859 2936379903 2936375103 Bacteria 6652732
860 2936382807 2936381700 Bacteria 7006523
861 2937000707 2936996657 Bacteria 6298727
862 2937004557 2937002841 Bacteria 6934057
863 2937011199 2937009748 Bacteria 6746052
864 2937019822 2937016420 Bacteria 6782579
865 2937024585 2937023124 Bacteria 6815156
866 2937030288 2937029754 Bacteria 6424026
867 2937042670 2937036028 Bacteria 6846469
868 2937045541 2937042894 Bacteria 6741576
869 2937056155 2937049772 Bacteria 6757901
870 2937063569 2937056579 Bacteria 7107896
871 2937067775 2937063883 Bacteria 7199456
872 2937074392 2937071275 Bacteria 6984483
873 2937080274 2937078374 Bacteria 6610289
874 2937086027 2937084907 Bacteria 6618516
875 2937097222 2937091812 Bacteria 6979387
876 2937103034 2937098957 Bacteria 7249374
877 2937111258 2937106411 Bacteria 6947143
878 2937116143 2937113482 Bacteria 6505872
879 2937121986 2937119839 Bacteria 6597547
880 2937128827 2937126314 Bacteria 6771275
881 2941502138 2941499720 Bacteria 7599444
882 2957376383 2957375807 Bacteria 6425588
883 2957384276 2957382221 Bacteria 6737050
884 2957390739 2957388812 Bacteria 6778072
885 2957395895 2957395598 Bacteria 6822399
886 2957404501 2957402308 Bacteria 6741770
887 2957412088 2957408893 Bacteria 6558585
888 2957421210 2957415311 Bacteria 6991633
889 2957427172 2957422303 Bacteria 7172205
890 2957431717 2957430029 Bacteria 7022557
891 2957438169 2957437181 Bacteria 6568994
892 2957446907 2957443900 Bacteria 6869977
893 2957453749 2957450854 Bacteria 6765715
894 2957461945 2957457609 Bacteria 6967680
895 2957467043 2957464669 Bacteria 6568877
896 2957476387 2957471148 Bacteria 6797643
897 2957479603 2957478035 Bacteria 6756658
898 2957490461 2957484790 Bacteria 6703082
899 2957494108 2957491536 Bacteria 6695180
900 2957503311 2957498199 Bacteria 7126688
901 2957510615 2957505466 Bacteria 7253085
902 2960587488 2960584000 Bacteria 6864594
903 2960592088 2960591022 Bacteria 6622873
904 2960599992 2960597568 Bacteria 6550735
905 2960610590 2960603979 Bacteria 6898737
906 2960612315 2960610863 Bacteria 6691244
907 2960620465 2960617483 Bacteria 6727748
908 2960624480 2960624210 Bacteria 6875384
909 2960632048 2960631154 Bacteria 6732508
910 2960644123 2960637947 Bacteria 7296468
911 2960648414 2960645483 Bacteria 7211087
912 2960656525 2960652885 Bacteria 7083688
913 2960665566 2960660292 Bacteria 7041660
914 2960669659 2960667422 Bacteria 6763020
915 2960675159 2960674078 Bacteria 6609048
916 2960681623 2960680706 Bacteria 6624464
917 2960691467 2960687367 Bacteria 6535474
918 2960694801 2960693952 Bacteria 6749742
919 2964614126 2964607997 Bacteria 7101408
920 2964617747 2964615318 Bacteria 6809089
921 2964623632 2964621998 Bacteria 6834995
922 2964632587 2964628898 Bacteria 7083044
923 2964640818 2964636051 Bacteria 7091832
924 2964645685 2964643177 Bacteria 6820887
925 2964651556 2964649959 Bacteria 6675118
926 2964660526 2964656573 Bacteria 7100150
927 2964666922 2964663802 Bacteria 7019362
928 2964675343 2964670856 Bacteria 6851364
929 2964682875 2964678106 Bacteria 6792020
930 2964688483 2964685014 Bacteria 6839111
931 2964692480 2964691889 Bacteria 6802758
932 2964701642 2964698721 Bacteria 6765331
933 2964711092 2964705432 Bacteria 7114648
934 2964715159 2964712639 Bacteria 6695970
935 2964720679 2964719344 Bacteria 7286602
936 2967665124 2967664464 Bacteria 6948836
937 2967678413 2967671571 Bacteria 7021409
938 2967684425 2967678726 Bacteria 7264382
939 2967689715 2967686174 Bacteria 6678622
940 2967694644 2967693043 Bacteria 6804451
941 2967706464 2967699805 Bacteria 6854538
942 2967708622 2967706974 Bacteria 7186053
943 2967714875 2967714385 Bacteria 7000047
944 2967726123 2967721400 Bacteria 7073753
945 2967728993 2967728569 Bacteria 6641507
946 2967737148 2967735183 Bacteria 6827012
947 2967742555 2967742019 Bacteria 6794534
948 2967751602 2967748971 Bacteria 6733771
949 2967760018 2967755722 Bacteria 6814706
950 2967767515 2967762386 Bacteria 6923502
951 2967772120 2967769361 Bacteria 6587838
952 2967778981 2967775926 Bacteria 6738189
953 2970021061 2970019648 Bacteria 7072033
954 2970028343 2970026789 Bacteria 6785236
955 2970040290 2970033650 Bacteria 7118744
956 2970042640 2970040964 Bacteria 6731123
957 2970050971 2970047711 Bacteria 7088379
958 2970056701 2970054988 Bacteria 6611507
959 2970067143 2970061556 Bacteria 7099761
960 2970071587 2970068827 Bacteria 7123112
961 2970078263 2970076120 Bacteria 6697332
962 2970085245 2970082768 Bacteria 6183754
963 2970092547 2970088815 Bacteria 6933825
964 2970102155 2970095765 Bacteria 6936963
965 2970107998 2970102677 Bacteria 6812532
966 2970110709 2970109326 Bacteria 6863976
967 2970117355 2970116247 Bacteria 6501857
968 2970125822 2970122695 Bacteria 6625855
969 2970131165 2970129317 Bacteria 6806560
970 2970136293 2970136068 Bacteria 7207982
971 2970146728 2970143518 Bacteria 6446480
972 2970151615 2970149975 Bacteria 6779706
973 2970159568 2970156795 Bacteria 7168044
974 2970166977 2970164137 Bacteria 6861252
975 2970174243 2970170962 Bacteria 6876229
976 2970180825 2970177841 Bacteria 6768001
977 2970189170 2970184632 Bacteria 7054431
978 2970193600 2970191845 Bacteria 7032787
979 2977519116 2977516862 Bacteria 6940108
980 2977526329 2977523885 Bacteria 6960446
981 2977534055 2977530762 Bacteria 6951399
982 2977539626 2977537788 Bacteria 6929320
983 2977546360 2977544691 Bacteria 6875412
984 2977558432 2977551784 Bacteria 7125765
985 2977563173 2977558990 Bacteria 6863948
986 2977567665 2977565890 Bacteria 6901543
987 2977575746 2977572785 Bacteria 6763888
988 2977581997 2977579622 Bacteria 6772100
989 2978974617 2978969890 Bacteria 5400756
990 2979094678 2979089926 Bacteria 5670289
991 2979100757 2979095461 Bacteria 5669583
992 2979103913 2979100975 Bacteria 5423623
993 2984511520 2984509177 Bacteria 5274802
994 2984522120 2984518228 Bacteria 5277463
995 2984541418 2984537506 Bacteria 5277481
996 2984603695 2984601300 Bacteria 5455244
997 2989349670 2989349275 Bacteria 6349068
998 2989774285 2989771324 Bacteria 5605128
999 2996889040 2996887358 Bacteria 5795980
1000 2996894333 2996893221 Bacteria 5823108
1001 3003934064 3003930520 Bacteria 5667563
1002 3005414602 3005409236 Bacteria 7188837
1003 3005419472 3005416602 Bacteria 7064308
1004 3005419807 3005416602 Bacteria 7064308
1005 3005448444 3005445848 Bacteria 6906074
1006 3005451110 3005445848 Bacteria 6906074
1007 3005454634 3005452660 Bacteria 5889319
1008 639649186 639633055 Bacteria 7751309
1009 643826312 643692032 Bacteria 6891900
1010 648739212 648276728 Bacteria 6968865
1011 650740557 650716007 Bacteria 5573770
1012 8003571622 8003570095 Bacteria 5747666
1013 8003994166 8003992118 Bacteria 7266902
1014 8004001798 8003999396 Bacteria 7063185
1015 8005260303 8005258706 Bacteria 6184835
1016 8005281204 8005275841 Bacteria 6929066
1017 8005283260 8005282627 Bacteria 6675747
1018 8005293634 8005289223 Bacteria 6634003
1019 8005303119 8005301065 Bacteria 6614431
1020 8005312828 8005307578 Bacteria 7395396
1021 8005316373 8005314921 Bacteria 7072929
1022 8005316763 8005314921 Bacteria 7072929
1023 8005323567 8005321885 Bacteria 5795980
1024 8005380922 8005376324 Bacteria 6590079
1025 8005389128 8005382845 Bacteria 6732062
1026 8005396108 8005395548 Bacteria 6806915
1027 8005435151 8005430974 Bacteria 6689030
1028 8005463681 8005460587 Bacteria 7157962
1029 8005489189 8005484373 Bacteria 6297373
1030 8005500893 8005497431 Bacteria 6477605
1031 8005545616 8005542996 Bacteria 7077758
1032 8005557021 8005556819 Bacteria 6908598
1033 8005567987 8005563573 Bacteria 7153261
1034 8005573468 8005570704 Bacteria 6957481
1035 8005622266 8005619151 Bacteria 7030230
1036 8005632254 8005626139 Bacteria 6534237
1037 8005648135 8005645114 Bacteria 6950293
1038 8005659031 8005658619 Bacteria 4500593
1039 8005660062 8005658619 Bacteria 4500593
1040 8005672311 8005668836 Bacteria 6953162
1041 8005682891 8005682033 Bacteria 6726518
1042 8005686926 8005682033 Bacteria 6726518
1043 8005692113 8005688590 Bacteria 6610080
1044 8005697394 8005695170 Bacteria 6912330
1045 8018134088 8018127388 Bacteria 7351159
1046 8018153226 8018150411 Bacteria 5549903
1047 8018164632 8018163183 Bacteria 7277977
1048 8018181331 8018176218 Bacteria 6896178
1049 8023683174 8023680758 Bacteria 7729763
1050 8024482869 8024479707 Bacteria 6954785
1051 8024488025 8024486573 Bacteria 6540512
1052 8024504417 8024501048 Bacteria 6427847
1053 8046771931 8046767195 Bacteria 7547379
1054 8046773323 8046767195 Bacteria 7547379
1055 8049295320 8049293176 Bacteria 6128433
1056 8054462973 8054460903 Bacteria 4872905
1057 8054558649 8054558443 Bacteria 5204801
1058 8054568608 8054563764 Bacteria 5592885
1059 8055432762 8055431914 Bacteria 4551896
1060 8056375928 8056375014 Bacteria 7006639
1061 8056386719 8056382006 Bacteria 6408074
1062 8057575739 8057575449 Bacteria 7367519
1063 8057877680 8057874678 Bacteria 7494653
1064 Ga0495610_0000770
1065 JGI24740J21852_10000015
1066 JGI24740J21852_10000464
1067 JGI25155J39150_1000001
1068 JGI25155J39150_1000195
1069 JGI25156J39149_1000001
1070 JGI25156J39149_1000433
1071 JGI25162J39368_1000366
1072 JGI25162J39368_1000368
1073 JGI25162J39368_1000477
1074 JGI25162J39368_1000802
1075 JGI25154J39366_1000122
1076 JGI25154J39366_1000360
1077 JGI25158J39367_1000038
1078 JGI25158J39367_1000694
1079 JGI25158J39367_1004417
1080 JGI25157J39369_1000044
1081 JGI25157J39369_1000458
1082 JGI25152J39213_1000636
1083 JGI25152J39213_1001023
1084 JGI25152J39213_1005336
1085 JGI25152J39213_1011099
1086 JGI25152J39213_1011145
1087 JGI25150J39212_1000026
1088 JGI25150J39212_1000107
1089 JGI25150J39212_1005870
1090 JGI25159J45721_1000014
1091 JGI25159J45721_1000424
1092 JGI25159J45721_1000493
1093 JGI25151J46595_10000053
1094 JGI25151J46595_10000374
1095 JGI25151J46595_10000839
1096 JGI25151J46595_10003886
1097 JGI25151J46595_10008401
1098 JGI25151J46595_10033516
1099 JGI25165J46597_1000516
1100 JGI25165J46597_1000603
1101 JGI25165J46597_1001042
1102 JGI25165J46597_1001132
1103 JGI25165J46597_1002650
1104 JGI25153J46596_10000696
1105 JGI25153J46596_10005690
1106 JGI25153J46596_10009242
1107 JGI25153J46596_10012015
1108 JGI25153J46596_10027126
1109 JGI25153J46596_10027232
1110 JGI25160J50197_1000001
1111 JGI25160J50197_1000020
1112 JGI25160J50197_1002863
1113 JGI25160J50197_1018252
1114 JGI25161J50226_1000001
1115 JGI25161J50226_1000010
1116 JGI25161J50226_1000174
1117 JGI25161J50226_1001138
1118 JGI25161J50226_1003445
1119 Ga0055526_1001490
1120 Ga0055526_1003506
1121 Ga0055526_1003741
1122 Ga0055524_1002170
1123 Ga0055524_1004376
1124 Ga0055524_1007091
1125 Ga0055536_1001187
1126 Ga0055536_1002960
1127 Ga0055528_1000584
1128 Ga0055528_1001199
1129 Ga0055528_1001734
1130 Ga0055528_1002830
1131 Ga0055528_1008190
1132 Ga0055528_1021493
1133 Ga0055530_10016062
1134 Ga0055540_1000929
1135 Ga0055540_1005992
1136 Ga0055540_1007010
1137 Ga0055540_1009093
1138 Ga0055540_1015257
1139 Ga0055531_10004794
1140 Ga0055531_10007721
1141 Ga0058692_1008129
1142 Ga0055543_1000003
1143 Ga0055543_1000047
1144 Ga0055543_1000353
1145 Ga0055543_1000500
1146 Ga0055543_1001281
1147 Ga0065165_1000013
1148 Ga0065165_1000068
1149 Ga0065165_1008678
1150 Ga0065165_1009678
1151 Ga0070670_100000515
1152 Ga0070670_100002993
1153 Ga0070665_100040748
1154 Ga0068856_100007936
1155 Ga0075365_10005814
1156 Ga0075363_100027951
1157 Ga0075364_10012850
1158 Ga0075367_10063647
1159 Ga0075369_10013843
1160 Ga0075370_10010432
1161 Ga0075370_10010686
1162 Ga0079104_1001253
1163 Ga0079104_1006084
1164 Ga0105240_10000076
1165 Ga0105240_10000201
1166 Ga0105248_10077623
1167 Ga0105237_10000226
1168 Ga0105237_10010705
1169 Ga0123341_1000007
1170 Ga0123342_1004784
1171 Ga0123342_1013992
1172 Ga0105239_10000641
1173 Ga0105239_10009932
1174 Ga0157371_10000017
1175 Ga0157370_10000455
1176 Ga0157370_10000461
1177 Ga0157370_10005282
1178 Ga0157369_10016027
1179 Ga0157369_10039605
1180 Ga0171463_1003
1181 Ga0182007_10000314
1182 Ga0182007_10004384
1183 Ga0182005_1001330
1184 Ga0182005_1003578
1185 Ga0183363_1156
1186 Ga0214544_1001800
1187 Ga0214542_1000012
1188 Ga0214543_1000024
1189 Ga0214543_1000038
1190 Ga0228711_1000008
1191 Ga0228710_1000009
1192 Ga0209435_100012
1193 Ga0209435_100122
1194 Ga0209436_100025
1195 Ga0209436_100150
1196 Ga0209436_101065
1197 Ga0209437_100051
1198 Ga0209437_100064
1199 Ga0209437_100098
1200 Ga0209437_100469
1201 Ga0207425_1000075
1202 Ga0207425_1000113
1203 Ga0207425_1005180
1204 Ga0207425_1006502
1205 Ga0207425_1009350
1206 Ga0209646_1000026
1207 Ga0209646_1000385
1208 Ga0209026_1000014
1209 Ga0209026_1000501
1210 Ga0209759_1000012
1211 Ga0209759_1000743
1212 Ga0209129_1000156
1213 Ga0209129_1000181
1214 Ga0209129_1000218
1215 Ga0209129_1000348
1216 Ga0209129_1001767
1217 Ga0209129_1005932
1218 Ga0209129_1006736
1219 Ga0209129_1007796
1220 Ga0209129_1008863
1221 Ga0209233_1000081
1222 Ga0209233_1000095
1223 Ga0209233_1000113
1224 Ga0209233_1000217
1225 Ga0209233_1000375
1226 Ga0209233_1000427
1227 Ga0209673_1000010
1228 Ga0209673_1000117
1229 Ga0209673_1000151
1230 Ga0209673_1000863
1231 Ga0209673_1001685
1232 Ga0209673_1002134
1233 Ga0209673_1009188
1234 Ga0209673_1009281
1235 Ga0209673_1021742
1236 Ga0209130_1000001
1237 Ga0209130_1000003
1238 Ga0209130_1000020
1239 Ga0209130_1000034
1240 Ga0209676_1000482
1241 Ga0209676_1010300
1242 Ga0209025_1000070
1243 Ga0209025_1000140
1244 Ga0209025_1000181
1245 Ga0209025_1000314
1246 Ga0209025_1000506
1247 Ga0209025_1001813
1248 Ga0209025_1001869
1249 Ga0209025_1004380
1250 Ga0209025_1005193
1251 Ga0209025_1008432
1252 Ga0209025_1015317
1253 Ga0209025_1016060
1254 Ga0209025_1022888
1255 Ga0209564_1000013
1256 Ga0209564_1000647
1257 Ga0209564_1001131
1258 Ga0209564_1001780
1259 Ga0209564_1004823
1260 Ga0209758_1000156
1261 Ga0209758_1000405
1262 Ga0209758_1000413
1263 Ga0209758_1000655
1264 Ga0209758_1000758
1265 Ga0209758_1001882
1266 Ga0209758_1002154
1267 Ga0209758_1002252
1268 Ga0209758_1004734
1269 Ga0209758_1006389
1270 Ga0209758_1014125
1271 Ga0209050_1000646
1272 Ga0209050_1008819
1273 Ga0209256_1000396
1274 Ga0209256_1001653
1275 Ga0209256_1001736
1276 Ga0209256_1002721
1277 Ga0209256_1005804
1278 Ga0209256_1006650
1279 Ga0209256_1012329
1280 Ga0207426_1000006
1281 Ga0207426_1000008
1282 Ga0207426_1000011
1283 Ga0207426_1000045
1284 Ga0207426_1000221
1285 Ga0207426_1000869
1286 Ga0209051_1000097
1287 Ga0209051_1000314
1288 Ga0209051_1001414
1289 Ga0209051_1003927
1290 Ga0209051_1007515
1291 Ga0209051_1013189
1292 Ga0209257_1001142
1293 Ga0209257_1002070
1294 Ga0209257_1003315
1295 Ga0207695_10000011
1296 Ga0207695_10000118
1297 Ga0207671_10000093
1298 Ga0207671_10000175
1299 Ga0207650_10000837
1300 Ga0207650_10002272
1301 Ga0207711_10075060
1302 Ga0207668_10107108
1303 Ga0207702_10044361
1304 Ga0209281_1000106
1305 Ga0209281_1000318
1306 Ga0209371_1000022
1307 Ga0209371_1002282
1308 Ga0209371_1006788
1309 Ga0209371_1007555
1310 Ga0209282_1000024
1311 Ga0209282_1004803
1312 Ga0307515_10001559
1313 Ga0307515_10007368
1314 Ga0268256_1000019
1315 Ga0268256_1004953
1316 Ga0268256_1006891
1317 Ga0268256_1007789
1318 Ga0265325_10016256
1319 Ga0307513_10119150
1320 Ga0307405_10000857
1321 Ga0307405_10002833
1322 Ga0307412_10000493
1323 Ga0315914_1000012
1324 Ga0315913_1000006
1325 Ga0315915_1000010
1326 Ga0373927_0000350
1327 Ga0373925_0052624
1328 Ga0395900_0010176
1329 Ga0395905_0000867
1330 Ga0395905_0005044
1331 Ga0395901_0154081
1332 Ga0439465_0003817
1333 Ga0439465_0007101
1334 Ga0439465_0013037
1335 Ga0451853_2433547
1336 Ga0466963_0037894
1337 Ga0466970_0000026
1338 Ga0466957_0010513
1339 Ga0466957_0021187
1340 Ga0466958_0062046
1341 Ga0495638_0001181
1342 Ga0495638_0024145
1343 Ga0495605_0001952
1344 Ga0495607_0022946
1345 Ga0495583_0013196
1346 Ga0495583_0019889
1347 Ga0495606_0001601
1348 Ga0495606_0002324
1349 Ga0495606_0007174
1350 Ga0495606_0025623
1351 Ga0495606_0038135
1352 Ga0495610_0001969
1353 Ga0495610_0002191
1354 Ga0495610_0003825
1355 Ga0495610_0027406
1356 Ga0495616_0008906
1357 Ga0495620_0012690
1358 Ga0495631_0003360
1359 Ga0495632_0001278
1360 Ga0495632_0005104
1361 Ga0495632_0007228
1362 Ga0495632_0050993
1363 Ga0495643_0002802
1364 Ga0495643_0012570
1365 Ga0495643_0027634
1366 Ga0495648_0013780
1367 Ga0495663_0014361
1368 Ga0495654_0000045
1369 Ga0495654_0035169
1370 Ga0495609_0013320
1371 Ga0495597_0014741
1372 Ga0495622_0006123
1373 Ga0495633_0026822
1374 Ga0495668_0008091
1375 Ga0495625_0001387
1376 Ga0495625_0051086
1377 Ga0495588_0000895
1378 Ga0495657_0013648
1379 Ga0495670_0007690
1380 Ga0495649_0035998
1381 Ga0495600_0044740
1382 Ga0495660_0013338
1383 Ga0495604_0029637
1384 Ga0495672_0011266
1385 Ga0495683_0009820
1386 Ga0495681_0004658
1387 Ga0495686_0001455
1388 Ga0495686_0004688
1389 Ga0495686_0006538
1390 Ga0495686_0013660
1391 Ga0495686_0062023
1392 Ga0496100_0006892
1393 Ga0496101_0009796
1394 Ga0496102_0008153
1395 Ga0496102_0017086
1396 Ga0496103_0008310
1397 Ga0496106_0000957
1398 Ga0496106_0000982
1399 Ga0496111_0001270
1400 Ga0496113_0010326
1401 Ga0496116_0000142
1402 Ga0496116_0009760
1403 Ga0496116_0013505
1404 Ga0496116_0015034
1405 Ga0496116_0015182
1406 Ga0496116_0021260
1407 Ga0496116_0022090
1408 Ga0496116_0052557
1409 Ga0496117_0000002
1410 Ga0496117_0001574
1411 Ga0496117_0002367
1412 Ga0496117_0004520
1413 Ga0496117_0006762
1414 Ga0496117_0018869
1415 Ga0496117_0019692
1416 Ga0496117_0023835
1417 Ga0496117_0024641
1418 Ga0496118_0000087
1419 Ga0496118_0003357
1420 Ga0496118_0004297
1421 Ga0496118_0005314
1422 Ga0496118_0017417
1423 Ga0496118_0024847
1424 Ga0496118_0025539
1425 Ga0496119_0005947
1426 Ga0496119_0011615
1427 Ga0496119_0015392
1428 Ga0496119_0040522
1429 Ga0496120_0000413
1430 Ga0496120_0004953
1431 Ga0496120_0006147
1432 Ga0496121_0000003
1433 Ga0496121_0002536
1434 Ga0496121_0010503
1435 Ga0496121_0015847
1436 Ga0496121_0020370
1437 Ga0496121_0023681
1438 Ga0496121_0036685
1439 Ga0496121_0039518
1440 Ga0496121_0039603
1441 Ga0496121_0106562
1442 Ga0496122_0000004
1443 Ga0496122_0000190
1444 Ga0496122_0005980
1445 Ga0496122_0008521
1446 Ga0496122_0008959
1447 Ga0496122_0010294
1448 Ga0496122_0017023
1449 Ga0496122_0018314
1450 Ga0496122_0042821
1451 Ga0496123_0000007
1452 Ga0496123_0000336
1453 Ga0496123_0010318
1454 Ga0496123_0012104
1455 Ga0496123_0033840
1456 Ga0496124_0000285
1457 Ga0496124_0001040
1458 Ga0496124_0014720
1459 Ga0496124_0026382
1460 Ga0496124_0050763
1461 Ga0496124_0090675
1462 Ga0496125_0000039
1463 Ga0496125_0000248
1464 Ga0496125_0004925
1465 Ga0496125_0016232
1466 Ga0496125_0017415
1467 Ga0496125_0018773
1468 Ga0496125_0019671
1469 Ga0496125_0027607
1470 Ga0496126_0000866
1471 Ga0496126_0001294
1472 Ga0496126_0017426
1473 Ga0496126_0047995
1474 Ga0496126_0085604
1475 Ga0496126_0144505
1476 Ga0501031_0035722
1477 Ga0501032_0036811
1478 Ga0501033_0027473
1479 Ga0501034_0097012
1480 Ga0501036_0020924
1481 Ga0501036_0070972
1482 Ga0501037_0041769
1483 Ga0501037_0075558
1484 Ga0501043_0104581
1485 Ga0501047_0198606
1486 Ga0501068_0030071
1487 Ga0501080_0055887
1488 Ga0501080_0148226
1489 Ga0501083_0017170
1490 Ga0501083_0028925
1491 Ga0501280_002144
1492 Ga0501035_0071346
1493 Ga0501044_0020289
1494 Ga0501044_0077051
1495 Ga0501044_0132993
1496 nmdc:mga03683_4496_c1
1497 nmdc:mga00v17_12_c1
1498 nmdc:mga0yw44_291_c1
1499 nmdc:mga0yw44_3456_c1
1500 nmdc:mga07m45_36619_c1
1501 nmdc:mga0sz30_23498_c1
1502 nmdc:mga0sz30_3736_c1
1503 nmdc:mga0sz30_7957_c1
1504 Ga0500578_0046899
1505 Ga0500560_002077
1506 Ga0500569_012298
1507 Ga0500618_000184
1508 Ga0500618_000453
1509 Ga0500618_000677
1510 Ga0500618_001080
1511 Ga0500618_001232
1512 Ga0500618_008674
1513 Ga0500658_0000526
1514 Ga0500658_0002581
1515 Ga0500658_0015165
1516 Ga0500561_0000098
1517 Ga0500568_0000076
1518 Ga0500568_0004818
1519 Ga0500573_0003980
1520 Ga0500573_0005041
1521 Ga0500590_003631
1522 Ga0500616_0001018
1523 Ga0500616_0005682
1524 Ga0500622_0000215
1525 Ga0500622_0000458
1526 Ga0500624_000768
1527 Ga0500633_0000082
1528 Ga0500634_0000261
1529 Ga0500634_0011617
1530 Ga0500636_0000180
1531 Ga0500636_0006724
1532 2509108397
1533 2509376470
1534 2509392057
1535 2509445648
1536 2509447051
1537 2510133953
1538 2510306454
1539 2510895371
1540 2511131327
1541 2511135400
1542 2511174423
1543 2511187053
1544 2511193907
1545 2511199027
1546 2511502244
1547 2512533617
1548 2512970694
1549 2513567974
1550 2513576940
1551 2513584384
1552 2513596473
1553 2513604262
1554 2513618804
1555 2513633388
1556 2513708050
1557 2513865598
1558 2513884405
1559 2513905009
1560 2513909003
1561 2513925385
1562 2513986825
1563 2514001504
1564 2514006389
1565 2514020009
1566 2515113002
1567 2515609020
1568 2515638512
1569 2515640961
1570 2515655357
1571 2515739480
1572 2516204144
1573 2516893623
1574 2517036702
1575 2517077061
1576 2517095829
1577 2517407401
1578 2517570335
1579 2520377194
1580 2524448556
1581 2524459587
1582 2530645955
1583 2535516864
1584 2537875435
1585 2551674544
1586 2551677925
1587 2551687738
1588 2551698979
1589 2551715576
1590 2551715881
1591 2551744428
1592 2554248231
1593 2558864463
1594 2559295347
1595 2561468372
1596 2585166347
1597 2585202272
1598 2585222830
1599 2585226996
1600 2585231741
1601 2585255082
1602 2585257697
1603 2585267425
1604 2585271137
1605 2585274460
1606 2585277481
1607 2585280869
1608 2585323335
1609 2585324390
1610 2585331477
1611 2585335929
1612 2585386493
1613 2585393255
1614 2585402399
1615 2585527441
1616 2585530573
1617 2585535108
1618 2585538182
1619 2585545413
1620 2585550411
1621 2585554748
1622 2585555958
1623 2585558861
1624 2585561819
1625 2585822914
1626 2585836131
1627 2585842893
1628 2585843225
1629 2585898243
1630 2585902426
1631 2585904169
1632 2585907551
1633 2585996202
1634 2586000812
1635 2587980714
1636 2587982972
1637 2599331750
1638 2599417301
1639 2599601659
1640 2599721913
1641 2600194392
1642 2600374360
1643 2601610081
1644 2601746856
1645 2616293366
1646 2616308956
1647 2616310748
1648 2616554227
1649 2616557383
1650 2617382085
1651 2617384719
1652 2643803089
1653 2643811533
1654 2643856772
1655 2643920345
1656 2644003159
1657 2644050520
1658 2644063451
1659 2644107280
1660 2644150846
1661 2644191573
1662 2644193507
1663 2644205748
1664 2644238681
1665 2644308675
1666 2644335493
1667 2644374734
1668 2644414214
1669 2644447742
1670 2644483438
1671 2644492029
1672 2644499649
1673 2644521959
1674 2644539898
1675 2644614616
1676 2644676080
1677 2644690215
1678 2657681560
1679 2671111431
1680 2671117062
1681 2692315542
1682 2719181804
1683 2719386407
1684 2719666155
1685 2719732468
1686 2720492575
1687 2720614010
1688 2720620815
1689 2720632140
1690 2720775868
1691 2721147895
1692 2721159346
1693 2721164731
1694 2721400111
1695 2722840901
1696 2723027472
1697 2723561091
1698 2723567687
1699 2724038924
1700 2724045224
1701 2724090475
1702 2724104952
1703 2724110811
1704 2725952563
1705 2730108408
1706 2730165039
1707 2730298978
1708 2738800083
1709 2738801503
1710 2738945523
1711 2738947336
1712 2739032839
1713 2753462027
1714 2766065867
1715 2776913923
1716 2778173558
1717 2778175414
1718 2792585128
1719 2792620772
1720 2792626131
1721 2792639067
1722 2793280305
1723 2793294439
1724 2793314545
1725 2793320373
1726 2793329542
1727 2793334488
1728 2793339205
1729 2793348878
1730 2793351834
1731 2793362586
1732 2793368876
1733 2802720030
1734 2802727037
1735 2802731960
1736 2802739291
1737 2802745728
1738 2802752329
1739 2804752751
1740 2805928803
1741 2805935085
1742 2806043819
1743 2806050250
1744 2806057066
1745 2806064448
1746 2806071715
1747 2808987919
1748 2819559060
1749 2819609147
1750 2819637625
1751 2819641125
1752 2838017655
1753 2838027544
1754 2838029807
1755 2838034861
1756 2838038499
1757 2838043966
1758 2838054388
1759 2838068017
1760 2838070145
1761 2838076860
1762 2838661590
1763 2838670358
1764 2838675778
1765 2838683470
1766 2838687057
1767 2838697587
1768 2838702729
1769 2838710703
1770 2838714660
1771 2838721539
1772 2838725420
1773 2838729970
1774 2838743015
1775 2841848491
1776 2841852501
1777 2841862122
1778 2841870780
1779 2842078876
1780 2842113272
1781 2842118614
1782 2842125478
1783 2842130673
1784 2842148013
1785 2842154157
1786 2842158039
1787 2842168797
1788 2842170904
1789 2842177777
1790 2842181658
1791 2842187769
1792 2842197355
1793 2842203554
1794 2842205482
1795 2842212080
1796 2842217934
1797 2842226301
1798 2842230291
1799 2842240526
1800 2842244193
1801 2842253079
1802 2842257721
1803 2842266264
1804 2842271405
1805 2842278939
1806 2842285603
1807 2842292538
1808 2842301368
1809 2842305033
1810 2842314915
1811 2842320707
1812 2842346456
1813 2842357905
1814 2842368965
1815 2842374101
1816 2842378936
1817 2842385125
1818 2842399886
1819 2842402963
1820 2842409665
1821 2842416316
1822 2842423759
1823 2842430727
1824 2842437286
1825 2842443656
1826 2842454049
1827 2842464870
1828 2842471904
1829 2842476908
1830 2842481645
1831 2842484432
1832 2842484562
1833 2842491975
1834 2842496829
1835 2842503335
1836 2842508004
1837 2842511131
1838 2842518906
1839 2842521813
1840 2842924155
1841 2844164572
1842 2844458424
1843 2847419396
1844 2848994423
1845 2850081466
1846 2852390223
1847 2854899587
1848 2854918412
1849 2855826343
1850 2855841733
1851 2855872522
1852 2857517436
1853 2858802518
1854 2891373346
1855 2896389027
1856 2899796054
1857 2899807270
1858 2899850632
1859 2913299312
1860 2913310229
1861 2913312566
1862 2915981442
1863 2915991446
1864 2915998703
1865 2916003483
1866 2916011654
1867 2916020780
1868 2916024955
1869 2916033768
1870 2916037869
1871 2916045331
1872 2916049045
1873 2916055717
1874 2916064901
1875 2916083200
1876 2919107458
1877 2919107659
1878 2919114698
1879 2919169241
1880 2919174712
1881 2919409978
1882 2919413875
1883 2920761521
1884 2920825213
1885 2921201867
1886 2921211109
1887 2921240927
1888 2921246771
1889 2921252089
1890 2921263768
1891 2921266212
1892 2921287978
1893 2921290953
1894 2921299040
1895 2923558571
1896 2924146751
1897 2924157989
1898 2924159277
1899 2924169157
1900 2924174566
1901 2924182997
1902 2924192708
1903 2924195387
1904 2924203322
1905 2924210741
1906 2924217126
1907 2924223291
1908 2924230523
1909 2926755714
1910 2926762829
1911 2929140869
1912 2933008802
1913 2933014920
1914 2933022323
1915 2933570841
1916 2933588672
1917 2933596597
1918 2933600951
1919 2935897028
1920 2935901961
1921 2936372040
1922 2936379903
1923 2936382807
1924 2937000707
1925 2937004557
1926 2937011199
1927 2937019822
1928 2937024585
1929 2937030288
1930 2937042670
1931 2937045541
1932 2937056155
1933 2937063569
1934 2937067775
1935 2937074392
1936 2937080274
1937 2937086027
1938 2937097222
1939 2937103034
1940 2937111258
1941 2937116143
1942 2937121986
1943 2937128827
1944 2941502138
1945 2957376383
1946 2957384276
1947 2957390739
1948 2957395895
1949 2957404501
1950 2957412088
1951 2957421210
1952 2957427172
1953 2957431717
1954 2957438169
1955 2957446907
1956 2957453749
1957 2957461945
1958 2957467043
1959 2957476387
1960 2957479603
1961 2957490461
1962 2957494108
1963 2957503311
1964 2957510615
1965 2960587488
1966 2960592088
1967 2960599992
1968 2960610590
1969 2960612315
1970 2960620465
1971 2960624480
1972 2960632048
1973 2960644123
1974 2960648414
1975 2960656525
1976 2960665566
1977 2960669659
1978 2960675159
1979 2960681623
1980 2960691467
1981 2960694801
1982 2964614126
1983 2964617747
1984 2964623632
1985 2964632587
1986 2964640818
1987 2964645685
1988 2964651556
1989 2964660526
1990 2964666922
1991 2964675343
1992 2964682875
1993 2964688483
1994 2964692480
1995 2964701642
1996 2964711092
1997 2964715159
1998 2964720679
1999 2967665124
2000 2967678413
2001 2967684425
2002 2967689715
2003 2967694644
2004 2967706464
2005 2967708622
2006 2967714875
2007 2967726123
2008 2967728993
2009 2967737148
2010 2967742555
2011 2967751602
2012 2967760018
2013 2967767515
2014 2967772120
2015 2967778981
2016 2970021061
2017 2970028343
2018 2970040290
2019 2970042640
2020 2970050971
2021 2970056701
2022 2970067143
2023 2970071587
2024 2970078263
2025 2970085245
2026 2970092547
2027 2970102155
2028 2970107998
2029 2970110709
2030 2970117355
2031 2970125822
2032 2970131165
2033 2970136293
2034 2970146728
2035 2970151615
2036 2970159568
2037 2970166977
2038 2970174243
2039 2970180825
2040 2970189170
2041 2970193600
2042 2977519116
2043 2977526329
2044 2977534055
2045 2977539626
2046 2977546360
2047 2977558432
2048 2977563173
2049 2977567665
2050 2977575746
2051 2977581997
2052 2978974617
2053 2979094678
2054 2979100757
2055 2979103913
2056 2984511520
2057 2984522120
2058 2984541418
2059 2984603695
2060 2989349670
2061 2989774285
2062 2996889040
2063 2996894333
2064 3003934064
2065 3005414602
2066 3005419472
2067 3005419807
2068 3005448444
2069 3005451110
2070 3005454634
2071 639649186
2072 643826312
2073 648739212
2074 650740557
2075 8003571622
2076 8003994166
2077 8004001798
2078 8005260303
2079 8005281204
2080 8005283260
2081 8005293634
2082 8005303119
2083 8005312828
2084 8005316373
2085 8005316763
2086 8005323567
2087 8005380922
2088 8005389128
2089 8005396108
2090 8005435151
2091 8005463681
2092 8005489189
2093 8005500893
2094 8005545616
2095 8005557021
2096 8005567987
2097 8005573468
2098 8005622266
2099 8005632254
2100 8005648135
2101 8005659031
2102 8005660062
2103 8005672311
2104 8005682891
2105 8005686926
2106 8005692113
2107 8005697394
2108 8018134088
2109 8018153226
2110 8018164632
2111 8018181331
2112 8023683174
2113 8024482869
2114 8024488025
2115 8024504417
2116 8046771931
2117 8046773323
2118 8049295320
2119 8054462973
2120 8054558649
2121 8054568608
2122 8055432762
2123 8056375928
2124 8056386719
2125 8057575739
2126 8057877680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03717

PBP_dimer

Penicillin-binding Protein dimerisation domain

99

228

0.91

PF00905

Transpeptidase

Penicillin binding protein transpeptidase domain

274

576

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xqx-assembly1.cif.gz_A crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae with the h514a mutation at ph 7.5 0.9513 234 572
6xqz-assembly1.cif.gz_A crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae at ph 7.5 0.9497 234 572
6xqy-assembly1.cif.gz_A crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae at ph 9.5 0.9492 234 572
6p54-assembly2.cif.gz_B crystal structure of transpeptidase domain of pbp2 from neisseria gonorrhoeae acylated by ceftriaxone 0.9463 234 576
6p56-assembly1.cif.gz_A crystal structure of the transpeptidase domain of a t498a mutant of pbp2 from neisseria gonorrhoeae 0.9431 234 571
ID Description Score Start End Superfamily
3ue3A03 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9259 296 477 3.40.710.10
5uy7A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9238 234 572 3.40.710.10
5df7A02 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9207 235 572 3.40.710.10
4u3tA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9174 234 572 3.40.710.10
3ue3A03 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9114 296 477 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A4Q3H5U8-F1-model_v4 Penicillin-binding protein 2 0.9552 321 578 GO:0005886
GO:0008658
GO:0071555
AF-A0A836QQU9-F1-model_v4 Penicillin-binding protein 2 0.9546 229 562 GO:0005886
GO:0008658
GO:0071555
AF-A0A522SM81-F1-model_v4 Penicillin-binding protein 2 0.9526 162 584 GO:0005886
GO:0008658
GO:0071555
AF-A0A1G3IIE1-F1-model_v4 Penicillin-binding protein transpeptidase domain-containing protein 0.9493 317 576 GO:0005886
GO:0008658
GO:0071555
AF-I5BQZ1-F1-model_v4 Penicillin-binding protein, transpeptidase 0.9492 317 584 GO:0005886
GO:0008658
GO:0071555

Map