F489367

General Info

Members Datasets Scaffolds Average Seq Length
1065 484 2130 146

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10083281|Ga0075368_100832812
Length 156
Sequence VIFAHPGHRSMSIEDDVALFERVPTLSLLGTAALRMLAIGSEQRDFSAGDYLFNAGDEADAGYIVQRGSFRVEDGGAEVVAGPGSLIGELALIVAMKRPSSAVALDHASVIRVARSLFQRVLESDPAAARRLRDELATRTSQLASDILMAGAKLSI

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
95 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
96 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
196 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
197 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
207 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
228 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
234 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
260 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
261 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
262 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
263 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
264 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
285 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
286 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
287 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
306 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
309 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
310 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
315 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
316 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
329 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
330 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
331 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
337 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
338 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
339 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
340 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
341 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
345 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
346 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
347 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
348 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
349 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
350 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
351 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
352 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
355 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
356 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
357 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
358 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
359 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
360 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
363 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
364 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
373 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
374 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
375 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
376 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
377 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
378 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
379 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
380 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
381 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
382 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
383 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
397 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
398 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
402 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
405 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
406 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
418 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
421 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
422 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
423 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
426 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
427 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
428 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
429 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
432 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
433 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
434 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
435 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
436 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
437 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
438 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
439 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
440 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
441 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
442 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
443 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
444 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
445 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
446 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
447 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
448 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
449 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
450 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
451 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
452 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
453 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
454 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
455 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
456 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
457 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
458 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
459 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
460 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
461 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
462 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
463 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
464 2791355199
465 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
466 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
467 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
468 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
469 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
470 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
471 2906610324
472 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
473 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
474 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
475 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
476 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
477 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
478 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
479 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
480 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
481 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
482 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
483 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
484 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.7
Nodule 2.35
Rhizoplane 7.98
Rhizosphere 76.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10083281 3300006042 Bacteria 1303
2 JGI25406J46586_10005031 3300003203 Bacteria 6140
3 JGI25165J46597_1022757 3300003214 Bacteria 817
4 JGI25404J52841_10001308 3300003659 Bacteria 4327
5 JGI25405J52794_10026811 3300003911 Bacteria 1185
6 Ga0065715_10043807 3300005293 Bacteria 1176
7 Ga0070683_100057276 3300005329 Bacteria 3620
8 Ga0070670_100476247 3300005331 Bacteria 1108
9 Ga0070677_10344105 3300005333 Bacteria 771
10 Ga0068869_100101991 3300005334 Bacteria 2171
11 Ga0068869_100229449 3300005334 Bacteria 1474
12 Ga0068869_100340376 3300005334 Bacteria 1220
13 Ga0068869_100498288 3300005334 Bacteria 1016
14 Ga0070666_10161456 3300005335 Bacteria 1566
15 Ga0070666_10488888 3300005335 Bacteria 892
16 Ga0070680_100054700 3300005336 Bacteria 3260
17 Ga0070682_100055337 3300005337 Bacteria 2492
18 Ga0068868_100019711 3300005338 Bacteria 5057
19 Ga0068868_100022147 3300005338 Bacteria 4792
20 Ga0068868_100319979 3300005338 Bacteria 1321
21 Ga0068868_100641910 3300005338 Bacteria 944
22 Ga0068868_100847586 3300005338 Bacteria 828
23 Ga0070660_100036213 3300005339 Bacteria 3736
24 Ga0070660_100406858 3300005339 Bacteria 1126
25 Ga0070689_100355605 3300005340 Bacteria 1229
26 Ga0070687_100480020 3300005343 Bacteria 833
27 Ga0070661_100039129 3300005344 Bacteria 3455
28 Ga0070661_100139697 3300005344 Bacteria 1825
29 Ga0070668_100096268 3300005347 Bacteria 2339
30 Ga0070668_100100324 3300005347 Bacteria 2293
31 Ga0070668_100291344 3300005347 Bacteria 1366
32 Ga0070668_100493975 3300005347 Bacteria 1058
33 Ga0070668_100588024 3300005347 Bacteria 972
34 Ga0070668_100668867 3300005347 Bacteria 913
35 Ga0070668_101115051 3300005347 Bacteria 712
36 Ga0070668_101217857 3300005347 Bacteria 682
37 Ga0070668_101427324 3300005347 Bacteria 631
38 Ga0070669_100190221 3300005353 Bacteria 1610
39 Ga0070669_101073698 3300005353 Bacteria 693
40 Ga0070675_100283247 3300005354 Bacteria 1457
41 Ga0070675_100328839 3300005354 Bacteria 1351
42 Ga0070671_100189782 3300005355 Bacteria 1741
43 Ga0070671_100511413 3300005355 Bacteria 1033
44 Ga0070671_100575055 3300005355 Bacteria 973
45 Ga0070674_100080106 3300005356 Bacteria 2331
46 Ga0070674_100242257 3300005356 Bacteria 1412
47 Ga0070673_100075656 3300005364 Bacteria 2716
48 Ga0070673_100205132 3300005364 Bacteria 1699
49 Ga0070688_100368798 3300005365 Bacteria 1056
50 Ga0070659_100083150 3300005366 Bacteria 2558
51 Ga0070659_100090516 3300005366 Bacteria 2452
52 Ga0070659_100628436 3300005366 Bacteria 925
53 Ga0070659_100837153 3300005366 Bacteria 801
54 Ga0070667_100339874 3300005367 Bacteria 1357
55 Ga0070709_10001880 3300005434 Bacteria 11387
56 Ga0070709_10251445 3300005434 Bacteria 1274
57 Ga0070709_10558577 3300005434 Bacteria 877
58 Ga0070714_100166014 3300005435 Bacteria 2001
59 Ga0070714_100938018 3300005435 Bacteria 841
60 Ga0070713_100003661 3300005436 Bacteria 10174
61 Ga0070713_100254527 3300005436 Bacteria 1603
62 Ga0070713_100432354 3300005436 Bacteria 1234
63 Ga0070710_10001236 3300005437 Bacteria 12109
64 Ga0070710_10767458 3300005437 Bacteria 686
65 Ga0070701_10046388 3300005438 Bacteria 2234
66 Ga0070711_100000660 3300005439 Bacteria 18001
67 Ga0070694_100190827 3300005444 Bacteria 1521
68 Ga0070663_100004283 3300005455 Bacteria 8352
69 Ga0070663_100006019 3300005455 Bacteria 7261
70 Ga0070663_100041490 3300005455 Bacteria 3228
71 Ga0070663_100106616 3300005455 Bacteria 2099
72 Ga0070663_100145967 3300005455 Bacteria 1810
73 Ga0070663_100513745 3300005455 Bacteria 996
74 Ga0070678_100101607 3300005456 Bacteria 2229
75 Ga0070678_100155518 3300005456 Bacteria 1846
76 Ga0070678_100239872 3300005456 Bacteria 1515
77 Ga0070678_100463077 3300005456 Bacteria 1113
78 Ga0070662_100068881 3300005457 Bacteria 2602
79 Ga0070662_100568075 3300005457 Bacteria 952
80 Ga0070681_10041351 3300005458 Bacteria 4620
81 Ga0070685_10197790 3300005466 Bacteria 1305
82 Ga0070685_10299751 3300005466 Bacteria 1083
83 Ga0070707_100247197 3300005468 Bacteria 1736
84 Ga0070698_100250562 3300005471 Bacteria 1704
85 Ga0070698_100679092 3300005471 Bacteria 972
86 Ga0070699_100747027 3300005518 Bacteria 895
87 Ga0070679_100044363 3300005530 Bacteria 4429
88 Ga0070679_100137917 3300005530 Bacteria 2420
89 Ga0070679_101313556 3300005530 Bacteria 669
90 Ga0070684_100013455 3300005535 Bacteria 6598
91 Ga0070697_100040762 3300005536 Bacteria 3758
92 Ga0070697_100164270 3300005536 Bacteria 1877
93 Ga0068853_100012684 3300005539 Bacteria 6862
94 Ga0068853_100320184 3300005539 Bacteria 1437
95 Ga0068853_100409342 3300005539 Bacteria 1270
96 Ga0068853_100438174 3300005539 Bacteria 1228
97 Ga0070672_100111060 3300005543 Bacteria 2234
98 Ga0070686_100156329 3300005544 Bacteria 1601
99 Ga0070686_100695189 3300005544 Bacteria 810
100 Ga0070695_100460213 3300005545 Bacteria 976
101 Ga0070695_100963103 3300005545 Bacteria 692
102 Ga0070696_100326881 3300005546 Bacteria 1182
103 Ga0070696_100781622 3300005546 Bacteria 784
104 Ga0070693_100030109 3300005547 Bacteria 2966
105 Ga0070693_100820982 3300005547 Bacteria 691
106 Ga0070665_100024472 3300005548 Bacteria 6081
107 Ga0070665_100039914 3300005548 Bacteria 4719
108 Ga0070665_100171968 3300005548 Bacteria 2167
109 Ga0070665_100217866 3300005548 Bacteria 1909
110 Ga0070665_100600358 3300005548 Bacteria 1114
111 Ga0070665_100860059 3300005548 Bacteria 920
112 Ga0070665_101112290 3300005548 Bacteria 801
113 Ga0070665_101374247 3300005548 Bacteria 715
114 Ga0070704_100329757 3300005549 Bacteria 1282
115 Ga0068855_100152875 3300005563 Bacteria 2623
116 Ga0068855_100325655 3300005563 Bacteria 1697
117 Ga0068855_100805940 3300005563 Bacteria 998
118 Ga0070664_100226362 3300005564 Bacteria 1675
119 Ga0070664_101090609 3300005564 Bacteria 752
120 Ga0068857_100018485 3300005577 Bacteria 6114
121 Ga0068857_100300019 3300005577 Bacteria 1481
122 Ga0068857_100744212 3300005577 Bacteria 933
123 Ga0068854_100103682 3300005578 Bacteria 2136
124 Ga0068854_101170817 3300005578 Bacteria 688
125 Ga0068856_100187404 3300005614 Bacteria 2083
126 Ga0068856_100342633 3300005614 Bacteria 1513
127 Ga0070702_100030607 3300005615 Bacteria 2936
128 Ga0070702_100463897 3300005615 Bacteria 922
129 Ga0068852_100061074 3300005616 Bacteria 3274
130 Ga0068852_100283593 3300005616 Bacteria 1598
131 Ga0068852_100437310 3300005616 Bacteria 1293
132 Ga0068859_100143978 3300005617 Bacteria 2457
133 Ga0068859_100163963 3300005617 Bacteria 2302
134 Ga0068859_100285767 3300005617 Bacteria 1742
135 Ga0068859_100387875 3300005617 Bacteria 1492
136 Ga0068864_100215262 3300005618 Bacteria 1771
137 Ga0068864_100470018 3300005618 Bacteria 1205
138 Ga0068866_10223485 3300005718 Bacteria 1137
139 Ga0068861_100278047 3300005719 Bacteria 1440
140 Ga0068861_101297616 3300005719 Bacteria 708
141 Ga0068851_10011859 3300005834 Bacteria 4097
142 Ga0068851_10219431 3300005834 Bacteria 1068
143 Ga0068851_10387661 3300005834 Bacteria 820
144 Ga0068863_100232337 3300005841 Bacteria 1779
145 Ga0068863_100333555 3300005841 Bacteria 1474
146 Ga0068863_101461091 3300005841 Bacteria 692
147 Ga0068858_100016049 3300005842 Bacteria 7036
148 Ga0068858_100057164 3300005842 Bacteria 3605
149 Ga0068858_100425075 3300005842 Bacteria 1278
150 Ga0068858_101043936 3300005842 Bacteria 801
151 Ga0068860_100086214 3300005843 Bacteria 2988
152 Ga0068860_100326155 3300005843 Bacteria 1507
153 Ga0068862_100351637 3300005844 Bacteria 1367
154 Ga0081455_10005984 3300005937 Bacteria 13195
155 Ga0081455_10008111 3300005937 Bacteria 10962
156 Ga0081455_10011164 3300005937 Bacteria 9043
157 Ga0081455_10028676 3300005937 Bacteria 5082
158 Ga0081455_10277173 3300005937 Bacteria 1213
159 Ga0081455_10296594 3300005937 Bacteria 1162
160 Ga0081538_10031555 3300005981 Bacteria 3570
161 Ga0081540_1001950 3300005983 Bacteria 17252
162 Ga0081540_1013355 3300005983 Bacteria 5344
163 Ga0081540_1015913 3300005983 Bacteria 4740
164 Ga0081540_1022081 3300005983 Bacteria 3766
165 Ga0081540_1023147 3300005983 Bacteria 3645
166 Ga0081540_1025816 3300005983 Bacteria 3370
167 Ga0081540_1059141 3300005983 Bacteria 1842
168 Ga0081540_1080759 3300005983 Bacteria 1465
169 Ga0081540_1096413 3300005983 Bacteria 1287
170 Ga0081540_1209291 3300005983 Bacteria 703
171 Ga0081539_10001064 3300005985 Bacteria 50201
172 Ga0081539_10158403 3300005985 Bacteria 1082
173 Ga0070717_10104664 3300006028 Bacteria 2408
174 Ga0075368_10036443 3300006042 Bacteria 1922
175 Ga0075363_100036055 3300006048 Bacteria 2592
176 Ga0075363_100252532 3300006048 Bacteria 1016
177 Ga0075364_10535182 3300006051 Bacteria 801
178 Ga0070715_10000108 3300006163 Bacteria 20251
179 Ga0070715_10061039 3300006163 Bacteria 1655
180 Ga0070716_100003373 3300006173 Bacteria 7517
181 Ga0070716_100081143 3300006173 Bacteria 1936
182 Ga0070716_101381619 3300006173 Bacteria 572
183 Ga0070712_100175596 3300006175 Bacteria 1666
184 Ga0075362_10110465 3300006177 Bacteria 1293
185 Ga0075362_10175531 3300006177 Bacteria 1037
186 Ga0075362_10194650 3300006177 Bacteria 985
187 Ga0075367_10019052 3300006178 Bacteria 3799
188 Ga0075367_10584169 3300006178 Bacteria 710
189 Ga0075369_10065526 3300006186 Bacteria 1592
190 Ga0075369_10091113 3300006186 Bacteria 1361
191 Ga0075369_10120898 3300006186 Bacteria 1185
192 Ga0075369_10285141 3300006186 Bacteria 770
193 Ga0075366_10263289 3300006195 Bacteria 1052
194 Ga0075366_10378298 3300006195 Bacteria 870
195 Ga0097621_100059415 3300006237 Bacteria 3130
196 Ga0097621_100356720 3300006237 Bacteria 1302
197 Ga0097621_100562793 3300006237 Bacteria 1039
198 Ga0097621_101578693 3300006237 Bacteria 623
199 Ga0075370_10101372 3300006353 Bacteria 1666
200 Ga0075370_10298076 3300006353 Bacteria 958
201 Ga0075370_10309862 3300006353 Bacteria 940
202 Ga0075370_10655801 3300006353 Bacteria 637
203 Ga0068871_100274748 3300006358 Bacteria 1472
204 Ga0068871_100697797 3300006358 Bacteria 930
205 Ga0075428_100085123 3300006844 Bacteria 3448
206 Ga0075430_100416688 3300006846 Bacteria 1109
207 Ga0075433_10113605 3300006852 Bacteria 2402
208 Ga0075434_100071865 3300006871 Bacteria 3452
209 Ga0075434_101486958 3300006871 Bacteria 687
210 Ga0068865_100137618 3300006881 Bacteria 1837
211 Ga0075436_100065143 3300006914 Bacteria 2519
212 Ga0097620_100143973 3300006931 Bacteria 2457
213 Ga0097620_100163966 3300006931 Bacteria 2302
214 Ga0097620_100285751 3300006931 Bacteria 1742
215 Ga0097620_100387894 3300006931 Bacteria 1492
216 Ga0099825_1041366 3300006941 Bacteria 1326
217 Ga0099824_1013118 3300006942 Bacteria 8741
218 Ga0099822_1000007 3300006943 Bacteria 77453
219 Ga0075435_100022140 3300007076 Bacteria 4900
220 Ga0075435_101589091 3300007076 Bacteria 574
221 Ga0099794_10003899 3300007265 Bacteria 5778
222 Ga0099794_10022739 3300007265 Bacteria 2860
223 Ga0099794_10071677 3300007265 Bacteria 1698
224 Ga0099794_10280335 3300007265 Bacteria 862
225 Ga0099795_10004002 3300007788 Bacteria 3742
226 Ga0099795_10025241 3300007788 Bacteria 1991
227 Ga0099795_10385447 3300007788 Bacteria 634
228 Ga0105250_10031767 3300009092 Bacteria 2120
229 Ga0105250_10309136 3300009092 Bacteria 685
230 Ga0105240_10013534 3300009093 Bacteria 11198
231 Ga0105240_10465454 3300009093 Bacteria 1412
232 Ga0105240_12409352 3300009093 Bacteria 545
233 Ga0105245_10305400 3300009098 Bacteria 1563
234 Ga0105245_10986325 3300009098 Bacteria 886
235 Ga0105245_11532193 3300009098 Bacteria 718
236 Ga0105245_11895014 3300009098 Bacteria 649
237 Ga0105247_10148239 3300009101 Bacteria 1544
238 Ga0105247_10231821 3300009101 Bacteria 1254
239 Ga0114129_10144590 3300009147 Bacteria 3258
240 Ga0114129_12077105 3300009147 Bacteria 686
241 Ga0105243_10340224 3300009148 Bacteria 1374
242 Ga0105243_10665406 3300009148 Bacteria 1011
243 Ga0105243_11826886 3300009148 Bacteria 639
244 Ga0105243_12315773 3300009148 Bacteria 575
245 Ga0105243_12826006 3300009148 Bacteria 526
246 Ga0105241_10241838 3300009174 Bacteria 1526
247 Ga0105241_10888921 3300009174 Bacteria 826
248 Ga0105242_10405567 3300009176 Bacteria 1273
249 Ga0105242_10689974 3300009176 Bacteria 998
250 Ga0105242_11578412 3300009176 Bacteria 689
251 Ga0105248_10403979 3300009177 Bacteria 1538
252 Ga0105237_10017081 3300009545 Bacteria 7528
253 Ga0105237_10022854 3300009545 Bacteria 6414
254 Ga0105237_10291074 3300009545 Bacteria 1636
255 Ga0105237_10437709 3300009545 Bacteria 1313
256 Ga0105237_11123598 3300009545 Bacteria 792
257 Ga0105237_11415667 3300009545 Bacteria 702
258 Ga0105238_10160027 3300009551 Bacteria 2227
259 Ga0105238_10284200 3300009551 Bacteria 1636
260 Ga0105238_10656870 3300009551 Bacteria 1059
261 Ga0105238_11001183 3300009551 Bacteria 857
262 Ga0105249_10058990 3300009553 Bacteria 3519
263 Ga0105249_11057152 3300009553 Bacteria 881
264 Ga0105249_11292009 3300009553 Bacteria 801
265 Ga0105249_11546025 3300009553 Bacteria 736
266 Ga0099796_10070681 3300010159 Bacteria 1259
267 Ga0099796_10262636 3300010159 Bacteria 721
268 Ga0099796_10288461 3300010159 Bacteria 692
269 Ga0099796_10479453 3300010159 Bacteria 556
270 Ga0105239_10031640 3300010375 Bacteria 5817
271 Ga0105239_10327997 3300010375 Bacteria 1726
272 Ga0105239_10337166 3300010375 Bacteria 1701
273 Ga0105239_10582750 3300010375 Bacteria 1275
274 Ga0105239_11077120 3300010375 Bacteria 925
275 Ga0105246_10029026 3300011119 Bacteria 3638
276 Ga0105246_10145415 3300011119 Bacteria 1788
277 Ga0105246_10617184 3300011119 Bacteria 939
278 Ga0157317_1006476 3300012475 Bacteria 818
279 Ga0157370_10057525 3300013104 Bacteria 3696
280 Ga0157370_10157802 3300013104 Bacteria 2111
281 Ga0157369_10057884 3300013105 Bacteria 4181
282 Ga0157374_10028269 3300013296 Bacteria 5066
283 Ga0157374_10036000 3300013296 Bacteria 4532
284 Ga0157374_10785472 3300013296 Bacteria 968
285 Ga0157378_10232684 3300013297 Bacteria 1757
286 Ga0157378_10254811 3300013297 Bacteria 1681
287 Ga0157378_10457022 3300013297 Bacteria 1268
288 Ga0157378_12241853 3300013297 Bacteria 597
289 Ga0163162_10043869 3300013306 Bacteria 4477
290 Ga0163162_10372823 3300013306 Bacteria 1560
291 Ga0163162_10677893 3300013306 Bacteria 1154
292 Ga0163162_10812570 3300013306 Bacteria 1052
293 Ga0163162_11198528 3300013306 Bacteria 862
294 Ga0157372_11771564 3300013307 Bacteria 710
295 Ga0157372_12521854 3300013307 Bacteria 590
296 Ga0157375_10508577 3300013308 Bacteria 1368
297 Ga0157375_12214709 3300013308 Bacteria 655
298 Ga0163163_10002009 3300014325 Bacteria 17183
299 Ga0163163_10078671 3300014325 Bacteria 3294
300 Ga0163163_10779476 3300014325 Bacteria 1019
301 Ga0157380_10644389 3300014326 Bacteria 1056
302 Ga0157380_10892325 3300014326 Bacteria 914
303 Ga0157380_10971924 3300014326 Bacteria 880
304 Ga0157377_10136398 3300014745 Bacteria 1504
305 Ga0157377_10583519 3300014745 Bacteria 795
306 Ga0157377_10909713 3300014745 Bacteria 658
307 Ga0157377_10927522 3300014745 Bacteria 653
308 Ga0157379_10018063 3300014968 Bacteria 6216
309 Ga0157379_10595404 3300014968 Bacteria 1032
310 Ga0157379_10613719 3300014968 Bacteria 1016
311 Ga0157379_11638325 3300014968 Bacteria 629
312 Ga0157379_11746039 3300014968 Bacteria 610
313 Ga0157376_10017044 3300014969 Bacteria 5532
314 Ga0157376_10138313 3300014969 Bacteria 2182
315 Ga0157376_10344822 3300014969 Bacteria 1423
316 Ga0157376_10490967 3300014969 Bacteria 1205
317 Ga0163161_10558273 3300017792 Bacteria 939
318 Ga0163161_10912093 3300017792 Bacteria 745
319 Ga0213873_10002209 3300021358 Bacteria 3344
320 Ga0213872_10070436 3300021361 Bacteria 1577
321 Ga0213872_10344068 3300021361 Bacteria 613
322 Ga0213874_10006326 3300021377 Bacteria 2802
323 Ga0213876_10005462 3300021384 Bacteria 6986
324 Ga0213876_10071525 3300021384 Bacteria 1832
325 Ga0209233_1001514 3300025261 Bacteria 9126
326 Ga0209758_1003344 3300025297 Bacteria 14725
327 Ga0209758_1015313 3300025297 Bacteria 3985
328 Ga0207697_10025606 3300025315 Bacteria 2411
329 Ga0207656_10084455 3300025321 Bacteria 1432
330 Ga0207656_10153819 3300025321 Bacteria 1091
331 Ga0207653_10054382 3300025885 Bacteria 1339
332 Ga0207682_10185059 3300025893 Bacteria 953
333 Ga0207692_10000829 3300025898 Bacteria 11083
334 Ga0207710_10336767 3300025900 Bacteria 767
335 Ga0207688_10139410 3300025901 Bacteria 1427
336 Ga0207688_10152616 3300025901 Bacteria 1365
337 Ga0207688_10167449 3300025901 Bacteria 1305
338 Ga0207688_10171453 3300025901 Bacteria 1290
339 Ga0207680_10363416 3300025903 Bacteria 1018
340 Ga0207680_10476161 3300025903 Bacteria 888
341 Ga0207647_10155427 3300025904 Bacteria 1336
342 Ga0207685_10001367 3300025905 Bacteria 5051
343 Ga0207685_10164329 3300025905 Bacteria 1016
344 Ga0207685_10199366 3300025905 Bacteria 939
345 Ga0207699_10004989 3300025906 Bacteria 6347
346 Ga0207645_10043296 3300025907 Bacteria 2881
347 Ga0207643_10273737 3300025908 Bacteria 1045
348 Ga0207705_10244175 3300025909 Bacteria 1368
349 Ga0207654_10269225 3300025911 Bacteria 1149
350 Ga0207654_10735191 3300025911 Bacteria 710
351 Ga0207707_10004934 3300025912 Bacteria 11734
352 Ga0207707_10105415 3300025912 Bacteria 2464
353 Ga0207695_10033471 3300025913 Bacteria 5603
354 Ga0207695_10151832 3300025913 Bacteria 2255
355 Ga0207671_10033557 3300025914 Bacteria 3817
356 Ga0207671_10045233 3300025914 Bacteria 3255
357 Ga0207671_10047548 3300025914 Bacteria 3176
358 Ga0207671_10063451 3300025914 Bacteria 2745
359 Ga0207671_10083371 3300025914 Bacteria 2400
360 Ga0207671_10543341 3300025914 Bacteria 926
361 Ga0207693_10000310 3300025915 Bacteria 45408
362 Ga0207693_10005993 3300025915 Bacteria 10080
363 Ga0207693_10036014 3300025915 Bacteria 3900
364 Ga0207693_10847462 3300025915 Bacteria 703
365 Ga0207663_10000230 3300025916 Bacteria 24696
366 Ga0207663_10009652 3300025916 Bacteria 5107
367 Ga0207663_10730238 3300025916 Bacteria 786
368 Ga0207660_10011652 3300025917 Bacteria 5733
369 Ga0207660_10064010 3300025917 Bacteria 2653
370 Ga0207662_10077673 3300025918 Bacteria 2020
371 Ga0207657_10022864 3300025919 Bacteria 5836
372 Ga0207657_10229612 3300025919 Bacteria 1484
373 Ga0207649_10101458 3300025920 Bacteria 1905
374 Ga0207649_10132939 3300025920 Bacteria 1692
375 Ga0207649_11358260 3300025920 Bacteria 562
376 Ga0207652_10002828 3300025921 Bacteria 14572
377 Ga0207652_10175637 3300025921 Bacteria 1924
378 Ga0207681_10178556 3300025923 Bacteria 1615
379 Ga0207694_10048946 3300025924 Bacteria 3271
380 Ga0207694_10199304 3300025924 Bacteria 1628
381 Ga0207694_10201814 3300025924 Bacteria 1618
382 Ga0207650_10191966 3300025925 Bacteria 1632
383 Ga0207650_10603275 3300025925 Bacteria 923
384 Ga0207659_11421753 3300025926 Bacteria 594
385 Ga0207687_10066362 3300025927 Bacteria 2565
386 Ga0207687_10294416 3300025927 Bacteria 1305
387 Ga0207687_10845203 3300025927 Bacteria 782
388 Ga0207687_11246467 3300025927 Bacteria 639
389 Ga0207700_10021866 3300025928 Bacteria 4377
390 Ga0207700_10076835 3300025928 Bacteria 2592
391 Ga0207700_10113880 3300025928 Bacteria 2181
392 Ga0207700_11027583 3300025928 Bacteria 737
393 Ga0207700_11693477 3300025928 Bacteria 558
394 Ga0207664_10001147 3300025929 Bacteria 17636
395 Ga0207664_10289562 3300025929 Bacteria 1439
396 Ga0207664_11517751 3300025929 Bacteria 592
397 Ga0207644_10105890 3300025931 Bacteria 2119
398 Ga0207644_10394385 3300025931 Bacteria 1130
399 Ga0207644_10458984 3300025931 Bacteria 1047
400 Ga0207644_11030039 3300025931 Bacteria 691
401 Ga0207690_10779457 3300025932 Bacteria 789
402 Ga0207706_10183747 3300025933 Bacteria 1836
403 Ga0207706_10422850 3300025933 Bacteria 1154
404 Ga0207669_10627604 3300025937 Bacteria 876
405 Ga0207704_10026355 3300025938 Bacteria 3188
406 Ga0207665_10003377 3300025939 Bacteria 10687
407 Ga0207665_10028331 3300025939 Bacteria 3699
408 Ga0207665_10410649 3300025939 Bacteria 1033
409 Ga0207665_10750668 3300025939 Bacteria 769
410 Ga0207665_11041790 3300025939 Bacteria 651
411 Ga0207691_10172349 3300025940 Bacteria 1894
412 Ga0207691_10579060 3300025940 Bacteria 951
413 Ga0207691_10596088 3300025940 Bacteria 935
414 Ga0207711_10108773 3300025941 Bacteria 2463
415 Ga0207689_10299334 3300025942 Bacteria 1333
416 Ga0207689_10662279 3300025942 Bacteria 880
417 Ga0207689_10667697 3300025942 Bacteria 876
418 Ga0207689_10828033 3300025942 Bacteria 781
419 Ga0207689_11011769 3300025942 Bacteria 701
420 Ga0207661_10621100 3300025944 Bacteria 992
421 Ga0207661_11140644 3300025944 Bacteria 718
422 Ga0207679_10188478 3300025945 Bacteria 1713
423 Ga0207667_10033916 3300025949 Bacteria 5484
424 Ga0207667_10046837 3300025949 Bacteria 4579
425 Ga0207667_10323540 3300025949 Bacteria 1575
426 Ga0207667_10725976 3300025949 Bacteria 994
427 Ga0207667_10736403 3300025949 Bacteria 986
428 Ga0207651_11685075 3300025960 Bacteria 571
429 Ga0207668_10084474 3300025972 Bacteria 2313
430 Ga0207668_10229600 3300025972 Bacteria 1495
431 Ga0207668_10269628 3300025972 Bacteria 1391
432 Ga0207668_11075907 3300025972 Bacteria 720
433 Ga0207668_11323720 3300025972 Bacteria 649
434 Ga0207640_10578462 3300025981 Bacteria 948
435 Ga0207658_10377977 3300025986 Bacteria 1240
436 Ga0207677_10846895 3300026023 Bacteria 821
437 Ga0207677_10950800 3300026023 Bacteria 777
438 Ga0207703_10460605 3300026035 Bacteria 1189
439 Ga0207703_10546886 3300026035 Bacteria 1091
440 Ga0207703_11102772 3300026035 Bacteria 762
441 Ga0207639_10020456 3300026041 Bacteria 4737
442 Ga0207639_10585829 3300026041 Bacteria 1027
443 Ga0207639_10804131 3300026041 Bacteria 876
444 Ga0207678_10003936 3300026067 Bacteria 13364
445 Ga0207678_10038029 3300026067 Bacteria 4184
446 Ga0207678_10060441 3300026067 Bacteria 3259
447 Ga0207678_10111318 3300026067 Bacteria 2335
448 Ga0207678_10276024 3300026067 Bacteria 1442
449 Ga0207678_10285739 3300026067 Bacteria 1416
450 Ga0207678_10801106 3300026067 Bacteria 832
451 Ga0207678_10811112 3300026067 Bacteria 826
452 Ga0207708_10150915 3300026075 Bacteria 1829
453 Ga0207702_10258568 3300026078 Bacteria 1638
454 Ga0207641_10052079 3300026088 Bacteria 3466
455 Ga0207641_10157936 3300026088 Bacteria 2059
456 Ga0207676_10118741 3300026095 Bacteria 2226
457 Ga0207676_10183336 3300026095 Bacteria 1835
458 Ga0207676_10470385 3300026095 Bacteria 1188
459 Ga0207676_10526692 3300026095 Bacteria 1126
460 Ga0207676_11857207 3300026095 Bacteria 601
461 Ga0207674_10035377 3300026116 Bacteria 5212
462 Ga0207674_10243898 3300026116 Bacteria 1744
463 Ga0207675_100150426 3300026118 Bacteria 2215
464 Ga0207675_100868222 3300026118 Bacteria 918
465 Ga0207675_101811801 3300026118 Bacteria 629
466 Ga0207683_10046557 3300026121 Bacteria 3796
467 Ga0207683_10302354 3300026121 Bacteria 1464
468 Ga0207683_10344193 3300026121 Bacteria 1368
469 Ga0207683_10377084 3300026121 Bacteria 1303
470 Ga0207698_10245737 3300026142 Bacteria 1634
471 Ga0207698_10360493 3300026142 Bacteria 1376
472 Ga0209589_1000021 3300027357 Bacteria 186431
473 Ga0209489_100028 3300027361 Bacteria 186431
474 Ga0209700_100037 3300027363 Bacteria 186431
475 Ga0209179_1021592 3300027512 Bacteria 1258
476 Ga0209179_1036546 3300027512 Bacteria 1023
477 Ga0209179_1039240 3300027512 Bacteria 993
478 Ga0209588_1009657 3300027671 Bacteria 2886
479 Ga0268266_10001190 3300028379 Bacteria 32120
480 Ga0268266_10026628 3300028379 Bacteria 4920
481 Ga0268266_10136800 3300028379 Bacteria 2195
482 Ga0268266_10177059 3300028379 Bacteria 1939
483 Ga0268266_10244142 3300028379 Bacteria 1658
484 Ga0268266_10464199 3300028379 Bacteria 1205
485 Ga0268265_10108354 3300028380 Bacteria 2261
486 Ga0268265_10673746 3300028380 Bacteria 996
487 Ga0268265_10938787 3300028380 Bacteria 851
488 Ga0268264_10838001 3300028381 Bacteria 920
489 Ga0268264_11260465 3300028381 Bacteria 749
490 Ga0265334_10011626 3300028573 Bacteria 3701
491 Ga0307517_10144360 3300028786 Bacteria 1657
492 Ga0307515_10117765 3300028794 Bacteria 3037
493 Ga0307515_10355136 3300028794 Bacteria 1110
494 Ga0307515_10536209 3300028794 Bacteria 780
495 Ga0307512_10213162 3300030522 Bacteria 1023
496 Ga0265330_10032679 3300031235 Bacteria 2331
497 Ga0265332_10032204 3300031238 Bacteria 2285
498 Ga0265331_10115739 3300031250 Bacteria 1228
499 Ga0307513_10079098 3300031456 Bacteria 3398
500 Ga0307513_10124353 3300031456 Bacteria 2539
501 Ga0307513_10289279 3300031456 Bacteria 1411
502 Ga0307513_10296134 3300031456 Bacteria 1387
503 Ga0307509_10109035 3300031507 Bacteria 2780
504 Ga0307408_100680306 3300031548 Bacteria 923
505 Ga0307408_101597115 3300031548 Bacteria 619
506 Ga0307408_101618310 3300031548 Bacteria 615
507 Ga0307408_101759614 3300031548 Bacteria 592
508 Ga0307408_101947593 3300031548 Bacteria 564
509 Ga0307508_10000002 3300031616 Bacteria 407635
510 Ga0307508_10392970 3300031616 Bacteria 978
511 Ga0307508_10616974 3300031616 Bacteria 687
512 Ga0265314_10078677 3300031711 Bacteria 2182
513 Ga0265342_10005840 3300031712 Bacteria 9294
514 Ga0307516_10026599 3300031730 Bacteria 5874
515 Ga0307516_10055776 3300031730 Bacteria 3856
516 Ga0307516_10073131 3300031730 Bacteria 3285
517 Ga0307516_10407746 3300031730 Bacteria 1018
518 Ga0307413_10061383 3300031824 Bacteria 2319
519 Ga0307406_10037569 3300031901 Bacteria 2992
520 Ga0307406_10281523 3300031901 Bacteria 1269
521 Ga0307406_10302761 3300031901 Bacteria 1229
522 Ga0307407_10388790 3300031903 Bacteria 998
523 Ga0307407_10414938 3300031903 Bacteria 969
524 Ga0307412_10156128 3300031911 Bacteria 1689
525 Ga0307412_10408085 3300031911 Bacteria 1108
526 Ga0307412_12278855 3300031911 Bacteria 505
527 Ga0307416_100466527 3300032002 Bacteria 1319
528 Ga0307416_101921018 3300032002 Bacteria 695
529 Ga0307416_102134282 3300032002 Bacteria 662
530 Ga0307414_10079957 3300032004 Bacteria 2389
531 Ga0307414_11540638 3300032004 Bacteria 619
532 Ga0307411_10175504 3300032005 Bacteria 1621
533 Ga0307415_100039787 3300032126 Bacteria 3111
534 Ga0307415_101799059 3300032126 Bacteria 593
535 Ga0307507_10334425 3300033179 Bacteria 902
536 Ga0307510_10016711 3300033180 Bacteria 8658
537 Ga0307510_10018241 3300033180 Bacteria 8262
538 Ga0307510_10090848 3300033180 Bacteria 2898
539 Ga0373930_0015324 3300034816 Bacteria 1438
540 Ga0373930_0071943 3300034816 Bacteria 787
541 Ga0373938_0089022 3300034957 Bacteria 761
542 Ga0373934_0001837 3300035086 Bacteria 7804
543 Ga0373940_0018427 3300035088 Bacteria 1752
544 Ga0373949_0160911 3300035090 Bacteria 655
545 Ga0373923_0000584 3300035111 Bacteria 9020
546 Ga0373932_0007741 3300035112 Bacteria 2564
547 Ga0373932_0040581 3300035112 Bacteria 1341
548 Ga0373936_0037608 3300035113 Bacteria 1933
549 Ga0373936_0072456 3300035113 Bacteria 1422
550 Ga0373953_0004679 3300035117 Bacteria 4382
551 Ga0373953_0005933 3300035117 Bacteria 3996
552 Ga0373953_0088641 3300035117 Bacteria 1293
553 Ga0373954_0000457 3300035118 Bacteria 15282
554 Ga0373954_0003801 3300035118 Bacteria 6446
555 Ga0373954_0314106 3300035118 Bacteria 773
556 Ga0373956_0002647 3300035119 Bacteria 7252
557 Ga0373956_0095376 3300035119 Bacteria 1375
558 Ga0373957_0004514 3300035120 Bacteria 4236
559 Ga0373957_0091627 3300035120 Bacteria 1209
560 Ga0373943_0706600 3300035170 Bacteria 597
561 Ga0373946_0157220 3300035171 Bacteria 1065
562 Ga0373946_0698539 3300035171 Bacteria 530
563 Ga0373955_0001753 3300035172 Bacteria 9318
564 Ga0373955_1037096 3300035172 Bacteria 505
565 Ga0373942_0174898 3300035207 Bacteria 701
566 Ga0373942_0261773 3300035207 Bacteria 591
567 Ga0373962_0166982 3300035242 Bacteria 729
568 Ga0373924_0000541 3300035410 Bacteria 11623
569 Ga0373931_0003137 3300035691 Bacteria 7381
570 Ga0373931_0035089 3300035691 Bacteria 2606
571 Ga0373931_0093843 3300035691 Bacteria 1677
572 Ga0373931_0208930 3300035691 Bacteria 1170
573 Ga0373935_0750917 3300035692 Bacteria 719
574 Ga0373927_0004813 3300035695 Bacteria 9384
575 Ga0373927_0068940 3300035695 Bacteria 2289
576 Ga0373927_0321833 3300035695 Bacteria 1018
577 Ga0373927_0382760 3300035695 Bacteria 928
578 Ga0373927_0944146 3300035695 Bacteria 569
579 Ga0373933_0004255 3300035724 Bacteria 7878
580 Ga0373933_0015606 3300035724 Bacteria 4236
581 Ga0373933_0413936 3300035724 Bacteria 880
582 Ga0373933_0847308 3300035724 Bacteria 602
583 Ga0373947_0018758 3300035725 Bacteria 3984
584 Ga0373947_0053711 3300035725 Bacteria 2430
585 Ga0373937_0007949 3300036401 Bacteria 9195
586 Ga0373937_0060148 3300036401 Bacteria 3491
587 Ga0373937_0413087 3300036401 Bacteria 1280
588 Ga0373925_0020848 3300037068 Bacteria 4777
589 Ga0373925_0322393 3300037068 Bacteria 1250
590 Ga0373925_0755909 3300037068 Bacteria 801
591 Ga0395898_0192439 3300037466 Bacteria 1949
592 Ga0395905_0045415 3300037471 Bacteria 4120
593 Ga0395901_0108441 3300038443 Bacteria 2915
594 Ga0436365_0147971 3300039437 Bacteria 1146
595 Ga0436365_0725440 3300039437 Bacteria 10515
596 Ga0436365_0870281 3300039437 Bacteria 1107
597 Ga0436365_1521235 3300039437 Bacteria 2773
598 Ga0436360_0049247 3300039438 Bacteria 659
599 Ga0436361_1075147 3300039447 Bacteria 1699
600 Ga0436361_1180359 3300039447 Bacteria 1703
601 Ga0436363_0125979 3300039450 Bacteria 4409
602 Ga0436363_0449948 3300039450 Bacteria 4308
603 Ga0436363_0859709 3300039450 Bacteria 1179
604 Ga0436362_0490728 3300039453 Bacteria 4488
605 Ga0439461_0215132 3300041410 Bacteria 522
606 Ga0451793_1519244 3300041452 Bacteria 601
607 Ga0451800_1461880 3300041459 Bacteria 652
608 Ga0451802_1581769 3300041460 Bacteria 877
609 Ga0451807_0100949 3300041486 Bacteria 590
610 Ga0451807_0551131 3300041486 Bacteria 1003
611 Ga0451853_0276032 3300041512 Bacteria 1558
612 Ga0451853_2010475 3300041512 Bacteria 908
613 Ga0439431_0058714 3300041997 Bacteria 1009
614 Ga0439458_0105670 3300042157 Bacteria 734
615 Ga0466969_0500927 3300044656 Bacteria 554
616 Ga0466966_0143026 3300044684 Bacteria 1461
617 Ga0466963_0195311 3300044694 Bacteria 1415
618 Ga0466964_0299525 3300044706 Bacteria 810
619 Ga0466957_0206439 3300044842 Bacteria 1292
620 Ga0466959_0095420 3300045049 Bacteria 2133
621 Ga0466959_0175405 3300045049 Bacteria 1502
622 Ga0466958_0070229 3300045836 Bacteria 2143
623 Ga0495617_115334 3300046452 Bacteria 867
624 Ga0495592_0005520 3300046454 Bacteria 9352
625 Ga0495592_0017032 3300046454 Bacteria 5516
626 Ga0495592_0548530 3300046454 Bacteria 711
627 Ga0495603_0009420 3300046455 Bacteria 5902
628 Ga0495603_0031353 3300046455 Bacteria 3200
629 Ga0495603_0032179 3300046455 Bacteria 3156
630 Ga0495603_0182138 3300046455 Bacteria 1215
631 Ga0495603_0251264 3300046455 Bacteria 1018
632 Ga0495603_0286546 3300046455 Bacteria 946
633 Ga0495590_0196847 3300046457 Bacteria 740
634 Ga0495629_0000124 3300046459 Bacteria 68796
635 Ga0495629_0019538 3300046459 Bacteria 4839
636 Ga0495629_0205127 3300046459 Bacteria 1362
637 Ga0495629_0322325 3300046459 Bacteria 1056
638 Ga0495629_0680707 3300046459 Bacteria 684
639 Ga0495638_0068701 3300046460 Bacteria 2172
640 Ga0495638_0143782 3300046460 Bacteria 1389
641 Ga0495638_0561132 3300046460 Bacteria 566
642 Ga0495641_0114432 3300046461 Bacteria 1203
643 Ga0495651_0038303 3300046462 Bacteria 3733
644 Ga0495651_0041553 3300046462 Bacteria 3571
645 Ga0495651_0048532 3300046462 Bacteria 3279
646 Ga0495653_0018700 3300046463 Bacteria 5625
647 Ga0495650_0044302 3300046471 Bacteria 1882
648 Ga0495650_0149724 3300046471 Bacteria 839
649 Ga0495580_0173040 3300046472 Bacteria 1492
650 Ga0495580_0640376 3300046472 Bacteria 700
651 Ga0495582_0216236 3300046473 Bacteria 1096
652 Ga0495605_0074128 3300046474 Bacteria 1602
653 Ga0495605_0353624 3300046474 Bacteria 616
654 Ga0495639_0010176 3300046475 Bacteria 4045
655 Ga0495639_0011821 3300046475 Bacteria 3765
656 Ga0495639_0175348 3300046475 Bacteria 1042
657 Ga0495664_0186020 3300046477 Bacteria 1259
658 Ga0495664_0552547 3300046477 Bacteria 686
659 Ga0495584_0154657 3300046491 Bacteria 1165
660 Ga0495584_0260805 3300046491 Bacteria 881
661 Ga0495584_0315505 3300046491 Bacteria 794
662 Ga0495584_0419443 3300046491 Bacteria 680
663 Ga0495585_0051609 3300046492 Bacteria 2278
664 Ga0495594_0213414 3300046499 Bacteria 1101
665 Ga0495594_0325484 3300046499 Bacteria 875
666 Ga0495594_0605335 3300046499 Bacteria 621
667 Ga0495596_0286243 3300046500 Bacteria 640
668 Ga0495607_0277858 3300046501 Bacteria 796
669 Ga0495607_0354581 3300046501 Bacteria 676
670 Ga0495583_0072582 3300046506 Bacteria 1510
671 Ga0495583_0185166 3300046506 Bacteria 851
672 Ga0495606_0111682 3300046507 Bacteria 1648
673 Ga0495606_0442193 3300046507 Bacteria 668
674 Ga0495608_0002253 3300046511 Bacteria 13922
675 Ga0495608_0018263 3300046511 Bacteria 4839
676 Ga0495608_0709897 3300046511 Bacteria 598
677 Ga0495616_0159601 3300046513 Bacteria 1015
678 Ga0495616_0171049 3300046513 Bacteria 971
679 Ga0495616_0373556 3300046513 Bacteria 590
680 Ga0495618_0008644 3300046514 Bacteria 6154
681 Ga0495618_0434356 3300046514 Bacteria 799
682 Ga0495618_0527281 3300046514 Bacteria 709
683 Ga0495620_0219096 3300046515 Bacteria 729
684 Ga0495620_0308263 3300046515 Bacteria 601
685 Ga0495628_0010523 3300046516 Bacteria 7852
686 Ga0495628_0213293 3300046516 Bacteria 1451
687 Ga0495628_0806211 3300046516 Bacteria 657
688 Ga0495630_0423003 3300046517 Bacteria 1021
689 Ga0495630_0491654 3300046517 Bacteria 941
690 Ga0495631_0042150 3300046518 Bacteria 2017
691 Ga0495631_0114330 3300046518 Bacteria 1160
692 Ga0495631_0126228 3300046518 Bacteria 1100
693 Ga0495632_0028862 3300046519 Bacteria 2894
694 Ga0495632_0167360 3300046519 Bacteria 1011
695 Ga0495632_0269147 3300046519 Bacteria 760
696 Ga0495643_0440432 3300046522 Bacteria 569
697 Ga0495644_0067837 3300046523 Bacteria 1340
698 Ga0495644_0125454 3300046523 Bacteria 977
699 Ga0495644_0146613 3300046523 Bacteria 902
700 Ga0495648_0312553 3300046524 Bacteria 732
701 Ga0495663_0063724 3300046525 Bacteria 1162
702 Ga0495663_0335989 3300046525 Bacteria 548
703 Ga0495642_0043703 3300046528 Bacteria 1828
704 Ga0495642_0389011 3300046528 Bacteria 614
705 Ga0495652_0021486 3300046529 Bacteria 5736
706 Ga0495652_0034509 3300046529 Bacteria 4408
707 Ga0495652_0791622 3300046529 Bacteria 632
708 Ga0495665_0557993 3300046531 Bacteria 574
709 Ga0495640_0020098 3300046533 Bacteria 4920
710 Ga0495640_0035828 3300046533 Bacteria 3510
711 Ga0495640_0187493 3300046533 Bacteria 1316
712 Ga0495587_0015106 3300046536 Bacteria 4825
713 Ga0495587_0019403 3300046536 Bacteria 4207
714 Ga0495587_0789730 3300046536 Bacteria 519
715 Ga0495598_0023551 3300046537 Bacteria 1659
716 Ga0495598_0053990 3300046537 Bacteria 1219
717 Ga0495598_0121980 3300046537 Bacteria 884
718 Ga0495609_0133827 3300046538 Bacteria 1060
719 Ga0495609_0152655 3300046538 Bacteria 982
720 Ga0495609_0246544 3300046538 Bacteria 736
721 Ga0495621_0058368 3300046539 Bacteria 1395
722 Ga0495597_0063414 3300046542 Bacteria 1606
723 Ga0495645_0016860 3300046543 Bacteria 5228
724 Ga0495645_0074551 3300046543 Bacteria 2443
725 Ga0495622_0015732 3300046557 Bacteria 3518
726 Ga0495622_0145857 3300046557 Bacteria 1073
727 Ga0495622_0464518 3300046557 Bacteria 542
728 Ga0495633_0040434 3300046558 Bacteria 2221
729 Ga0495633_0106287 3300046558 Bacteria 1302
730 Ga0495633_0460207 3300046558 Bacteria 574
731 Ga0495667_0000551 3300046559 Bacteria 23946
732 Ga0495667_0060348 3300046559 Bacteria 2487
733 Ga0495656_0070007 3300046615 Bacteria 1555
734 Ga0495656_0239937 3300046615 Bacteria 912
735 Ga0495656_0461313 3300046615 Bacteria 670
736 Ga0495668_0114918 3300046616 Bacteria 1472
737 Ga0495668_0140491 3300046616 Bacteria 1321
738 Ga0495668_0603323 3300046616 Bacteria 606
739 Ga0495668_0647449 3300046616 Bacteria 584
740 Ga0495634_0230125 3300046642 Bacteria 1141
741 Ga0495611_0047537 3300046648 Bacteria 1926
742 Ga0495611_0325785 3300046648 Bacteria 706
743 Ga0495611_0594766 3300046648 Bacteria 500
744 Ga0495625_0234883 3300046660 Bacteria 1196
745 Ga0495625_0381302 3300046660 Bacteria 884
746 Ga0495625_0383761 3300046660 Bacteria 881
747 Ga0495635_0001218 3300046663 Bacteria 17215
748 Ga0495635_0023042 3300046663 Bacteria 4340
749 Ga0495635_0388050 3300046663 Bacteria 929
750 Ga0495659_0006041 3300046664 Bacteria 3828
751 Ga0495659_0110783 3300046664 Bacteria 1072
752 Ga0495661_0249435 3300046665 Bacteria 907
753 Ga0495661_0295438 3300046665 Bacteria 812
754 Ga0495588_0008572 3300046674 Bacteria 4696
755 Ga0495588_0545353 3300046674 Bacteria 608
756 Ga0495657_0019076 3300046675 Bacteria 4953
757 Ga0495657_0131203 3300046675 Bacteria 1569
758 Ga0495599_0009152 3300046678 Bacteria 6041
759 Ga0495599_0125057 3300046678 Bacteria 1598
760 Ga0495599_0545752 3300046678 Bacteria 679
761 Ga0495623_0016600 3300046679 Bacteria 4755
762 Ga0495623_0022621 3300046679 Bacteria 4058
763 Ga0495646_0000643 3300046680 Bacteria 19081
764 Ga0495658_0154848 3300046683 Bacteria 1410
765 Ga0495658_0403890 3300046683 Bacteria 871
766 Ga0495669_0020635 3300046684 Bacteria 2853
767 Ga0495669_0144646 3300046684 Bacteria 1123
768 Ga0495669_0333092 3300046684 Bacteria 733
769 Ga0495669_0359936 3300046684 Bacteria 703
770 Ga0495669_0432748 3300046684 Bacteria 638
771 Ga0495613_0045757 3300046689 Bacteria 3236
772 Ga0495624_0062626 3300046690 Bacteria 2327
773 Ga0495624_0126692 3300046690 Bacteria 1567
774 Ga0495624_0434046 3300046690 Bacteria 787
775 Ga0495624_0674831 3300046690 Bacteria 614
776 Ga0495670_0080754 3300046691 Bacteria 1656
777 Ga0495670_0116066 3300046691 Bacteria 1388
778 Ga0495670_0239019 3300046691 Bacteria 967
779 Ga0495671_0420378 3300046692 Bacteria 639
780 Ga0495671_0435417 3300046692 Bacteria 627
781 Ga0495649_0351810 3300046694 Bacteria 744
782 Ga0495649_0440068 3300046694 Bacteria 652
783 Ga0495649_0603714 3300046694 Bacteria 541
784 Ga0495589_0100555 3300046794 Bacteria 1399
785 Ga0495589_0140556 3300046794 Bacteria 1156
786 Ga0495600_0001007 3300046809 Bacteria 15210
787 Ga0495600_0204018 3300046809 Bacteria 1269
788 Ga0495600_0266369 3300046809 Bacteria 1087
789 Ga0495660_0509809 3300046810 Bacteria 513
790 Ga0495581_0045989 3300047315 Bacteria 2523
791 Ga0495604_0015936 3300047317 Bacteria 6000
792 Ga0495604_0023465 3300047317 Bacteria 4921
793 Ga0495604_0625893 3300047317 Bacteria 688
794 Ga0495636_0129366 3300047318 Bacteria 1122
795 Ga0495636_0620928 3300047318 Bacteria 529
796 Ga0495674_0003683 3300047319 Bacteria 14908
797 Ga0495674_0114961 3300047319 Bacteria 2278
798 Ga0495672_0037809 3300047320 Bacteria 2950
799 Ga0495672_0170661 3300047320 Bacteria 1110
800 Ga0495672_0416072 3300047320 Bacteria 612
801 Ga0495676_0042130 3300047321 Bacteria 3751
802 Ga0495676_0130352 3300047321 Bacteria 1816
803 Ga0495680_0001909 3300047322 Bacteria 21876
804 Ga0495680_0046311 3300047322 Bacteria 3429
805 Ga0495683_0224830 3300047323 Bacteria 835
806 Ga0495675_0001972 3300047444 Bacteria 12248
807 Ga0495675_0011175 3300047444 Bacteria 5630
808 Ga0495677_0106209 3300047445 Bacteria 1065
809 Ga0495679_127596 3300047446 Bacteria 692
810 Ga0495673_0028030 3300047469 Bacteria 2672
811 Ga0495673_0030851 3300047469 Bacteria 2514
812 Ga0495681_0192030 3300047470 Bacteria 833
813 Ga0495684_0000313 3300047471 Bacteria 39705
814 Ga0495684_0035943 3300047471 Bacteria 3798
815 Ga0495686_0075038 3300047472 Bacteria 2074
816 Ga0495686_0335243 3300047472 Bacteria 826
817 Ga0495686_0634235 3300047472 Bacteria 550
818 Ga0495593_0001524 3300047673 Bacteria 13627
819 Ga0495593_0128564 3300047673 Bacteria 1287
820 Ga0495602_0050780 3300048088 Bacteria 3702
821 Ga0495602_0059972 3300048088 Bacteria 3318
822 Ga0495614_0024394 3300048089 Bacteria 2611
823 Ga0495615_0206356 3300048090 Bacteria 608
824 Ga0495626_0104917 3300048091 Bacteria 1229
825 Ga0495626_0200604 3300048091 Bacteria 818
826 Ga0496100_0087995 3300048903 Bacteria 2113
827 Ga0496100_0139318 3300048903 Bacteria 1717
828 Ga0496101_0027335 3300048904 Bacteria 3974
829 Ga0496101_0046806 3300048904 Bacteria 3103
830 Ga0496102_0011927 3300048905 Bacteria 7505
831 Ga0496102_0049981 3300048905 Bacteria 3806
832 Ga0496102_0123428 3300048905 Bacteria 2420
833 Ga0496102_0165118 3300048905 Bacteria 2083
834 Ga0496102_0223293 3300048905 Bacteria 1776
835 Ga0496103_0041533 3300048906 Bacteria 2827
836 Ga0496103_0359980 3300048906 Bacteria 935
837 Ga0496103_0580446 3300048906 Bacteria 715
838 Ga0496104_0049045 3300048907 Bacteria 3982
839 Ga0496104_0059609 3300048907 Bacteria 3613
840 Ga0496104_0104080 3300048907 Bacteria 2719
841 Ga0496104_0234039 3300048907 Bacteria 1749
842 Ga0496105_0085784 3300048908 Bacteria 2602
843 Ga0496105_0110428 3300048908 Bacteria 2270
844 Ga0496105_0275606 3300048908 Bacteria 1357
845 Ga0496105_0413318 3300048908 Bacteria 1069
846 Ga0496105_0535321 3300048908 Bacteria 916
847 Ga0496105_0598519 3300048908 Bacteria 856
848 Ga0496105_0803467 3300048908 Bacteria 715
849 Ga0496106_0037784 3300048909 Bacteria 3612
850 Ga0496106_0052259 3300048909 Bacteria 3082
851 Ga0496106_0294060 3300048909 Bacteria 1302
852 Ga0496106_0627129 3300048909 Bacteria 860
853 Ga0496106_0877008 3300048909 Bacteria 709
854 Ga0496106_1091148 3300048909 Bacteria 626
855 Ga0496107_0002944 3300048910 Bacteria 11270
856 Ga0496107_0012539 3300048910 Bacteria 5917
857 Ga0496107_0288009 3300048910 Bacteria 1222
858 Ga0496107_0415006 3300048910 Bacteria 1001
859 Ga0496107_0815124 3300048910 Bacteria 683
860 Ga0496108_0050424 3300048911 Bacteria 3484
861 Ga0496108_0102539 3300048911 Bacteria 2441
862 Ga0496108_0117623 3300048911 Bacteria 2277
863 Ga0496108_0852630 3300048911 Bacteria 784
864 Ga0496109_0009866 3300048912 Bacteria 8152
865 Ga0496109_0035253 3300048912 Bacteria 4512
866 Ga0496109_0050985 3300048912 Bacteria 3769
867 Ga0496109_0721443 3300048912 Bacteria 934
868 Ga0496110_0122513 3300048913 Bacteria 2344
869 Ga0496110_0165944 3300048913 Bacteria 2002
870 Ga0496110_0248028 3300048913 Bacteria 1620
871 Ga0496110_0355700 3300048913 Bacteria 1334
872 Ga0496110_0491122 3300048913 Bacteria 1118
873 Ga0496110_0665390 3300048913 Bacteria 942
874 Ga0496110_1106760 3300048913 Bacteria 700
875 Ga0496110_1140543 3300048913 Bacteria 688
876 Ga0496111_0050121 3300048914 Bacteria 3010
877 Ga0496111_0050303 3300048914 Bacteria 3006
878 Ga0496111_0145014 3300048914 Bacteria 1760
879 Ga0496111_0155083 3300048914 Bacteria 1699
880 Ga0496111_0260027 3300048914 Bacteria 1288
881 Ga0496111_0548895 3300048914 Bacteria 848
882 Ga0496111_0880681 3300048914 Bacteria 645
883 Ga0496112_0001974 3300048915 Bacteria 16209
884 Ga0496112_0014051 3300048915 Bacteria 7412
885 Ga0496112_0028765 3300048915 Bacteria 5368
886 Ga0496112_0186304 3300048915 Bacteria 2038
887 Ga0496112_0219897 3300048915 Bacteria 1855
888 Ga0496112_0237027 3300048915 Bacteria 1778
889 Ga0496113_0013547 3300048916 Bacteria 5531
890 Ga0496113_0050127 3300048916 Bacteria 3111
891 Ga0496113_0251019 3300048916 Bacteria 1412
892 Ga0496113_0274424 3300048916 Bacteria 1348
893 Ga0496114_0080131 3300048917 Bacteria 2757
894 Ga0496114_0932388 3300048917 Bacteria 750
895 Ga0496114_1593423 3300048917 Bacteria 541
896 Ga0496115_0003266 3300048918 Bacteria 11628
897 Ga0496115_0032667 3300048918 Bacteria 4106
898 Ga0496115_0193576 3300048918 Bacteria 1680
899 Ga0496115_0223229 3300048918 Bacteria 1555
900 Ga0496115_0256728 3300048918 Bacteria 1438
901 Ga0496115_0260811 3300048918 Bacteria 1425
902 Ga0496115_0268189 3300048918 Bacteria 1403
903 Ga0496115_0853393 3300048918 Bacteria 705
904 Ga0496115_0937074 3300048918 Bacteria 666
905 Ga0496116_0323335 3300048919 Bacteria 721
906 Ga0496117_0195191 3300048920 Bacteria 1149
907 Ga0496117_0356569 3300048920 Bacteria 753
908 Ga0496117_0406694 3300048920 Bacteria 685
909 Ga0496119_0139958 3300048922 Bacteria 1308
910 Ga0496119_0176977 3300048922 Bacteria 1122
911 Ga0496119_0306434 3300048922 Bacteria 781
912 Ga0496119_0420303 3300048922 Bacteria 635
913 Ga0496121_0039609 3300048924 Bacteria 4148
914 Ga0496121_0086669 3300048924 Bacteria 2460
915 Ga0496121_0100066 3300048924 Bacteria 2238
916 Ga0496121_0147348 3300048924 Bacteria 1737
917 Ga0496121_0214125 3300048924 Bacteria 1362
918 Ga0496124_0671010 3300048927 Bacteria 662
919 Ga0496125_0130928 3300048928 Bacteria 1766
920 Ga0496126_0007843 3300048929 Bacteria 11636
921 Ga0496126_0030834 3300048929 Bacteria 5075
922 Ga0496126_0031354 3300048929 Bacteria 5024
923 Ga0496126_0121393 3300048929 Bacteria 2265
924 Ga0496126_0166479 3300048929 Bacteria 1881
925 Ga0496126_0407442 3300048929 Bacteria 1101
926 Ga0496126_0452718 3300048929 Bacteria 1033
927 Ga0496126_0722205 3300048929 Bacteria 772
928 Ga0495682_0155730 3300049460 Bacteria 814
929 Ga0501032_0019827 3300049569 Bacteria 4695
930 Ga0501032_0227629 3300049569 Bacteria 1212
931 Ga0501032_0664431 3300049569 Bacteria 661
932 Ga0501034_0697001 3300049571 Bacteria 914
933 Ga0501034_0776041 3300049571 Bacteria 852
934 Ga0501036_0103183 3300049572 Bacteria 2412
935 Ga0501037_0580240 3300049573 Bacteria 754
936 Ga0501038_0083459 3300049574 Bacteria 2689
937 Ga0501038_0531410 3300049574 Bacteria 896
938 Ga0501039_0193009 3300049575 Bacteria 1601
939 Ga0501039_0244298 3300049575 Bacteria 1411
940 Ga0501047_0124847 3300049581 Bacteria 2454
941 Ga0501047_1158453 3300049581 Bacteria 586
942 Ga0501067_0080761 3300049583 Bacteria 1802
943 Ga0501067_0110475 3300049583 Bacteria 1528
944 Ga0501068_0036146 3300049584 Bacteria 2952
945 Ga0501068_0345611 3300049584 Bacteria 956
946 Ga0501069_0023410 3300049585 Bacteria 3368
947 Ga0501069_0258501 3300049585 Bacteria 1016
948 Ga0501072_0444037 3300049588 Bacteria 1027
949 Ga0501073_0063515 3300049589 Bacteria 2575
950 Ga0501076_0260681 3300049592 Bacteria 1419
951 Ga0501079_0822338 3300049741 Bacteria 731
952 Ga0501080_0234585 3300049742 Bacteria 1676
953 Ga0501081_0603531 3300049743 Bacteria 822
954 Ga0501083_0036945 3300049744 Bacteria 3328
955 Ga0501035_0044770 3300049822 Bacteria 3983
956 Ga0501035_0152365 3300049822 Bacteria 2005
957 Ga0501044_0130692 3300049823 Bacteria 2505
958 Ga0501045_0005982 3300049824 Bacteria 8415
959 Ga0501045_1376484 3300049824 Bacteria 513
960 nmdc:mga03683_203155_c1 3300050489 Bacteria 910
961 nmdc:mga03683_221246_c1 3300050489 Bacteria 873
962 nmdc:mga03683_26211_c1 3300050489 Bacteria 2298
963 nmdc:mga03n38_25130_c1 3300050490 Bacteria 2442
964 nmdc:mga03n38_253802_c1 3300050490 Bacteria 930
965 nmdc:mga00v17_388333_c1 3300050491 Bacteria 907
966 nmdc:mga00v17_75943_c1 3300050491 Bacteria 2090
967 nmdc:mga00v17_85112_c1 3300050491 Bacteria 1980
968 nmdc:mga0yw44_216206_c1 3300050492 Bacteria 1269
969 nmdc:mga0yw44_415260_c1 3300050492 Bacteria 911
970 nmdc:mga0yw44_55596_c1 3300050492 Bacteria 2409
971 nmdc:mga0yw44_800725_c1 3300050492 Bacteria 640
972 nmdc:mga0k408_139477_c1 3300050493 Bacteria 1442
973 nmdc:mga06z11_189952_c1 3300050494 Bacteria 1189
974 nmdc:mga06z11_312960_c1 3300050494 Bacteria 935
975 nmdc:mga06z11_33726_c1 3300050494 Bacteria 2507
976 nmdc:mga06z11_635642_c1 3300050494 Bacteria 650
977 nmdc:mga07m45_19967_c1 3300050496 Bacteria 3636
978 nmdc:mga07m45_38992_c1 3300050496 Bacteria 2654
979 nmdc:mga07m45_55869_c1 3300050496 Bacteria 2231
980 nmdc:mga05p37_102181_c1 3300050507 Bacteria 3530
981 nmdc:mga0qj67_533055_c1 3300050509 Bacteria 942
982 nmdc:mga08y16_15164_c1 3300050511 Bacteria 8103
983 nmdc:mga0n895_69515_c1 3300050512 Bacteria 3489
984 nmdc:mga0rr50_179637_c1 3300050513 Bacteria 1729
985 nmdc:mga0rr50_308324_c2 3300050513 Bacteria 1012
986 nmdc:mga08x19_140497_c1 3300050514 Bacteria 1631
987 nmdc:mga0a205_134118_c1 3300050515 Bacteria 2018
988 nmdc:mga0sz30_21935_c1 3300050516 Bacteria 2589
989 nmdc:mga0sz30_255674_c1 3300050516 Bacteria 780
990 nmdc:mga0sz30_48450_c1 3300050516 Bacteria 1798
991 Ga0495601_0054219 3300053077 Bacteria 2536
992 Ga0495601_0311791 3300053077 Bacteria 1025
993 Ga0495612_0016378 3300053078 Bacteria 2971
994 Ga0500610_0117724 3300053079 Bacteria 1361
995 Ga0500635_0153508 3300053080 Bacteria 880
996 Ga0495655_0051461 3300053083 Bacteria 1092
997 Ga0495655_0178933 3300053083 Bacteria 683
998 Ga0495595_0000445 3300053084 Bacteria 15683
999 Ga0495595_0054813 3300053084 Bacteria 1854
1000 Ga0495619_0001995 3300053085 Bacteria 13585
1001 Ga0495619_0084768 3300053085 Bacteria 2139
1002 Ga0500643_027818 3300053087 Bacteria 1753
1003 Ga0500581_258691 3300053089 Bacteria 724
1004 Ga0500646_0279689 3300053090 Bacteria 594
1005 Ga0500650_0212604 3300053098 Bacteria 878
1006 Ga0500650_0250963 3300053098 Bacteria 794
1007 Ga0500554_003817 3300053102 Bacteria 3121
1008 Ga0500554_017215 3300053102 Bacteria 1927
1009 Ga0500582_161701 3300053114 Bacteria 770
1010 Ga0500592_043676 3300053116 Bacteria 726
1011 Ga0500595_000477 3300053119 Bacteria 24734
1012 Ga0500595_028055 3300053119 Bacteria 1921
1013 Ga0500617_206272 3300053124 Bacteria 715
1014 Ga0500621_175371 3300053126 Bacteria 782
1015 Ga0500658_0297115 3300053134 Bacteria 742
1016 Ga0500658_0317980 3300053134 Bacteria 715
1017 Ga0500588_0114309 3300053146 Bacteria 945
1018 Ga0500589_064971 3300053147 Bacteria 1664
1019 Ga0500589_133161 3300053147 Bacteria 1035
1020 Ga0500589_206025 3300053147 Bacteria 751
1021 Ga0500589_266318 3300053147 Bacteria 621
1022 Ga0500590_335920 3300053148 Bacteria 548
1023 Ga0500603_028836 3300053150 Bacteria 1419
1024 Ga0500622_0051250 3300053156 Bacteria 2125
1025 Ga0500627_0145273 3300053158 Bacteria 1071
1026 Ga0500633_0146917 3300053160 Bacteria 883
1027 Ga0500634_0208305 3300053161 Bacteria 851
1028 Ga0500638_011253 3300053162 Bacteria 3961
1029 Ga0500636_0070176 3300053177 Bacteria 2033
1030 Ga0500637_0010152 3300053178 Bacteria 4822
1031 Ga0500637_0011408 3300053178 Bacteria 4594
1032 Ga0500645_159327 3300053730 Bacteria 619
1033 Ga0500609_015338 3300053731 Bacteria 1037
1034 Ga0501084_0309355 3300054114 Bacteria 1334
1035 Ga0500661_002168 3300055283 Bacteria 3704
1036 Ga0501082_0988906 3300060353 Bacteria 736
1037 Ga0501082_1215592 3300060353 Bacteria 658
1038 Ga0530510_0616412 3300061734 Bacteria 826
1039 Ga0530510_0853936 3300061734 Bacteria 695
1040 2513674579 2513237098 Bacteria 9902361
1041 2513695121 2513237101 Bacteria 7952346
1042 2671122457 2667528175 Bacteria 7532676
1043 2723841652 2721755755 Bacteria 8322773
1044 2728755000 2728368998 Bacteria 8720350
1045 2793081066
1046 2874608055 2874604998 Bacteria 7834745
1047 2876815495 2876808645 Bacteria 8824342
1048 2879112180 2879110137 Bacteria 8907982
1049 2889035480 2889033259 Bacteria 9099371
1050 2903751484 2903748898 Bacteria 9972761
1051 2903771850 2903768456 Bacteria 9749579
1052 2906613884
1053 2908747454 2908739725 Bacteria 8628932
1054 2922363991 2922361189 Bacteria 7436256
1055 2922392575 2922386360 Bacteria 7017218
1056 2935636530 2935630451 Bacteria 8169952
1057 2941513165 2941507105 Bacteria 8166816
1058 2941521180 2941515067 Bacteria 8166720
1059 2941528883 2941523033 Bacteria 8169134
1060 3005475073 3005474847 Bacteria 9259049
1061 8006967466 8006964411 Bacteria 8966052
1062 8006990931 8006984368 Bacteria 9651211
1063 8006996502 8006994254 Bacteria 8309700
1064 8019572492 8019565922 Bacteria 9639779
1065 8056675752 8056673599 Bacteria 7871253
1066 Ga0075368_10083281
1067 JGI25406J46586_10005031
1068 JGI25165J46597_1022757
1069 JGI25404J52841_10001308
1070 JGI25405J52794_10026811
1071 Ga0065715_10043807
1072 Ga0070683_100057276
1073 Ga0070670_100476247
1074 Ga0070677_10344105
1075 Ga0068869_100101991
1076 Ga0068869_100229449
1077 Ga0068869_100340376
1078 Ga0068869_100498288
1079 Ga0070666_10161456
1080 Ga0070666_10488888
1081 Ga0070680_100054700
1082 Ga0070682_100055337
1083 Ga0068868_100019711
1084 Ga0068868_100022147
1085 Ga0068868_100319979
1086 Ga0068868_100641910
1087 Ga0068868_100847586
1088 Ga0070660_100036213
1089 Ga0070660_100406858
1090 Ga0070689_100355605
1091 Ga0070687_100480020
1092 Ga0070661_100039129
1093 Ga0070661_100139697
1094 Ga0070668_100096268
1095 Ga0070668_100100324
1096 Ga0070668_100291344
1097 Ga0070668_100493975
1098 Ga0070668_100588024
1099 Ga0070668_100668867
1100 Ga0070668_101115051
1101 Ga0070668_101217857
1102 Ga0070668_101427324
1103 Ga0070669_100190221
1104 Ga0070669_101073698
1105 Ga0070675_100283247
1106 Ga0070675_100328839
1107 Ga0070671_100189782
1108 Ga0070671_100511413
1109 Ga0070671_100575055
1110 Ga0070674_100080106
1111 Ga0070674_100242257
1112 Ga0070673_100075656
1113 Ga0070673_100205132
1114 Ga0070688_100368798
1115 Ga0070659_100083150
1116 Ga0070659_100090516
1117 Ga0070659_100628436
1118 Ga0070659_100837153
1119 Ga0070667_100339874
1120 Ga0070709_10001880
1121 Ga0070709_10251445
1122 Ga0070709_10558577
1123 Ga0070714_100166014
1124 Ga0070714_100938018
1125 Ga0070713_100003661
1126 Ga0070713_100254527
1127 Ga0070713_100432354
1128 Ga0070710_10001236
1129 Ga0070710_10767458
1130 Ga0070701_10046388
1131 Ga0070711_100000660
1132 Ga0070694_100190827
1133 Ga0070663_100004283
1134 Ga0070663_100006019
1135 Ga0070663_100041490
1136 Ga0070663_100106616
1137 Ga0070663_100145967
1138 Ga0070663_100513745
1139 Ga0070678_100101607
1140 Ga0070678_100155518
1141 Ga0070678_100239872
1142 Ga0070678_100463077
1143 Ga0070662_100068881
1144 Ga0070662_100568075
1145 Ga0070681_10041351
1146 Ga0070685_10197790
1147 Ga0070685_10299751
1148 Ga0070707_100247197
1149 Ga0070698_100250562
1150 Ga0070698_100679092
1151 Ga0070699_100747027
1152 Ga0070679_100044363
1153 Ga0070679_100137917
1154 Ga0070679_101313556
1155 Ga0070684_100013455
1156 Ga0070697_100040762
1157 Ga0070697_100164270
1158 Ga0068853_100012684
1159 Ga0068853_100320184
1160 Ga0068853_100409342
1161 Ga0068853_100438174
1162 Ga0070672_100111060
1163 Ga0070686_100156329
1164 Ga0070686_100695189
1165 Ga0070695_100460213
1166 Ga0070695_100963103
1167 Ga0070696_100326881
1168 Ga0070696_100781622
1169 Ga0070693_100030109
1170 Ga0070693_100820982
1171 Ga0070665_100024472
1172 Ga0070665_100039914
1173 Ga0070665_100171968
1174 Ga0070665_100217866
1175 Ga0070665_100600358
1176 Ga0070665_100860059
1177 Ga0070665_101112290
1178 Ga0070665_101374247
1179 Ga0070704_100329757
1180 Ga0068855_100152875
1181 Ga0068855_100325655
1182 Ga0068855_100805940
1183 Ga0070664_100226362
1184 Ga0070664_101090609
1185 Ga0068857_100018485
1186 Ga0068857_100300019
1187 Ga0068857_100744212
1188 Ga0068854_100103682
1189 Ga0068854_101170817
1190 Ga0068856_100187404
1191 Ga0068856_100342633
1192 Ga0070702_100030607
1193 Ga0070702_100463897
1194 Ga0068852_100061074
1195 Ga0068852_100283593
1196 Ga0068852_100437310
1197 Ga0068859_100143978
1198 Ga0068859_100163963
1199 Ga0068859_100285767
1200 Ga0068859_100387875
1201 Ga0068864_100215262
1202 Ga0068864_100470018
1203 Ga0068866_10223485
1204 Ga0068861_100278047
1205 Ga0068861_101297616
1206 Ga0068851_10011859
1207 Ga0068851_10219431
1208 Ga0068851_10387661
1209 Ga0068863_100232337
1210 Ga0068863_100333555
1211 Ga0068863_101461091
1212 Ga0068858_100016049
1213 Ga0068858_100057164
1214 Ga0068858_100425075
1215 Ga0068858_101043936
1216 Ga0068860_100086214
1217 Ga0068860_100326155
1218 Ga0068862_100351637
1219 Ga0081455_10005984
1220 Ga0081455_10008111
1221 Ga0081455_10011164
1222 Ga0081455_10028676
1223 Ga0081455_10277173
1224 Ga0081455_10296594
1225 Ga0081538_10031555
1226 Ga0081540_1001950
1227 Ga0081540_1013355
1228 Ga0081540_1015913
1229 Ga0081540_1022081
1230 Ga0081540_1023147
1231 Ga0081540_1025816
1232 Ga0081540_1059141
1233 Ga0081540_1080759
1234 Ga0081540_1096413
1235 Ga0081540_1209291
1236 Ga0081539_10001064
1237 Ga0081539_10158403
1238 Ga0070717_10104664
1239 Ga0075368_10036443
1240 Ga0075363_100036055
1241 Ga0075363_100252532
1242 Ga0075364_10535182
1243 Ga0070715_10000108
1244 Ga0070715_10061039
1245 Ga0070716_100003373
1246 Ga0070716_100081143
1247 Ga0070716_101381619
1248 Ga0070712_100175596
1249 Ga0075362_10110465
1250 Ga0075362_10175531
1251 Ga0075362_10194650
1252 Ga0075367_10019052
1253 Ga0075367_10584169
1254 Ga0075369_10065526
1255 Ga0075369_10091113
1256 Ga0075369_10120898
1257 Ga0075369_10285141
1258 Ga0075366_10263289
1259 Ga0075366_10378298
1260 Ga0097621_100059415
1261 Ga0097621_100356720
1262 Ga0097621_100562793
1263 Ga0097621_101578693
1264 Ga0075370_10101372
1265 Ga0075370_10298076
1266 Ga0075370_10309862
1267 Ga0075370_10655801
1268 Ga0068871_100274748
1269 Ga0068871_100697797
1270 Ga0075428_100085123
1271 Ga0075430_100416688
1272 Ga0075433_10113605
1273 Ga0075434_100071865
1274 Ga0075434_101486958
1275 Ga0068865_100137618
1276 Ga0075436_100065143
1277 Ga0097620_100143973
1278 Ga0097620_100163966
1279 Ga0097620_100285751
1280 Ga0097620_100387894
1281 Ga0099825_1041366
1282 Ga0099824_1013118
1283 Ga0099822_1000007
1284 Ga0075435_100022140
1285 Ga0075435_101589091
1286 Ga0099794_10003899
1287 Ga0099794_10022739
1288 Ga0099794_10071677
1289 Ga0099794_10280335
1290 Ga0099795_10004002
1291 Ga0099795_10025241
1292 Ga0099795_10385447
1293 Ga0105250_10031767
1294 Ga0105250_10309136
1295 Ga0105240_10013534
1296 Ga0105240_10465454
1297 Ga0105240_12409352
1298 Ga0105245_10305400
1299 Ga0105245_10986325
1300 Ga0105245_11532193
1301 Ga0105245_11895014
1302 Ga0105247_10148239
1303 Ga0105247_10231821
1304 Ga0114129_10144590
1305 Ga0114129_12077105
1306 Ga0105243_10340224
1307 Ga0105243_10665406
1308 Ga0105243_11826886
1309 Ga0105243_12315773
1310 Ga0105243_12826006
1311 Ga0105241_10241838
1312 Ga0105241_10888921
1313 Ga0105242_10405567
1314 Ga0105242_10689974
1315 Ga0105242_11578412
1316 Ga0105248_10403979
1317 Ga0105237_10017081
1318 Ga0105237_10022854
1319 Ga0105237_10291074
1320 Ga0105237_10437709
1321 Ga0105237_11123598
1322 Ga0105237_11415667
1323 Ga0105238_10160027
1324 Ga0105238_10284200
1325 Ga0105238_10656870
1326 Ga0105238_11001183
1327 Ga0105249_10058990
1328 Ga0105249_11057152
1329 Ga0105249_11292009
1330 Ga0105249_11546025
1331 Ga0099796_10070681
1332 Ga0099796_10262636
1333 Ga0099796_10288461
1334 Ga0099796_10479453
1335 Ga0105239_10031640
1336 Ga0105239_10327997
1337 Ga0105239_10337166
1338 Ga0105239_10582750
1339 Ga0105239_11077120
1340 Ga0105246_10029026
1341 Ga0105246_10145415
1342 Ga0105246_10617184
1343 Ga0157317_1006476
1344 Ga0157370_10057525
1345 Ga0157370_10157802
1346 Ga0157369_10057884
1347 Ga0157374_10028269
1348 Ga0157374_10036000
1349 Ga0157374_10785472
1350 Ga0157378_10232684
1351 Ga0157378_10254811
1352 Ga0157378_10457022
1353 Ga0157378_12241853
1354 Ga0163162_10043869
1355 Ga0163162_10372823
1356 Ga0163162_10677893
1357 Ga0163162_10812570
1358 Ga0163162_11198528
1359 Ga0157372_11771564
1360 Ga0157372_12521854
1361 Ga0157375_10508577
1362 Ga0157375_12214709
1363 Ga0163163_10002009
1364 Ga0163163_10078671
1365 Ga0163163_10779476
1366 Ga0157380_10644389
1367 Ga0157380_10892325
1368 Ga0157380_10971924
1369 Ga0157377_10136398
1370 Ga0157377_10583519
1371 Ga0157377_10909713
1372 Ga0157377_10927522
1373 Ga0157379_10018063
1374 Ga0157379_10595404
1375 Ga0157379_10613719
1376 Ga0157379_11638325
1377 Ga0157379_11746039
1378 Ga0157376_10017044
1379 Ga0157376_10138313
1380 Ga0157376_10344822
1381 Ga0157376_10490967
1382 Ga0163161_10558273
1383 Ga0163161_10912093
1384 Ga0213873_10002209
1385 Ga0213872_10070436
1386 Ga0213872_10344068
1387 Ga0213874_10006326
1388 Ga0213876_10005462
1389 Ga0213876_10071525
1390 Ga0209233_1001514
1391 Ga0209758_1003344
1392 Ga0209758_1015313
1393 Ga0207697_10025606
1394 Ga0207656_10084455
1395 Ga0207656_10153819
1396 Ga0207653_10054382
1397 Ga0207682_10185059
1398 Ga0207692_10000829
1399 Ga0207710_10336767
1400 Ga0207688_10139410
1401 Ga0207688_10152616
1402 Ga0207688_10167449
1403 Ga0207688_10171453
1404 Ga0207680_10363416
1405 Ga0207680_10476161
1406 Ga0207647_10155427
1407 Ga0207685_10001367
1408 Ga0207685_10164329
1409 Ga0207685_10199366
1410 Ga0207699_10004989
1411 Ga0207645_10043296
1412 Ga0207643_10273737
1413 Ga0207705_10244175
1414 Ga0207654_10269225
1415 Ga0207654_10735191
1416 Ga0207707_10004934
1417 Ga0207707_10105415
1418 Ga0207695_10033471
1419 Ga0207695_10151832
1420 Ga0207671_10033557
1421 Ga0207671_10045233
1422 Ga0207671_10047548
1423 Ga0207671_10063451
1424 Ga0207671_10083371
1425 Ga0207671_10543341
1426 Ga0207693_10000310
1427 Ga0207693_10005993
1428 Ga0207693_10036014
1429 Ga0207693_10847462
1430 Ga0207663_10000230
1431 Ga0207663_10009652
1432 Ga0207663_10730238
1433 Ga0207660_10011652
1434 Ga0207660_10064010
1435 Ga0207662_10077673
1436 Ga0207657_10022864
1437 Ga0207657_10229612
1438 Ga0207649_10101458
1439 Ga0207649_10132939
1440 Ga0207649_11358260
1441 Ga0207652_10002828
1442 Ga0207652_10175637
1443 Ga0207681_10178556
1444 Ga0207694_10048946
1445 Ga0207694_10199304
1446 Ga0207694_10201814
1447 Ga0207650_10191966
1448 Ga0207650_10603275
1449 Ga0207659_11421753
1450 Ga0207687_10066362
1451 Ga0207687_10294416
1452 Ga0207687_10845203
1453 Ga0207687_11246467
1454 Ga0207700_10021866
1455 Ga0207700_10076835
1456 Ga0207700_10113880
1457 Ga0207700_11027583
1458 Ga0207700_11693477
1459 Ga0207664_10001147
1460 Ga0207664_10289562
1461 Ga0207664_11517751
1462 Ga0207644_10105890
1463 Ga0207644_10394385
1464 Ga0207644_10458984
1465 Ga0207644_11030039
1466 Ga0207690_10779457
1467 Ga0207706_10183747
1468 Ga0207706_10422850
1469 Ga0207669_10627604
1470 Ga0207704_10026355
1471 Ga0207665_10003377
1472 Ga0207665_10028331
1473 Ga0207665_10410649
1474 Ga0207665_10750668
1475 Ga0207665_11041790
1476 Ga0207691_10172349
1477 Ga0207691_10579060
1478 Ga0207691_10596088
1479 Ga0207711_10108773
1480 Ga0207689_10299334
1481 Ga0207689_10662279
1482 Ga0207689_10667697
1483 Ga0207689_10828033
1484 Ga0207689_11011769
1485 Ga0207661_10621100
1486 Ga0207661_11140644
1487 Ga0207679_10188478
1488 Ga0207667_10033916
1489 Ga0207667_10046837
1490 Ga0207667_10323540
1491 Ga0207667_10725976
1492 Ga0207667_10736403
1493 Ga0207651_11685075
1494 Ga0207668_10084474
1495 Ga0207668_10229600
1496 Ga0207668_10269628
1497 Ga0207668_11075907
1498 Ga0207668_11323720
1499 Ga0207640_10578462
1500 Ga0207658_10377977
1501 Ga0207677_10846895
1502 Ga0207677_10950800
1503 Ga0207703_10460605
1504 Ga0207703_10546886
1505 Ga0207703_11102772
1506 Ga0207639_10020456
1507 Ga0207639_10585829
1508 Ga0207639_10804131
1509 Ga0207678_10003936
1510 Ga0207678_10038029
1511 Ga0207678_10060441
1512 Ga0207678_10111318
1513 Ga0207678_10276024
1514 Ga0207678_10285739
1515 Ga0207678_10801106
1516 Ga0207678_10811112
1517 Ga0207708_10150915
1518 Ga0207702_10258568
1519 Ga0207641_10052079
1520 Ga0207641_10157936
1521 Ga0207676_10118741
1522 Ga0207676_10183336
1523 Ga0207676_10470385
1524 Ga0207676_10526692
1525 Ga0207676_11857207
1526 Ga0207674_10035377
1527 Ga0207674_10243898
1528 Ga0207675_100150426
1529 Ga0207675_100868222
1530 Ga0207675_101811801
1531 Ga0207683_10046557
1532 Ga0207683_10302354
1533 Ga0207683_10344193
1534 Ga0207683_10377084
1535 Ga0207698_10245737
1536 Ga0207698_10360493
1537 Ga0209589_1000021
1538 Ga0209489_100028
1539 Ga0209700_100037
1540 Ga0209179_1021592
1541 Ga0209179_1036546
1542 Ga0209179_1039240
1543 Ga0209588_1009657
1544 Ga0268266_10001190
1545 Ga0268266_10026628
1546 Ga0268266_10136800
1547 Ga0268266_10177059
1548 Ga0268266_10244142
1549 Ga0268266_10464199
1550 Ga0268265_10108354
1551 Ga0268265_10673746
1552 Ga0268265_10938787
1553 Ga0268264_10838001
1554 Ga0268264_11260465
1555 Ga0265334_10011626
1556 Ga0307517_10144360
1557 Ga0307515_10117765
1558 Ga0307515_10355136
1559 Ga0307515_10536209
1560 Ga0307512_10213162
1561 Ga0265330_10032679
1562 Ga0265332_10032204
1563 Ga0265331_10115739
1564 Ga0307513_10079098
1565 Ga0307513_10124353
1566 Ga0307513_10289279
1567 Ga0307513_10296134
1568 Ga0307509_10109035
1569 Ga0307408_100680306
1570 Ga0307408_101597115
1571 Ga0307408_101618310
1572 Ga0307408_101759614
1573 Ga0307408_101947593
1574 Ga0307508_10000002
1575 Ga0307508_10392970
1576 Ga0307508_10616974
1577 Ga0265314_10078677
1578 Ga0265342_10005840
1579 Ga0307516_10026599
1580 Ga0307516_10055776
1581 Ga0307516_10073131
1582 Ga0307516_10407746
1583 Ga0307413_10061383
1584 Ga0307406_10037569
1585 Ga0307406_10281523
1586 Ga0307406_10302761
1587 Ga0307407_10388790
1588 Ga0307407_10414938
1589 Ga0307412_10156128
1590 Ga0307412_10408085
1591 Ga0307412_12278855
1592 Ga0307416_100466527
1593 Ga0307416_101921018
1594 Ga0307416_102134282
1595 Ga0307414_10079957
1596 Ga0307414_11540638
1597 Ga0307411_10175504
1598 Ga0307415_100039787
1599 Ga0307415_101799059
1600 Ga0307507_10334425
1601 Ga0307510_10016711
1602 Ga0307510_10018241
1603 Ga0307510_10090848
1604 Ga0373930_0015324
1605 Ga0373930_0071943
1606 Ga0373938_0089022
1607 Ga0373934_0001837
1608 Ga0373940_0018427
1609 Ga0373949_0160911
1610 Ga0373923_0000584
1611 Ga0373932_0007741
1612 Ga0373932_0040581
1613 Ga0373936_0037608
1614 Ga0373936_0072456
1615 Ga0373953_0004679
1616 Ga0373953_0005933
1617 Ga0373953_0088641
1618 Ga0373954_0000457
1619 Ga0373954_0003801
1620 Ga0373954_0314106
1621 Ga0373956_0002647
1622 Ga0373956_0095376
1623 Ga0373957_0004514
1624 Ga0373957_0091627
1625 Ga0373943_0706600
1626 Ga0373946_0157220
1627 Ga0373946_0698539
1628 Ga0373955_0001753
1629 Ga0373955_1037096
1630 Ga0373942_0174898
1631 Ga0373942_0261773
1632 Ga0373962_0166982
1633 Ga0373924_0000541
1634 Ga0373931_0003137
1635 Ga0373931_0035089
1636 Ga0373931_0093843
1637 Ga0373931_0208930
1638 Ga0373935_0750917
1639 Ga0373927_0004813
1640 Ga0373927_0068940
1641 Ga0373927_0321833
1642 Ga0373927_0382760
1643 Ga0373927_0944146
1644 Ga0373933_0004255
1645 Ga0373933_0015606
1646 Ga0373933_0413936
1647 Ga0373933_0847308
1648 Ga0373947_0018758
1649 Ga0373947_0053711
1650 Ga0373937_0007949
1651 Ga0373937_0060148
1652 Ga0373937_0413087
1653 Ga0373925_0020848
1654 Ga0373925_0322393
1655 Ga0373925_0755909
1656 Ga0395898_0192439
1657 Ga0395905_0045415
1658 Ga0395901_0108441
1659 Ga0436365_0147971
1660 Ga0436365_0725440
1661 Ga0436365_0870281
1662 Ga0436365_1521235
1663 Ga0436360_0049247
1664 Ga0436361_1075147
1665 Ga0436361_1180359
1666 Ga0436363_0125979
1667 Ga0436363_0449948
1668 Ga0436363_0859709
1669 Ga0436362_0490728
1670 Ga0439461_0215132
1671 Ga0451793_1519244
1672 Ga0451800_1461880
1673 Ga0451802_1581769
1674 Ga0451807_0100949
1675 Ga0451807_0551131
1676 Ga0451853_0276032
1677 Ga0451853_2010475
1678 Ga0439431_0058714
1679 Ga0439458_0105670
1680 Ga0466969_0500927
1681 Ga0466966_0143026
1682 Ga0466963_0195311
1683 Ga0466964_0299525
1684 Ga0466957_0206439
1685 Ga0466959_0095420
1686 Ga0466959_0175405
1687 Ga0466958_0070229
1688 Ga0495617_115334
1689 Ga0495592_0005520
1690 Ga0495592_0017032
1691 Ga0495592_0548530
1692 Ga0495603_0009420
1693 Ga0495603_0031353
1694 Ga0495603_0032179
1695 Ga0495603_0182138
1696 Ga0495603_0251264
1697 Ga0495603_0286546
1698 Ga0495590_0196847
1699 Ga0495629_0000124
1700 Ga0495629_0019538
1701 Ga0495629_0205127
1702 Ga0495629_0322325
1703 Ga0495629_0680707
1704 Ga0495638_0068701
1705 Ga0495638_0143782
1706 Ga0495638_0561132
1707 Ga0495641_0114432
1708 Ga0495651_0038303
1709 Ga0495651_0041553
1710 Ga0495651_0048532
1711 Ga0495653_0018700
1712 Ga0495650_0044302
1713 Ga0495650_0149724
1714 Ga0495580_0173040
1715 Ga0495580_0640376
1716 Ga0495582_0216236
1717 Ga0495605_0074128
1718 Ga0495605_0353624
1719 Ga0495639_0010176
1720 Ga0495639_0011821
1721 Ga0495639_0175348
1722 Ga0495664_0186020
1723 Ga0495664_0552547
1724 Ga0495584_0154657
1725 Ga0495584_0260805
1726 Ga0495584_0315505
1727 Ga0495584_0419443
1728 Ga0495585_0051609
1729 Ga0495594_0213414
1730 Ga0495594_0325484
1731 Ga0495594_0605335
1732 Ga0495596_0286243
1733 Ga0495607_0277858
1734 Ga0495607_0354581
1735 Ga0495583_0072582
1736 Ga0495583_0185166
1737 Ga0495606_0111682
1738 Ga0495606_0442193
1739 Ga0495608_0002253
1740 Ga0495608_0018263
1741 Ga0495608_0709897
1742 Ga0495616_0159601
1743 Ga0495616_0171049
1744 Ga0495616_0373556
1745 Ga0495618_0008644
1746 Ga0495618_0434356
1747 Ga0495618_0527281
1748 Ga0495620_0219096
1749 Ga0495620_0308263
1750 Ga0495628_0010523
1751 Ga0495628_0213293
1752 Ga0495628_0806211
1753 Ga0495630_0423003
1754 Ga0495630_0491654
1755 Ga0495631_0042150
1756 Ga0495631_0114330
1757 Ga0495631_0126228
1758 Ga0495632_0028862
1759 Ga0495632_0167360
1760 Ga0495632_0269147
1761 Ga0495643_0440432
1762 Ga0495644_0067837
1763 Ga0495644_0125454
1764 Ga0495644_0146613
1765 Ga0495648_0312553
1766 Ga0495663_0063724
1767 Ga0495663_0335989
1768 Ga0495642_0043703
1769 Ga0495642_0389011
1770 Ga0495652_0021486
1771 Ga0495652_0034509
1772 Ga0495652_0791622
1773 Ga0495665_0557993
1774 Ga0495640_0020098
1775 Ga0495640_0035828
1776 Ga0495640_0187493
1777 Ga0495587_0015106
1778 Ga0495587_0019403
1779 Ga0495587_0789730
1780 Ga0495598_0023551
1781 Ga0495598_0053990
1782 Ga0495598_0121980
1783 Ga0495609_0133827
1784 Ga0495609_0152655
1785 Ga0495609_0246544
1786 Ga0495621_0058368
1787 Ga0495597_0063414
1788 Ga0495645_0016860
1789 Ga0495645_0074551
1790 Ga0495622_0015732
1791 Ga0495622_0145857
1792 Ga0495622_0464518
1793 Ga0495633_0040434
1794 Ga0495633_0106287
1795 Ga0495633_0460207
1796 Ga0495667_0000551
1797 Ga0495667_0060348
1798 Ga0495656_0070007
1799 Ga0495656_0239937
1800 Ga0495656_0461313
1801 Ga0495668_0114918
1802 Ga0495668_0140491
1803 Ga0495668_0603323
1804 Ga0495668_0647449
1805 Ga0495634_0230125
1806 Ga0495611_0047537
1807 Ga0495611_0325785
1808 Ga0495611_0594766
1809 Ga0495625_0234883
1810 Ga0495625_0381302
1811 Ga0495625_0383761
1812 Ga0495635_0001218
1813 Ga0495635_0023042
1814 Ga0495635_0388050
1815 Ga0495659_0006041
1816 Ga0495659_0110783
1817 Ga0495661_0249435
1818 Ga0495661_0295438
1819 Ga0495588_0008572
1820 Ga0495588_0545353
1821 Ga0495657_0019076
1822 Ga0495657_0131203
1823 Ga0495599_0009152
1824 Ga0495599_0125057
1825 Ga0495599_0545752
1826 Ga0495623_0016600
1827 Ga0495623_0022621
1828 Ga0495646_0000643
1829 Ga0495658_0154848
1830 Ga0495658_0403890
1831 Ga0495669_0020635
1832 Ga0495669_0144646
1833 Ga0495669_0333092
1834 Ga0495669_0359936
1835 Ga0495669_0432748
1836 Ga0495613_0045757
1837 Ga0495624_0062626
1838 Ga0495624_0126692
1839 Ga0495624_0434046
1840 Ga0495624_0674831
1841 Ga0495670_0080754
1842 Ga0495670_0116066
1843 Ga0495670_0239019
1844 Ga0495671_0420378
1845 Ga0495671_0435417
1846 Ga0495649_0351810
1847 Ga0495649_0440068
1848 Ga0495649_0603714
1849 Ga0495589_0100555
1850 Ga0495589_0140556
1851 Ga0495600_0001007
1852 Ga0495600_0204018
1853 Ga0495600_0266369
1854 Ga0495660_0509809
1855 Ga0495581_0045989
1856 Ga0495604_0015936
1857 Ga0495604_0023465
1858 Ga0495604_0625893
1859 Ga0495636_0129366
1860 Ga0495636_0620928
1861 Ga0495674_0003683
1862 Ga0495674_0114961
1863 Ga0495672_0037809
1864 Ga0495672_0170661
1865 Ga0495672_0416072
1866 Ga0495676_0042130
1867 Ga0495676_0130352
1868 Ga0495680_0001909
1869 Ga0495680_0046311
1870 Ga0495683_0224830
1871 Ga0495675_0001972
1872 Ga0495675_0011175
1873 Ga0495677_0106209
1874 Ga0495679_127596
1875 Ga0495673_0028030
1876 Ga0495673_0030851
1877 Ga0495681_0192030
1878 Ga0495684_0000313
1879 Ga0495684_0035943
1880 Ga0495686_0075038
1881 Ga0495686_0335243
1882 Ga0495686_0634235
1883 Ga0495593_0001524
1884 Ga0495593_0128564
1885 Ga0495602_0050780
1886 Ga0495602_0059972
1887 Ga0495614_0024394
1888 Ga0495615_0206356
1889 Ga0495626_0104917
1890 Ga0495626_0200604
1891 Ga0496100_0087995
1892 Ga0496100_0139318
1893 Ga0496101_0027335
1894 Ga0496101_0046806
1895 Ga0496102_0011927
1896 Ga0496102_0049981
1897 Ga0496102_0123428
1898 Ga0496102_0165118
1899 Ga0496102_0223293
1900 Ga0496103_0041533
1901 Ga0496103_0359980
1902 Ga0496103_0580446
1903 Ga0496104_0049045
1904 Ga0496104_0059609
1905 Ga0496104_0104080
1906 Ga0496104_0234039
1907 Ga0496105_0085784
1908 Ga0496105_0110428
1909 Ga0496105_0275606
1910 Ga0496105_0413318
1911 Ga0496105_0535321
1912 Ga0496105_0598519
1913 Ga0496105_0803467
1914 Ga0496106_0037784
1915 Ga0496106_0052259
1916 Ga0496106_0294060
1917 Ga0496106_0627129
1918 Ga0496106_0877008
1919 Ga0496106_1091148
1920 Ga0496107_0002944
1921 Ga0496107_0012539
1922 Ga0496107_0288009
1923 Ga0496107_0415006
1924 Ga0496107_0815124
1925 Ga0496108_0050424
1926 Ga0496108_0102539
1927 Ga0496108_0117623
1928 Ga0496108_0852630
1929 Ga0496109_0009866
1930 Ga0496109_0035253
1931 Ga0496109_0050985
1932 Ga0496109_0721443
1933 Ga0496110_0122513
1934 Ga0496110_0165944
1935 Ga0496110_0248028
1936 Ga0496110_0355700
1937 Ga0496110_0491122
1938 Ga0496110_0665390
1939 Ga0496110_1106760
1940 Ga0496110_1140543
1941 Ga0496111_0050121
1942 Ga0496111_0050303
1943 Ga0496111_0145014
1944 Ga0496111_0155083
1945 Ga0496111_0260027
1946 Ga0496111_0548895
1947 Ga0496111_0880681
1948 Ga0496112_0001974
1949 Ga0496112_0014051
1950 Ga0496112_0028765
1951 Ga0496112_0186304
1952 Ga0496112_0219897
1953 Ga0496112_0237027
1954 Ga0496113_0013547
1955 Ga0496113_0050127
1956 Ga0496113_0251019
1957 Ga0496113_0274424
1958 Ga0496114_0080131
1959 Ga0496114_0932388
1960 Ga0496114_1593423
1961 Ga0496115_0003266
1962 Ga0496115_0032667
1963 Ga0496115_0193576
1964 Ga0496115_0223229
1965 Ga0496115_0256728
1966 Ga0496115_0260811
1967 Ga0496115_0268189
1968 Ga0496115_0853393
1969 Ga0496115_0937074
1970 Ga0496116_0323335
1971 Ga0496117_0195191
1972 Ga0496117_0356569
1973 Ga0496117_0406694
1974 Ga0496119_0139958
1975 Ga0496119_0176977
1976 Ga0496119_0306434
1977 Ga0496119_0420303
1978 Ga0496121_0039609
1979 Ga0496121_0086669
1980 Ga0496121_0100066
1981 Ga0496121_0147348
1982 Ga0496121_0214125
1983 Ga0496124_0671010
1984 Ga0496125_0130928
1985 Ga0496126_0007843
1986 Ga0496126_0030834
1987 Ga0496126_0031354
1988 Ga0496126_0121393
1989 Ga0496126_0166479
1990 Ga0496126_0407442
1991 Ga0496126_0452718
1992 Ga0496126_0722205
1993 Ga0495682_0155730
1994 Ga0501032_0019827
1995 Ga0501032_0227629
1996 Ga0501032_0664431
1997 Ga0501034_0697001
1998 Ga0501034_0776041
1999 Ga0501036_0103183
2000 Ga0501037_0580240
2001 Ga0501038_0083459
2002 Ga0501038_0531410
2003 Ga0501039_0193009
2004 Ga0501039_0244298
2005 Ga0501047_0124847
2006 Ga0501047_1158453
2007 Ga0501067_0080761
2008 Ga0501067_0110475
2009 Ga0501068_0036146
2010 Ga0501068_0345611
2011 Ga0501069_0023410
2012 Ga0501069_0258501
2013 Ga0501072_0444037
2014 Ga0501073_0063515
2015 Ga0501076_0260681
2016 Ga0501079_0822338
2017 Ga0501080_0234585
2018 Ga0501081_0603531
2019 Ga0501083_0036945
2020 Ga0501035_0044770
2021 Ga0501035_0152365
2022 Ga0501044_0130692
2023 Ga0501045_0005982
2024 Ga0501045_1376484
2025 nmdc:mga03683_203155_c1
2026 nmdc:mga03683_221246_c1
2027 nmdc:mga03683_26211_c1
2028 nmdc:mga03n38_25130_c1
2029 nmdc:mga03n38_253802_c1
2030 nmdc:mga00v17_388333_c1
2031 nmdc:mga00v17_75943_c1
2032 nmdc:mga00v17_85112_c1
2033 nmdc:mga0yw44_216206_c1
2034 nmdc:mga0yw44_415260_c1
2035 nmdc:mga0yw44_55596_c1
2036 nmdc:mga0yw44_800725_c1
2037 nmdc:mga0k408_139477_c1
2038 nmdc:mga06z11_189952_c1
2039 nmdc:mga06z11_312960_c1
2040 nmdc:mga06z11_33726_c1
2041 nmdc:mga06z11_635642_c1
2042 nmdc:mga07m45_19967_c1
2043 nmdc:mga07m45_38992_c1
2044 nmdc:mga07m45_55869_c1
2045 nmdc:mga05p37_102181_c1
2046 nmdc:mga0qj67_533055_c1
2047 nmdc:mga08y16_15164_c1
2048 nmdc:mga0n895_69515_c1
2049 nmdc:mga0rr50_179637_c1
2050 nmdc:mga0rr50_308324_c2
2051 nmdc:mga08x19_140497_c1
2052 nmdc:mga0a205_134118_c1
2053 nmdc:mga0sz30_21935_c1
2054 nmdc:mga0sz30_255674_c1
2055 nmdc:mga0sz30_48450_c1
2056 Ga0495601_0054219
2057 Ga0495601_0311791
2058 Ga0495612_0016378
2059 Ga0500610_0117724
2060 Ga0500635_0153508
2061 Ga0495655_0051461
2062 Ga0495655_0178933
2063 Ga0495595_0000445
2064 Ga0495595_0054813
2065 Ga0495619_0001995
2066 Ga0495619_0084768
2067 Ga0500643_027818
2068 Ga0500581_258691
2069 Ga0500646_0279689
2070 Ga0500650_0212604
2071 Ga0500650_0250963
2072 Ga0500554_003817
2073 Ga0500554_017215
2074 Ga0500582_161701
2075 Ga0500592_043676
2076 Ga0500595_000477
2077 Ga0500595_028055
2078 Ga0500617_206272
2079 Ga0500621_175371
2080 Ga0500658_0297115
2081 Ga0500658_0317980
2082 Ga0500588_0114309
2083 Ga0500589_064971
2084 Ga0500589_133161
2085 Ga0500589_206025
2086 Ga0500589_266318
2087 Ga0500590_335920
2088 Ga0500603_028836
2089 Ga0500622_0051250
2090 Ga0500627_0145273
2091 Ga0500633_0146917
2092 Ga0500634_0208305
2093 Ga0500638_011253
2094 Ga0500636_0070176
2095 Ga0500637_0010152
2096 Ga0500637_0011408
2097 Ga0500645_159327
2098 Ga0500609_015338
2099 Ga0501084_0309355
2100 Ga0500661_002168
2101 Ga0501082_0988906
2102 Ga0501082_1215592
2103 Ga0530510_0616412
2104 Ga0530510_0853936
2105 2513674579
2106 2513695121
2107 2671122457
2108 2723841652
2109 2728755000
2110 2793081066
2111 2874608055
2112 2876815495
2113 2879112180
2114 2889035480
2115 2903751484
2116 2903771850
2117 2906613884
2118 2908747454
2119 2922363991
2120 2922392575
2121 2935636530
2122 2941513165
2123 2941521180
2124 2941528883
2125 3005475073
2126 8006967466
2127 8006990931
2128 8006996502
2129 8019572492
2130 8056675752

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

43

125

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ku8-assembly3.cif.gz_C structures of pkgi reveal a cgmp-selective activation mechanism 0.9372 3 115
3co2-assembly1.cif.gz_C mlotik1 ion channel cyclic-nucleotide binding domain mutant 0.9256 6 117
3j4q-assembly1.cif.gz_C pseudo-atomic model of the akap18-pka complex in a bent conformation derived from electron microscopy 0.9077 3 113
2qvs-assembly1.cif.gz_B crystal structure of type iia holoenzyme of camp-dependent protein kinase 0.9077 3 113
3plq-assembly1.cif.gz_A crystal structure of pka type i regulatory subunit bound with rp-8-br-camps 0.9022 5 114
ID Description Score Start End Superfamily
af_E7F7H6_385_507_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9156 8 125 2.60.120.10
af_Q4DSV5_212_344_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9148 3 112 2.60.120.10
af_E9AGM0_334_458_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9083 3 112 2.60.120.10
5j3uA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9042 3 112 2.60.120.10
3of1A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9041 2 111 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A537R663-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9989 1 124 GO:0003700
GO:0005829
AF-A0A537R663-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.983 1 124 GO:0003700
GO:0005829
AF-A0A431P2R6-F1-model_v4 deleted 0.9733 1 145
AF-A0A5E4NT20-F1-model_v4 Cyclic nucleotide-binding protein 0.9708 1 138 GO:0003700
GO:0005829
AF-A0A4U6BN04-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9705 1 145 GO:0003700
GO:0005829

Map