F489367
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1065 | 484 | 2130 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300006042|Ga0075368_10083281|Ga0075368_100832812 |
| Length | 156 |
| Sequence | VIFAHPGHRSMSIEDDVALFERVPTLSLLGTAALRMLAIGSEQRDFSAGDYLFNAGDEADAGYIVQRGSFRVEDGGAEVVAGPGSLIGELALIVAMKRPSSAVALDHASVIRVARSLFQRVLESDPAAARRLRDELATRTSQLASDILMAGAKLSI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 95 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 96 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 130 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 131 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 207 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 260 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 261 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 266 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 267 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 368 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 373 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 376 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 377 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 378 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 379 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 380 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 381 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 382 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 383 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 384 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 414 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 416 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 424 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 427 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 428 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 432 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 434 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 435 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 436 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 437 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 438 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 439 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 440 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 441 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 443 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 444 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 445 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 447 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 449 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 450 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 451 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 453 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 455 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 457 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 459 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 460 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 461 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 462 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 463 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 464 | 2791355199 | |||
| 465 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 466 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 467 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 468 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 469 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 470 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 471 | 2906610324 | |||
| 472 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 473 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 474 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 475 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 476 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 477 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 478 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 479 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 480 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 481 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 482 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 483 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 484 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.74 |
| Metatranscriptomes | 0 |
| Isolates | 2.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.7 |
| Nodule | 2.35 |
| Rhizoplane | 7.98 |
| Rhizosphere | 76.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075368_10083281 | 3300006042 | Bacteria | 1303 |
| 2 | JGI25406J46586_10005031 | 3300003203 | Bacteria | 6140 |
| 3 | JGI25165J46597_1022757 | 3300003214 | Bacteria | 817 |
| 4 | JGI25404J52841_10001308 | 3300003659 | Bacteria | 4327 |
| 5 | JGI25405J52794_10026811 | 3300003911 | Bacteria | 1185 |
| 6 | Ga0065715_10043807 | 3300005293 | Bacteria | 1176 |
| 7 | Ga0070683_100057276 | 3300005329 | Bacteria | 3620 |
| 8 | Ga0070670_100476247 | 3300005331 | Bacteria | 1108 |
| 9 | Ga0070677_10344105 | 3300005333 | Bacteria | 771 |
| 10 | Ga0068869_100101991 | 3300005334 | Bacteria | 2171 |
| 11 | Ga0068869_100229449 | 3300005334 | Bacteria | 1474 |
| 12 | Ga0068869_100340376 | 3300005334 | Bacteria | 1220 |
| 13 | Ga0068869_100498288 | 3300005334 | Bacteria | 1016 |
| 14 | Ga0070666_10161456 | 3300005335 | Bacteria | 1566 |
| 15 | Ga0070666_10488888 | 3300005335 | Bacteria | 892 |
| 16 | Ga0070680_100054700 | 3300005336 | Bacteria | 3260 |
| 17 | Ga0070682_100055337 | 3300005337 | Bacteria | 2492 |
| 18 | Ga0068868_100019711 | 3300005338 | Bacteria | 5057 |
| 19 | Ga0068868_100022147 | 3300005338 | Bacteria | 4792 |
| 20 | Ga0068868_100319979 | 3300005338 | Bacteria | 1321 |
| 21 | Ga0068868_100641910 | 3300005338 | Bacteria | 944 |
| 22 | Ga0068868_100847586 | 3300005338 | Bacteria | 828 |
| 23 | Ga0070660_100036213 | 3300005339 | Bacteria | 3736 |
| 24 | Ga0070660_100406858 | 3300005339 | Bacteria | 1126 |
| 25 | Ga0070689_100355605 | 3300005340 | Bacteria | 1229 |
| 26 | Ga0070687_100480020 | 3300005343 | Bacteria | 833 |
| 27 | Ga0070661_100039129 | 3300005344 | Bacteria | 3455 |
| 28 | Ga0070661_100139697 | 3300005344 | Bacteria | 1825 |
| 29 | Ga0070668_100096268 | 3300005347 | Bacteria | 2339 |
| 30 | Ga0070668_100100324 | 3300005347 | Bacteria | 2293 |
| 31 | Ga0070668_100291344 | 3300005347 | Bacteria | 1366 |
| 32 | Ga0070668_100493975 | 3300005347 | Bacteria | 1058 |
| 33 | Ga0070668_100588024 | 3300005347 | Bacteria | 972 |
| 34 | Ga0070668_100668867 | 3300005347 | Bacteria | 913 |
| 35 | Ga0070668_101115051 | 3300005347 | Bacteria | 712 |
| 36 | Ga0070668_101217857 | 3300005347 | Bacteria | 682 |
| 37 | Ga0070668_101427324 | 3300005347 | Bacteria | 631 |
| 38 | Ga0070669_100190221 | 3300005353 | Bacteria | 1610 |
| 39 | Ga0070669_101073698 | 3300005353 | Bacteria | 693 |
| 40 | Ga0070675_100283247 | 3300005354 | Bacteria | 1457 |
| 41 | Ga0070675_100328839 | 3300005354 | Bacteria | 1351 |
| 42 | Ga0070671_100189782 | 3300005355 | Bacteria | 1741 |
| 43 | Ga0070671_100511413 | 3300005355 | Bacteria | 1033 |
| 44 | Ga0070671_100575055 | 3300005355 | Bacteria | 973 |
| 45 | Ga0070674_100080106 | 3300005356 | Bacteria | 2331 |
| 46 | Ga0070674_100242257 | 3300005356 | Bacteria | 1412 |
| 47 | Ga0070673_100075656 | 3300005364 | Bacteria | 2716 |
| 48 | Ga0070673_100205132 | 3300005364 | Bacteria | 1699 |
| 49 | Ga0070688_100368798 | 3300005365 | Bacteria | 1056 |
| 50 | Ga0070659_100083150 | 3300005366 | Bacteria | 2558 |
| 51 | Ga0070659_100090516 | 3300005366 | Bacteria | 2452 |
| 52 | Ga0070659_100628436 | 3300005366 | Bacteria | 925 |
| 53 | Ga0070659_100837153 | 3300005366 | Bacteria | 801 |
| 54 | Ga0070667_100339874 | 3300005367 | Bacteria | 1357 |
| 55 | Ga0070709_10001880 | 3300005434 | Bacteria | 11387 |
| 56 | Ga0070709_10251445 | 3300005434 | Bacteria | 1274 |
| 57 | Ga0070709_10558577 | 3300005434 | Bacteria | 877 |
| 58 | Ga0070714_100166014 | 3300005435 | Bacteria | 2001 |
| 59 | Ga0070714_100938018 | 3300005435 | Bacteria | 841 |
| 60 | Ga0070713_100003661 | 3300005436 | Bacteria | 10174 |
| 61 | Ga0070713_100254527 | 3300005436 | Bacteria | 1603 |
| 62 | Ga0070713_100432354 | 3300005436 | Bacteria | 1234 |
| 63 | Ga0070710_10001236 | 3300005437 | Bacteria | 12109 |
| 64 | Ga0070710_10767458 | 3300005437 | Bacteria | 686 |
| 65 | Ga0070701_10046388 | 3300005438 | Bacteria | 2234 |
| 66 | Ga0070711_100000660 | 3300005439 | Bacteria | 18001 |
| 67 | Ga0070694_100190827 | 3300005444 | Bacteria | 1521 |
| 68 | Ga0070663_100004283 | 3300005455 | Bacteria | 8352 |
| 69 | Ga0070663_100006019 | 3300005455 | Bacteria | 7261 |
| 70 | Ga0070663_100041490 | 3300005455 | Bacteria | 3228 |
| 71 | Ga0070663_100106616 | 3300005455 | Bacteria | 2099 |
| 72 | Ga0070663_100145967 | 3300005455 | Bacteria | 1810 |
| 73 | Ga0070663_100513745 | 3300005455 | Bacteria | 996 |
| 74 | Ga0070678_100101607 | 3300005456 | Bacteria | 2229 |
| 75 | Ga0070678_100155518 | 3300005456 | Bacteria | 1846 |
| 76 | Ga0070678_100239872 | 3300005456 | Bacteria | 1515 |
| 77 | Ga0070678_100463077 | 3300005456 | Bacteria | 1113 |
| 78 | Ga0070662_100068881 | 3300005457 | Bacteria | 2602 |
| 79 | Ga0070662_100568075 | 3300005457 | Bacteria | 952 |
| 80 | Ga0070681_10041351 | 3300005458 | Bacteria | 4620 |
| 81 | Ga0070685_10197790 | 3300005466 | Bacteria | 1305 |
| 82 | Ga0070685_10299751 | 3300005466 | Bacteria | 1083 |
| 83 | Ga0070707_100247197 | 3300005468 | Bacteria | 1736 |
| 84 | Ga0070698_100250562 | 3300005471 | Bacteria | 1704 |
| 85 | Ga0070698_100679092 | 3300005471 | Bacteria | 972 |
| 86 | Ga0070699_100747027 | 3300005518 | Bacteria | 895 |
| 87 | Ga0070679_100044363 | 3300005530 | Bacteria | 4429 |
| 88 | Ga0070679_100137917 | 3300005530 | Bacteria | 2420 |
| 89 | Ga0070679_101313556 | 3300005530 | Bacteria | 669 |
| 90 | Ga0070684_100013455 | 3300005535 | Bacteria | 6598 |
| 91 | Ga0070697_100040762 | 3300005536 | Bacteria | 3758 |
| 92 | Ga0070697_100164270 | 3300005536 | Bacteria | 1877 |
| 93 | Ga0068853_100012684 | 3300005539 | Bacteria | 6862 |
| 94 | Ga0068853_100320184 | 3300005539 | Bacteria | 1437 |
| 95 | Ga0068853_100409342 | 3300005539 | Bacteria | 1270 |
| 96 | Ga0068853_100438174 | 3300005539 | Bacteria | 1228 |
| 97 | Ga0070672_100111060 | 3300005543 | Bacteria | 2234 |
| 98 | Ga0070686_100156329 | 3300005544 | Bacteria | 1601 |
| 99 | Ga0070686_100695189 | 3300005544 | Bacteria | 810 |
| 100 | Ga0070695_100460213 | 3300005545 | Bacteria | 976 |
| 101 | Ga0070695_100963103 | 3300005545 | Bacteria | 692 |
| 102 | Ga0070696_100326881 | 3300005546 | Bacteria | 1182 |
| 103 | Ga0070696_100781622 | 3300005546 | Bacteria | 784 |
| 104 | Ga0070693_100030109 | 3300005547 | Bacteria | 2966 |
| 105 | Ga0070693_100820982 | 3300005547 | Bacteria | 691 |
| 106 | Ga0070665_100024472 | 3300005548 | Bacteria | 6081 |
| 107 | Ga0070665_100039914 | 3300005548 | Bacteria | 4719 |
| 108 | Ga0070665_100171968 | 3300005548 | Bacteria | 2167 |
| 109 | Ga0070665_100217866 | 3300005548 | Bacteria | 1909 |
| 110 | Ga0070665_100600358 | 3300005548 | Bacteria | 1114 |
| 111 | Ga0070665_100860059 | 3300005548 | Bacteria | 920 |
| 112 | Ga0070665_101112290 | 3300005548 | Bacteria | 801 |
| 113 | Ga0070665_101374247 | 3300005548 | Bacteria | 715 |
| 114 | Ga0070704_100329757 | 3300005549 | Bacteria | 1282 |
| 115 | Ga0068855_100152875 | 3300005563 | Bacteria | 2623 |
| 116 | Ga0068855_100325655 | 3300005563 | Bacteria | 1697 |
| 117 | Ga0068855_100805940 | 3300005563 | Bacteria | 998 |
| 118 | Ga0070664_100226362 | 3300005564 | Bacteria | 1675 |
| 119 | Ga0070664_101090609 | 3300005564 | Bacteria | 752 |
| 120 | Ga0068857_100018485 | 3300005577 | Bacteria | 6114 |
| 121 | Ga0068857_100300019 | 3300005577 | Bacteria | 1481 |
| 122 | Ga0068857_100744212 | 3300005577 | Bacteria | 933 |
| 123 | Ga0068854_100103682 | 3300005578 | Bacteria | 2136 |
| 124 | Ga0068854_101170817 | 3300005578 | Bacteria | 688 |
| 125 | Ga0068856_100187404 | 3300005614 | Bacteria | 2083 |
| 126 | Ga0068856_100342633 | 3300005614 | Bacteria | 1513 |
| 127 | Ga0070702_100030607 | 3300005615 | Bacteria | 2936 |
| 128 | Ga0070702_100463897 | 3300005615 | Bacteria | 922 |
| 129 | Ga0068852_100061074 | 3300005616 | Bacteria | 3274 |
| 130 | Ga0068852_100283593 | 3300005616 | Bacteria | 1598 |
| 131 | Ga0068852_100437310 | 3300005616 | Bacteria | 1293 |
| 132 | Ga0068859_100143978 | 3300005617 | Bacteria | 2457 |
| 133 | Ga0068859_100163963 | 3300005617 | Bacteria | 2302 |
| 134 | Ga0068859_100285767 | 3300005617 | Bacteria | 1742 |
| 135 | Ga0068859_100387875 | 3300005617 | Bacteria | 1492 |
| 136 | Ga0068864_100215262 | 3300005618 | Bacteria | 1771 |
| 137 | Ga0068864_100470018 | 3300005618 | Bacteria | 1205 |
| 138 | Ga0068866_10223485 | 3300005718 | Bacteria | 1137 |
| 139 | Ga0068861_100278047 | 3300005719 | Bacteria | 1440 |
| 140 | Ga0068861_101297616 | 3300005719 | Bacteria | 708 |
| 141 | Ga0068851_10011859 | 3300005834 | Bacteria | 4097 |
| 142 | Ga0068851_10219431 | 3300005834 | Bacteria | 1068 |
| 143 | Ga0068851_10387661 | 3300005834 | Bacteria | 820 |
| 144 | Ga0068863_100232337 | 3300005841 | Bacteria | 1779 |
| 145 | Ga0068863_100333555 | 3300005841 | Bacteria | 1474 |
| 146 | Ga0068863_101461091 | 3300005841 | Bacteria | 692 |
| 147 | Ga0068858_100016049 | 3300005842 | Bacteria | 7036 |
| 148 | Ga0068858_100057164 | 3300005842 | Bacteria | 3605 |
| 149 | Ga0068858_100425075 | 3300005842 | Bacteria | 1278 |
| 150 | Ga0068858_101043936 | 3300005842 | Bacteria | 801 |
| 151 | Ga0068860_100086214 | 3300005843 | Bacteria | 2988 |
| 152 | Ga0068860_100326155 | 3300005843 | Bacteria | 1507 |
| 153 | Ga0068862_100351637 | 3300005844 | Bacteria | 1367 |
| 154 | Ga0081455_10005984 | 3300005937 | Bacteria | 13195 |
| 155 | Ga0081455_10008111 | 3300005937 | Bacteria | 10962 |
| 156 | Ga0081455_10011164 | 3300005937 | Bacteria | 9043 |
| 157 | Ga0081455_10028676 | 3300005937 | Bacteria | 5082 |
| 158 | Ga0081455_10277173 | 3300005937 | Bacteria | 1213 |
| 159 | Ga0081455_10296594 | 3300005937 | Bacteria | 1162 |
| 160 | Ga0081538_10031555 | 3300005981 | Bacteria | 3570 |
| 161 | Ga0081540_1001950 | 3300005983 | Bacteria | 17252 |
| 162 | Ga0081540_1013355 | 3300005983 | Bacteria | 5344 |
| 163 | Ga0081540_1015913 | 3300005983 | Bacteria | 4740 |
| 164 | Ga0081540_1022081 | 3300005983 | Bacteria | 3766 |
| 165 | Ga0081540_1023147 | 3300005983 | Bacteria | 3645 |
| 166 | Ga0081540_1025816 | 3300005983 | Bacteria | 3370 |
| 167 | Ga0081540_1059141 | 3300005983 | Bacteria | 1842 |
| 168 | Ga0081540_1080759 | 3300005983 | Bacteria | 1465 |
| 169 | Ga0081540_1096413 | 3300005983 | Bacteria | 1287 |
| 170 | Ga0081540_1209291 | 3300005983 | Bacteria | 703 |
| 171 | Ga0081539_10001064 | 3300005985 | Bacteria | 50201 |
| 172 | Ga0081539_10158403 | 3300005985 | Bacteria | 1082 |
| 173 | Ga0070717_10104664 | 3300006028 | Bacteria | 2408 |
| 174 | Ga0075368_10036443 | 3300006042 | Bacteria | 1922 |
| 175 | Ga0075363_100036055 | 3300006048 | Bacteria | 2592 |
| 176 | Ga0075363_100252532 | 3300006048 | Bacteria | 1016 |
| 177 | Ga0075364_10535182 | 3300006051 | Bacteria | 801 |
| 178 | Ga0070715_10000108 | 3300006163 | Bacteria | 20251 |
| 179 | Ga0070715_10061039 | 3300006163 | Bacteria | 1655 |
| 180 | Ga0070716_100003373 | 3300006173 | Bacteria | 7517 |
| 181 | Ga0070716_100081143 | 3300006173 | Bacteria | 1936 |
| 182 | Ga0070716_101381619 | 3300006173 | Bacteria | 572 |
| 183 | Ga0070712_100175596 | 3300006175 | Bacteria | 1666 |
| 184 | Ga0075362_10110465 | 3300006177 | Bacteria | 1293 |
| 185 | Ga0075362_10175531 | 3300006177 | Bacteria | 1037 |
| 186 | Ga0075362_10194650 | 3300006177 | Bacteria | 985 |
| 187 | Ga0075367_10019052 | 3300006178 | Bacteria | 3799 |
| 188 | Ga0075367_10584169 | 3300006178 | Bacteria | 710 |
| 189 | Ga0075369_10065526 | 3300006186 | Bacteria | 1592 |
| 190 | Ga0075369_10091113 | 3300006186 | Bacteria | 1361 |
| 191 | Ga0075369_10120898 | 3300006186 | Bacteria | 1185 |
| 192 | Ga0075369_10285141 | 3300006186 | Bacteria | 770 |
| 193 | Ga0075366_10263289 | 3300006195 | Bacteria | 1052 |
| 194 | Ga0075366_10378298 | 3300006195 | Bacteria | 870 |
| 195 | Ga0097621_100059415 | 3300006237 | Bacteria | 3130 |
| 196 | Ga0097621_100356720 | 3300006237 | Bacteria | 1302 |
| 197 | Ga0097621_100562793 | 3300006237 | Bacteria | 1039 |
| 198 | Ga0097621_101578693 | 3300006237 | Bacteria | 623 |
| 199 | Ga0075370_10101372 | 3300006353 | Bacteria | 1666 |
| 200 | Ga0075370_10298076 | 3300006353 | Bacteria | 958 |
| 201 | Ga0075370_10309862 | 3300006353 | Bacteria | 940 |
| 202 | Ga0075370_10655801 | 3300006353 | Bacteria | 637 |
| 203 | Ga0068871_100274748 | 3300006358 | Bacteria | 1472 |
| 204 | Ga0068871_100697797 | 3300006358 | Bacteria | 930 |
| 205 | Ga0075428_100085123 | 3300006844 | Bacteria | 3448 |
| 206 | Ga0075430_100416688 | 3300006846 | Bacteria | 1109 |
| 207 | Ga0075433_10113605 | 3300006852 | Bacteria | 2402 |
| 208 | Ga0075434_100071865 | 3300006871 | Bacteria | 3452 |
| 209 | Ga0075434_101486958 | 3300006871 | Bacteria | 687 |
| 210 | Ga0068865_100137618 | 3300006881 | Bacteria | 1837 |
| 211 | Ga0075436_100065143 | 3300006914 | Bacteria | 2519 |
| 212 | Ga0097620_100143973 | 3300006931 | Bacteria | 2457 |
| 213 | Ga0097620_100163966 | 3300006931 | Bacteria | 2302 |
| 214 | Ga0097620_100285751 | 3300006931 | Bacteria | 1742 |
| 215 | Ga0097620_100387894 | 3300006931 | Bacteria | 1492 |
| 216 | Ga0099825_1041366 | 3300006941 | Bacteria | 1326 |
| 217 | Ga0099824_1013118 | 3300006942 | Bacteria | 8741 |
| 218 | Ga0099822_1000007 | 3300006943 | Bacteria | 77453 |
| 219 | Ga0075435_100022140 | 3300007076 | Bacteria | 4900 |
| 220 | Ga0075435_101589091 | 3300007076 | Bacteria | 574 |
| 221 | Ga0099794_10003899 | 3300007265 | Bacteria | 5778 |
| 222 | Ga0099794_10022739 | 3300007265 | Bacteria | 2860 |
| 223 | Ga0099794_10071677 | 3300007265 | Bacteria | 1698 |
| 224 | Ga0099794_10280335 | 3300007265 | Bacteria | 862 |
| 225 | Ga0099795_10004002 | 3300007788 | Bacteria | 3742 |
| 226 | Ga0099795_10025241 | 3300007788 | Bacteria | 1991 |
| 227 | Ga0099795_10385447 | 3300007788 | Bacteria | 634 |
| 228 | Ga0105250_10031767 | 3300009092 | Bacteria | 2120 |
| 229 | Ga0105250_10309136 | 3300009092 | Bacteria | 685 |
| 230 | Ga0105240_10013534 | 3300009093 | Bacteria | 11198 |
| 231 | Ga0105240_10465454 | 3300009093 | Bacteria | 1412 |
| 232 | Ga0105240_12409352 | 3300009093 | Bacteria | 545 |
| 233 | Ga0105245_10305400 | 3300009098 | Bacteria | 1563 |
| 234 | Ga0105245_10986325 | 3300009098 | Bacteria | 886 |
| 235 | Ga0105245_11532193 | 3300009098 | Bacteria | 718 |
| 236 | Ga0105245_11895014 | 3300009098 | Bacteria | 649 |
| 237 | Ga0105247_10148239 | 3300009101 | Bacteria | 1544 |
| 238 | Ga0105247_10231821 | 3300009101 | Bacteria | 1254 |
| 239 | Ga0114129_10144590 | 3300009147 | Bacteria | 3258 |
| 240 | Ga0114129_12077105 | 3300009147 | Bacteria | 686 |
| 241 | Ga0105243_10340224 | 3300009148 | Bacteria | 1374 |
| 242 | Ga0105243_10665406 | 3300009148 | Bacteria | 1011 |
| 243 | Ga0105243_11826886 | 3300009148 | Bacteria | 639 |
| 244 | Ga0105243_12315773 | 3300009148 | Bacteria | 575 |
| 245 | Ga0105243_12826006 | 3300009148 | Bacteria | 526 |
| 246 | Ga0105241_10241838 | 3300009174 | Bacteria | 1526 |
| 247 | Ga0105241_10888921 | 3300009174 | Bacteria | 826 |
| 248 | Ga0105242_10405567 | 3300009176 | Bacteria | 1273 |
| 249 | Ga0105242_10689974 | 3300009176 | Bacteria | 998 |
| 250 | Ga0105242_11578412 | 3300009176 | Bacteria | 689 |
| 251 | Ga0105248_10403979 | 3300009177 | Bacteria | 1538 |
| 252 | Ga0105237_10017081 | 3300009545 | Bacteria | 7528 |
| 253 | Ga0105237_10022854 | 3300009545 | Bacteria | 6414 |
| 254 | Ga0105237_10291074 | 3300009545 | Bacteria | 1636 |
| 255 | Ga0105237_10437709 | 3300009545 | Bacteria | 1313 |
| 256 | Ga0105237_11123598 | 3300009545 | Bacteria | 792 |
| 257 | Ga0105237_11415667 | 3300009545 | Bacteria | 702 |
| 258 | Ga0105238_10160027 | 3300009551 | Bacteria | 2227 |
| 259 | Ga0105238_10284200 | 3300009551 | Bacteria | 1636 |
| 260 | Ga0105238_10656870 | 3300009551 | Bacteria | 1059 |
| 261 | Ga0105238_11001183 | 3300009551 | Bacteria | 857 |
| 262 | Ga0105249_10058990 | 3300009553 | Bacteria | 3519 |
| 263 | Ga0105249_11057152 | 3300009553 | Bacteria | 881 |
| 264 | Ga0105249_11292009 | 3300009553 | Bacteria | 801 |
| 265 | Ga0105249_11546025 | 3300009553 | Bacteria | 736 |
| 266 | Ga0099796_10070681 | 3300010159 | Bacteria | 1259 |
| 267 | Ga0099796_10262636 | 3300010159 | Bacteria | 721 |
| 268 | Ga0099796_10288461 | 3300010159 | Bacteria | 692 |
| 269 | Ga0099796_10479453 | 3300010159 | Bacteria | 556 |
| 270 | Ga0105239_10031640 | 3300010375 | Bacteria | 5817 |
| 271 | Ga0105239_10327997 | 3300010375 | Bacteria | 1726 |
| 272 | Ga0105239_10337166 | 3300010375 | Bacteria | 1701 |
| 273 | Ga0105239_10582750 | 3300010375 | Bacteria | 1275 |
| 274 | Ga0105239_11077120 | 3300010375 | Bacteria | 925 |
| 275 | Ga0105246_10029026 | 3300011119 | Bacteria | 3638 |
| 276 | Ga0105246_10145415 | 3300011119 | Bacteria | 1788 |
| 277 | Ga0105246_10617184 | 3300011119 | Bacteria | 939 |
| 278 | Ga0157317_1006476 | 3300012475 | Bacteria | 818 |
| 279 | Ga0157370_10057525 | 3300013104 | Bacteria | 3696 |
| 280 | Ga0157370_10157802 | 3300013104 | Bacteria | 2111 |
| 281 | Ga0157369_10057884 | 3300013105 | Bacteria | 4181 |
| 282 | Ga0157374_10028269 | 3300013296 | Bacteria | 5066 |
| 283 | Ga0157374_10036000 | 3300013296 | Bacteria | 4532 |
| 284 | Ga0157374_10785472 | 3300013296 | Bacteria | 968 |
| 285 | Ga0157378_10232684 | 3300013297 | Bacteria | 1757 |
| 286 | Ga0157378_10254811 | 3300013297 | Bacteria | 1681 |
| 287 | Ga0157378_10457022 | 3300013297 | Bacteria | 1268 |
| 288 | Ga0157378_12241853 | 3300013297 | Bacteria | 597 |
| 289 | Ga0163162_10043869 | 3300013306 | Bacteria | 4477 |
| 290 | Ga0163162_10372823 | 3300013306 | Bacteria | 1560 |
| 291 | Ga0163162_10677893 | 3300013306 | Bacteria | 1154 |
| 292 | Ga0163162_10812570 | 3300013306 | Bacteria | 1052 |
| 293 | Ga0163162_11198528 | 3300013306 | Bacteria | 862 |
| 294 | Ga0157372_11771564 | 3300013307 | Bacteria | 710 |
| 295 | Ga0157372_12521854 | 3300013307 | Bacteria | 590 |
| 296 | Ga0157375_10508577 | 3300013308 | Bacteria | 1368 |
| 297 | Ga0157375_12214709 | 3300013308 | Bacteria | 655 |
| 298 | Ga0163163_10002009 | 3300014325 | Bacteria | 17183 |
| 299 | Ga0163163_10078671 | 3300014325 | Bacteria | 3294 |
| 300 | Ga0163163_10779476 | 3300014325 | Bacteria | 1019 |
| 301 | Ga0157380_10644389 | 3300014326 | Bacteria | 1056 |
| 302 | Ga0157380_10892325 | 3300014326 | Bacteria | 914 |
| 303 | Ga0157380_10971924 | 3300014326 | Bacteria | 880 |
| 304 | Ga0157377_10136398 | 3300014745 | Bacteria | 1504 |
| 305 | Ga0157377_10583519 | 3300014745 | Bacteria | 795 |
| 306 | Ga0157377_10909713 | 3300014745 | Bacteria | 658 |
| 307 | Ga0157377_10927522 | 3300014745 | Bacteria | 653 |
| 308 | Ga0157379_10018063 | 3300014968 | Bacteria | 6216 |
| 309 | Ga0157379_10595404 | 3300014968 | Bacteria | 1032 |
| 310 | Ga0157379_10613719 | 3300014968 | Bacteria | 1016 |
| 311 | Ga0157379_11638325 | 3300014968 | Bacteria | 629 |
| 312 | Ga0157379_11746039 | 3300014968 | Bacteria | 610 |
| 313 | Ga0157376_10017044 | 3300014969 | Bacteria | 5532 |
| 314 | Ga0157376_10138313 | 3300014969 | Bacteria | 2182 |
| 315 | Ga0157376_10344822 | 3300014969 | Bacteria | 1423 |
| 316 | Ga0157376_10490967 | 3300014969 | Bacteria | 1205 |
| 317 | Ga0163161_10558273 | 3300017792 | Bacteria | 939 |
| 318 | Ga0163161_10912093 | 3300017792 | Bacteria | 745 |
| 319 | Ga0213873_10002209 | 3300021358 | Bacteria | 3344 |
| 320 | Ga0213872_10070436 | 3300021361 | Bacteria | 1577 |
| 321 | Ga0213872_10344068 | 3300021361 | Bacteria | 613 |
| 322 | Ga0213874_10006326 | 3300021377 | Bacteria | 2802 |
| 323 | Ga0213876_10005462 | 3300021384 | Bacteria | 6986 |
| 324 | Ga0213876_10071525 | 3300021384 | Bacteria | 1832 |
| 325 | Ga0209233_1001514 | 3300025261 | Bacteria | 9126 |
| 326 | Ga0209758_1003344 | 3300025297 | Bacteria | 14725 |
| 327 | Ga0209758_1015313 | 3300025297 | Bacteria | 3985 |
| 328 | Ga0207697_10025606 | 3300025315 | Bacteria | 2411 |
| 329 | Ga0207656_10084455 | 3300025321 | Bacteria | 1432 |
| 330 | Ga0207656_10153819 | 3300025321 | Bacteria | 1091 |
| 331 | Ga0207653_10054382 | 3300025885 | Bacteria | 1339 |
| 332 | Ga0207682_10185059 | 3300025893 | Bacteria | 953 |
| 333 | Ga0207692_10000829 | 3300025898 | Bacteria | 11083 |
| 334 | Ga0207710_10336767 | 3300025900 | Bacteria | 767 |
| 335 | Ga0207688_10139410 | 3300025901 | Bacteria | 1427 |
| 336 | Ga0207688_10152616 | 3300025901 | Bacteria | 1365 |
| 337 | Ga0207688_10167449 | 3300025901 | Bacteria | 1305 |
| 338 | Ga0207688_10171453 | 3300025901 | Bacteria | 1290 |
| 339 | Ga0207680_10363416 | 3300025903 | Bacteria | 1018 |
| 340 | Ga0207680_10476161 | 3300025903 | Bacteria | 888 |
| 341 | Ga0207647_10155427 | 3300025904 | Bacteria | 1336 |
| 342 | Ga0207685_10001367 | 3300025905 | Bacteria | 5051 |
| 343 | Ga0207685_10164329 | 3300025905 | Bacteria | 1016 |
| 344 | Ga0207685_10199366 | 3300025905 | Bacteria | 939 |
| 345 | Ga0207699_10004989 | 3300025906 | Bacteria | 6347 |
| 346 | Ga0207645_10043296 | 3300025907 | Bacteria | 2881 |
| 347 | Ga0207643_10273737 | 3300025908 | Bacteria | 1045 |
| 348 | Ga0207705_10244175 | 3300025909 | Bacteria | 1368 |
| 349 | Ga0207654_10269225 | 3300025911 | Bacteria | 1149 |
| 350 | Ga0207654_10735191 | 3300025911 | Bacteria | 710 |
| 351 | Ga0207707_10004934 | 3300025912 | Bacteria | 11734 |
| 352 | Ga0207707_10105415 | 3300025912 | Bacteria | 2464 |
| 353 | Ga0207695_10033471 | 3300025913 | Bacteria | 5603 |
| 354 | Ga0207695_10151832 | 3300025913 | Bacteria | 2255 |
| 355 | Ga0207671_10033557 | 3300025914 | Bacteria | 3817 |
| 356 | Ga0207671_10045233 | 3300025914 | Bacteria | 3255 |
| 357 | Ga0207671_10047548 | 3300025914 | Bacteria | 3176 |
| 358 | Ga0207671_10063451 | 3300025914 | Bacteria | 2745 |
| 359 | Ga0207671_10083371 | 3300025914 | Bacteria | 2400 |
| 360 | Ga0207671_10543341 | 3300025914 | Bacteria | 926 |
| 361 | Ga0207693_10000310 | 3300025915 | Bacteria | 45408 |
| 362 | Ga0207693_10005993 | 3300025915 | Bacteria | 10080 |
| 363 | Ga0207693_10036014 | 3300025915 | Bacteria | 3900 |
| 364 | Ga0207693_10847462 | 3300025915 | Bacteria | 703 |
| 365 | Ga0207663_10000230 | 3300025916 | Bacteria | 24696 |
| 366 | Ga0207663_10009652 | 3300025916 | Bacteria | 5107 |
| 367 | Ga0207663_10730238 | 3300025916 | Bacteria | 786 |
| 368 | Ga0207660_10011652 | 3300025917 | Bacteria | 5733 |
| 369 | Ga0207660_10064010 | 3300025917 | Bacteria | 2653 |
| 370 | Ga0207662_10077673 | 3300025918 | Bacteria | 2020 |
| 371 | Ga0207657_10022864 | 3300025919 | Bacteria | 5836 |
| 372 | Ga0207657_10229612 | 3300025919 | Bacteria | 1484 |
| 373 | Ga0207649_10101458 | 3300025920 | Bacteria | 1905 |
| 374 | Ga0207649_10132939 | 3300025920 | Bacteria | 1692 |
| 375 | Ga0207649_11358260 | 3300025920 | Bacteria | 562 |
| 376 | Ga0207652_10002828 | 3300025921 | Bacteria | 14572 |
| 377 | Ga0207652_10175637 | 3300025921 | Bacteria | 1924 |
| 378 | Ga0207681_10178556 | 3300025923 | Bacteria | 1615 |
| 379 | Ga0207694_10048946 | 3300025924 | Bacteria | 3271 |
| 380 | Ga0207694_10199304 | 3300025924 | Bacteria | 1628 |
| 381 | Ga0207694_10201814 | 3300025924 | Bacteria | 1618 |
| 382 | Ga0207650_10191966 | 3300025925 | Bacteria | 1632 |
| 383 | Ga0207650_10603275 | 3300025925 | Bacteria | 923 |
| 384 | Ga0207659_11421753 | 3300025926 | Bacteria | 594 |
| 385 | Ga0207687_10066362 | 3300025927 | Bacteria | 2565 |
| 386 | Ga0207687_10294416 | 3300025927 | Bacteria | 1305 |
| 387 | Ga0207687_10845203 | 3300025927 | Bacteria | 782 |
| 388 | Ga0207687_11246467 | 3300025927 | Bacteria | 639 |
| 389 | Ga0207700_10021866 | 3300025928 | Bacteria | 4377 |
| 390 | Ga0207700_10076835 | 3300025928 | Bacteria | 2592 |
| 391 | Ga0207700_10113880 | 3300025928 | Bacteria | 2181 |
| 392 | Ga0207700_11027583 | 3300025928 | Bacteria | 737 |
| 393 | Ga0207700_11693477 | 3300025928 | Bacteria | 558 |
| 394 | Ga0207664_10001147 | 3300025929 | Bacteria | 17636 |
| 395 | Ga0207664_10289562 | 3300025929 | Bacteria | 1439 |
| 396 | Ga0207664_11517751 | 3300025929 | Bacteria | 592 |
| 397 | Ga0207644_10105890 | 3300025931 | Bacteria | 2119 |
| 398 | Ga0207644_10394385 | 3300025931 | Bacteria | 1130 |
| 399 | Ga0207644_10458984 | 3300025931 | Bacteria | 1047 |
| 400 | Ga0207644_11030039 | 3300025931 | Bacteria | 691 |
| 401 | Ga0207690_10779457 | 3300025932 | Bacteria | 789 |
| 402 | Ga0207706_10183747 | 3300025933 | Bacteria | 1836 |
| 403 | Ga0207706_10422850 | 3300025933 | Bacteria | 1154 |
| 404 | Ga0207669_10627604 | 3300025937 | Bacteria | 876 |
| 405 | Ga0207704_10026355 | 3300025938 | Bacteria | 3188 |
| 406 | Ga0207665_10003377 | 3300025939 | Bacteria | 10687 |
| 407 | Ga0207665_10028331 | 3300025939 | Bacteria | 3699 |
| 408 | Ga0207665_10410649 | 3300025939 | Bacteria | 1033 |
| 409 | Ga0207665_10750668 | 3300025939 | Bacteria | 769 |
| 410 | Ga0207665_11041790 | 3300025939 | Bacteria | 651 |
| 411 | Ga0207691_10172349 | 3300025940 | Bacteria | 1894 |
| 412 | Ga0207691_10579060 | 3300025940 | Bacteria | 951 |
| 413 | Ga0207691_10596088 | 3300025940 | Bacteria | 935 |
| 414 | Ga0207711_10108773 | 3300025941 | Bacteria | 2463 |
| 415 | Ga0207689_10299334 | 3300025942 | Bacteria | 1333 |
| 416 | Ga0207689_10662279 | 3300025942 | Bacteria | 880 |
| 417 | Ga0207689_10667697 | 3300025942 | Bacteria | 876 |
| 418 | Ga0207689_10828033 | 3300025942 | Bacteria | 781 |
| 419 | Ga0207689_11011769 | 3300025942 | Bacteria | 701 |
| 420 | Ga0207661_10621100 | 3300025944 | Bacteria | 992 |
| 421 | Ga0207661_11140644 | 3300025944 | Bacteria | 718 |
| 422 | Ga0207679_10188478 | 3300025945 | Bacteria | 1713 |
| 423 | Ga0207667_10033916 | 3300025949 | Bacteria | 5484 |
| 424 | Ga0207667_10046837 | 3300025949 | Bacteria | 4579 |
| 425 | Ga0207667_10323540 | 3300025949 | Bacteria | 1575 |
| 426 | Ga0207667_10725976 | 3300025949 | Bacteria | 994 |
| 427 | Ga0207667_10736403 | 3300025949 | Bacteria | 986 |
| 428 | Ga0207651_11685075 | 3300025960 | Bacteria | 571 |
| 429 | Ga0207668_10084474 | 3300025972 | Bacteria | 2313 |
| 430 | Ga0207668_10229600 | 3300025972 | Bacteria | 1495 |
| 431 | Ga0207668_10269628 | 3300025972 | Bacteria | 1391 |
| 432 | Ga0207668_11075907 | 3300025972 | Bacteria | 720 |
| 433 | Ga0207668_11323720 | 3300025972 | Bacteria | 649 |
| 434 | Ga0207640_10578462 | 3300025981 | Bacteria | 948 |
| 435 | Ga0207658_10377977 | 3300025986 | Bacteria | 1240 |
| 436 | Ga0207677_10846895 | 3300026023 | Bacteria | 821 |
| 437 | Ga0207677_10950800 | 3300026023 | Bacteria | 777 |
| 438 | Ga0207703_10460605 | 3300026035 | Bacteria | 1189 |
| 439 | Ga0207703_10546886 | 3300026035 | Bacteria | 1091 |
| 440 | Ga0207703_11102772 | 3300026035 | Bacteria | 762 |
| 441 | Ga0207639_10020456 | 3300026041 | Bacteria | 4737 |
| 442 | Ga0207639_10585829 | 3300026041 | Bacteria | 1027 |
| 443 | Ga0207639_10804131 | 3300026041 | Bacteria | 876 |
| 444 | Ga0207678_10003936 | 3300026067 | Bacteria | 13364 |
| 445 | Ga0207678_10038029 | 3300026067 | Bacteria | 4184 |
| 446 | Ga0207678_10060441 | 3300026067 | Bacteria | 3259 |
| 447 | Ga0207678_10111318 | 3300026067 | Bacteria | 2335 |
| 448 | Ga0207678_10276024 | 3300026067 | Bacteria | 1442 |
| 449 | Ga0207678_10285739 | 3300026067 | Bacteria | 1416 |
| 450 | Ga0207678_10801106 | 3300026067 | Bacteria | 832 |
| 451 | Ga0207678_10811112 | 3300026067 | Bacteria | 826 |
| 452 | Ga0207708_10150915 | 3300026075 | Bacteria | 1829 |
| 453 | Ga0207702_10258568 | 3300026078 | Bacteria | 1638 |
| 454 | Ga0207641_10052079 | 3300026088 | Bacteria | 3466 |
| 455 | Ga0207641_10157936 | 3300026088 | Bacteria | 2059 |
| 456 | Ga0207676_10118741 | 3300026095 | Bacteria | 2226 |
| 457 | Ga0207676_10183336 | 3300026095 | Bacteria | 1835 |
| 458 | Ga0207676_10470385 | 3300026095 | Bacteria | 1188 |
| 459 | Ga0207676_10526692 | 3300026095 | Bacteria | 1126 |
| 460 | Ga0207676_11857207 | 3300026095 | Bacteria | 601 |
| 461 | Ga0207674_10035377 | 3300026116 | Bacteria | 5212 |
| 462 | Ga0207674_10243898 | 3300026116 | Bacteria | 1744 |
| 463 | Ga0207675_100150426 | 3300026118 | Bacteria | 2215 |
| 464 | Ga0207675_100868222 | 3300026118 | Bacteria | 918 |
| 465 | Ga0207675_101811801 | 3300026118 | Bacteria | 629 |
| 466 | Ga0207683_10046557 | 3300026121 | Bacteria | 3796 |
| 467 | Ga0207683_10302354 | 3300026121 | Bacteria | 1464 |
| 468 | Ga0207683_10344193 | 3300026121 | Bacteria | 1368 |
| 469 | Ga0207683_10377084 | 3300026121 | Bacteria | 1303 |
| 470 | Ga0207698_10245737 | 3300026142 | Bacteria | 1634 |
| 471 | Ga0207698_10360493 | 3300026142 | Bacteria | 1376 |
| 472 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 473 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 474 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 475 | Ga0209179_1021592 | 3300027512 | Bacteria | 1258 |
| 476 | Ga0209179_1036546 | 3300027512 | Bacteria | 1023 |
| 477 | Ga0209179_1039240 | 3300027512 | Bacteria | 993 |
| 478 | Ga0209588_1009657 | 3300027671 | Bacteria | 2886 |
| 479 | Ga0268266_10001190 | 3300028379 | Bacteria | 32120 |
| 480 | Ga0268266_10026628 | 3300028379 | Bacteria | 4920 |
| 481 | Ga0268266_10136800 | 3300028379 | Bacteria | 2195 |
| 482 | Ga0268266_10177059 | 3300028379 | Bacteria | 1939 |
| 483 | Ga0268266_10244142 | 3300028379 | Bacteria | 1658 |
| 484 | Ga0268266_10464199 | 3300028379 | Bacteria | 1205 |
| 485 | Ga0268265_10108354 | 3300028380 | Bacteria | 2261 |
| 486 | Ga0268265_10673746 | 3300028380 | Bacteria | 996 |
| 487 | Ga0268265_10938787 | 3300028380 | Bacteria | 851 |
| 488 | Ga0268264_10838001 | 3300028381 | Bacteria | 920 |
| 489 | Ga0268264_11260465 | 3300028381 | Bacteria | 749 |
| 490 | Ga0265334_10011626 | 3300028573 | Bacteria | 3701 |
| 491 | Ga0307517_10144360 | 3300028786 | Bacteria | 1657 |
| 492 | Ga0307515_10117765 | 3300028794 | Bacteria | 3037 |
| 493 | Ga0307515_10355136 | 3300028794 | Bacteria | 1110 |
| 494 | Ga0307515_10536209 | 3300028794 | Bacteria | 780 |
| 495 | Ga0307512_10213162 | 3300030522 | Bacteria | 1023 |
| 496 | Ga0265330_10032679 | 3300031235 | Bacteria | 2331 |
| 497 | Ga0265332_10032204 | 3300031238 | Bacteria | 2285 |
| 498 | Ga0265331_10115739 | 3300031250 | Bacteria | 1228 |
| 499 | Ga0307513_10079098 | 3300031456 | Bacteria | 3398 |
| 500 | Ga0307513_10124353 | 3300031456 | Bacteria | 2539 |
| 501 | Ga0307513_10289279 | 3300031456 | Bacteria | 1411 |
| 502 | Ga0307513_10296134 | 3300031456 | Bacteria | 1387 |
| 503 | Ga0307509_10109035 | 3300031507 | Bacteria | 2780 |
| 504 | Ga0307408_100680306 | 3300031548 | Bacteria | 923 |
| 505 | Ga0307408_101597115 | 3300031548 | Bacteria | 619 |
| 506 | Ga0307408_101618310 | 3300031548 | Bacteria | 615 |
| 507 | Ga0307408_101759614 | 3300031548 | Bacteria | 592 |
| 508 | Ga0307408_101947593 | 3300031548 | Bacteria | 564 |
| 509 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 510 | Ga0307508_10392970 | 3300031616 | Bacteria | 978 |
| 511 | Ga0307508_10616974 | 3300031616 | Bacteria | 687 |
| 512 | Ga0265314_10078677 | 3300031711 | Bacteria | 2182 |
| 513 | Ga0265342_10005840 | 3300031712 | Bacteria | 9294 |
| 514 | Ga0307516_10026599 | 3300031730 | Bacteria | 5874 |
| 515 | Ga0307516_10055776 | 3300031730 | Bacteria | 3856 |
| 516 | Ga0307516_10073131 | 3300031730 | Bacteria | 3285 |
| 517 | Ga0307516_10407746 | 3300031730 | Bacteria | 1018 |
| 518 | Ga0307413_10061383 | 3300031824 | Bacteria | 2319 |
| 519 | Ga0307406_10037569 | 3300031901 | Bacteria | 2992 |
| 520 | Ga0307406_10281523 | 3300031901 | Bacteria | 1269 |
| 521 | Ga0307406_10302761 | 3300031901 | Bacteria | 1229 |
| 522 | Ga0307407_10388790 | 3300031903 | Bacteria | 998 |
| 523 | Ga0307407_10414938 | 3300031903 | Bacteria | 969 |
| 524 | Ga0307412_10156128 | 3300031911 | Bacteria | 1689 |
| 525 | Ga0307412_10408085 | 3300031911 | Bacteria | 1108 |
| 526 | Ga0307412_12278855 | 3300031911 | Bacteria | 505 |
| 527 | Ga0307416_100466527 | 3300032002 | Bacteria | 1319 |
| 528 | Ga0307416_101921018 | 3300032002 | Bacteria | 695 |
| 529 | Ga0307416_102134282 | 3300032002 | Bacteria | 662 |
| 530 | Ga0307414_10079957 | 3300032004 | Bacteria | 2389 |
| 531 | Ga0307414_11540638 | 3300032004 | Bacteria | 619 |
| 532 | Ga0307411_10175504 | 3300032005 | Bacteria | 1621 |
| 533 | Ga0307415_100039787 | 3300032126 | Bacteria | 3111 |
| 534 | Ga0307415_101799059 | 3300032126 | Bacteria | 593 |
| 535 | Ga0307507_10334425 | 3300033179 | Bacteria | 902 |
| 536 | Ga0307510_10016711 | 3300033180 | Bacteria | 8658 |
| 537 | Ga0307510_10018241 | 3300033180 | Bacteria | 8262 |
| 538 | Ga0307510_10090848 | 3300033180 | Bacteria | 2898 |
| 539 | Ga0373930_0015324 | 3300034816 | Bacteria | 1438 |
| 540 | Ga0373930_0071943 | 3300034816 | Bacteria | 787 |
| 541 | Ga0373938_0089022 | 3300034957 | Bacteria | 761 |
| 542 | Ga0373934_0001837 | 3300035086 | Bacteria | 7804 |
| 543 | Ga0373940_0018427 | 3300035088 | Bacteria | 1752 |
| 544 | Ga0373949_0160911 | 3300035090 | Bacteria | 655 |
| 545 | Ga0373923_0000584 | 3300035111 | Bacteria | 9020 |
| 546 | Ga0373932_0007741 | 3300035112 | Bacteria | 2564 |
| 547 | Ga0373932_0040581 | 3300035112 | Bacteria | 1341 |
| 548 | Ga0373936_0037608 | 3300035113 | Bacteria | 1933 |
| 549 | Ga0373936_0072456 | 3300035113 | Bacteria | 1422 |
| 550 | Ga0373953_0004679 | 3300035117 | Bacteria | 4382 |
| 551 | Ga0373953_0005933 | 3300035117 | Bacteria | 3996 |
| 552 | Ga0373953_0088641 | 3300035117 | Bacteria | 1293 |
| 553 | Ga0373954_0000457 | 3300035118 | Bacteria | 15282 |
| 554 | Ga0373954_0003801 | 3300035118 | Bacteria | 6446 |
| 555 | Ga0373954_0314106 | 3300035118 | Bacteria | 773 |
| 556 | Ga0373956_0002647 | 3300035119 | Bacteria | 7252 |
| 557 | Ga0373956_0095376 | 3300035119 | Bacteria | 1375 |
| 558 | Ga0373957_0004514 | 3300035120 | Bacteria | 4236 |
| 559 | Ga0373957_0091627 | 3300035120 | Bacteria | 1209 |
| 560 | Ga0373943_0706600 | 3300035170 | Bacteria | 597 |
| 561 | Ga0373946_0157220 | 3300035171 | Bacteria | 1065 |
| 562 | Ga0373946_0698539 | 3300035171 | Bacteria | 530 |
| 563 | Ga0373955_0001753 | 3300035172 | Bacteria | 9318 |
| 564 | Ga0373955_1037096 | 3300035172 | Bacteria | 505 |
| 565 | Ga0373942_0174898 | 3300035207 | Bacteria | 701 |
| 566 | Ga0373942_0261773 | 3300035207 | Bacteria | 591 |
| 567 | Ga0373962_0166982 | 3300035242 | Bacteria | 729 |
| 568 | Ga0373924_0000541 | 3300035410 | Bacteria | 11623 |
| 569 | Ga0373931_0003137 | 3300035691 | Bacteria | 7381 |
| 570 | Ga0373931_0035089 | 3300035691 | Bacteria | 2606 |
| 571 | Ga0373931_0093843 | 3300035691 | Bacteria | 1677 |
| 572 | Ga0373931_0208930 | 3300035691 | Bacteria | 1170 |
| 573 | Ga0373935_0750917 | 3300035692 | Bacteria | 719 |
| 574 | Ga0373927_0004813 | 3300035695 | Bacteria | 9384 |
| 575 | Ga0373927_0068940 | 3300035695 | Bacteria | 2289 |
| 576 | Ga0373927_0321833 | 3300035695 | Bacteria | 1018 |
| 577 | Ga0373927_0382760 | 3300035695 | Bacteria | 928 |
| 578 | Ga0373927_0944146 | 3300035695 | Bacteria | 569 |
| 579 | Ga0373933_0004255 | 3300035724 | Bacteria | 7878 |
| 580 | Ga0373933_0015606 | 3300035724 | Bacteria | 4236 |
| 581 | Ga0373933_0413936 | 3300035724 | Bacteria | 880 |
| 582 | Ga0373933_0847308 | 3300035724 | Bacteria | 602 |
| 583 | Ga0373947_0018758 | 3300035725 | Bacteria | 3984 |
| 584 | Ga0373947_0053711 | 3300035725 | Bacteria | 2430 |
| 585 | Ga0373937_0007949 | 3300036401 | Bacteria | 9195 |
| 586 | Ga0373937_0060148 | 3300036401 | Bacteria | 3491 |
| 587 | Ga0373937_0413087 | 3300036401 | Bacteria | 1280 |
| 588 | Ga0373925_0020848 | 3300037068 | Bacteria | 4777 |
| 589 | Ga0373925_0322393 | 3300037068 | Bacteria | 1250 |
| 590 | Ga0373925_0755909 | 3300037068 | Bacteria | 801 |
| 591 | Ga0395898_0192439 | 3300037466 | Bacteria | 1949 |
| 592 | Ga0395905_0045415 | 3300037471 | Bacteria | 4120 |
| 593 | Ga0395901_0108441 | 3300038443 | Bacteria | 2915 |
| 594 | Ga0436365_0147971 | 3300039437 | Bacteria | 1146 |
| 595 | Ga0436365_0725440 | 3300039437 | Bacteria | 10515 |
| 596 | Ga0436365_0870281 | 3300039437 | Bacteria | 1107 |
| 597 | Ga0436365_1521235 | 3300039437 | Bacteria | 2773 |
| 598 | Ga0436360_0049247 | 3300039438 | Bacteria | 659 |
| 599 | Ga0436361_1075147 | 3300039447 | Bacteria | 1699 |
| 600 | Ga0436361_1180359 | 3300039447 | Bacteria | 1703 |
| 601 | Ga0436363_0125979 | 3300039450 | Bacteria | 4409 |
| 602 | Ga0436363_0449948 | 3300039450 | Bacteria | 4308 |
| 603 | Ga0436363_0859709 | 3300039450 | Bacteria | 1179 |
| 604 | Ga0436362_0490728 | 3300039453 | Bacteria | 4488 |
| 605 | Ga0439461_0215132 | 3300041410 | Bacteria | 522 |
| 606 | Ga0451793_1519244 | 3300041452 | Bacteria | 601 |
| 607 | Ga0451800_1461880 | 3300041459 | Bacteria | 652 |
| 608 | Ga0451802_1581769 | 3300041460 | Bacteria | 877 |
| 609 | Ga0451807_0100949 | 3300041486 | Bacteria | 590 |
| 610 | Ga0451807_0551131 | 3300041486 | Bacteria | 1003 |
| 611 | Ga0451853_0276032 | 3300041512 | Bacteria | 1558 |
| 612 | Ga0451853_2010475 | 3300041512 | Bacteria | 908 |
| 613 | Ga0439431_0058714 | 3300041997 | Bacteria | 1009 |
| 614 | Ga0439458_0105670 | 3300042157 | Bacteria | 734 |
| 615 | Ga0466969_0500927 | 3300044656 | Bacteria | 554 |
| 616 | Ga0466966_0143026 | 3300044684 | Bacteria | 1461 |
| 617 | Ga0466963_0195311 | 3300044694 | Bacteria | 1415 |
| 618 | Ga0466964_0299525 | 3300044706 | Bacteria | 810 |
| 619 | Ga0466957_0206439 | 3300044842 | Bacteria | 1292 |
| 620 | Ga0466959_0095420 | 3300045049 | Bacteria | 2133 |
| 621 | Ga0466959_0175405 | 3300045049 | Bacteria | 1502 |
| 622 | Ga0466958_0070229 | 3300045836 | Bacteria | 2143 |
| 623 | Ga0495617_115334 | 3300046452 | Bacteria | 867 |
| 624 | Ga0495592_0005520 | 3300046454 | Bacteria | 9352 |
| 625 | Ga0495592_0017032 | 3300046454 | Bacteria | 5516 |
| 626 | Ga0495592_0548530 | 3300046454 | Bacteria | 711 |
| 627 | Ga0495603_0009420 | 3300046455 | Bacteria | 5902 |
| 628 | Ga0495603_0031353 | 3300046455 | Bacteria | 3200 |
| 629 | Ga0495603_0032179 | 3300046455 | Bacteria | 3156 |
| 630 | Ga0495603_0182138 | 3300046455 | Bacteria | 1215 |
| 631 | Ga0495603_0251264 | 3300046455 | Bacteria | 1018 |
| 632 | Ga0495603_0286546 | 3300046455 | Bacteria | 946 |
| 633 | Ga0495590_0196847 | 3300046457 | Bacteria | 740 |
| 634 | Ga0495629_0000124 | 3300046459 | Bacteria | 68796 |
| 635 | Ga0495629_0019538 | 3300046459 | Bacteria | 4839 |
| 636 | Ga0495629_0205127 | 3300046459 | Bacteria | 1362 |
| 637 | Ga0495629_0322325 | 3300046459 | Bacteria | 1056 |
| 638 | Ga0495629_0680707 | 3300046459 | Bacteria | 684 |
| 639 | Ga0495638_0068701 | 3300046460 | Bacteria | 2172 |
| 640 | Ga0495638_0143782 | 3300046460 | Bacteria | 1389 |
| 641 | Ga0495638_0561132 | 3300046460 | Bacteria | 566 |
| 642 | Ga0495641_0114432 | 3300046461 | Bacteria | 1203 |
| 643 | Ga0495651_0038303 | 3300046462 | Bacteria | 3733 |
| 644 | Ga0495651_0041553 | 3300046462 | Bacteria | 3571 |
| 645 | Ga0495651_0048532 | 3300046462 | Bacteria | 3279 |
| 646 | Ga0495653_0018700 | 3300046463 | Bacteria | 5625 |
| 647 | Ga0495650_0044302 | 3300046471 | Bacteria | 1882 |
| 648 | Ga0495650_0149724 | 3300046471 | Bacteria | 839 |
| 649 | Ga0495580_0173040 | 3300046472 | Bacteria | 1492 |
| 650 | Ga0495580_0640376 | 3300046472 | Bacteria | 700 |
| 651 | Ga0495582_0216236 | 3300046473 | Bacteria | 1096 |
| 652 | Ga0495605_0074128 | 3300046474 | Bacteria | 1602 |
| 653 | Ga0495605_0353624 | 3300046474 | Bacteria | 616 |
| 654 | Ga0495639_0010176 | 3300046475 | Bacteria | 4045 |
| 655 | Ga0495639_0011821 | 3300046475 | Bacteria | 3765 |
| 656 | Ga0495639_0175348 | 3300046475 | Bacteria | 1042 |
| 657 | Ga0495664_0186020 | 3300046477 | Bacteria | 1259 |
| 658 | Ga0495664_0552547 | 3300046477 | Bacteria | 686 |
| 659 | Ga0495584_0154657 | 3300046491 | Bacteria | 1165 |
| 660 | Ga0495584_0260805 | 3300046491 | Bacteria | 881 |
| 661 | Ga0495584_0315505 | 3300046491 | Bacteria | 794 |
| 662 | Ga0495584_0419443 | 3300046491 | Bacteria | 680 |
| 663 | Ga0495585_0051609 | 3300046492 | Bacteria | 2278 |
| 664 | Ga0495594_0213414 | 3300046499 | Bacteria | 1101 |
| 665 | Ga0495594_0325484 | 3300046499 | Bacteria | 875 |
| 666 | Ga0495594_0605335 | 3300046499 | Bacteria | 621 |
| 667 | Ga0495596_0286243 | 3300046500 | Bacteria | 640 |
| 668 | Ga0495607_0277858 | 3300046501 | Bacteria | 796 |
| 669 | Ga0495607_0354581 | 3300046501 | Bacteria | 676 |
| 670 | Ga0495583_0072582 | 3300046506 | Bacteria | 1510 |
| 671 | Ga0495583_0185166 | 3300046506 | Bacteria | 851 |
| 672 | Ga0495606_0111682 | 3300046507 | Bacteria | 1648 |
| 673 | Ga0495606_0442193 | 3300046507 | Bacteria | 668 |
| 674 | Ga0495608_0002253 | 3300046511 | Bacteria | 13922 |
| 675 | Ga0495608_0018263 | 3300046511 | Bacteria | 4839 |
| 676 | Ga0495608_0709897 | 3300046511 | Bacteria | 598 |
| 677 | Ga0495616_0159601 | 3300046513 | Bacteria | 1015 |
| 678 | Ga0495616_0171049 | 3300046513 | Bacteria | 971 |
| 679 | Ga0495616_0373556 | 3300046513 | Bacteria | 590 |
| 680 | Ga0495618_0008644 | 3300046514 | Bacteria | 6154 |
| 681 | Ga0495618_0434356 | 3300046514 | Bacteria | 799 |
| 682 | Ga0495618_0527281 | 3300046514 | Bacteria | 709 |
| 683 | Ga0495620_0219096 | 3300046515 | Bacteria | 729 |
| 684 | Ga0495620_0308263 | 3300046515 | Bacteria | 601 |
| 685 | Ga0495628_0010523 | 3300046516 | Bacteria | 7852 |
| 686 | Ga0495628_0213293 | 3300046516 | Bacteria | 1451 |
| 687 | Ga0495628_0806211 | 3300046516 | Bacteria | 657 |
| 688 | Ga0495630_0423003 | 3300046517 | Bacteria | 1021 |
| 689 | Ga0495630_0491654 | 3300046517 | Bacteria | 941 |
| 690 | Ga0495631_0042150 | 3300046518 | Bacteria | 2017 |
| 691 | Ga0495631_0114330 | 3300046518 | Bacteria | 1160 |
| 692 | Ga0495631_0126228 | 3300046518 | Bacteria | 1100 |
| 693 | Ga0495632_0028862 | 3300046519 | Bacteria | 2894 |
| 694 | Ga0495632_0167360 | 3300046519 | Bacteria | 1011 |
| 695 | Ga0495632_0269147 | 3300046519 | Bacteria | 760 |
| 696 | Ga0495643_0440432 | 3300046522 | Bacteria | 569 |
| 697 | Ga0495644_0067837 | 3300046523 | Bacteria | 1340 |
| 698 | Ga0495644_0125454 | 3300046523 | Bacteria | 977 |
| 699 | Ga0495644_0146613 | 3300046523 | Bacteria | 902 |
| 700 | Ga0495648_0312553 | 3300046524 | Bacteria | 732 |
| 701 | Ga0495663_0063724 | 3300046525 | Bacteria | 1162 |
| 702 | Ga0495663_0335989 | 3300046525 | Bacteria | 548 |
| 703 | Ga0495642_0043703 | 3300046528 | Bacteria | 1828 |
| 704 | Ga0495642_0389011 | 3300046528 | Bacteria | 614 |
| 705 | Ga0495652_0021486 | 3300046529 | Bacteria | 5736 |
| 706 | Ga0495652_0034509 | 3300046529 | Bacteria | 4408 |
| 707 | Ga0495652_0791622 | 3300046529 | Bacteria | 632 |
| 708 | Ga0495665_0557993 | 3300046531 | Bacteria | 574 |
| 709 | Ga0495640_0020098 | 3300046533 | Bacteria | 4920 |
| 710 | Ga0495640_0035828 | 3300046533 | Bacteria | 3510 |
| 711 | Ga0495640_0187493 | 3300046533 | Bacteria | 1316 |
| 712 | Ga0495587_0015106 | 3300046536 | Bacteria | 4825 |
| 713 | Ga0495587_0019403 | 3300046536 | Bacteria | 4207 |
| 714 | Ga0495587_0789730 | 3300046536 | Bacteria | 519 |
| 715 | Ga0495598_0023551 | 3300046537 | Bacteria | 1659 |
| 716 | Ga0495598_0053990 | 3300046537 | Bacteria | 1219 |
| 717 | Ga0495598_0121980 | 3300046537 | Bacteria | 884 |
| 718 | Ga0495609_0133827 | 3300046538 | Bacteria | 1060 |
| 719 | Ga0495609_0152655 | 3300046538 | Bacteria | 982 |
| 720 | Ga0495609_0246544 | 3300046538 | Bacteria | 736 |
| 721 | Ga0495621_0058368 | 3300046539 | Bacteria | 1395 |
| 722 | Ga0495597_0063414 | 3300046542 | Bacteria | 1606 |
| 723 | Ga0495645_0016860 | 3300046543 | Bacteria | 5228 |
| 724 | Ga0495645_0074551 | 3300046543 | Bacteria | 2443 |
| 725 | Ga0495622_0015732 | 3300046557 | Bacteria | 3518 |
| 726 | Ga0495622_0145857 | 3300046557 | Bacteria | 1073 |
| 727 | Ga0495622_0464518 | 3300046557 | Bacteria | 542 |
| 728 | Ga0495633_0040434 | 3300046558 | Bacteria | 2221 |
| 729 | Ga0495633_0106287 | 3300046558 | Bacteria | 1302 |
| 730 | Ga0495633_0460207 | 3300046558 | Bacteria | 574 |
| 731 | Ga0495667_0000551 | 3300046559 | Bacteria | 23946 |
| 732 | Ga0495667_0060348 | 3300046559 | Bacteria | 2487 |
| 733 | Ga0495656_0070007 | 3300046615 | Bacteria | 1555 |
| 734 | Ga0495656_0239937 | 3300046615 | Bacteria | 912 |
| 735 | Ga0495656_0461313 | 3300046615 | Bacteria | 670 |
| 736 | Ga0495668_0114918 | 3300046616 | Bacteria | 1472 |
| 737 | Ga0495668_0140491 | 3300046616 | Bacteria | 1321 |
| 738 | Ga0495668_0603323 | 3300046616 | Bacteria | 606 |
| 739 | Ga0495668_0647449 | 3300046616 | Bacteria | 584 |
| 740 | Ga0495634_0230125 | 3300046642 | Bacteria | 1141 |
| 741 | Ga0495611_0047537 | 3300046648 | Bacteria | 1926 |
| 742 | Ga0495611_0325785 | 3300046648 | Bacteria | 706 |
| 743 | Ga0495611_0594766 | 3300046648 | Bacteria | 500 |
| 744 | Ga0495625_0234883 | 3300046660 | Bacteria | 1196 |
| 745 | Ga0495625_0381302 | 3300046660 | Bacteria | 884 |
| 746 | Ga0495625_0383761 | 3300046660 | Bacteria | 881 |
| 747 | Ga0495635_0001218 | 3300046663 | Bacteria | 17215 |
| 748 | Ga0495635_0023042 | 3300046663 | Bacteria | 4340 |
| 749 | Ga0495635_0388050 | 3300046663 | Bacteria | 929 |
| 750 | Ga0495659_0006041 | 3300046664 | Bacteria | 3828 |
| 751 | Ga0495659_0110783 | 3300046664 | Bacteria | 1072 |
| 752 | Ga0495661_0249435 | 3300046665 | Bacteria | 907 |
| 753 | Ga0495661_0295438 | 3300046665 | Bacteria | 812 |
| 754 | Ga0495588_0008572 | 3300046674 | Bacteria | 4696 |
| 755 | Ga0495588_0545353 | 3300046674 | Bacteria | 608 |
| 756 | Ga0495657_0019076 | 3300046675 | Bacteria | 4953 |
| 757 | Ga0495657_0131203 | 3300046675 | Bacteria | 1569 |
| 758 | Ga0495599_0009152 | 3300046678 | Bacteria | 6041 |
| 759 | Ga0495599_0125057 | 3300046678 | Bacteria | 1598 |
| 760 | Ga0495599_0545752 | 3300046678 | Bacteria | 679 |
| 761 | Ga0495623_0016600 | 3300046679 | Bacteria | 4755 |
| 762 | Ga0495623_0022621 | 3300046679 | Bacteria | 4058 |
| 763 | Ga0495646_0000643 | 3300046680 | Bacteria | 19081 |
| 764 | Ga0495658_0154848 | 3300046683 | Bacteria | 1410 |
| 765 | Ga0495658_0403890 | 3300046683 | Bacteria | 871 |
| 766 | Ga0495669_0020635 | 3300046684 | Bacteria | 2853 |
| 767 | Ga0495669_0144646 | 3300046684 | Bacteria | 1123 |
| 768 | Ga0495669_0333092 | 3300046684 | Bacteria | 733 |
| 769 | Ga0495669_0359936 | 3300046684 | Bacteria | 703 |
| 770 | Ga0495669_0432748 | 3300046684 | Bacteria | 638 |
| 771 | Ga0495613_0045757 | 3300046689 | Bacteria | 3236 |
| 772 | Ga0495624_0062626 | 3300046690 | Bacteria | 2327 |
| 773 | Ga0495624_0126692 | 3300046690 | Bacteria | 1567 |
| 774 | Ga0495624_0434046 | 3300046690 | Bacteria | 787 |
| 775 | Ga0495624_0674831 | 3300046690 | Bacteria | 614 |
| 776 | Ga0495670_0080754 | 3300046691 | Bacteria | 1656 |
| 777 | Ga0495670_0116066 | 3300046691 | Bacteria | 1388 |
| 778 | Ga0495670_0239019 | 3300046691 | Bacteria | 967 |
| 779 | Ga0495671_0420378 | 3300046692 | Bacteria | 639 |
| 780 | Ga0495671_0435417 | 3300046692 | Bacteria | 627 |
| 781 | Ga0495649_0351810 | 3300046694 | Bacteria | 744 |
| 782 | Ga0495649_0440068 | 3300046694 | Bacteria | 652 |
| 783 | Ga0495649_0603714 | 3300046694 | Bacteria | 541 |
| 784 | Ga0495589_0100555 | 3300046794 | Bacteria | 1399 |
| 785 | Ga0495589_0140556 | 3300046794 | Bacteria | 1156 |
| 786 | Ga0495600_0001007 | 3300046809 | Bacteria | 15210 |
| 787 | Ga0495600_0204018 | 3300046809 | Bacteria | 1269 |
| 788 | Ga0495600_0266369 | 3300046809 | Bacteria | 1087 |
| 789 | Ga0495660_0509809 | 3300046810 | Bacteria | 513 |
| 790 | Ga0495581_0045989 | 3300047315 | Bacteria | 2523 |
| 791 | Ga0495604_0015936 | 3300047317 | Bacteria | 6000 |
| 792 | Ga0495604_0023465 | 3300047317 | Bacteria | 4921 |
| 793 | Ga0495604_0625893 | 3300047317 | Bacteria | 688 |
| 794 | Ga0495636_0129366 | 3300047318 | Bacteria | 1122 |
| 795 | Ga0495636_0620928 | 3300047318 | Bacteria | 529 |
| 796 | Ga0495674_0003683 | 3300047319 | Bacteria | 14908 |
| 797 | Ga0495674_0114961 | 3300047319 | Bacteria | 2278 |
| 798 | Ga0495672_0037809 | 3300047320 | Bacteria | 2950 |
| 799 | Ga0495672_0170661 | 3300047320 | Bacteria | 1110 |
| 800 | Ga0495672_0416072 | 3300047320 | Bacteria | 612 |
| 801 | Ga0495676_0042130 | 3300047321 | Bacteria | 3751 |
| 802 | Ga0495676_0130352 | 3300047321 | Bacteria | 1816 |
| 803 | Ga0495680_0001909 | 3300047322 | Bacteria | 21876 |
| 804 | Ga0495680_0046311 | 3300047322 | Bacteria | 3429 |
| 805 | Ga0495683_0224830 | 3300047323 | Bacteria | 835 |
| 806 | Ga0495675_0001972 | 3300047444 | Bacteria | 12248 |
| 807 | Ga0495675_0011175 | 3300047444 | Bacteria | 5630 |
| 808 | Ga0495677_0106209 | 3300047445 | Bacteria | 1065 |
| 809 | Ga0495679_127596 | 3300047446 | Bacteria | 692 |
| 810 | Ga0495673_0028030 | 3300047469 | Bacteria | 2672 |
| 811 | Ga0495673_0030851 | 3300047469 | Bacteria | 2514 |
| 812 | Ga0495681_0192030 | 3300047470 | Bacteria | 833 |
| 813 | Ga0495684_0000313 | 3300047471 | Bacteria | 39705 |
| 814 | Ga0495684_0035943 | 3300047471 | Bacteria | 3798 |
| 815 | Ga0495686_0075038 | 3300047472 | Bacteria | 2074 |
| 816 | Ga0495686_0335243 | 3300047472 | Bacteria | 826 |
| 817 | Ga0495686_0634235 | 3300047472 | Bacteria | 550 |
| 818 | Ga0495593_0001524 | 3300047673 | Bacteria | 13627 |
| 819 | Ga0495593_0128564 | 3300047673 | Bacteria | 1287 |
| 820 | Ga0495602_0050780 | 3300048088 | Bacteria | 3702 |
| 821 | Ga0495602_0059972 | 3300048088 | Bacteria | 3318 |
| 822 | Ga0495614_0024394 | 3300048089 | Bacteria | 2611 |
| 823 | Ga0495615_0206356 | 3300048090 | Bacteria | 608 |
| 824 | Ga0495626_0104917 | 3300048091 | Bacteria | 1229 |
| 825 | Ga0495626_0200604 | 3300048091 | Bacteria | 818 |
| 826 | Ga0496100_0087995 | 3300048903 | Bacteria | 2113 |
| 827 | Ga0496100_0139318 | 3300048903 | Bacteria | 1717 |
| 828 | Ga0496101_0027335 | 3300048904 | Bacteria | 3974 |
| 829 | Ga0496101_0046806 | 3300048904 | Bacteria | 3103 |
| 830 | Ga0496102_0011927 | 3300048905 | Bacteria | 7505 |
| 831 | Ga0496102_0049981 | 3300048905 | Bacteria | 3806 |
| 832 | Ga0496102_0123428 | 3300048905 | Bacteria | 2420 |
| 833 | Ga0496102_0165118 | 3300048905 | Bacteria | 2083 |
| 834 | Ga0496102_0223293 | 3300048905 | Bacteria | 1776 |
| 835 | Ga0496103_0041533 | 3300048906 | Bacteria | 2827 |
| 836 | Ga0496103_0359980 | 3300048906 | Bacteria | 935 |
| 837 | Ga0496103_0580446 | 3300048906 | Bacteria | 715 |
| 838 | Ga0496104_0049045 | 3300048907 | Bacteria | 3982 |
| 839 | Ga0496104_0059609 | 3300048907 | Bacteria | 3613 |
| 840 | Ga0496104_0104080 | 3300048907 | Bacteria | 2719 |
| 841 | Ga0496104_0234039 | 3300048907 | Bacteria | 1749 |
| 842 | Ga0496105_0085784 | 3300048908 | Bacteria | 2602 |
| 843 | Ga0496105_0110428 | 3300048908 | Bacteria | 2270 |
| 844 | Ga0496105_0275606 | 3300048908 | Bacteria | 1357 |
| 845 | Ga0496105_0413318 | 3300048908 | Bacteria | 1069 |
| 846 | Ga0496105_0535321 | 3300048908 | Bacteria | 916 |
| 847 | Ga0496105_0598519 | 3300048908 | Bacteria | 856 |
| 848 | Ga0496105_0803467 | 3300048908 | Bacteria | 715 |
| 849 | Ga0496106_0037784 | 3300048909 | Bacteria | 3612 |
| 850 | Ga0496106_0052259 | 3300048909 | Bacteria | 3082 |
| 851 | Ga0496106_0294060 | 3300048909 | Bacteria | 1302 |
| 852 | Ga0496106_0627129 | 3300048909 | Bacteria | 860 |
| 853 | Ga0496106_0877008 | 3300048909 | Bacteria | 709 |
| 854 | Ga0496106_1091148 | 3300048909 | Bacteria | 626 |
| 855 | Ga0496107_0002944 | 3300048910 | Bacteria | 11270 |
| 856 | Ga0496107_0012539 | 3300048910 | Bacteria | 5917 |
| 857 | Ga0496107_0288009 | 3300048910 | Bacteria | 1222 |
| 858 | Ga0496107_0415006 | 3300048910 | Bacteria | 1001 |
| 859 | Ga0496107_0815124 | 3300048910 | Bacteria | 683 |
| 860 | Ga0496108_0050424 | 3300048911 | Bacteria | 3484 |
| 861 | Ga0496108_0102539 | 3300048911 | Bacteria | 2441 |
| 862 | Ga0496108_0117623 | 3300048911 | Bacteria | 2277 |
| 863 | Ga0496108_0852630 | 3300048911 | Bacteria | 784 |
| 864 | Ga0496109_0009866 | 3300048912 | Bacteria | 8152 |
| 865 | Ga0496109_0035253 | 3300048912 | Bacteria | 4512 |
| 866 | Ga0496109_0050985 | 3300048912 | Bacteria | 3769 |
| 867 | Ga0496109_0721443 | 3300048912 | Bacteria | 934 |
| 868 | Ga0496110_0122513 | 3300048913 | Bacteria | 2344 |
| 869 | Ga0496110_0165944 | 3300048913 | Bacteria | 2002 |
| 870 | Ga0496110_0248028 | 3300048913 | Bacteria | 1620 |
| 871 | Ga0496110_0355700 | 3300048913 | Bacteria | 1334 |
| 872 | Ga0496110_0491122 | 3300048913 | Bacteria | 1118 |
| 873 | Ga0496110_0665390 | 3300048913 | Bacteria | 942 |
| 874 | Ga0496110_1106760 | 3300048913 | Bacteria | 700 |
| 875 | Ga0496110_1140543 | 3300048913 | Bacteria | 688 |
| 876 | Ga0496111_0050121 | 3300048914 | Bacteria | 3010 |
| 877 | Ga0496111_0050303 | 3300048914 | Bacteria | 3006 |
| 878 | Ga0496111_0145014 | 3300048914 | Bacteria | 1760 |
| 879 | Ga0496111_0155083 | 3300048914 | Bacteria | 1699 |
| 880 | Ga0496111_0260027 | 3300048914 | Bacteria | 1288 |
| 881 | Ga0496111_0548895 | 3300048914 | Bacteria | 848 |
| 882 | Ga0496111_0880681 | 3300048914 | Bacteria | 645 |
| 883 | Ga0496112_0001974 | 3300048915 | Bacteria | 16209 |
| 884 | Ga0496112_0014051 | 3300048915 | Bacteria | 7412 |
| 885 | Ga0496112_0028765 | 3300048915 | Bacteria | 5368 |
| 886 | Ga0496112_0186304 | 3300048915 | Bacteria | 2038 |
| 887 | Ga0496112_0219897 | 3300048915 | Bacteria | 1855 |
| 888 | Ga0496112_0237027 | 3300048915 | Bacteria | 1778 |
| 889 | Ga0496113_0013547 | 3300048916 | Bacteria | 5531 |
| 890 | Ga0496113_0050127 | 3300048916 | Bacteria | 3111 |
| 891 | Ga0496113_0251019 | 3300048916 | Bacteria | 1412 |
| 892 | Ga0496113_0274424 | 3300048916 | Bacteria | 1348 |
| 893 | Ga0496114_0080131 | 3300048917 | Bacteria | 2757 |
| 894 | Ga0496114_0932388 | 3300048917 | Bacteria | 750 |
| 895 | Ga0496114_1593423 | 3300048917 | Bacteria | 541 |
| 896 | Ga0496115_0003266 | 3300048918 | Bacteria | 11628 |
| 897 | Ga0496115_0032667 | 3300048918 | Bacteria | 4106 |
| 898 | Ga0496115_0193576 | 3300048918 | Bacteria | 1680 |
| 899 | Ga0496115_0223229 | 3300048918 | Bacteria | 1555 |
| 900 | Ga0496115_0256728 | 3300048918 | Bacteria | 1438 |
| 901 | Ga0496115_0260811 | 3300048918 | Bacteria | 1425 |
| 902 | Ga0496115_0268189 | 3300048918 | Bacteria | 1403 |
| 903 | Ga0496115_0853393 | 3300048918 | Bacteria | 705 |
| 904 | Ga0496115_0937074 | 3300048918 | Bacteria | 666 |
| 905 | Ga0496116_0323335 | 3300048919 | Bacteria | 721 |
| 906 | Ga0496117_0195191 | 3300048920 | Bacteria | 1149 |
| 907 | Ga0496117_0356569 | 3300048920 | Bacteria | 753 |
| 908 | Ga0496117_0406694 | 3300048920 | Bacteria | 685 |
| 909 | Ga0496119_0139958 | 3300048922 | Bacteria | 1308 |
| 910 | Ga0496119_0176977 | 3300048922 | Bacteria | 1122 |
| 911 | Ga0496119_0306434 | 3300048922 | Bacteria | 781 |
| 912 | Ga0496119_0420303 | 3300048922 | Bacteria | 635 |
| 913 | Ga0496121_0039609 | 3300048924 | Bacteria | 4148 |
| 914 | Ga0496121_0086669 | 3300048924 | Bacteria | 2460 |
| 915 | Ga0496121_0100066 | 3300048924 | Bacteria | 2238 |
| 916 | Ga0496121_0147348 | 3300048924 | Bacteria | 1737 |
| 917 | Ga0496121_0214125 | 3300048924 | Bacteria | 1362 |
| 918 | Ga0496124_0671010 | 3300048927 | Bacteria | 662 |
| 919 | Ga0496125_0130928 | 3300048928 | Bacteria | 1766 |
| 920 | Ga0496126_0007843 | 3300048929 | Bacteria | 11636 |
| 921 | Ga0496126_0030834 | 3300048929 | Bacteria | 5075 |
| 922 | Ga0496126_0031354 | 3300048929 | Bacteria | 5024 |
| 923 | Ga0496126_0121393 | 3300048929 | Bacteria | 2265 |
| 924 | Ga0496126_0166479 | 3300048929 | Bacteria | 1881 |
| 925 | Ga0496126_0407442 | 3300048929 | Bacteria | 1101 |
| 926 | Ga0496126_0452718 | 3300048929 | Bacteria | 1033 |
| 927 | Ga0496126_0722205 | 3300048929 | Bacteria | 772 |
| 928 | Ga0495682_0155730 | 3300049460 | Bacteria | 814 |
| 929 | Ga0501032_0019827 | 3300049569 | Bacteria | 4695 |
| 930 | Ga0501032_0227629 | 3300049569 | Bacteria | 1212 |
| 931 | Ga0501032_0664431 | 3300049569 | Bacteria | 661 |
| 932 | Ga0501034_0697001 | 3300049571 | Bacteria | 914 |
| 933 | Ga0501034_0776041 | 3300049571 | Bacteria | 852 |
| 934 | Ga0501036_0103183 | 3300049572 | Bacteria | 2412 |
| 935 | Ga0501037_0580240 | 3300049573 | Bacteria | 754 |
| 936 | Ga0501038_0083459 | 3300049574 | Bacteria | 2689 |
| 937 | Ga0501038_0531410 | 3300049574 | Bacteria | 896 |
| 938 | Ga0501039_0193009 | 3300049575 | Bacteria | 1601 |
| 939 | Ga0501039_0244298 | 3300049575 | Bacteria | 1411 |
| 940 | Ga0501047_0124847 | 3300049581 | Bacteria | 2454 |
| 941 | Ga0501047_1158453 | 3300049581 | Bacteria | 586 |
| 942 | Ga0501067_0080761 | 3300049583 | Bacteria | 1802 |
| 943 | Ga0501067_0110475 | 3300049583 | Bacteria | 1528 |
| 944 | Ga0501068_0036146 | 3300049584 | Bacteria | 2952 |
| 945 | Ga0501068_0345611 | 3300049584 | Bacteria | 956 |
| 946 | Ga0501069_0023410 | 3300049585 | Bacteria | 3368 |
| 947 | Ga0501069_0258501 | 3300049585 | Bacteria | 1016 |
| 948 | Ga0501072_0444037 | 3300049588 | Bacteria | 1027 |
| 949 | Ga0501073_0063515 | 3300049589 | Bacteria | 2575 |
| 950 | Ga0501076_0260681 | 3300049592 | Bacteria | 1419 |
| 951 | Ga0501079_0822338 | 3300049741 | Bacteria | 731 |
| 952 | Ga0501080_0234585 | 3300049742 | Bacteria | 1676 |
| 953 | Ga0501081_0603531 | 3300049743 | Bacteria | 822 |
| 954 | Ga0501083_0036945 | 3300049744 | Bacteria | 3328 |
| 955 | Ga0501035_0044770 | 3300049822 | Bacteria | 3983 |
| 956 | Ga0501035_0152365 | 3300049822 | Bacteria | 2005 |
| 957 | Ga0501044_0130692 | 3300049823 | Bacteria | 2505 |
| 958 | Ga0501045_0005982 | 3300049824 | Bacteria | 8415 |
| 959 | Ga0501045_1376484 | 3300049824 | Bacteria | 513 |
| 960 | nmdc:mga03683_203155_c1 | 3300050489 | Bacteria | 910 |
| 961 | nmdc:mga03683_221246_c1 | 3300050489 | Bacteria | 873 |
| 962 | nmdc:mga03683_26211_c1 | 3300050489 | Bacteria | 2298 |
| 963 | nmdc:mga03n38_25130_c1 | 3300050490 | Bacteria | 2442 |
| 964 | nmdc:mga03n38_253802_c1 | 3300050490 | Bacteria | 930 |
| 965 | nmdc:mga00v17_388333_c1 | 3300050491 | Bacteria | 907 |
| 966 | nmdc:mga00v17_75943_c1 | 3300050491 | Bacteria | 2090 |
| 967 | nmdc:mga00v17_85112_c1 | 3300050491 | Bacteria | 1980 |
| 968 | nmdc:mga0yw44_216206_c1 | 3300050492 | Bacteria | 1269 |
| 969 | nmdc:mga0yw44_415260_c1 | 3300050492 | Bacteria | 911 |
| 970 | nmdc:mga0yw44_55596_c1 | 3300050492 | Bacteria | 2409 |
| 971 | nmdc:mga0yw44_800725_c1 | 3300050492 | Bacteria | 640 |
| 972 | nmdc:mga0k408_139477_c1 | 3300050493 | Bacteria | 1442 |
| 973 | nmdc:mga06z11_189952_c1 | 3300050494 | Bacteria | 1189 |
| 974 | nmdc:mga06z11_312960_c1 | 3300050494 | Bacteria | 935 |
| 975 | nmdc:mga06z11_33726_c1 | 3300050494 | Bacteria | 2507 |
| 976 | nmdc:mga06z11_635642_c1 | 3300050494 | Bacteria | 650 |
| 977 | nmdc:mga07m45_19967_c1 | 3300050496 | Bacteria | 3636 |
| 978 | nmdc:mga07m45_38992_c1 | 3300050496 | Bacteria | 2654 |
| 979 | nmdc:mga07m45_55869_c1 | 3300050496 | Bacteria | 2231 |
| 980 | nmdc:mga05p37_102181_c1 | 3300050507 | Bacteria | 3530 |
| 981 | nmdc:mga0qj67_533055_c1 | 3300050509 | Bacteria | 942 |
| 982 | nmdc:mga08y16_15164_c1 | 3300050511 | Bacteria | 8103 |
| 983 | nmdc:mga0n895_69515_c1 | 3300050512 | Bacteria | 3489 |
| 984 | nmdc:mga0rr50_179637_c1 | 3300050513 | Bacteria | 1729 |
| 985 | nmdc:mga0rr50_308324_c2 | 3300050513 | Bacteria | 1012 |
| 986 | nmdc:mga08x19_140497_c1 | 3300050514 | Bacteria | 1631 |
| 987 | nmdc:mga0a205_134118_c1 | 3300050515 | Bacteria | 2018 |
| 988 | nmdc:mga0sz30_21935_c1 | 3300050516 | Bacteria | 2589 |
| 989 | nmdc:mga0sz30_255674_c1 | 3300050516 | Bacteria | 780 |
| 990 | nmdc:mga0sz30_48450_c1 | 3300050516 | Bacteria | 1798 |
| 991 | Ga0495601_0054219 | 3300053077 | Bacteria | 2536 |
| 992 | Ga0495601_0311791 | 3300053077 | Bacteria | 1025 |
| 993 | Ga0495612_0016378 | 3300053078 | Bacteria | 2971 |
| 994 | Ga0500610_0117724 | 3300053079 | Bacteria | 1361 |
| 995 | Ga0500635_0153508 | 3300053080 | Bacteria | 880 |
| 996 | Ga0495655_0051461 | 3300053083 | Bacteria | 1092 |
| 997 | Ga0495655_0178933 | 3300053083 | Bacteria | 683 |
| 998 | Ga0495595_0000445 | 3300053084 | Bacteria | 15683 |
| 999 | Ga0495595_0054813 | 3300053084 | Bacteria | 1854 |
| 1000 | Ga0495619_0001995 | 3300053085 | Bacteria | 13585 |
| 1001 | Ga0495619_0084768 | 3300053085 | Bacteria | 2139 |
| 1002 | Ga0500643_027818 | 3300053087 | Bacteria | 1753 |
| 1003 | Ga0500581_258691 | 3300053089 | Bacteria | 724 |
| 1004 | Ga0500646_0279689 | 3300053090 | Bacteria | 594 |
| 1005 | Ga0500650_0212604 | 3300053098 | Bacteria | 878 |
| 1006 | Ga0500650_0250963 | 3300053098 | Bacteria | 794 |
| 1007 | Ga0500554_003817 | 3300053102 | Bacteria | 3121 |
| 1008 | Ga0500554_017215 | 3300053102 | Bacteria | 1927 |
| 1009 | Ga0500582_161701 | 3300053114 | Bacteria | 770 |
| 1010 | Ga0500592_043676 | 3300053116 | Bacteria | 726 |
| 1011 | Ga0500595_000477 | 3300053119 | Bacteria | 24734 |
| 1012 | Ga0500595_028055 | 3300053119 | Bacteria | 1921 |
| 1013 | Ga0500617_206272 | 3300053124 | Bacteria | 715 |
| 1014 | Ga0500621_175371 | 3300053126 | Bacteria | 782 |
| 1015 | Ga0500658_0297115 | 3300053134 | Bacteria | 742 |
| 1016 | Ga0500658_0317980 | 3300053134 | Bacteria | 715 |
| 1017 | Ga0500588_0114309 | 3300053146 | Bacteria | 945 |
| 1018 | Ga0500589_064971 | 3300053147 | Bacteria | 1664 |
| 1019 | Ga0500589_133161 | 3300053147 | Bacteria | 1035 |
| 1020 | Ga0500589_206025 | 3300053147 | Bacteria | 751 |
| 1021 | Ga0500589_266318 | 3300053147 | Bacteria | 621 |
| 1022 | Ga0500590_335920 | 3300053148 | Bacteria | 548 |
| 1023 | Ga0500603_028836 | 3300053150 | Bacteria | 1419 |
| 1024 | Ga0500622_0051250 | 3300053156 | Bacteria | 2125 |
| 1025 | Ga0500627_0145273 | 3300053158 | Bacteria | 1071 |
| 1026 | Ga0500633_0146917 | 3300053160 | Bacteria | 883 |
| 1027 | Ga0500634_0208305 | 3300053161 | Bacteria | 851 |
| 1028 | Ga0500638_011253 | 3300053162 | Bacteria | 3961 |
| 1029 | Ga0500636_0070176 | 3300053177 | Bacteria | 2033 |
| 1030 | Ga0500637_0010152 | 3300053178 | Bacteria | 4822 |
| 1031 | Ga0500637_0011408 | 3300053178 | Bacteria | 4594 |
| 1032 | Ga0500645_159327 | 3300053730 | Bacteria | 619 |
| 1033 | Ga0500609_015338 | 3300053731 | Bacteria | 1037 |
| 1034 | Ga0501084_0309355 | 3300054114 | Bacteria | 1334 |
| 1035 | Ga0500661_002168 | 3300055283 | Bacteria | 3704 |
| 1036 | Ga0501082_0988906 | 3300060353 | Bacteria | 736 |
| 1037 | Ga0501082_1215592 | 3300060353 | Bacteria | 658 |
| 1038 | Ga0530510_0616412 | 3300061734 | Bacteria | 826 |
| 1039 | Ga0530510_0853936 | 3300061734 | Bacteria | 695 |
| 1040 | 2513674579 | 2513237098 | Bacteria | 9902361 |
| 1041 | 2513695121 | 2513237101 | Bacteria | 7952346 |
| 1042 | 2671122457 | 2667528175 | Bacteria | 7532676 |
| 1043 | 2723841652 | 2721755755 | Bacteria | 8322773 |
| 1044 | 2728755000 | 2728368998 | Bacteria | 8720350 |
| 1045 | 2793081066 | |||
| 1046 | 2874608055 | 2874604998 | Bacteria | 7834745 |
| 1047 | 2876815495 | 2876808645 | Bacteria | 8824342 |
| 1048 | 2879112180 | 2879110137 | Bacteria | 8907982 |
| 1049 | 2889035480 | 2889033259 | Bacteria | 9099371 |
| 1050 | 2903751484 | 2903748898 | Bacteria | 9972761 |
| 1051 | 2903771850 | 2903768456 | Bacteria | 9749579 |
| 1052 | 2906613884 | |||
| 1053 | 2908747454 | 2908739725 | Bacteria | 8628932 |
| 1054 | 2922363991 | 2922361189 | Bacteria | 7436256 |
| 1055 | 2922392575 | 2922386360 | Bacteria | 7017218 |
| 1056 | 2935636530 | 2935630451 | Bacteria | 8169952 |
| 1057 | 2941513165 | 2941507105 | Bacteria | 8166816 |
| 1058 | 2941521180 | 2941515067 | Bacteria | 8166720 |
| 1059 | 2941528883 | 2941523033 | Bacteria | 8169134 |
| 1060 | 3005475073 | 3005474847 | Bacteria | 9259049 |
| 1061 | 8006967466 | 8006964411 | Bacteria | 8966052 |
| 1062 | 8006990931 | 8006984368 | Bacteria | 9651211 |
| 1063 | 8006996502 | 8006994254 | Bacteria | 8309700 |
| 1064 | 8019572492 | 8019565922 | Bacteria | 9639779 |
| 1065 | 8056675752 | 8056673599 | Bacteria | 7871253 |
| 1066 | Ga0075368_10083281 | |||
| 1067 | JGI25406J46586_10005031 | |||
| 1068 | JGI25165J46597_1022757 | |||
| 1069 | JGI25404J52841_10001308 | |||
| 1070 | JGI25405J52794_10026811 | |||
| 1071 | Ga0065715_10043807 | |||
| 1072 | Ga0070683_100057276 | |||
| 1073 | Ga0070670_100476247 | |||
| 1074 | Ga0070677_10344105 | |||
| 1075 | Ga0068869_100101991 | |||
| 1076 | Ga0068869_100229449 | |||
| 1077 | Ga0068869_100340376 | |||
| 1078 | Ga0068869_100498288 | |||
| 1079 | Ga0070666_10161456 | |||
| 1080 | Ga0070666_10488888 | |||
| 1081 | Ga0070680_100054700 | |||
| 1082 | Ga0070682_100055337 | |||
| 1083 | Ga0068868_100019711 | |||
| 1084 | Ga0068868_100022147 | |||
| 1085 | Ga0068868_100319979 | |||
| 1086 | Ga0068868_100641910 | |||
| 1087 | Ga0068868_100847586 | |||
| 1088 | Ga0070660_100036213 | |||
| 1089 | Ga0070660_100406858 | |||
| 1090 | Ga0070689_100355605 | |||
| 1091 | Ga0070687_100480020 | |||
| 1092 | Ga0070661_100039129 | |||
| 1093 | Ga0070661_100139697 | |||
| 1094 | Ga0070668_100096268 | |||
| 1095 | Ga0070668_100100324 | |||
| 1096 | Ga0070668_100291344 | |||
| 1097 | Ga0070668_100493975 | |||
| 1098 | Ga0070668_100588024 | |||
| 1099 | Ga0070668_100668867 | |||
| 1100 | Ga0070668_101115051 | |||
| 1101 | Ga0070668_101217857 | |||
| 1102 | Ga0070668_101427324 | |||
| 1103 | Ga0070669_100190221 | |||
| 1104 | Ga0070669_101073698 | |||
| 1105 | Ga0070675_100283247 | |||
| 1106 | Ga0070675_100328839 | |||
| 1107 | Ga0070671_100189782 | |||
| 1108 | Ga0070671_100511413 | |||
| 1109 | Ga0070671_100575055 | |||
| 1110 | Ga0070674_100080106 | |||
| 1111 | Ga0070674_100242257 | |||
| 1112 | Ga0070673_100075656 | |||
| 1113 | Ga0070673_100205132 | |||
| 1114 | Ga0070688_100368798 | |||
| 1115 | Ga0070659_100083150 | |||
| 1116 | Ga0070659_100090516 | |||
| 1117 | Ga0070659_100628436 | |||
| 1118 | Ga0070659_100837153 | |||
| 1119 | Ga0070667_100339874 | |||
| 1120 | Ga0070709_10001880 | |||
| 1121 | Ga0070709_10251445 | |||
| 1122 | Ga0070709_10558577 | |||
| 1123 | Ga0070714_100166014 | |||
| 1124 | Ga0070714_100938018 | |||
| 1125 | Ga0070713_100003661 | |||
| 1126 | Ga0070713_100254527 | |||
| 1127 | Ga0070713_100432354 | |||
| 1128 | Ga0070710_10001236 | |||
| 1129 | Ga0070710_10767458 | |||
| 1130 | Ga0070701_10046388 | |||
| 1131 | Ga0070711_100000660 | |||
| 1132 | Ga0070694_100190827 | |||
| 1133 | Ga0070663_100004283 | |||
| 1134 | Ga0070663_100006019 | |||
| 1135 | Ga0070663_100041490 | |||
| 1136 | Ga0070663_100106616 | |||
| 1137 | Ga0070663_100145967 | |||
| 1138 | Ga0070663_100513745 | |||
| 1139 | Ga0070678_100101607 | |||
| 1140 | Ga0070678_100155518 | |||
| 1141 | Ga0070678_100239872 | |||
| 1142 | Ga0070678_100463077 | |||
| 1143 | Ga0070662_100068881 | |||
| 1144 | Ga0070662_100568075 | |||
| 1145 | Ga0070681_10041351 | |||
| 1146 | Ga0070685_10197790 | |||
| 1147 | Ga0070685_10299751 | |||
| 1148 | Ga0070707_100247197 | |||
| 1149 | Ga0070698_100250562 | |||
| 1150 | Ga0070698_100679092 | |||
| 1151 | Ga0070699_100747027 | |||
| 1152 | Ga0070679_100044363 | |||
| 1153 | Ga0070679_100137917 | |||
| 1154 | Ga0070679_101313556 | |||
| 1155 | Ga0070684_100013455 | |||
| 1156 | Ga0070697_100040762 | |||
| 1157 | Ga0070697_100164270 | |||
| 1158 | Ga0068853_100012684 | |||
| 1159 | Ga0068853_100320184 | |||
| 1160 | Ga0068853_100409342 | |||
| 1161 | Ga0068853_100438174 | |||
| 1162 | Ga0070672_100111060 | |||
| 1163 | Ga0070686_100156329 | |||
| 1164 | Ga0070686_100695189 | |||
| 1165 | Ga0070695_100460213 | |||
| 1166 | Ga0070695_100963103 | |||
| 1167 | Ga0070696_100326881 | |||
| 1168 | Ga0070696_100781622 | |||
| 1169 | Ga0070693_100030109 | |||
| 1170 | Ga0070693_100820982 | |||
| 1171 | Ga0070665_100024472 | |||
| 1172 | Ga0070665_100039914 | |||
| 1173 | Ga0070665_100171968 | |||
| 1174 | Ga0070665_100217866 | |||
| 1175 | Ga0070665_100600358 | |||
| 1176 | Ga0070665_100860059 | |||
| 1177 | Ga0070665_101112290 | |||
| 1178 | Ga0070665_101374247 | |||
| 1179 | Ga0070704_100329757 | |||
| 1180 | Ga0068855_100152875 | |||
| 1181 | Ga0068855_100325655 | |||
| 1182 | Ga0068855_100805940 | |||
| 1183 | Ga0070664_100226362 | |||
| 1184 | Ga0070664_101090609 | |||
| 1185 | Ga0068857_100018485 | |||
| 1186 | Ga0068857_100300019 | |||
| 1187 | Ga0068857_100744212 | |||
| 1188 | Ga0068854_100103682 | |||
| 1189 | Ga0068854_101170817 | |||
| 1190 | Ga0068856_100187404 | |||
| 1191 | Ga0068856_100342633 | |||
| 1192 | Ga0070702_100030607 | |||
| 1193 | Ga0070702_100463897 | |||
| 1194 | Ga0068852_100061074 | |||
| 1195 | Ga0068852_100283593 | |||
| 1196 | Ga0068852_100437310 | |||
| 1197 | Ga0068859_100143978 | |||
| 1198 | Ga0068859_100163963 | |||
| 1199 | Ga0068859_100285767 | |||
| 1200 | Ga0068859_100387875 | |||
| 1201 | Ga0068864_100215262 | |||
| 1202 | Ga0068864_100470018 | |||
| 1203 | Ga0068866_10223485 | |||
| 1204 | Ga0068861_100278047 | |||
| 1205 | Ga0068861_101297616 | |||
| 1206 | Ga0068851_10011859 | |||
| 1207 | Ga0068851_10219431 | |||
| 1208 | Ga0068851_10387661 | |||
| 1209 | Ga0068863_100232337 | |||
| 1210 | Ga0068863_100333555 | |||
| 1211 | Ga0068863_101461091 | |||
| 1212 | Ga0068858_100016049 | |||
| 1213 | Ga0068858_100057164 | |||
| 1214 | Ga0068858_100425075 | |||
| 1215 | Ga0068858_101043936 | |||
| 1216 | Ga0068860_100086214 | |||
| 1217 | Ga0068860_100326155 | |||
| 1218 | Ga0068862_100351637 | |||
| 1219 | Ga0081455_10005984 | |||
| 1220 | Ga0081455_10008111 | |||
| 1221 | Ga0081455_10011164 | |||
| 1222 | Ga0081455_10028676 | |||
| 1223 | Ga0081455_10277173 | |||
| 1224 | Ga0081455_10296594 | |||
| 1225 | Ga0081538_10031555 | |||
| 1226 | Ga0081540_1001950 | |||
| 1227 | Ga0081540_1013355 | |||
| 1228 | Ga0081540_1015913 | |||
| 1229 | Ga0081540_1022081 | |||
| 1230 | Ga0081540_1023147 | |||
| 1231 | Ga0081540_1025816 | |||
| 1232 | Ga0081540_1059141 | |||
| 1233 | Ga0081540_1080759 | |||
| 1234 | Ga0081540_1096413 | |||
| 1235 | Ga0081540_1209291 | |||
| 1236 | Ga0081539_10001064 | |||
| 1237 | Ga0081539_10158403 | |||
| 1238 | Ga0070717_10104664 | |||
| 1239 | Ga0075368_10036443 | |||
| 1240 | Ga0075363_100036055 | |||
| 1241 | Ga0075363_100252532 | |||
| 1242 | Ga0075364_10535182 | |||
| 1243 | Ga0070715_10000108 | |||
| 1244 | Ga0070715_10061039 | |||
| 1245 | Ga0070716_100003373 | |||
| 1246 | Ga0070716_100081143 | |||
| 1247 | Ga0070716_101381619 | |||
| 1248 | Ga0070712_100175596 | |||
| 1249 | Ga0075362_10110465 | |||
| 1250 | Ga0075362_10175531 | |||
| 1251 | Ga0075362_10194650 | |||
| 1252 | Ga0075367_10019052 | |||
| 1253 | Ga0075367_10584169 | |||
| 1254 | Ga0075369_10065526 | |||
| 1255 | Ga0075369_10091113 | |||
| 1256 | Ga0075369_10120898 | |||
| 1257 | Ga0075369_10285141 | |||
| 1258 | Ga0075366_10263289 | |||
| 1259 | Ga0075366_10378298 | |||
| 1260 | Ga0097621_100059415 | |||
| 1261 | Ga0097621_100356720 | |||
| 1262 | Ga0097621_100562793 | |||
| 1263 | Ga0097621_101578693 | |||
| 1264 | Ga0075370_10101372 | |||
| 1265 | Ga0075370_10298076 | |||
| 1266 | Ga0075370_10309862 | |||
| 1267 | Ga0075370_10655801 | |||
| 1268 | Ga0068871_100274748 | |||
| 1269 | Ga0068871_100697797 | |||
| 1270 | Ga0075428_100085123 | |||
| 1271 | Ga0075430_100416688 | |||
| 1272 | Ga0075433_10113605 | |||
| 1273 | Ga0075434_100071865 | |||
| 1274 | Ga0075434_101486958 | |||
| 1275 | Ga0068865_100137618 | |||
| 1276 | Ga0075436_100065143 | |||
| 1277 | Ga0097620_100143973 | |||
| 1278 | Ga0097620_100163966 | |||
| 1279 | Ga0097620_100285751 | |||
| 1280 | Ga0097620_100387894 | |||
| 1281 | Ga0099825_1041366 | |||
| 1282 | Ga0099824_1013118 | |||
| 1283 | Ga0099822_1000007 | |||
| 1284 | Ga0075435_100022140 | |||
| 1285 | Ga0075435_101589091 | |||
| 1286 | Ga0099794_10003899 | |||
| 1287 | Ga0099794_10022739 | |||
| 1288 | Ga0099794_10071677 | |||
| 1289 | Ga0099794_10280335 | |||
| 1290 | Ga0099795_10004002 | |||
| 1291 | Ga0099795_10025241 | |||
| 1292 | Ga0099795_10385447 | |||
| 1293 | Ga0105250_10031767 | |||
| 1294 | Ga0105250_10309136 | |||
| 1295 | Ga0105240_10013534 | |||
| 1296 | Ga0105240_10465454 | |||
| 1297 | Ga0105240_12409352 | |||
| 1298 | Ga0105245_10305400 | |||
| 1299 | Ga0105245_10986325 | |||
| 1300 | Ga0105245_11532193 | |||
| 1301 | Ga0105245_11895014 | |||
| 1302 | Ga0105247_10148239 | |||
| 1303 | Ga0105247_10231821 | |||
| 1304 | Ga0114129_10144590 | |||
| 1305 | Ga0114129_12077105 | |||
| 1306 | Ga0105243_10340224 | |||
| 1307 | Ga0105243_10665406 | |||
| 1308 | Ga0105243_11826886 | |||
| 1309 | Ga0105243_12315773 | |||
| 1310 | Ga0105243_12826006 | |||
| 1311 | Ga0105241_10241838 | |||
| 1312 | Ga0105241_10888921 | |||
| 1313 | Ga0105242_10405567 | |||
| 1314 | Ga0105242_10689974 | |||
| 1315 | Ga0105242_11578412 | |||
| 1316 | Ga0105248_10403979 | |||
| 1317 | Ga0105237_10017081 | |||
| 1318 | Ga0105237_10022854 | |||
| 1319 | Ga0105237_10291074 | |||
| 1320 | Ga0105237_10437709 | |||
| 1321 | Ga0105237_11123598 | |||
| 1322 | Ga0105237_11415667 | |||
| 1323 | Ga0105238_10160027 | |||
| 1324 | Ga0105238_10284200 | |||
| 1325 | Ga0105238_10656870 | |||
| 1326 | Ga0105238_11001183 | |||
| 1327 | Ga0105249_10058990 | |||
| 1328 | Ga0105249_11057152 | |||
| 1329 | Ga0105249_11292009 | |||
| 1330 | Ga0105249_11546025 | |||
| 1331 | Ga0099796_10070681 | |||
| 1332 | Ga0099796_10262636 | |||
| 1333 | Ga0099796_10288461 | |||
| 1334 | Ga0099796_10479453 | |||
| 1335 | Ga0105239_10031640 | |||
| 1336 | Ga0105239_10327997 | |||
| 1337 | Ga0105239_10337166 | |||
| 1338 | Ga0105239_10582750 | |||
| 1339 | Ga0105239_11077120 | |||
| 1340 | Ga0105246_10029026 | |||
| 1341 | Ga0105246_10145415 | |||
| 1342 | Ga0105246_10617184 | |||
| 1343 | Ga0157317_1006476 | |||
| 1344 | Ga0157370_10057525 | |||
| 1345 | Ga0157370_10157802 | |||
| 1346 | Ga0157369_10057884 | |||
| 1347 | Ga0157374_10028269 | |||
| 1348 | Ga0157374_10036000 | |||
| 1349 | Ga0157374_10785472 | |||
| 1350 | Ga0157378_10232684 | |||
| 1351 | Ga0157378_10254811 | |||
| 1352 | Ga0157378_10457022 | |||
| 1353 | Ga0157378_12241853 | |||
| 1354 | Ga0163162_10043869 | |||
| 1355 | Ga0163162_10372823 | |||
| 1356 | Ga0163162_10677893 | |||
| 1357 | Ga0163162_10812570 | |||
| 1358 | Ga0163162_11198528 | |||
| 1359 | Ga0157372_11771564 | |||
| 1360 | Ga0157372_12521854 | |||
| 1361 | Ga0157375_10508577 | |||
| 1362 | Ga0157375_12214709 | |||
| 1363 | Ga0163163_10002009 | |||
| 1364 | Ga0163163_10078671 | |||
| 1365 | Ga0163163_10779476 | |||
| 1366 | Ga0157380_10644389 | |||
| 1367 | Ga0157380_10892325 | |||
| 1368 | Ga0157380_10971924 | |||
| 1369 | Ga0157377_10136398 | |||
| 1370 | Ga0157377_10583519 | |||
| 1371 | Ga0157377_10909713 | |||
| 1372 | Ga0157377_10927522 | |||
| 1373 | Ga0157379_10018063 | |||
| 1374 | Ga0157379_10595404 | |||
| 1375 | Ga0157379_10613719 | |||
| 1376 | Ga0157379_11638325 | |||
| 1377 | Ga0157379_11746039 | |||
| 1378 | Ga0157376_10017044 | |||
| 1379 | Ga0157376_10138313 | |||
| 1380 | Ga0157376_10344822 | |||
| 1381 | Ga0157376_10490967 | |||
| 1382 | Ga0163161_10558273 | |||
| 1383 | Ga0163161_10912093 | |||
| 1384 | Ga0213873_10002209 | |||
| 1385 | Ga0213872_10070436 | |||
| 1386 | Ga0213872_10344068 | |||
| 1387 | Ga0213874_10006326 | |||
| 1388 | Ga0213876_10005462 | |||
| 1389 | Ga0213876_10071525 | |||
| 1390 | Ga0209233_1001514 | |||
| 1391 | Ga0209758_1003344 | |||
| 1392 | Ga0209758_1015313 | |||
| 1393 | Ga0207697_10025606 | |||
| 1394 | Ga0207656_10084455 | |||
| 1395 | Ga0207656_10153819 | |||
| 1396 | Ga0207653_10054382 | |||
| 1397 | Ga0207682_10185059 | |||
| 1398 | Ga0207692_10000829 | |||
| 1399 | Ga0207710_10336767 | |||
| 1400 | Ga0207688_10139410 | |||
| 1401 | Ga0207688_10152616 | |||
| 1402 | Ga0207688_10167449 | |||
| 1403 | Ga0207688_10171453 | |||
| 1404 | Ga0207680_10363416 | |||
| 1405 | Ga0207680_10476161 | |||
| 1406 | Ga0207647_10155427 | |||
| 1407 | Ga0207685_10001367 | |||
| 1408 | Ga0207685_10164329 | |||
| 1409 | Ga0207685_10199366 | |||
| 1410 | Ga0207699_10004989 | |||
| 1411 | Ga0207645_10043296 | |||
| 1412 | Ga0207643_10273737 | |||
| 1413 | Ga0207705_10244175 | |||
| 1414 | Ga0207654_10269225 | |||
| 1415 | Ga0207654_10735191 | |||
| 1416 | Ga0207707_10004934 | |||
| 1417 | Ga0207707_10105415 | |||
| 1418 | Ga0207695_10033471 | |||
| 1419 | Ga0207695_10151832 | |||
| 1420 | Ga0207671_10033557 | |||
| 1421 | Ga0207671_10045233 | |||
| 1422 | Ga0207671_10047548 | |||
| 1423 | Ga0207671_10063451 | |||
| 1424 | Ga0207671_10083371 | |||
| 1425 | Ga0207671_10543341 | |||
| 1426 | Ga0207693_10000310 | |||
| 1427 | Ga0207693_10005993 | |||
| 1428 | Ga0207693_10036014 | |||
| 1429 | Ga0207693_10847462 | |||
| 1430 | Ga0207663_10000230 | |||
| 1431 | Ga0207663_10009652 | |||
| 1432 | Ga0207663_10730238 | |||
| 1433 | Ga0207660_10011652 | |||
| 1434 | Ga0207660_10064010 | |||
| 1435 | Ga0207662_10077673 | |||
| 1436 | Ga0207657_10022864 | |||
| 1437 | Ga0207657_10229612 | |||
| 1438 | Ga0207649_10101458 | |||
| 1439 | Ga0207649_10132939 | |||
| 1440 | Ga0207649_11358260 | |||
| 1441 | Ga0207652_10002828 | |||
| 1442 | Ga0207652_10175637 | |||
| 1443 | Ga0207681_10178556 | |||
| 1444 | Ga0207694_10048946 | |||
| 1445 | Ga0207694_10199304 | |||
| 1446 | Ga0207694_10201814 | |||
| 1447 | Ga0207650_10191966 | |||
| 1448 | Ga0207650_10603275 | |||
| 1449 | Ga0207659_11421753 | |||
| 1450 | Ga0207687_10066362 | |||
| 1451 | Ga0207687_10294416 | |||
| 1452 | Ga0207687_10845203 | |||
| 1453 | Ga0207687_11246467 | |||
| 1454 | Ga0207700_10021866 | |||
| 1455 | Ga0207700_10076835 | |||
| 1456 | Ga0207700_10113880 | |||
| 1457 | Ga0207700_11027583 | |||
| 1458 | Ga0207700_11693477 | |||
| 1459 | Ga0207664_10001147 | |||
| 1460 | Ga0207664_10289562 | |||
| 1461 | Ga0207664_11517751 | |||
| 1462 | Ga0207644_10105890 | |||
| 1463 | Ga0207644_10394385 | |||
| 1464 | Ga0207644_10458984 | |||
| 1465 | Ga0207644_11030039 | |||
| 1466 | Ga0207690_10779457 | |||
| 1467 | Ga0207706_10183747 | |||
| 1468 | Ga0207706_10422850 | |||
| 1469 | Ga0207669_10627604 | |||
| 1470 | Ga0207704_10026355 | |||
| 1471 | Ga0207665_10003377 | |||
| 1472 | Ga0207665_10028331 | |||
| 1473 | Ga0207665_10410649 | |||
| 1474 | Ga0207665_10750668 | |||
| 1475 | Ga0207665_11041790 | |||
| 1476 | Ga0207691_10172349 | |||
| 1477 | Ga0207691_10579060 | |||
| 1478 | Ga0207691_10596088 | |||
| 1479 | Ga0207711_10108773 | |||
| 1480 | Ga0207689_10299334 | |||
| 1481 | Ga0207689_10662279 | |||
| 1482 | Ga0207689_10667697 | |||
| 1483 | Ga0207689_10828033 | |||
| 1484 | Ga0207689_11011769 | |||
| 1485 | Ga0207661_10621100 | |||
| 1486 | Ga0207661_11140644 | |||
| 1487 | Ga0207679_10188478 | |||
| 1488 | Ga0207667_10033916 | |||
| 1489 | Ga0207667_10046837 | |||
| 1490 | Ga0207667_10323540 | |||
| 1491 | Ga0207667_10725976 | |||
| 1492 | Ga0207667_10736403 | |||
| 1493 | Ga0207651_11685075 | |||
| 1494 | Ga0207668_10084474 | |||
| 1495 | Ga0207668_10229600 | |||
| 1496 | Ga0207668_10269628 | |||
| 1497 | Ga0207668_11075907 | |||
| 1498 | Ga0207668_11323720 | |||
| 1499 | Ga0207640_10578462 | |||
| 1500 | Ga0207658_10377977 | |||
| 1501 | Ga0207677_10846895 | |||
| 1502 | Ga0207677_10950800 | |||
| 1503 | Ga0207703_10460605 | |||
| 1504 | Ga0207703_10546886 | |||
| 1505 | Ga0207703_11102772 | |||
| 1506 | Ga0207639_10020456 | |||
| 1507 | Ga0207639_10585829 | |||
| 1508 | Ga0207639_10804131 | |||
| 1509 | Ga0207678_10003936 | |||
| 1510 | Ga0207678_10038029 | |||
| 1511 | Ga0207678_10060441 | |||
| 1512 | Ga0207678_10111318 | |||
| 1513 | Ga0207678_10276024 | |||
| 1514 | Ga0207678_10285739 | |||
| 1515 | Ga0207678_10801106 | |||
| 1516 | Ga0207678_10811112 | |||
| 1517 | Ga0207708_10150915 | |||
| 1518 | Ga0207702_10258568 | |||
| 1519 | Ga0207641_10052079 | |||
| 1520 | Ga0207641_10157936 | |||
| 1521 | Ga0207676_10118741 | |||
| 1522 | Ga0207676_10183336 | |||
| 1523 | Ga0207676_10470385 | |||
| 1524 | Ga0207676_10526692 | |||
| 1525 | Ga0207676_11857207 | |||
| 1526 | Ga0207674_10035377 | |||
| 1527 | Ga0207674_10243898 | |||
| 1528 | Ga0207675_100150426 | |||
| 1529 | Ga0207675_100868222 | |||
| 1530 | Ga0207675_101811801 | |||
| 1531 | Ga0207683_10046557 | |||
| 1532 | Ga0207683_10302354 | |||
| 1533 | Ga0207683_10344193 | |||
| 1534 | Ga0207683_10377084 | |||
| 1535 | Ga0207698_10245737 | |||
| 1536 | Ga0207698_10360493 | |||
| 1537 | Ga0209589_1000021 | |||
| 1538 | Ga0209489_100028 | |||
| 1539 | Ga0209700_100037 | |||
| 1540 | Ga0209179_1021592 | |||
| 1541 | Ga0209179_1036546 | |||
| 1542 | Ga0209179_1039240 | |||
| 1543 | Ga0209588_1009657 | |||
| 1544 | Ga0268266_10001190 | |||
| 1545 | Ga0268266_10026628 | |||
| 1546 | Ga0268266_10136800 | |||
| 1547 | Ga0268266_10177059 | |||
| 1548 | Ga0268266_10244142 | |||
| 1549 | Ga0268266_10464199 | |||
| 1550 | Ga0268265_10108354 | |||
| 1551 | Ga0268265_10673746 | |||
| 1552 | Ga0268265_10938787 | |||
| 1553 | Ga0268264_10838001 | |||
| 1554 | Ga0268264_11260465 | |||
| 1555 | Ga0265334_10011626 | |||
| 1556 | Ga0307517_10144360 | |||
| 1557 | Ga0307515_10117765 | |||
| 1558 | Ga0307515_10355136 | |||
| 1559 | Ga0307515_10536209 | |||
| 1560 | Ga0307512_10213162 | |||
| 1561 | Ga0265330_10032679 | |||
| 1562 | Ga0265332_10032204 | |||
| 1563 | Ga0265331_10115739 | |||
| 1564 | Ga0307513_10079098 | |||
| 1565 | Ga0307513_10124353 | |||
| 1566 | Ga0307513_10289279 | |||
| 1567 | Ga0307513_10296134 | |||
| 1568 | Ga0307509_10109035 | |||
| 1569 | Ga0307408_100680306 | |||
| 1570 | Ga0307408_101597115 | |||
| 1571 | Ga0307408_101618310 | |||
| 1572 | Ga0307408_101759614 | |||
| 1573 | Ga0307408_101947593 | |||
| 1574 | Ga0307508_10000002 | |||
| 1575 | Ga0307508_10392970 | |||
| 1576 | Ga0307508_10616974 | |||
| 1577 | Ga0265314_10078677 | |||
| 1578 | Ga0265342_10005840 | |||
| 1579 | Ga0307516_10026599 | |||
| 1580 | Ga0307516_10055776 | |||
| 1581 | Ga0307516_10073131 | |||
| 1582 | Ga0307516_10407746 | |||
| 1583 | Ga0307413_10061383 | |||
| 1584 | Ga0307406_10037569 | |||
| 1585 | Ga0307406_10281523 | |||
| 1586 | Ga0307406_10302761 | |||
| 1587 | Ga0307407_10388790 | |||
| 1588 | Ga0307407_10414938 | |||
| 1589 | Ga0307412_10156128 | |||
| 1590 | Ga0307412_10408085 | |||
| 1591 | Ga0307412_12278855 | |||
| 1592 | Ga0307416_100466527 | |||
| 1593 | Ga0307416_101921018 | |||
| 1594 | Ga0307416_102134282 | |||
| 1595 | Ga0307414_10079957 | |||
| 1596 | Ga0307414_11540638 | |||
| 1597 | Ga0307411_10175504 | |||
| 1598 | Ga0307415_100039787 | |||
| 1599 | Ga0307415_101799059 | |||
| 1600 | Ga0307507_10334425 | |||
| 1601 | Ga0307510_10016711 | |||
| 1602 | Ga0307510_10018241 | |||
| 1603 | Ga0307510_10090848 | |||
| 1604 | Ga0373930_0015324 | |||
| 1605 | Ga0373930_0071943 | |||
| 1606 | Ga0373938_0089022 | |||
| 1607 | Ga0373934_0001837 | |||
| 1608 | Ga0373940_0018427 | |||
| 1609 | Ga0373949_0160911 | |||
| 1610 | Ga0373923_0000584 | |||
| 1611 | Ga0373932_0007741 | |||
| 1612 | Ga0373932_0040581 | |||
| 1613 | Ga0373936_0037608 | |||
| 1614 | Ga0373936_0072456 | |||
| 1615 | Ga0373953_0004679 | |||
| 1616 | Ga0373953_0005933 | |||
| 1617 | Ga0373953_0088641 | |||
| 1618 | Ga0373954_0000457 | |||
| 1619 | Ga0373954_0003801 | |||
| 1620 | Ga0373954_0314106 | |||
| 1621 | Ga0373956_0002647 | |||
| 1622 | Ga0373956_0095376 | |||
| 1623 | Ga0373957_0004514 | |||
| 1624 | Ga0373957_0091627 | |||
| 1625 | Ga0373943_0706600 | |||
| 1626 | Ga0373946_0157220 | |||
| 1627 | Ga0373946_0698539 | |||
| 1628 | Ga0373955_0001753 | |||
| 1629 | Ga0373955_1037096 | |||
| 1630 | Ga0373942_0174898 | |||
| 1631 | Ga0373942_0261773 | |||
| 1632 | Ga0373962_0166982 | |||
| 1633 | Ga0373924_0000541 | |||
| 1634 | Ga0373931_0003137 | |||
| 1635 | Ga0373931_0035089 | |||
| 1636 | Ga0373931_0093843 | |||
| 1637 | Ga0373931_0208930 | |||
| 1638 | Ga0373935_0750917 | |||
| 1639 | Ga0373927_0004813 | |||
| 1640 | Ga0373927_0068940 | |||
| 1641 | Ga0373927_0321833 | |||
| 1642 | Ga0373927_0382760 | |||
| 1643 | Ga0373927_0944146 | |||
| 1644 | Ga0373933_0004255 | |||
| 1645 | Ga0373933_0015606 | |||
| 1646 | Ga0373933_0413936 | |||
| 1647 | Ga0373933_0847308 | |||
| 1648 | Ga0373947_0018758 | |||
| 1649 | Ga0373947_0053711 | |||
| 1650 | Ga0373937_0007949 | |||
| 1651 | Ga0373937_0060148 | |||
| 1652 | Ga0373937_0413087 | |||
| 1653 | Ga0373925_0020848 | |||
| 1654 | Ga0373925_0322393 | |||
| 1655 | Ga0373925_0755909 | |||
| 1656 | Ga0395898_0192439 | |||
| 1657 | Ga0395905_0045415 | |||
| 1658 | Ga0395901_0108441 | |||
| 1659 | Ga0436365_0147971 | |||
| 1660 | Ga0436365_0725440 | |||
| 1661 | Ga0436365_0870281 | |||
| 1662 | Ga0436365_1521235 | |||
| 1663 | Ga0436360_0049247 | |||
| 1664 | Ga0436361_1075147 | |||
| 1665 | Ga0436361_1180359 | |||
| 1666 | Ga0436363_0125979 | |||
| 1667 | Ga0436363_0449948 | |||
| 1668 | Ga0436363_0859709 | |||
| 1669 | Ga0436362_0490728 | |||
| 1670 | Ga0439461_0215132 | |||
| 1671 | Ga0451793_1519244 | |||
| 1672 | Ga0451800_1461880 | |||
| 1673 | Ga0451802_1581769 | |||
| 1674 | Ga0451807_0100949 | |||
| 1675 | Ga0451807_0551131 | |||
| 1676 | Ga0451853_0276032 | |||
| 1677 | Ga0451853_2010475 | |||
| 1678 | Ga0439431_0058714 | |||
| 1679 | Ga0439458_0105670 | |||
| 1680 | Ga0466969_0500927 | |||
| 1681 | Ga0466966_0143026 | |||
| 1682 | Ga0466963_0195311 | |||
| 1683 | Ga0466964_0299525 | |||
| 1684 | Ga0466957_0206439 | |||
| 1685 | Ga0466959_0095420 | |||
| 1686 | Ga0466959_0175405 | |||
| 1687 | Ga0466958_0070229 | |||
| 1688 | Ga0495617_115334 | |||
| 1689 | Ga0495592_0005520 | |||
| 1690 | Ga0495592_0017032 | |||
| 1691 | Ga0495592_0548530 | |||
| 1692 | Ga0495603_0009420 | |||
| 1693 | Ga0495603_0031353 | |||
| 1694 | Ga0495603_0032179 | |||
| 1695 | Ga0495603_0182138 | |||
| 1696 | Ga0495603_0251264 | |||
| 1697 | Ga0495603_0286546 | |||
| 1698 | Ga0495590_0196847 | |||
| 1699 | Ga0495629_0000124 | |||
| 1700 | Ga0495629_0019538 | |||
| 1701 | Ga0495629_0205127 | |||
| 1702 | Ga0495629_0322325 | |||
| 1703 | Ga0495629_0680707 | |||
| 1704 | Ga0495638_0068701 | |||
| 1705 | Ga0495638_0143782 | |||
| 1706 | Ga0495638_0561132 | |||
| 1707 | Ga0495641_0114432 | |||
| 1708 | Ga0495651_0038303 | |||
| 1709 | Ga0495651_0041553 | |||
| 1710 | Ga0495651_0048532 | |||
| 1711 | Ga0495653_0018700 | |||
| 1712 | Ga0495650_0044302 | |||
| 1713 | Ga0495650_0149724 | |||
| 1714 | Ga0495580_0173040 | |||
| 1715 | Ga0495580_0640376 | |||
| 1716 | Ga0495582_0216236 | |||
| 1717 | Ga0495605_0074128 | |||
| 1718 | Ga0495605_0353624 | |||
| 1719 | Ga0495639_0010176 | |||
| 1720 | Ga0495639_0011821 | |||
| 1721 | Ga0495639_0175348 | |||
| 1722 | Ga0495664_0186020 | |||
| 1723 | Ga0495664_0552547 | |||
| 1724 | Ga0495584_0154657 | |||
| 1725 | Ga0495584_0260805 | |||
| 1726 | Ga0495584_0315505 | |||
| 1727 | Ga0495584_0419443 | |||
| 1728 | Ga0495585_0051609 | |||
| 1729 | Ga0495594_0213414 | |||
| 1730 | Ga0495594_0325484 | |||
| 1731 | Ga0495594_0605335 | |||
| 1732 | Ga0495596_0286243 | |||
| 1733 | Ga0495607_0277858 | |||
| 1734 | Ga0495607_0354581 | |||
| 1735 | Ga0495583_0072582 | |||
| 1736 | Ga0495583_0185166 | |||
| 1737 | Ga0495606_0111682 | |||
| 1738 | Ga0495606_0442193 | |||
| 1739 | Ga0495608_0002253 | |||
| 1740 | Ga0495608_0018263 | |||
| 1741 | Ga0495608_0709897 | |||
| 1742 | Ga0495616_0159601 | |||
| 1743 | Ga0495616_0171049 | |||
| 1744 | Ga0495616_0373556 | |||
| 1745 | Ga0495618_0008644 | |||
| 1746 | Ga0495618_0434356 | |||
| 1747 | Ga0495618_0527281 | |||
| 1748 | Ga0495620_0219096 | |||
| 1749 | Ga0495620_0308263 | |||
| 1750 | Ga0495628_0010523 | |||
| 1751 | Ga0495628_0213293 | |||
| 1752 | Ga0495628_0806211 | |||
| 1753 | Ga0495630_0423003 | |||
| 1754 | Ga0495630_0491654 | |||
| 1755 | Ga0495631_0042150 | |||
| 1756 | Ga0495631_0114330 | |||
| 1757 | Ga0495631_0126228 | |||
| 1758 | Ga0495632_0028862 | |||
| 1759 | Ga0495632_0167360 | |||
| 1760 | Ga0495632_0269147 | |||
| 1761 | Ga0495643_0440432 | |||
| 1762 | Ga0495644_0067837 | |||
| 1763 | Ga0495644_0125454 | |||
| 1764 | Ga0495644_0146613 | |||
| 1765 | Ga0495648_0312553 | |||
| 1766 | Ga0495663_0063724 | |||
| 1767 | Ga0495663_0335989 | |||
| 1768 | Ga0495642_0043703 | |||
| 1769 | Ga0495642_0389011 | |||
| 1770 | Ga0495652_0021486 | |||
| 1771 | Ga0495652_0034509 | |||
| 1772 | Ga0495652_0791622 | |||
| 1773 | Ga0495665_0557993 | |||
| 1774 | Ga0495640_0020098 | |||
| 1775 | Ga0495640_0035828 | |||
| 1776 | Ga0495640_0187493 | |||
| 1777 | Ga0495587_0015106 | |||
| 1778 | Ga0495587_0019403 | |||
| 1779 | Ga0495587_0789730 | |||
| 1780 | Ga0495598_0023551 | |||
| 1781 | Ga0495598_0053990 | |||
| 1782 | Ga0495598_0121980 | |||
| 1783 | Ga0495609_0133827 | |||
| 1784 | Ga0495609_0152655 | |||
| 1785 | Ga0495609_0246544 | |||
| 1786 | Ga0495621_0058368 | |||
| 1787 | Ga0495597_0063414 | |||
| 1788 | Ga0495645_0016860 | |||
| 1789 | Ga0495645_0074551 | |||
| 1790 | Ga0495622_0015732 | |||
| 1791 | Ga0495622_0145857 | |||
| 1792 | Ga0495622_0464518 | |||
| 1793 | Ga0495633_0040434 | |||
| 1794 | Ga0495633_0106287 | |||
| 1795 | Ga0495633_0460207 | |||
| 1796 | Ga0495667_0000551 | |||
| 1797 | Ga0495667_0060348 | |||
| 1798 | Ga0495656_0070007 | |||
| 1799 | Ga0495656_0239937 | |||
| 1800 | Ga0495656_0461313 | |||
| 1801 | Ga0495668_0114918 | |||
| 1802 | Ga0495668_0140491 | |||
| 1803 | Ga0495668_0603323 | |||
| 1804 | Ga0495668_0647449 | |||
| 1805 | Ga0495634_0230125 | |||
| 1806 | Ga0495611_0047537 | |||
| 1807 | Ga0495611_0325785 | |||
| 1808 | Ga0495611_0594766 | |||
| 1809 | Ga0495625_0234883 | |||
| 1810 | Ga0495625_0381302 | |||
| 1811 | Ga0495625_0383761 | |||
| 1812 | Ga0495635_0001218 | |||
| 1813 | Ga0495635_0023042 | |||
| 1814 | Ga0495635_0388050 | |||
| 1815 | Ga0495659_0006041 | |||
| 1816 | Ga0495659_0110783 | |||
| 1817 | Ga0495661_0249435 | |||
| 1818 | Ga0495661_0295438 | |||
| 1819 | Ga0495588_0008572 | |||
| 1820 | Ga0495588_0545353 | |||
| 1821 | Ga0495657_0019076 | |||
| 1822 | Ga0495657_0131203 | |||
| 1823 | Ga0495599_0009152 | |||
| 1824 | Ga0495599_0125057 | |||
| 1825 | Ga0495599_0545752 | |||
| 1826 | Ga0495623_0016600 | |||
| 1827 | Ga0495623_0022621 | |||
| 1828 | Ga0495646_0000643 | |||
| 1829 | Ga0495658_0154848 | |||
| 1830 | Ga0495658_0403890 | |||
| 1831 | Ga0495669_0020635 | |||
| 1832 | Ga0495669_0144646 | |||
| 1833 | Ga0495669_0333092 | |||
| 1834 | Ga0495669_0359936 | |||
| 1835 | Ga0495669_0432748 | |||
| 1836 | Ga0495613_0045757 | |||
| 1837 | Ga0495624_0062626 | |||
| 1838 | Ga0495624_0126692 | |||
| 1839 | Ga0495624_0434046 | |||
| 1840 | Ga0495624_0674831 | |||
| 1841 | Ga0495670_0080754 | |||
| 1842 | Ga0495670_0116066 | |||
| 1843 | Ga0495670_0239019 | |||
| 1844 | Ga0495671_0420378 | |||
| 1845 | Ga0495671_0435417 | |||
| 1846 | Ga0495649_0351810 | |||
| 1847 | Ga0495649_0440068 | |||
| 1848 | Ga0495649_0603714 | |||
| 1849 | Ga0495589_0100555 | |||
| 1850 | Ga0495589_0140556 | |||
| 1851 | Ga0495600_0001007 | |||
| 1852 | Ga0495600_0204018 | |||
| 1853 | Ga0495600_0266369 | |||
| 1854 | Ga0495660_0509809 | |||
| 1855 | Ga0495581_0045989 | |||
| 1856 | Ga0495604_0015936 | |||
| 1857 | Ga0495604_0023465 | |||
| 1858 | Ga0495604_0625893 | |||
| 1859 | Ga0495636_0129366 | |||
| 1860 | Ga0495636_0620928 | |||
| 1861 | Ga0495674_0003683 | |||
| 1862 | Ga0495674_0114961 | |||
| 1863 | Ga0495672_0037809 | |||
| 1864 | Ga0495672_0170661 | |||
| 1865 | Ga0495672_0416072 | |||
| 1866 | Ga0495676_0042130 | |||
| 1867 | Ga0495676_0130352 | |||
| 1868 | Ga0495680_0001909 | |||
| 1869 | Ga0495680_0046311 | |||
| 1870 | Ga0495683_0224830 | |||
| 1871 | Ga0495675_0001972 | |||
| 1872 | Ga0495675_0011175 | |||
| 1873 | Ga0495677_0106209 | |||
| 1874 | Ga0495679_127596 | |||
| 1875 | Ga0495673_0028030 | |||
| 1876 | Ga0495673_0030851 | |||
| 1877 | Ga0495681_0192030 | |||
| 1878 | Ga0495684_0000313 | |||
| 1879 | Ga0495684_0035943 | |||
| 1880 | Ga0495686_0075038 | |||
| 1881 | Ga0495686_0335243 | |||
| 1882 | Ga0495686_0634235 | |||
| 1883 | Ga0495593_0001524 | |||
| 1884 | Ga0495593_0128564 | |||
| 1885 | Ga0495602_0050780 | |||
| 1886 | Ga0495602_0059972 | |||
| 1887 | Ga0495614_0024394 | |||
| 1888 | Ga0495615_0206356 | |||
| 1889 | Ga0495626_0104917 | |||
| 1890 | Ga0495626_0200604 | |||
| 1891 | Ga0496100_0087995 | |||
| 1892 | Ga0496100_0139318 | |||
| 1893 | Ga0496101_0027335 | |||
| 1894 | Ga0496101_0046806 | |||
| 1895 | Ga0496102_0011927 | |||
| 1896 | Ga0496102_0049981 | |||
| 1897 | Ga0496102_0123428 | |||
| 1898 | Ga0496102_0165118 | |||
| 1899 | Ga0496102_0223293 | |||
| 1900 | Ga0496103_0041533 | |||
| 1901 | Ga0496103_0359980 | |||
| 1902 | Ga0496103_0580446 | |||
| 1903 | Ga0496104_0049045 | |||
| 1904 | Ga0496104_0059609 | |||
| 1905 | Ga0496104_0104080 | |||
| 1906 | Ga0496104_0234039 | |||
| 1907 | Ga0496105_0085784 | |||
| 1908 | Ga0496105_0110428 | |||
| 1909 | Ga0496105_0275606 | |||
| 1910 | Ga0496105_0413318 | |||
| 1911 | Ga0496105_0535321 | |||
| 1912 | Ga0496105_0598519 | |||
| 1913 | Ga0496105_0803467 | |||
| 1914 | Ga0496106_0037784 | |||
| 1915 | Ga0496106_0052259 | |||
| 1916 | Ga0496106_0294060 | |||
| 1917 | Ga0496106_0627129 | |||
| 1918 | Ga0496106_0877008 | |||
| 1919 | Ga0496106_1091148 | |||
| 1920 | Ga0496107_0002944 | |||
| 1921 | Ga0496107_0012539 | |||
| 1922 | Ga0496107_0288009 | |||
| 1923 | Ga0496107_0415006 | |||
| 1924 | Ga0496107_0815124 | |||
| 1925 | Ga0496108_0050424 | |||
| 1926 | Ga0496108_0102539 | |||
| 1927 | Ga0496108_0117623 | |||
| 1928 | Ga0496108_0852630 | |||
| 1929 | Ga0496109_0009866 | |||
| 1930 | Ga0496109_0035253 | |||
| 1931 | Ga0496109_0050985 | |||
| 1932 | Ga0496109_0721443 | |||
| 1933 | Ga0496110_0122513 | |||
| 1934 | Ga0496110_0165944 | |||
| 1935 | Ga0496110_0248028 | |||
| 1936 | Ga0496110_0355700 | |||
| 1937 | Ga0496110_0491122 | |||
| 1938 | Ga0496110_0665390 | |||
| 1939 | Ga0496110_1106760 | |||
| 1940 | Ga0496110_1140543 | |||
| 1941 | Ga0496111_0050121 | |||
| 1942 | Ga0496111_0050303 | |||
| 1943 | Ga0496111_0145014 | |||
| 1944 | Ga0496111_0155083 | |||
| 1945 | Ga0496111_0260027 | |||
| 1946 | Ga0496111_0548895 | |||
| 1947 | Ga0496111_0880681 | |||
| 1948 | Ga0496112_0001974 | |||
| 1949 | Ga0496112_0014051 | |||
| 1950 | Ga0496112_0028765 | |||
| 1951 | Ga0496112_0186304 | |||
| 1952 | Ga0496112_0219897 | |||
| 1953 | Ga0496112_0237027 | |||
| 1954 | Ga0496113_0013547 | |||
| 1955 | Ga0496113_0050127 | |||
| 1956 | Ga0496113_0251019 | |||
| 1957 | Ga0496113_0274424 | |||
| 1958 | Ga0496114_0080131 | |||
| 1959 | Ga0496114_0932388 | |||
| 1960 | Ga0496114_1593423 | |||
| 1961 | Ga0496115_0003266 | |||
| 1962 | Ga0496115_0032667 | |||
| 1963 | Ga0496115_0193576 | |||
| 1964 | Ga0496115_0223229 | |||
| 1965 | Ga0496115_0256728 | |||
| 1966 | Ga0496115_0260811 | |||
| 1967 | Ga0496115_0268189 | |||
| 1968 | Ga0496115_0853393 | |||
| 1969 | Ga0496115_0937074 | |||
| 1970 | Ga0496116_0323335 | |||
| 1971 | Ga0496117_0195191 | |||
| 1972 | Ga0496117_0356569 | |||
| 1973 | Ga0496117_0406694 | |||
| 1974 | Ga0496119_0139958 | |||
| 1975 | Ga0496119_0176977 | |||
| 1976 | Ga0496119_0306434 | |||
| 1977 | Ga0496119_0420303 | |||
| 1978 | Ga0496121_0039609 | |||
| 1979 | Ga0496121_0086669 | |||
| 1980 | Ga0496121_0100066 | |||
| 1981 | Ga0496121_0147348 | |||
| 1982 | Ga0496121_0214125 | |||
| 1983 | Ga0496124_0671010 | |||
| 1984 | Ga0496125_0130928 | |||
| 1985 | Ga0496126_0007843 | |||
| 1986 | Ga0496126_0030834 | |||
| 1987 | Ga0496126_0031354 | |||
| 1988 | Ga0496126_0121393 | |||
| 1989 | Ga0496126_0166479 | |||
| 1990 | Ga0496126_0407442 | |||
| 1991 | Ga0496126_0452718 | |||
| 1992 | Ga0496126_0722205 | |||
| 1993 | Ga0495682_0155730 | |||
| 1994 | Ga0501032_0019827 | |||
| 1995 | Ga0501032_0227629 | |||
| 1996 | Ga0501032_0664431 | |||
| 1997 | Ga0501034_0697001 | |||
| 1998 | Ga0501034_0776041 | |||
| 1999 | Ga0501036_0103183 | |||
| 2000 | Ga0501037_0580240 | |||
| 2001 | Ga0501038_0083459 | |||
| 2002 | Ga0501038_0531410 | |||
| 2003 | Ga0501039_0193009 | |||
| 2004 | Ga0501039_0244298 | |||
| 2005 | Ga0501047_0124847 | |||
| 2006 | Ga0501047_1158453 | |||
| 2007 | Ga0501067_0080761 | |||
| 2008 | Ga0501067_0110475 | |||
| 2009 | Ga0501068_0036146 | |||
| 2010 | Ga0501068_0345611 | |||
| 2011 | Ga0501069_0023410 | |||
| 2012 | Ga0501069_0258501 | |||
| 2013 | Ga0501072_0444037 | |||
| 2014 | Ga0501073_0063515 | |||
| 2015 | Ga0501076_0260681 | |||
| 2016 | Ga0501079_0822338 | |||
| 2017 | Ga0501080_0234585 | |||
| 2018 | Ga0501081_0603531 | |||
| 2019 | Ga0501083_0036945 | |||
| 2020 | Ga0501035_0044770 | |||
| 2021 | Ga0501035_0152365 | |||
| 2022 | Ga0501044_0130692 | |||
| 2023 | Ga0501045_0005982 | |||
| 2024 | Ga0501045_1376484 | |||
| 2025 | nmdc:mga03683_203155_c1 | |||
| 2026 | nmdc:mga03683_221246_c1 | |||
| 2027 | nmdc:mga03683_26211_c1 | |||
| 2028 | nmdc:mga03n38_25130_c1 | |||
| 2029 | nmdc:mga03n38_253802_c1 | |||
| 2030 | nmdc:mga00v17_388333_c1 | |||
| 2031 | nmdc:mga00v17_75943_c1 | |||
| 2032 | nmdc:mga00v17_85112_c1 | |||
| 2033 | nmdc:mga0yw44_216206_c1 | |||
| 2034 | nmdc:mga0yw44_415260_c1 | |||
| 2035 | nmdc:mga0yw44_55596_c1 | |||
| 2036 | nmdc:mga0yw44_800725_c1 | |||
| 2037 | nmdc:mga0k408_139477_c1 | |||
| 2038 | nmdc:mga06z11_189952_c1 | |||
| 2039 | nmdc:mga06z11_312960_c1 | |||
| 2040 | nmdc:mga06z11_33726_c1 | |||
| 2041 | nmdc:mga06z11_635642_c1 | |||
| 2042 | nmdc:mga07m45_19967_c1 | |||
| 2043 | nmdc:mga07m45_38992_c1 | |||
| 2044 | nmdc:mga07m45_55869_c1 | |||
| 2045 | nmdc:mga05p37_102181_c1 | |||
| 2046 | nmdc:mga0qj67_533055_c1 | |||
| 2047 | nmdc:mga08y16_15164_c1 | |||
| 2048 | nmdc:mga0n895_69515_c1 | |||
| 2049 | nmdc:mga0rr50_179637_c1 | |||
| 2050 | nmdc:mga0rr50_308324_c2 | |||
| 2051 | nmdc:mga08x19_140497_c1 | |||
| 2052 | nmdc:mga0a205_134118_c1 | |||
| 2053 | nmdc:mga0sz30_21935_c1 | |||
| 2054 | nmdc:mga0sz30_255674_c1 | |||
| 2055 | nmdc:mga0sz30_48450_c1 | |||
| 2056 | Ga0495601_0054219 | |||
| 2057 | Ga0495601_0311791 | |||
| 2058 | Ga0495612_0016378 | |||
| 2059 | Ga0500610_0117724 | |||
| 2060 | Ga0500635_0153508 | |||
| 2061 | Ga0495655_0051461 | |||
| 2062 | Ga0495655_0178933 | |||
| 2063 | Ga0495595_0000445 | |||
| 2064 | Ga0495595_0054813 | |||
| 2065 | Ga0495619_0001995 | |||
| 2066 | Ga0495619_0084768 | |||
| 2067 | Ga0500643_027818 | |||
| 2068 | Ga0500581_258691 | |||
| 2069 | Ga0500646_0279689 | |||
| 2070 | Ga0500650_0212604 | |||
| 2071 | Ga0500650_0250963 | |||
| 2072 | Ga0500554_003817 | |||
| 2073 | Ga0500554_017215 | |||
| 2074 | Ga0500582_161701 | |||
| 2075 | Ga0500592_043676 | |||
| 2076 | Ga0500595_000477 | |||
| 2077 | Ga0500595_028055 | |||
| 2078 | Ga0500617_206272 | |||
| 2079 | Ga0500621_175371 | |||
| 2080 | Ga0500658_0297115 | |||
| 2081 | Ga0500658_0317980 | |||
| 2082 | Ga0500588_0114309 | |||
| 2083 | Ga0500589_064971 | |||
| 2084 | Ga0500589_133161 | |||
| 2085 | Ga0500589_206025 | |||
| 2086 | Ga0500589_266318 | |||
| 2087 | Ga0500590_335920 | |||
| 2088 | Ga0500603_028836 | |||
| 2089 | Ga0500622_0051250 | |||
| 2090 | Ga0500627_0145273 | |||
| 2091 | Ga0500633_0146917 | |||
| 2092 | Ga0500634_0208305 | |||
| 2093 | Ga0500638_011253 | |||
| 2094 | Ga0500636_0070176 | |||
| 2095 | Ga0500637_0010152 | |||
| 2096 | Ga0500637_0011408 | |||
| 2097 | Ga0500645_159327 | |||
| 2098 | Ga0500609_015338 | |||
| 2099 | Ga0501084_0309355 | |||
| 2100 | Ga0500661_002168 | |||
| 2101 | Ga0501082_0988906 | |||
| 2102 | Ga0501082_1215592 | |||
| 2103 | Ga0530510_0616412 | |||
| 2104 | Ga0530510_0853936 | |||
| 2105 | 2513674579 | |||
| 2106 | 2513695121 | |||
| 2107 | 2671122457 | |||
| 2108 | 2723841652 | |||
| 2109 | 2728755000 | |||
| 2110 | 2793081066 | |||
| 2111 | 2874608055 | |||
| 2112 | 2876815495 | |||
| 2113 | 2879112180 | |||
| 2114 | 2889035480 | |||
| 2115 | 2903751484 | |||
| 2116 | 2903771850 | |||
| 2117 | 2906613884 | |||
| 2118 | 2908747454 | |||
| 2119 | 2922363991 | |||
| 2120 | 2922392575 | |||
| 2121 | 2935636530 | |||
| 2122 | 2941513165 | |||
| 2123 | 2941521180 | |||
| 2124 | 2941528883 | |||
| 2125 | 3005475073 | |||
| 2126 | 8006967466 | |||
| 2127 | 8006990931 | |||
| 2128 | 8006996502 | |||
| 2129 | 8019572492 | |||
| 2130 | 8056675752 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ku8-assembly3.cif.gz_C | structures of pkgi reveal a cgmp-selective activation mechanism | 0.9372 | 3 | 115 |
| 3co2-assembly1.cif.gz_C | mlotik1 ion channel cyclic-nucleotide binding domain mutant | 0.9256 | 6 | 117 |
| 3j4q-assembly1.cif.gz_C | pseudo-atomic model of the akap18-pka complex in a bent conformation derived from electron microscopy | 0.9077 | 3 | 113 |
| 2qvs-assembly1.cif.gz_B | crystal structure of type iia holoenzyme of camp-dependent protein kinase | 0.9077 | 3 | 113 |
| 3plq-assembly1.cif.gz_A | crystal structure of pka type i regulatory subunit bound with rp-8-br-camps | 0.9022 | 5 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7F7H6_385_507_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9156 | 8 | 125 | 2.60.120.10 |
| af_Q4DSV5_212_344_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9148 | 3 | 112 | 2.60.120.10 |
| af_E9AGM0_334_458_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9083 | 3 | 112 | 2.60.120.10 |
| 5j3uA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9042 | 3 | 112 | 2.60.120.10 |
| 3of1A01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9041 | 2 | 111 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537R663-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.9989 | 1 | 124 |
GO:0003700
GO:0005829 |
| AF-A0A537R663-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.983 | 1 | 124 |
GO:0003700
GO:0005829 |
| AF-A0A431P2R6-F1-model_v4 | deleted | 0.9733 | 1 | 145 |
|
| AF-A0A5E4NT20-F1-model_v4 | Cyclic nucleotide-binding protein | 0.9708 | 1 | 138 |
GO:0003700
GO:0005829 |
| AF-A0A4U6BN04-F1-model_v4 | Crp/Fnr family transcriptional regulator | 0.9705 | 1 | 145 |
GO:0003700
GO:0005829 |