F489378

General Info

Members Datasets Scaffolds Average Seq Length
1065 505 2130 171

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0851689|Ga0395901_0851689_110_718
Length 202
Sequence MGRRREEGRRRPEAGARFAQGLAREVQVGVVKKANFADRFINGIEWAAAIFVGIVALNIFVNVTLRKFFSWSIPDYYDFGRMLLGILIFWGIAATSYRGGHITVDLVWTAVNGKWKRIIDVFATVVLLFVVIVQTSMLFDKVRLTYADNVQTFDLNIPTWPFYAVAWAGDVCAVILIAIRTWRLVFKPEALHDEHYDQKAME

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
130 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
131 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
132 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
133 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
237 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
241 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
242 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
243 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
244 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
245 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
251 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
252 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
253 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
254 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
264 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
281 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
282 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
283 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
284 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
285 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
286 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
287 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
288 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
289 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
292 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
296 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
313 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
314 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
315 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
320 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
321 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
324 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
325 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
326 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
327 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
328 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
329 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
332 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
333 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
334 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
335 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
336 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
337 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
338 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
339 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
340 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
346 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
358 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
359 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
360 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
367 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
368 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
369 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
370 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
371 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
381 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
382 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
385 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
386 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
387 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
388 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
389 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
390 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
391 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
392 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
393 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
394 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
395 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
396 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
411 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
412 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
413 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
414 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
416 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
417 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
418 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
419 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
420 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
421 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
422 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
423 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
426 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
427 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
428 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
429 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
430 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
431 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
432 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
433 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
434 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
435 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
436 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
437 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
438 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
439 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
440 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
441 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
442 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
443 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
444 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
445 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
446 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
447 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
448 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
449 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
450 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
451 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
452 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
453 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
454 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
455 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
458 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
459 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
460 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
461 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
462 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
463 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
464 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
465 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
466 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
467 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
468 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
469 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
470 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
471 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
472 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
473 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
474 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
475 2643221658 Variovorax sp. Root411 Isolate Unclassified
476 2643221672 Variovorax sp. Root434 Isolate Unclassified
477 2738541277 Variovorax sp. GV051 Isolate Unclassified
478 2738541307 Variovorax sp. GV008 Isolate Unclassified
479 2738543013 Variovorax sp. BT01 Isolate Unclassified
480 2738543019 Variovorax sp. GV040 Isolate Unclassified
481 2791355199
482 2818991446 Variovorax sp. 1180 Isolate Unclassified
483 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
484 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
485 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
486 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
487 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
488 2885198086 Variovorax sp. 679 Isolate Unclassified
489 2885211737 Variovorax sp. 553 Isolate Unclassified
490 2899924645 Variovorax sp. 369 Isolate Unclassified
491 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
492 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
493 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
494 2928037797 Variovorax sp. 1126 Isolate Unclassified
495 2928044640 Variovorax sp. 1128 Isolate Unclassified
496 2928051484 Variovorax sp. 1133 Isolate Unclassified
497 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
498 2928070936 Variovorax gossypii 1167 Isolate Unclassified
499 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
500 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
501 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
502 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
503 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
504 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
505 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 0.09
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.25
Nodule 0.66
Rhizoplane 5.35
Rhizosphere 65.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0851689 3300038443 Bacteria 897
2 JGI24740J21852_10021053 3300001979 Bacteria 2265
3 JGI24735J21928_10075636 3300002067 Bacteria 964
4 JGI25158J39367_1007100 3300002739 Bacteria 1587
5 JGI25152J39213_1008884 3300002773 Bacteria 2445
6 JGI25150J39212_1010324 3300002774 Bacteria 1739
7 JGI25150J39212_1033110 3300002774 Bacteria 703
8 JGI25159J45721_1003181 3300002987 Bacteria 5894
9 JGI25159J45721_1019013 3300002987 Bacteria 1366
10 JGI25151J46595_10026451 3300003187 Bacteria 2340
11 JGI25406J46586_10000233 3300003203 Bacteria 24719
12 JGI25406J46586_10022537 3300003203 Bacteria 2506
13 JGI25153J46596_10002553 3300003215 Bacteria 10441
14 JGI25153J46596_10030668 3300003215 Bacteria 1825
15 rootH1_10067490 3300003316 Bacteria 2077
16 JGI25160J50197_1001363 3300003354 Bacteria 12304
17 JGI25160J50197_1004644 3300003354 Bacteria 5894
18 JGI25161J50226_1002632 3300003374 Bacteria 4500
19 JGI25161J50226_1009988 3300003374 Bacteria 1304
20 JGI25404J52841_10004643 3300003659 Bacteria 2799
21 JGI25404J52841_10008463 3300003659 Bacteria 2191
22 JGI25404J52841_10012135 3300003659 Bacteria 1863
23 JGI25404J52841_10024208 3300003659 Bacteria 1309
24 JGI25404J52841_10039658 3300003659 Bacteria 997
25 JGI25404J52841_10095463 3300003659 Bacteria 622
26 Ga0055527_1007840 3300003760 Bacteria 1292
27 Ga0055535_1000181 3300003761 Bacteria 66856
28 Ga0055542_1000070 3300003762 Bacteria 147374
29 Ga0055526_1007214 3300003771 Bacteria 5835
30 Ga0055526_1008818 3300003771 Bacteria 4959
31 Ga0055537_1003344 3300003773 Bacteria 4959
32 Ga0055537_1007479 3300003773 Bacteria 2627
33 Ga0055524_1006736 3300003775 Bacteria 4959
34 Ga0055524_1009023 3300003775 Bacteria 4093
35 Ga0055536_1001696 3300003781 Bacteria 13035
36 Ga0055536_1008117 3300003781 Bacteria 4573
37 Ga0055536_1018110 3300003781 Bacteria 2271
38 Ga0055534_1001432 3300003784 Bacteria 9493
39 Ga0055534_1013581 3300003784 Bacteria 1559
40 Ga0055528_1007183 3300003790 Bacteria 4959
41 Ga0055528_1031161 3300003790 Bacteria 1394
42 Ga0055530_10000952 3300003791 Bacteria 23669
43 Ga0055530_10009915 3300003791 Bacteria 3590
44 Ga0055540_1010090 3300003792 Bacteria 3177
45 Ga0055540_1028778 3300003792 Bacteria 1309
46 Ga0055531_10002573 3300003794 Bacteria 12043
47 Ga0055531_10005367 3300003794 Bacteria 7516
48 Ga0055531_10011800 3300003794 Bacteria 4172
49 Ga0055531_10048604 3300003794 Bacteria 1142
50 JGI25405J52794_10037446 3300003911 Bacteria 1020
51 Ga0055543_1013689 3300004625 Bacteria 1597
52 Ga0055543_1014300 3300004625 Bacteria 1549
53 Ga0065165_1003666 3300005262 Bacteria 10479
54 Ga0065165_1059322 3300005262 Bacteria 1053
55 Ga0065714_10018495 3300005288 Bacteria 1921
56 Ga0065714_10019306 3300005288 Bacteria 1926
57 Ga0065714_10035760 3300005288 Bacteria 879
58 Ga0065704_10397369 3300005289 Bacteria 756
59 Ga0065715_10026993 3300005293 Bacteria 1372
60 Ga0070658_10361288 3300005327 Bacteria 1244
61 Ga0070676_10049322 3300005328 Bacteria 2464
62 Ga0070683_100071835 3300005329 Bacteria 3230
63 Ga0070690_100103269 3300005330 Bacteria 1892
64 Ga0070690_100782446 3300005330 Bacteria 739
65 Ga0070670_100062923 3300005331 Bacteria 3185
66 Ga0070670_100264917 3300005331 Bacteria 1499
67 Ga0070670_100543968 3300005331 Bacteria 1036
68 Ga0070670_101103482 3300005331 Bacteria 723
69 Ga0068869_100171337 3300005334 Bacteria 1696
70 Ga0068869_100440347 3300005334 Bacteria 1078
71 Ga0068869_100646239 3300005334 Bacteria 897
72 Ga0070680_100536919 3300005336 Bacteria 1002
73 Ga0068868_100041467 3300005338 Bacteria 3586
74 Ga0068868_100263359 3300005338 Bacteria 1454
75 Ga0068868_100307909 3300005338 Bacteria 1347
76 Ga0068868_100309493 3300005338 Bacteria 1343
77 Ga0068868_101366862 3300005338 Bacteria 660
78 Ga0070660_100015341 3300005339 Bacteria 5530
79 Ga0070660_100712685 3300005339 Bacteria 842
80 Ga0070689_100387178 3300005340 Bacteria 1179
81 Ga0070689_100932072 3300005340 Bacteria 770
82 Ga0070691_10142480 3300005341 Bacteria 1223
83 Ga0070691_10180477 3300005341 Bacteria 1099
84 Ga0070661_100042792 3300005344 Bacteria 3307
85 Ga0070661_100175100 3300005344 Bacteria 1631
86 Ga0070668_100939419 3300005347 Bacteria 775
87 Ga0070668_101002817 3300005347 Bacteria 750
88 Ga0070668_101188534 3300005347 Bacteria 691
89 Ga0070668_101335220 3300005347 Bacteria 652
90 Ga0070675_100248897 3300005354 Bacteria 1555
91 Ga0070671_100184336 3300005355 Bacteria 1768
92 Ga0070674_100007000 3300005356 Bacteria 6623
93 Ga0070674_100063913 3300005356 Bacteria 2577
94 Ga0070674_100363996 3300005356 Bacteria 1172
95 Ga0070673_100143175 3300005364 Bacteria 2019
96 Ga0070659_100146861 3300005366 Bacteria 1922
97 Ga0070659_100873808 3300005366 Bacteria 785
98 Ga0070659_101894984 3300005366 Bacteria 535
99 Ga0070667_100024212 3300005367 Bacteria 5042
100 Ga0070667_100068095 3300005367 Bacteria 3028
101 Ga0070667_100173831 3300005367 Bacteria 1902
102 Ga0070667_100190538 3300005367 Bacteria 1817
103 Ga0070667_101252488 3300005367 Bacteria 695
104 Ga0070705_100901573 3300005440 Bacteria 711
105 Ga0070700_100010807 3300005441 Bacteria 5046
106 Ga0070708_100080252 3300005445 Bacteria 2952
107 Ga0070663_100027899 3300005455 Bacteria 3838
108 Ga0070663_100040079 3300005455 Bacteria 3277
109 Ga0070663_100066018 3300005455 Bacteria 2621
110 Ga0070663_100237493 3300005455 Bacteria 1437
111 Ga0070663_100678710 3300005455 Bacteria 874
112 Ga0070678_100292937 3300005456 Bacteria 1380
113 Ga0070678_101450772 3300005456 Bacteria 642
114 Ga0070662_100037931 3300005457 Bacteria 3419
115 Ga0070662_100196401 3300005457 Bacteria 1598
116 Ga0070662_100268139 3300005457 Bacteria 1378
117 Ga0070662_100351551 3300005457 Bacteria 1207
118 Ga0070681_10153378 3300005458 Bacteria 2229
119 Ga0070681_10460834 3300005458 Bacteria 1183
120 Ga0068867_100120843 3300005459 Bacteria 2024
121 Ga0068867_100169163 3300005459 Bacteria 1730
122 Ga0068867_100171802 3300005459 Bacteria 1717
123 Ga0068867_101353323 3300005459 Bacteria 659
124 Ga0070685_10454777 3300005466 Bacteria 898
125 Ga0070706_101008265 3300005467 Bacteria 768
126 Ga0070707_100056627 3300005468 Bacteria 3760
127 Ga0070698_100301976 3300005471 Bacteria 1532
128 Ga0070679_100515236 3300005530 Bacteria 1140
129 Ga0070684_100049588 3300005535 Bacteria 3644
130 Ga0070684_100053370 3300005535 Bacteria 3518
131 Ga0070684_100520395 3300005535 Bacteria 1102
132 Ga0070697_100175946 3300005536 Bacteria 1813
133 Ga0070697_100583683 3300005536 Bacteria 982
134 Ga0068853_100070695 3300005539 Bacteria 3038
135 Ga0068853_100080072 3300005539 Bacteria 2857
136 Ga0068853_100291441 3300005539 Bacteria 1506
137 Ga0070672_100031656 3300005543 Bacteria 3984
138 Ga0070672_100047861 3300005543 Bacteria 3319
139 Ga0070672_100423690 3300005543 Bacteria 1143
140 Ga0070672_100447801 3300005543 Bacteria 1112
141 Ga0070695_101046797 3300005545 Bacteria 666
142 Ga0070665_100145695 3300005548 Bacteria 2371
143 Ga0070665_100164868 3300005548 Bacteria 2218
144 Ga0070665_100313478 3300005548 Bacteria 1573
145 Ga0070665_100904033 3300005548 Bacteria 895
146 Ga0070704_100131020 3300005549 Bacteria 1943
147 Ga0068855_100126649 3300005563 Bacteria 2920
148 Ga0068855_100335750 3300005563 Bacteria 1667
149 Ga0068855_100373254 3300005563 Bacteria 1567
150 Ga0068855_101052839 3300005563 Bacteria 852
151 Ga0070664_100277606 3300005564 Bacteria 1510
152 Ga0070664_100336963 3300005564 Bacteria 1369
153 Ga0068857_100026204 3300005577 Bacteria 5137
154 Ga0068857_100117348 3300005577 Bacteria 2395
155 Ga0068857_100535826 3300005577 Bacteria 1102
156 Ga0068857_101297358 3300005577 Bacteria 706
157 Ga0068854_100190571 3300005578 Bacteria 1606
158 Ga0068854_100209311 3300005578 Bacteria 1537
159 Ga0068854_100701308 3300005578 Bacteria 874
160 Ga0068854_101159319 3300005578 Bacteria 691
161 Ga0068856_100028388 3300005614 Bacteria 5463
162 Ga0068856_100464903 3300005614 Bacteria 1286
163 Ga0068856_100637094 3300005614 Bacteria 1087
164 Ga0068856_100697178 3300005614 Bacteria 1036
165 Ga0070702_100092435 3300005615 Bacteria 1837
166 Ga0068852_100057569 3300005616 Bacteria 3364
167 Ga0068852_100129342 3300005616 Bacteria 2323
168 Ga0068859_101139072 3300005617 Bacteria 858
169 Ga0068866_10069758 3300005718 Bacteria 1853
170 Ga0068861_100003730 3300005719 Bacteria 10161
171 Ga0068861_100265171 3300005719 Bacteria 1472
172 Ga0068861_100540060 3300005719 Bacteria 1060
173 Ga0068851_10011436 3300005834 Bacteria 4163
174 Ga0068870_10417856 3300005840 Bacteria 877
175 Ga0068870_10651351 3300005840 Bacteria 722
176 Ga0068863_100750898 3300005841 Bacteria 971
177 Ga0068858_100329235 3300005842 Bacteria 1461
178 Ga0068858_100689531 3300005842 Bacteria 994
179 Ga0068860_100022098 3300005843 Bacteria 6158
180 Ga0068860_100484213 3300005843 Bacteria 1233
181 Ga0068860_100485726 3300005843 Bacteria 1231
182 Ga0068860_100836486 3300005843 Bacteria 935
183 Ga0068862_100067403 3300005844 Bacteria 3085
184 Ga0068862_100126298 3300005844 Bacteria 2258
185 Ga0068862_100325251 3300005844 Bacteria 1420
186 Ga0068862_100727212 3300005844 Bacteria 964
187 Ga0081455_10002140 3300005937 Bacteria 23551
188 Ga0081455_10011235 3300005937 Bacteria 9010
189 Ga0081455_10020632 3300005937 Bacteria 6197
190 Ga0081455_10038013 3300005937 Bacteria 4265
191 Ga0081538_10064867 3300005981 Bacteria 2062
192 Ga0081540_1002866 3300005983 Bacteria 13942
193 Ga0081540_1018952 3300005983 Bacteria 4203
194 Ga0081540_1021799 3300005983 Bacteria 3801
195 Ga0081540_1028548 3300005983 Bacteria 3131
196 Ga0081540_1043578 3300005983 Bacteria 2300
197 Ga0081540_1072595 3300005983 Bacteria 1585
198 Ga0081540_1079257 3300005983 Bacteria 1485
199 Ga0081540_1197938 3300005983 Bacteria 734
200 Ga0081539_10000157 3300005985 Bacteria 158278
201 Ga0081539_10002599 3300005985 Bacteria 24763
202 Ga0081539_10044556 3300005985 Bacteria 2560
203 Ga0081539_10045305 3300005985 Bacteria 2531
204 Ga0070717_10994929 3300006028 Bacteria 764
205 Ga0075365_10025036 3300006038 Bacteria 3774
206 Ga0075365_10160637 3300006038 Bacteria 1565
207 Ga0075365_10296160 3300006038 Bacteria 1138
208 Ga0075365_10531405 3300006038 Bacteria 832
209 Ga0075368_10067497 3300006042 Bacteria 1440
210 Ga0075363_100133737 3300006048 Bacteria 1392
211 Ga0075363_100224768 3300006048 Bacteria 1076
212 Ga0075363_100368667 3300006048 Bacteria 840
213 Ga0075364_10128844 3300006051 Bacteria 1697
214 Ga0075364_10332774 3300006051 Bacteria 1034
215 Ga0070716_100259333 3300006173 Bacteria 1189
216 Ga0070716_100332648 3300006173 Bacteria 1069
217 Ga0070712_100178805 3300006175 Bacteria 1652
218 Ga0075362_10004627 3300006177 Bacteria 4960
219 Ga0075362_10062462 3300006177 Bacteria 1687
220 Ga0075362_10102779 3300006177 Bacteria 1338
221 Ga0075362_10131650 3300006177 Bacteria 1190
222 Ga0075362_10323123 3300006177 Bacteria 769
223 Ga0075362_10350663 3300006177 Bacteria 739
224 Ga0075367_10005584 3300006178 Bacteria 6264
225 Ga0075367_10017641 3300006178 Bacteria 3922
226 Ga0075367_10034473 3300006178 Bacteria 2924
227 Ga0075367_10046736 3300006178 Bacteria 2544
228 Ga0075367_10216360 3300006178 Bacteria 1199
229 Ga0075369_10000214 3300006186 Bacteria 17133
230 Ga0075369_10024234 3300006186 Bacteria 2513
231 Ga0075369_10201466 3300006186 Bacteria 918
232 Ga0075369_10255381 3300006186 Bacteria 814
233 Ga0075366_10001920 3300006195 Bacteria 10516
234 Ga0075366_10026156 3300006195 Bacteria 3416
235 Ga0075366_10043155 3300006195 Bacteria 2671
236 Ga0075366_10072549 3300006195 Bacteria 2051
237 Ga0075366_10093438 3300006195 Bacteria 1802
238 Ga0075366_10097484 3300006195 Bacteria 1763
239 Ga0075366_10104047 3300006195 Bacteria 1705
240 Ga0075366_10278006 3300006195 Bacteria 1023
241 Ga0075366_10559195 3300006195 Bacteria 708
242 Ga0075366_10670053 3300006195 Bacteria 644
243 Ga0097621_100111264 3300006237 Bacteria 2314
244 Ga0097621_100213605 3300006237 Bacteria 1679
245 Ga0097621_100894611 3300006237 Bacteria 827
246 Ga0097621_101323344 3300006237 Bacteria 681
247 Ga0075370_10012893 3300006353 Bacteria 4429
248 Ga0075370_10020752 3300006353 Bacteria 3594
249 Ga0075370_10021432 3300006353 Bacteria 3540
250 Ga0075370_10027627 3300006353 Bacteria 3150
251 Ga0075370_10034702 3300006353 Bacteria 2828
252 Ga0075370_10050650 3300006353 Bacteria 2355
253 Ga0075370_10061122 3300006353 Bacteria 2146
254 Ga0075370_10074703 3300006353 Bacteria 1943
255 Ga0075370_10093647 3300006353 Bacteria 1734
256 Ga0075370_10235180 3300006353 Bacteria 1084
257 Ga0075370_10308439 3300006353 Bacteria 942
258 Ga0075370_10343251 3300006353 Bacteria 891
259 Ga0068871_100295793 3300006358 Bacteria 1420
260 Ga0068871_100681498 3300006358 Bacteria 940
261 Ga0075428_100074682 3300006844 Bacteria 3703
262 Ga0075428_100271762 3300006844 Bacteria 1824
263 Ga0075434_100066669 3300006871 Bacteria 3586
264 Ga0075434_100502909 3300006871 Bacteria 1233
265 Ga0075434_100757784 3300006871 Bacteria 988
266 Ga0075429_100298751 3300006880 Bacteria 1410
267 Ga0075429_100666500 3300006880 Bacteria 911
268 Ga0068865_100008038 3300006881 Bacteria 6512
269 Ga0068865_100008510 3300006881 Bacteria 6343
270 Ga0068865_100078906 3300006881 Bacteria 2357
271 Ga0097620_100295642 3300006931 Bacteria 1712
272 Ga0097620_101139045 3300006931 Bacteria 858
273 Ga0099794_10025065 3300007265 Bacteria 2743
274 Ga0099795_10011076 3300007788 Bacteria 2680
275 Ga0099795_10011242 3300007788 Bacteria 2669
276 Ga0105251_10112116 3300009011 Bacteria 1242
277 Ga0105251_10170878 3300009011 Bacteria 979
278 Ga0105244_10001808 3300009036 Bacteria 16736
279 Ga0105244_10117530 3300009036 Bacteria 1289
280 Ga0105240_10020996 3300009093 Bacteria 8692
281 Ga0105240_10033754 3300009093 Bacteria 6607
282 Ga0105240_10360192 3300009093 Bacteria 1648
283 Ga0105240_10556453 3300009093 Bacteria 1268
284 Ga0105240_10908124 3300009093 Bacteria 947
285 Ga0105245_10032198 3300009098 Bacteria 4642
286 Ga0105245_11021823 3300009098 Bacteria 871
287 Ga0105247_10159724 3300009101 Bacteria 1491
288 Ga0114129_10172553 3300009147 Bacteria 2947
289 Ga0114129_10749472 3300009147 Bacteria 1250
290 Ga0105243_10004605 3300009148 Bacteria 10871
291 Ga0105243_10123866 3300009148 Bacteria 2184
292 Ga0105243_10217937 3300009148 Bacteria 1685
293 Ga0105243_10521346 3300009148 Bacteria 1130
294 Ga0105241_10269478 3300009174 Bacteria 1450
295 Ga0105241_10355410 3300009174 Bacteria 1273
296 Ga0105241_10957463 3300009174 Bacteria 798
297 Ga0105241_11469211 3300009174 Bacteria 655
298 Ga0105242_10133944 3300009176 Bacteria 2142
299 Ga0105242_11086888 3300009176 Bacteria 813
300 Ga0105248_10137439 3300009177 Bacteria 2757
301 Ga0105248_10616910 3300009177 Bacteria 1224
302 Ga0105237_10146882 3300009545 Bacteria 2353
303 Ga0105237_10231551 3300009545 Bacteria 1848
304 Ga0105237_10284748 3300009545 Bacteria 1655
305 Ga0105237_10466298 3300009545 Bacteria 1269
306 Ga0105238_10047527 3300009551 Bacteria 4326
307 Ga0105238_10053482 3300009551 Bacteria 4057
308 Ga0105238_10133367 3300009551 Bacteria 2462
309 Ga0105238_10248355 3300009551 Bacteria 1757
310 Ga0105249_10197882 3300009553 Bacteria 1965
311 Ga0105249_10259582 3300009553 Bacteria 1726
312 Ga0105249_10260782 3300009553 Bacteria 1722
313 Ga0099796_10014598 3300010159 Bacteria 2273
314 Ga0099796_10133414 3300010159 Bacteria 965
315 Ga0105239_10096774 3300010375 Bacteria 3261
316 Ga0105239_10257650 3300010375 Bacteria 1960
317 Ga0105239_10290619 3300010375 Bacteria 1841
318 Ga0105239_11165572 3300010375 Bacteria 888
319 Ga0105246_10312740 3300011119 Bacteria 1273
320 Ga0105246_10898104 3300011119 Bacteria 794
321 Ga0105246_11046276 3300011119 Bacteria 742
322 Ga0157322_1023870 3300012490 Bacteria 609
323 Ga0157323_1012656 3300012495 Bacteria 698
324 Ga0157339_1005354 3300012505 Bacteria 1010
325 Ga0157342_1021807 3300012507 Bacteria 750
326 Ga0157316_1010668 3300012510 Bacteria 847
327 Ga0157373_10040974 3300013100 Bacteria 3313
328 Ga0157370_10018806 3300013104 Bacteria 6946
329 Ga0157370_10225228 3300013104 Bacteria 1736
330 Ga0157370_10393617 3300013104 Bacteria 1276
331 Ga0157369_10005188 3300013105 Bacteria 15228
332 Ga0157369_10067774 3300013105 Bacteria 3835
333 Ga0157369_10113059 3300013105 Bacteria 2885
334 Ga0157369_10319087 3300013105 Bacteria 1615
335 Ga0157374_10439352 3300013296 Bacteria 1305
336 Ga0157378_10181786 3300013297 Bacteria 1979
337 Ga0157378_10300338 3300013297 Bacteria 1554
338 Ga0163162_10005487 3300013306 Bacteria 12255
339 Ga0163162_10377705 3300013306 Bacteria 1550
340 Ga0163162_10426928 3300013306 Bacteria 1458
341 Ga0163162_10438690 3300013306 Bacteria 1438
342 Ga0163162_11559706 3300013306 Bacteria 753
343 Ga0157372_10060142 3300013307 Bacteria 4251
344 Ga0157372_10082216 3300013307 Bacteria 3646
345 Ga0157372_11303363 3300013307 Bacteria 838
346 Ga0157375_10358940 3300013308 Bacteria 1623
347 Ga0157375_10361348 3300013308 Bacteria 1618
348 Ga0157375_10586040 3300013308 Bacteria 1275
349 Ga0163163_10010769 3300014325 Bacteria 8250
350 Ga0163163_10334055 3300014325 Bacteria 1570
351 Ga0163163_10371961 3300014325 Bacteria 1486
352 Ga0157380_10135348 3300014326 Bacteria 2108
353 Ga0182008_10001754 3300014497 Bacteria 14232
354 Ga0182008_10001779 3300014497 Bacteria 14103
355 Ga0182008_10301146 3300014497 Bacteria 839
356 Ga0157377_10302965 3300014745 Bacteria 1055
357 Ga0157379_10067835 3300014968 Bacteria 3189
358 Ga0157379_10155995 3300014968 Bacteria 2059
359 Ga0157379_10215452 3300014968 Bacteria 1739
360 Ga0157376_10003714 3300014969 Bacteria 10547
361 Ga0157376_10491700 3300014969 Bacteria 1204
362 Ga0157376_10849912 3300014969 Bacteria 928
363 Ga0182006_1002899 3300015261 Bacteria 9108
364 Ga0182006_1028074 3300015261 Bacteria 2291
365 Ga0182007_10002457 3300015262 Bacteria 9203
366 Ga0182007_10003387 3300015262 Bacteria 7509
367 Ga0182005_1048462 3300015265 Bacteria 1154
368 Ga0183362_10001 3300015683 Bacteria 2046624
369 Ga0163161_10000554 3300017792 Bacteria 30160
370 Ga0163161_10043568 3300017792 Bacteria 3231
371 Ga0163161_10047639 3300017792 Bacteria 3094
372 Ga0206356_11249118 3300020070 Bacteria 1381
373 Ga0209436_101997 3300025208 Bacteria 6484
374 Ga0209672_102600 3300025228 Bacteria 4280
375 Ga0209147_100818 3300025229 Bacteria 14816
376 Ga0209258_100018 3300025242 Bacteria 567561
377 Ga0207425_1000579 3300025245 Bacteria 21473
378 Ga0209148_1000030 3300025254 Bacteria 567582
379 Ga0209129_1000114 3300025258 Bacteria 141791
380 Ga0209129_1001990 3300025258 Bacteria 10628
381 Ga0209129_1002798 3300025258 Bacteria 8119
382 Ga0209565_1001445 3300025263 Bacteria 10493
383 Ga0209565_1003173 3300025263 Bacteria 5462
384 Ga0209673_1000417 3300025273 Bacteria 74749
385 Ga0209673_1003002 3300025273 Bacteria 10493
386 Ga0209130_1000997 3300025284 Bacteria 22052
387 Ga0209130_1001138 3300025284 Bacteria 19478
388 Ga0209130_1002198 3300025284 Bacteria 10256
389 Ga0209130_1004584 3300025284 Bacteria 5183
390 Ga0209675_1009639 3300025291 Bacteria 3389
391 Ga0209675_1031059 3300025291 Bacteria 1266
392 Ga0209676_1000004 3300025292 Bacteria 1138360
393 Ga0209676_1000538 3300025292 Bacteria 58756
394 Ga0209676_1013442 3300025292 Bacteria 3146
395 Ga0209676_1031154 3300025292 Bacteria 1621
396 Ga0209025_1000343 3300025294 Bacteria 101870
397 Ga0209025_1004621 3300025294 Bacteria 11781
398 Ga0209025_1011201 3300025294 Bacteria 5949
399 Ga0209025_1043412 3300025294 Bacteria 1895
400 Ga0209564_1000070 3300025295 Bacteria 303126
401 Ga0209564_1000295 3300025295 Bacteria 100738
402 Ga0209564_1025311 3300025295 Bacteria 2001
403 Ga0209758_1000180 3300025297 Bacteria 141791
404 Ga0209758_1005089 3300025297 Bacteria 10410
405 Ga0209758_1020867 3300025297 Bacteria 3078
406 Ga0209758_1044076 3300025297 Bacteria 1636
407 Ga0209050_1000002 3300025298 Bacteria 1792849
408 Ga0209050_1007320 3300025298 Bacteria 6225
409 Ga0209050_1015534 3300025298 Bacteria 3188
410 Ga0209256_1000047 3300025299 Bacteria 314709
411 Ga0209256_1000157 3300025299 Bacteria 141791
412 Ga0207426_1000184 3300025302 Bacteria 154290
413 Ga0207426_1000204 3300025302 Bacteria 141791
414 Ga0209051_1000002 3300025303 Bacteria 1631846
415 Ga0209051_1000820 3300025303 Bacteria 32203
416 Ga0209051_1003554 3300025303 Bacteria 10146
417 Ga0209051_1016772 3300025303 Bacteria 3295
418 Ga0209257_1000002 3300025304 Bacteria 1767052
419 Ga0209257_1000096 3300025304 Bacteria 259390
420 Ga0209257_1000149 3300025304 Bacteria 192835
421 Ga0209257_1003517 3300025304 Bacteria 13328
422 Ga0209257_1011042 3300025304 Bacteria 4430
423 Ga0207655_1002512 3300025728 Bacteria 14781
424 Ga0207655_1135937 3300025728 Bacteria 795
425 Ga0207653_10028276 3300025885 Bacteria 1803
426 Ga0207682_10174381 3300025893 Bacteria 979
427 Ga0207642_10077529 3300025899 Bacteria 1603
428 Ga0207710_10082799 3300025900 Bacteria 1491
429 Ga0207688_10046362 3300025901 Bacteria 2427
430 Ga0207688_10433666 3300025901 Bacteria 818
431 Ga0207680_10521540 3300025903 Bacteria 847
432 Ga0207647_10224956 3300025904 Bacteria 1081
433 Ga0207645_10162232 3300025907 Bacteria 1463
434 Ga0207643_10341290 3300025908 Bacteria 939
435 Ga0207705_10018984 3300025909 Bacteria 4916
436 Ga0207705_10293441 3300025909 Bacteria 1246
437 Ga0207705_10445903 3300025909 Bacteria 1003
438 Ga0207684_10008664 3300025910 Bacteria 9031
439 Ga0207684_10880578 3300025910 Bacteria 754
440 Ga0207654_10590207 3300025911 Bacteria 792
441 Ga0207707_10000613 3300025912 Bacteria 35676
442 Ga0207695_10224579 3300025913 Bacteria 1785
443 Ga0207695_10231748 3300025913 Bacteria 1751
444 Ga0207695_10282140 3300025913 Bacteria 1555
445 Ga0207695_10439023 3300025913 Bacteria 1189
446 Ga0207671_10021771 3300025914 Bacteria 4858
447 Ga0207671_10087793 3300025914 Bacteria 2339
448 Ga0207671_10532643 3300025914 Bacteria 936
449 Ga0207663_10105327 3300025916 Bacteria 1903
450 Ga0207660_10015097 3300025917 Bacteria 5092
451 Ga0207660_10608673 3300025917 Bacteria 890
452 Ga0207657_10021660 3300025919 Bacteria 6041
453 Ga0207657_10513331 3300025919 Bacteria 938
454 Ga0207649_10090170 3300025920 Bacteria 2006
455 Ga0207649_10164082 3300025920 Bacteria 1542
456 Ga0207649_10711924 3300025920 Bacteria 779
457 Ga0207652_10023997 3300025921 Bacteria 5058
458 Ga0207652_10119188 3300025921 Bacteria 2347
459 Ga0207646_10099838 3300025922 Bacteria 2601
460 Ga0207681_11373958 3300025923 Bacteria 593
461 Ga0207694_10046553 3300025924 Bacteria 3353
462 Ga0207694_10077217 3300025924 Bacteria 2609
463 Ga0207694_10221004 3300025924 Bacteria 1545
464 Ga0207694_10264525 3300025924 Bacteria 1409
465 Ga0207694_10578726 3300025924 Bacteria 943
466 Ga0207650_10343713 3300025925 Bacteria 1226
467 Ga0207650_10424857 3300025925 Bacteria 1103
468 Ga0207659_10530613 3300025926 Bacteria 999
469 Ga0207659_10694060 3300025926 Bacteria 871
470 Ga0207687_10084331 3300025927 Bacteria 2303
471 Ga0207644_10052900 3300025931 Bacteria 2920
472 Ga0207690_10109417 3300025932 Bacteria 1988
473 Ga0207690_10259522 3300025932 Bacteria 1346
474 Ga0207690_10377018 3300025932 Bacteria 1127
475 Ga0207690_10536464 3300025932 Bacteria 950
476 Ga0207690_10719922 3300025932 Bacteria 821
477 Ga0207690_10825397 3300025932 Bacteria 767
478 Ga0207706_10113136 3300025933 Bacteria 2387
479 Ga0207706_10288281 3300025933 Bacteria 1431
480 Ga0207706_11357269 3300025933 Bacteria 585
481 Ga0207686_10085193 3300025934 Bacteria 2072
482 Ga0207686_10883532 3300025934 Bacteria 720
483 Ga0207709_10012501 3300025935 Bacteria 4675
484 Ga0207709_10102910 3300025935 Bacteria 1892
485 Ga0207670_10261547 3300025936 Bacteria 1342
486 Ga0207670_10820931 3300025936 Bacteria 775
487 Ga0207669_10039682 3300025937 Bacteria 2723
488 Ga0207669_10530855 3300025937 Bacteria 946
489 Ga0207704_10026450 3300025938 Bacteria 3184
490 Ga0207704_10103145 3300025938 Bacteria 1907
491 Ga0207704_10182716 3300025938 Bacteria 1517
492 Ga0207691_10586937 3300025940 Bacteria 944
493 Ga0207691_10871044 3300025940 Bacteria 755
494 Ga0207689_10111455 3300025942 Bacteria 2249
495 Ga0207689_10267866 3300025942 Bacteria 1414
496 Ga0207661_10039366 3300025944 Bacteria 3710
497 Ga0207661_10279575 3300025944 Bacteria 1491
498 Ga0207679_10037172 3300025945 Bacteria 3459
499 Ga0207679_10058416 3300025945 Bacteria 2858
500 Ga0207679_10333550 3300025945 Bacteria 1317
501 Ga0207667_10028504 3300025949 Bacteria 6065
502 Ga0207667_10109036 3300025949 Bacteria 2856
503 Ga0207667_10444399 3300025949 Bacteria 1318
504 Ga0207651_10102168 3300025960 Bacteria 2130
505 Ga0207651_10359083 3300025960 Bacteria 1229
506 Ga0207712_10137505 3300025961 Bacteria 1870
507 Ga0207712_10262372 3300025961 Bacteria 1402
508 Ga0207712_10265375 3300025961 Bacteria 1394
509 Ga0207668_10025674 3300025972 Bacteria 3815
510 Ga0207668_10269689 3300025972 Bacteria 1391
511 Ga0207668_10717025 3300025972 Bacteria 880
512 Ga0207640_10039886 3300025981 Bacteria 2975
513 Ga0207640_10156521 3300025981 Bacteria 1680
514 Ga0207640_10234272 3300025981 Bacteria 1414
515 Ga0207640_10637684 3300025981 Bacteria 906
516 Ga0207658_10088692 3300025986 Bacteria 2392
517 Ga0207658_10239814 3300025986 Bacteria 1535
518 Ga0207658_10254518 3300025986 Bacteria 1494
519 Ga0207658_10602331 3300025986 Bacteria 987
520 Ga0207658_10804100 3300025986 Bacteria 854
521 Ga0207677_10037687 3300026023 Bacteria 3162
522 Ga0207677_10120554 3300026023 Bacteria 1972
523 Ga0207703_10329839 3300026035 Bacteria 1399
524 Ga0207703_10559626 3300026035 Bacteria 1079
525 Ga0207703_10572846 3300026035 Bacteria 1066
526 Ga0207639_10018068 3300026041 Bacteria 5005
527 Ga0207639_10056817 3300026041 Bacteria 3001
528 Ga0207639_10119099 3300026041 Bacteria 2166
529 Ga0207678_10051459 3300026067 Bacteria 3556
530 Ga0207678_10063191 3300026067 Bacteria 3181
531 Ga0207678_10084486 3300026067 Bacteria 2715
532 Ga0207678_10085166 3300026067 Bacteria 2702
533 Ga0207678_10127217 3300026067 Bacteria 2173
534 Ga0207678_10350281 3300026067 Bacteria 1273
535 Ga0207708_10017331 3300026075 Bacteria 5421
536 Ga0207708_10085748 3300026075 Bacteria 2423
537 Ga0207702_11423424 3300026078 Bacteria 687
538 Ga0207641_10614958 3300026088 Bacteria 1065
539 Ga0207641_10622035 3300026088 Bacteria 1059
540 Ga0207641_10774829 3300026088 Bacteria 948
541 Ga0207648_10006213 3300026089 Bacteria 11904
542 Ga0207648_10059935 3300026089 Bacteria 3319
543 Ga0207648_10126250 3300026089 Bacteria 2250
544 Ga0207648_10218714 3300026089 Bacteria 1693
545 Ga0207676_10037774 3300026095 Bacteria 3682
546 Ga0207674_10102413 3300026116 Bacteria 2843
547 Ga0207674_10135758 3300026116 Bacteria 2422
548 Ga0207674_10138132 3300026116 Bacteria 2398
549 Ga0207674_10270306 3300026116 Bacteria 1647
550 Ga0207674_10424457 3300026116 Bacteria 1285
551 Ga0207674_10618827 3300026116 Bacteria 1046
552 Ga0207675_100015760 3300026118 Bacteria 7048
553 Ga0207675_100148877 3300026118 Bacteria 2227
554 Ga0207675_100294218 3300026118 Bacteria 1580
555 Ga0207675_100983785 3300026118 Bacteria 862
556 Ga0207683_10070377 3300026121 Bacteria 3091
557 Ga0207683_10154825 3300026121 Bacteria 2070
558 Ga0207683_10362082 3300026121 Bacteria 1332
559 Ga0207683_10454574 3300026121 Bacteria 1181
560 Ga0207698_10171166 3300026142 Bacteria 1912
561 Ga0207698_10348204 3300026142 Bacteria 1398
562 Ga0207698_11204436 3300026142 Bacteria 771
563 Ga0209588_1021371 3300027671 Bacteria 2033
564 Ga0268266_10003191 3300028379 Bacteria 16594
565 Ga0268266_10018212 3300028379 Bacteria 5987
566 Ga0268266_10088853 3300028379 Bacteria 2704
567 Ga0268266_10299308 3300028379 Bacteria 1500
568 Ga0268266_10679708 3300028379 Bacteria 991
569 Ga0268266_10695368 3300028379 Bacteria 980
570 Ga0268265_10119385 3300028380 Bacteria 2169
571 Ga0268265_10448564 3300028380 Bacteria 1204
572 Ga0268265_10644054 3300028380 Bacteria 1018
573 Ga0268265_10823801 3300028380 Bacteria 906
574 Ga0268264_10650633 3300028381 Bacteria 1043
575 Ga0265337_1016314 3300028556 Bacteria 2404
576 Ga0307517_10010277 3300028786 Bacteria 13120
577 Ga0307517_10248972 3300028786 Bacteria 1045
578 Ga0307515_10351259 3300028794 Bacteria 1121
579 Ga0307515_10428172 3300028794 Bacteria 942
580 Ga0307515_10499810 3300028794 Bacteria 827
581 Ga0265338_10159825 3300028800 Bacteria 1741
582 Ga0307512_10251225 3300030522 Bacteria 881
583 Ga0316182_1331932 3300030745 Bacteria 2043
584 Ga0265330_10022510 3300031235 Bacteria 2867
585 Ga0265325_10027929 3300031241 Bacteria 3046
586 Ga0265325_10031667 3300031241 Bacteria 2828
587 Ga0265325_10294432 3300031241 Bacteria 726
588 Ga0265339_10009653 3300031249 Bacteria 6042
589 Ga0265327_10000851 3300031251 Bacteria 45640
590 Ga0265316_10037388 3300031344 Bacteria 3918
591 Ga0265316_10081542 3300031344 Bacteria 2480
592 Ga0265316_10090976 3300031344 Bacteria 2328
593 Ga0307513_10134134 3300031456 Bacteria 2415
594 Ga0307513_10270685 3300031456 Bacteria 1482
595 Ga0307513_10400042 3300031456 Bacteria 1108
596 Ga0307509_10086316 3300031507 Bacteria 3227
597 Ga0307408_100426605 3300031548 Bacteria 1145
598 Ga0265313_10000062 3300031595 Bacteria 106169
599 Ga0265313_10001372 3300031595 Bacteria 22859
600 Ga0265313_10024898 3300031595 Bacteria 3185
601 Ga0265313_10061361 3300031595 Bacteria 1760
602 Ga0265313_10067779 3300031595 Bacteria 1650
603 Ga0307508_10357034 3300031616 Bacteria 1053
604 Ga0307514_10485766 3300031649 Bacteria 593
605 Ga0265314_10001182 3300031711 Bacteria 29977
606 Ga0265314_10003622 3300031711 Bacteria 14859
607 Ga0265314_10281468 3300031711 Bacteria 941
608 Ga0307516_10001245 3300031730 Bacteria 35441
609 Ga0307516_10044179 3300031730 Bacteria 4410
610 Ga0307516_10175345 3300031730 Bacteria 1881
611 Ga0307516_10369622 3300031730 Bacteria 1097
612 Ga0307516_10880179 3300031730 Bacteria 561
613 Ga0307405_10245328 3300031731 Bacteria 1329
614 Ga0307410_10520184 3300031852 Bacteria 982
615 Ga0307410_11448420 3300031852 Bacteria 604
616 Ga0307406_10437707 3300031901 Bacteria 1046
617 Ga0307406_10445914 3300031901 Bacteria 1037
618 Ga0307406_10880113 3300031901 Bacteria 761
619 Ga0307407_10083432 3300031903 Bacteria 1939
620 Ga0307412_10195692 3300031911 Bacteria 1532
621 Ga0307412_10550504 3300031911 Bacteria 969
622 Ga0307412_11326897 3300031911 Bacteria 648
623 Ga0307416_100028565 3300032002 Bacteria 4150
624 Ga0307416_100287321 3300032002 Bacteria 1626
625 Ga0307416_100850581 3300032002 Bacteria 1010
626 Ga0307416_101678654 3300032002 Bacteria 740
627 Ga0307415_100637705 3300032126 Bacteria 953
628 Ga0307510_10182663 3300033180 Bacteria 1658
629 Ga0373926_0037109 3300035083 Bacteria 1733
630 Ga0373936_0133317 3300035113 Bacteria 1069
631 Ga0373939_0001277 3300035114 Bacteria 6131
632 Ga0373957_0024419 3300035120 Bacteria 2171
633 Ga0373943_0073263 3300035170 Bacteria 1739
634 Ga0373943_0196570 3300035170 Bacteria 1115
635 Ga0373955_0030881 3300035172 Bacteria 2802
636 Ga0373931_0217856 3300035691 Bacteria 1148
637 Ga0373931_0248904 3300035691 Bacteria 1080
638 Ga0373927_0005689 3300035695 Bacteria 8558
639 Ga0373927_0028642 3300035695 Bacteria 3633
640 Ga0373927_0382120 3300035695 Bacteria 929
641 Ga0373927_0620632 3300035695 Bacteria 715
642 Ga0373933_0219872 3300035724 Bacteria 1218
643 Ga0373947_0017691 3300035725 Bacteria 4101
644 Ga0373947_0172392 3300035725 Bacteria 1405
645 Ga0373947_0199112 3300035725 Bacteria 1310
646 Ga0373947_0409925 3300035725 Bacteria 915
647 Ga0373937_0002154 3300036401 Bacteria 16484
648 Ga0373925_0005806 3300037068 Bacteria 9168
649 Ga0373925_0329269 3300037068 Bacteria 1237
650 Ga0373925_1123280 3300037068 Bacteria 646
651 Ga0395899_0002741 3300037312 Bacteria 14203
652 Ga0395899_0038874 3300037312 Bacteria 3563
653 Ga0395899_0060710 3300037312 Bacteria 2785
654 Ga0395900_0009354 3300037418 Bacteria 10048
655 Ga0395900_0056282 3300037418 Bacteria 4048
656 Ga0395900_0107563 3300037418 Bacteria 2865
657 Ga0395900_0890065 3300037418 Bacteria 814
658 Ga0395898_0148039 3300037466 Bacteria 2247
659 Ga0395905_0039610 3300037471 Bacteria 4421
660 Ga0395905_0413336 3300037471 Bacteria 1244
661 Ga0395905_0528220 3300037471 Bacteria 1080
662 Ga0395901_0042375 3300038443 Bacteria 4719
663 Ga0395901_0065280 3300038443 Bacteria 3789
664 Ga0395901_0114966 3300038443 Bacteria 2826
665 Ga0395901_0487733 3300038443 Bacteria 1256
666 Ga0436365_0805345 3300039437 Bacteria 806
667 Ga0436360_0035685 3300039438 Bacteria 1004
668 Ga0439465_0142733 3300041413 Bacteria 851
669 Ga0451795_0193704 3300041456 Bacteria 764
670 Ga0451807_0994696 3300041486 Bacteria 835
671 Ga0451841_0333288 3300041498 Bacteria 1100
672 Ga0451851_0341021 3300041507 Bacteria 765
673 Ga0439463_100494 3300042016 Bacteria 746
674 Ga0439458_0005013 3300042157 Bacteria 2995
675 Ga0451577_0111006 3300042876 Bacteria 2453
676 Ga0451577_0474877 3300042876 Bacteria 1135
677 Ga0466961_0269194 3300044693 Bacteria 1044
678 Ga0453684_0003325 3300044712 Bacteria 36528
679 Ga0453684_0755369 3300044712 Bacteria 1052
680 Ga0466968_0081706 3300044735 Bacteria 1421
681 Ga0466957_0452003 3300044842 Bacteria 885
682 Ga0466959_0359736 3300045049 Bacteria 992
683 Ga0451576_0302630 3300045051 Bacteria 1673
684 Ga0495617_116035 3300046452 Bacteria 864
685 Ga0495627_004050 3300046453 Bacteria 6247
686 Ga0495627_031474 3300046453 Bacteria 1675
687 Ga0495592_0001467 3300046454 Bacteria 16409
688 Ga0495592_0645095 3300046454 Bacteria 642
689 Ga0495603_0125073 3300046455 Bacteria 1498
690 Ga0495603_0274344 3300046455 Bacteria 970
691 Ga0495603_0748615 3300046455 Bacteria 558
692 Ga0495590_0015626 3300046457 Bacteria 2751
693 Ga0495590_0049279 3300046457 Bacteria 1470
694 Ga0495629_0070519 3300046459 Bacteria 2438
695 Ga0495629_0204200 3300046459 Bacteria 1366
696 Ga0495629_0500577 3300046459 Bacteria 819
697 Ga0495638_0024829 3300046460 Bacteria 3902
698 Ga0495641_0209408 3300046461 Bacteria 874
699 Ga0495641_0328875 3300046461 Bacteria 690
700 Ga0495651_0054642 3300046462 Bacteria 3070
701 Ga0495651_0156551 3300046462 Bacteria 1637
702 Ga0495653_0325123 3300046463 Bacteria 996
703 Ga0495650_0021840 3300046471 Bacteria 3080
704 Ga0495650_0053026 3300046471 Bacteria 1662
705 Ga0495650_0079742 3300046471 Bacteria 1265
706 Ga0495580_0276651 3300046472 Bacteria 1146
707 Ga0495580_0490489 3300046472 Bacteria 821
708 Ga0495582_0077374 3300046473 Bacteria 1845
709 Ga0495605_0204643 3300046474 Bacteria 859
710 Ga0495639_0008572 3300046475 Bacteria 4385
711 Ga0495639_0320209 3300046475 Bacteria 775
712 Ga0495585_0143880 3300046492 Bacteria 1247
713 Ga0495594_0206013 3300046499 Bacteria 1121
714 Ga0495594_0219945 3300046499 Bacteria 1083
715 Ga0495607_0055080 3300046501 Bacteria 2289
716 Ga0495606_0011174 3300046507 Bacteria 7350
717 Ga0495606_0114549 3300046507 Bacteria 1622
718 Ga0495606_0314392 3300046507 Bacteria 844
719 Ga0495610_0099080 3300046512 Bacteria 1308
720 Ga0495616_0005361 3300046513 Bacteria 7910
721 Ga0495620_0039477 3300046515 Bacteria 2085
722 Ga0495620_0145618 3300046515 Bacteria 925
723 Ga0495628_0003085 3300046516 Bacteria 14924
724 Ga0495628_0233259 3300046516 Bacteria 1379
725 Ga0495630_0096508 3300046517 Bacteria 2235
726 Ga0495630_0406428 3300046517 Bacteria 1043
727 Ga0495631_0000271 3300046518 Bacteria 36193
728 Ga0495632_0002822 3300046519 Bacteria 12862
729 Ga0495632_0074542 3300046519 Bacteria 1625
730 Ga0495644_0034321 3300046523 Bacteria 1915
731 Ga0495648_0328056 3300046524 Bacteria 707
732 Ga0495663_0013380 3300046525 Bacteria 2294
733 Ga0495663_0301502 3300046525 Bacteria 577
734 Ga0495666_0301960 3300046526 Bacteria 724
735 Ga0495642_0069068 3300046528 Bacteria 1475
736 Ga0495652_0002252 3300046529 Bacteria 20162
737 Ga0495654_0012115 3300046530 Bacteria 4642
738 Ga0495654_0204965 3300046530 Bacteria 842
739 Ga0495654_0270648 3300046530 Bacteria 702
740 Ga0495640_0271894 3300046533 Bacteria 1057
741 Ga0495586_0055750 3300046535 Bacteria 2142
742 Ga0495587_0401068 3300046536 Bacteria 762
743 Ga0495598_0116840 3300046537 Bacteria 900
744 Ga0495609_0043971 3300046538 Bacteria 2004
745 Ga0495609_0255209 3300046538 Bacteria 721
746 Ga0495621_0025169 3300046539 Bacteria 1997
747 Ga0495621_0252931 3300046539 Bacteria 720
748 Ga0495621_0385596 3300046539 Bacteria 592
749 Ga0495597_0034401 3300046542 Bacteria 2290
750 Ga0495645_0000223 3300046543 Bacteria 40729
751 Ga0495645_0079139 3300046543 Bacteria 2362
752 Ga0495622_0095768 3300046557 Bacteria 1362
753 Ga0495622_0163802 3300046557 Bacteria 1002
754 Ga0495622_0337975 3300046557 Bacteria 653
755 Ga0495633_0252472 3300046558 Bacteria 805
756 Ga0495633_0271883 3300046558 Bacteria 771
757 Ga0495667_0080383 3300046559 Bacteria 2119
758 Ga0495656_0006560 3300046615 Bacteria 4088
759 Ga0495656_0007454 3300046615 Bacteria 3865
760 Ga0495656_0066211 3300046615 Bacteria 1591
761 Ga0495656_0583482 3300046615 Bacteria 597
762 Ga0495668_0043443 3300046616 Bacteria 2500
763 Ga0495668_0134784 3300046616 Bacteria 1351
764 Ga0495668_0280810 3300046616 Bacteria 912
765 Ga0495668_0340212 3300046616 Bacteria 823
766 Ga0495634_0143811 3300046642 Bacteria 1512
767 Ga0495634_0374191 3300046642 Bacteria 850
768 Ga0495611_0171757 3300046648 Bacteria 1013
769 Ga0495625_0104617 3300046660 Bacteria 1940
770 Ga0495625_0148767 3300046660 Bacteria 1575
771 Ga0495625_0336795 3300046660 Bacteria 957
772 Ga0495625_0377979 3300046660 Bacteria 889
773 Ga0495635_0087265 3300046663 Bacteria 2135
774 Ga0495659_0009998 3300046664 Bacteria 3036
775 Ga0495659_0277614 3300046664 Bacteria 703
776 Ga0495661_0103581 3300046665 Bacteria 1597
777 Ga0495661_0297927 3300046665 Bacteria 808
778 Ga0495588_0178527 3300046674 Bacteria 1122
779 Ga0495588_0203667 3300046674 Bacteria 1045
780 Ga0495588_0297053 3300046674 Bacteria 851
781 Ga0495657_0403820 3300046675 Bacteria 804
782 Ga0495599_0001359 3300046678 Bacteria 13977
783 Ga0495623_0006317 3300046679 Bacteria 7704
784 Ga0495646_0461471 3300046680 Bacteria 655
785 Ga0495658_0232273 3300046683 Bacteria 1157
786 Ga0495658_0385180 3300046683 Bacteria 893
787 Ga0495669_0220294 3300046684 Bacteria 909
788 Ga0495669_0279449 3300046684 Bacteria 803
789 Ga0495613_0150544 3300046689 Bacteria 1660
790 Ga0495613_0337159 3300046689 Bacteria 1038
791 Ga0495624_0179967 3300046690 Bacteria 1289
792 Ga0495670_0039435 3300046691 Bacteria 2356
793 Ga0495670_0115351 3300046691 Bacteria 1392
794 Ga0495670_0185694 3300046691 Bacteria 1099
795 Ga0495671_0001942 3300046692 Bacteria 13261
796 Ga0495649_0003779 3300046694 Bacteria 10042
797 Ga0495589_0188912 3300046794 Bacteria 975
798 Ga0495660_0011983 3300046810 Bacteria 5029
799 Ga0495660_0069559 3300046810 Bacteria 1871
800 Ga0495581_0477963 3300047315 Bacteria 725
801 Ga0495604_0001128 3300047317 Bacteria 22177
802 Ga0495636_0051155 3300047318 Bacteria 1731
803 Ga0495636_0065206 3300047318 Bacteria 1547
804 Ga0495674_0668443 3300047319 Bacteria 818
805 Ga0495672_0014087 3300047320 Bacteria 5489
806 Ga0495676_0059100 3300047321 Bacteria 3013
807 Ga0495676_0324590 3300047321 Bacteria 1033
808 Ga0495687_000454 3300047443 Bacteria 50500
809 Ga0495687_003986 3300047443 Bacteria 10282
810 Ga0495687_007598 3300047443 Bacteria 6350
811 Ga0495675_0577708 3300047444 Bacteria 639
812 Ga0495677_0109037 3300047445 Bacteria 1052
813 Ga0495673_0145614 3300047469 Bacteria 920
814 Ga0495681_0144134 3300047470 Bacteria 1004
815 Ga0495681_0166736 3300047470 Bacteria 914
816 Ga0495686_0096145 3300047472 Bacteria 1793
817 Ga0495686_0247005 3300047472 Bacteria 1004
818 Ga0495593_0019013 3300047673 Bacteria 3855
819 Ga0495593_0072165 3300047673 Bacteria 1793
820 Ga0495602_0471732 3300048088 Bacteria 882
821 Ga0495614_0062248 3300048089 Bacteria 1603
822 Ga0495615_0000971 3300048090 Bacteria 4074
823 Ga0495615_0038722 3300048090 Bacteria 1180
824 Ga0496100_0021706 3300048903 Bacteria 3872
825 Ga0496101_0006611 3300048904 Bacteria 7470
826 Ga0496101_0014125 3300048904 Bacteria 5362
827 Ga0496101_0372094 3300048904 Bacteria 1124
828 Ga0496101_1153634 3300048904 Bacteria 608
829 Ga0496102_0018035 3300048905 Bacteria 6194
830 Ga0496102_0144286 3300048905 Bacteria 2233
831 Ga0496102_0368963 3300048905 Bacteria 1351
832 Ga0496102_0426939 3300048905 Bacteria 1245
833 Ga0496102_0440083 3300048905 Bacteria 1223
834 Ga0496103_0050404 3300048906 Bacteria 2575
835 Ga0496103_0395196 3300048906 Bacteria 888
836 Ga0496104_0000537 3300048907 Bacteria 32588
837 Ga0496104_0004825 3300048907 Bacteria 11751
838 Ga0496104_0011832 3300048907 Bacteria 7830
839 Ga0496104_0636087 3300048907 Bacteria 976
840 Ga0496105_0014924 3300048908 Bacteria 6184
841 Ga0496105_0040565 3300048908 Bacteria 3838
842 Ga0496105_0056143 3300048908 Bacteria 3251
843 Ga0496106_0226243 3300048909 Bacteria 1492
844 Ga0496106_0284724 3300048909 Bacteria 1324
845 Ga0496106_0312225 3300048909 Bacteria 1261
846 Ga0496107_0039012 3300048910 Bacteria 3407
847 Ga0496107_0293698 3300048910 Bacteria 1210
848 Ga0496107_0850197 3300048910 Bacteria 667
849 Ga0496108_0066093 3300048911 Bacteria 3049
850 Ga0496108_0081616 3300048911 Bacteria 2740
851 Ga0496108_0150792 3300048911 Bacteria 2006
852 Ga0496108_0861720 3300048911 Bacteria 779
853 Ga0496108_1474605 3300048911 Bacteria 567
854 Ga0496109_0087720 3300048912 Bacteria 2874
855 Ga0496109_0391540 3300048912 Bacteria 1313
856 Ga0496110_0058046 3300048913 Bacteria 3408
857 Ga0496110_0400131 3300048913 Bacteria 1252
858 Ga0496110_0490069 3300048913 Bacteria 1119
859 Ga0496110_0496476 3300048913 Bacteria 1111
860 Ga0496111_0036982 3300048914 Bacteria 3492
861 Ga0496111_0045794 3300048914 Bacteria 3148
862 Ga0496111_0112765 3300048914 Bacteria 2003
863 Ga0496111_0201283 3300048914 Bacteria 1480
864 Ga0496111_0272830 3300048914 Bacteria 1255
865 Ga0496111_0433882 3300048914 Bacteria 970
866 Ga0496112_0000035 3300048915 Bacteria 106983
867 Ga0496112_0296964 3300048915 Bacteria 1561
868 Ga0496112_0686115 3300048915 Bacteria 952
869 Ga0496112_0862064 3300048915 Bacteria 829
870 Ga0496113_0045494 3300048916 Bacteria 3256
871 Ga0496114_0170792 3300048917 Bacteria 1895
872 Ga0496114_0391617 3300048917 Bacteria 1230
873 Ga0496114_0507988 3300048917 Bacteria 1066
874 Ga0496115_0265483 3300048918 Bacteria 1411
875 Ga0496115_0431840 3300048918 Bacteria 1066
876 Ga0496116_0025379 3300048919 Bacteria 4358
877 Ga0496117_0022719 3300048920 Bacteria 5023
878 Ga0496117_0193301 3300048920 Bacteria 1156
879 Ga0496118_0017843 3300048921 Bacteria 6438
880 Ga0496118_0195702 3300048921 Bacteria 1204
881 Ga0496119_0101374 3300048922 Bacteria 1616
882 Ga0496121_0030123 3300048924 Bacteria 4992
883 Ga0496121_0045922 3300048924 Bacteria 3746
884 Ga0496121_0342173 3300048924 Bacteria 999
885 Ga0496121_0516092 3300048924 Bacteria 755
886 Ga0496122_0014937 3300048925 Bacteria 7471
887 Ga0496122_0075668 3300048925 Bacteria 2373
888 Ga0496122_0164552 3300048925 Bacteria 1347
889 Ga0496123_0041873 3300048926 Bacteria 3169
890 Ga0496123_0154698 3300048926 Bacteria 1231
891 Ga0496124_0011741 3300048927 Bacteria 8736
892 Ga0496125_0050182 3300048928 Bacteria 3457
893 Ga0496125_0258353 3300048928 Bacteria 1093
894 Ga0496126_0003472 3300048929 Bacteria 19892
895 Ga0496126_0052471 3300048929 Bacteria 3705
896 Ga0496126_0169399 3300048929 Bacteria 1862
897 Ga0495682_0071438 3300049460 Bacteria 1249
898 Ga0501034_0087141 3300049571 Bacteria 3122
899 Ga0501039_0132296 3300049575 Bacteria 1958
900 Ga0501043_0232610 3300049579 Bacteria 1423
901 Ga0501048_0619211 3300049582 Bacteria 777
902 Ga0501067_0331420 3300049583 Bacteria 848
903 Ga0501069_0153590 3300049585 Bacteria 1324
904 Ga0501075_0741675 3300049591 Bacteria 748
905 Ga0501076_0522117 3300049592 Bacteria 979
906 Ga0501079_0102231 3300049741 Bacteria 2223
907 Ga0501080_0062757 3300049742 Bacteria 3458
908 Ga0501080_1201459 3300049742 Bacteria 652
909 Ga0501035_0302515 3300049822 Bacteria 1347
910 Ga0501044_0270157 3300049823 Bacteria 1636
911 nmdc:mga03683_20442_c1 3300050489 Bacteria 2540
912 nmdc:mga03683_23202_c1 3300050489 Bacteria 2414
913 nmdc:mga03683_269461_c1 3300050489 Bacteria 794
914 nmdc:mga03683_371901_c1 3300050489 Bacteria 679
915 nmdc:mga03683_99957_c1 3300050489 Bacteria 774
916 nmdc:mga03n38_20900_c1 3300050490 Bacteria 2626
917 nmdc:mga03n38_3607_c1 3300050490 Bacteria 5004
918 nmdc:mga03n38_723420_c1 3300050490 Bacteria 575
919 nmdc:mga00v17_256487_c1 3300050491 Bacteria 1134
920 nmdc:mga00v17_261525_c1 3300050491 Bacteria 1123
921 nmdc:mga0yw44_128590_c1 3300050492 Bacteria 1638
922 nmdc:mga0yw44_47856_c1 3300050492 Bacteria 2576
923 nmdc:mga0yw44_606624_c1 3300050492 Bacteria 744
924 nmdc:mga0yw44_67988_c1 3300050492 Bacteria 2203
925 nmdc:mga0yw44_731544_c1 3300050492 Bacteria 672
926 nmdc:mga0yw44_90214_c1 3300050492 Bacteria 1936
927 nmdc:mga0k408_155748_c1 3300050493 Bacteria 1361
928 nmdc:mga0k408_203237_c1 3300050493 Bacteria 1183
929 nmdc:mga0k408_238751_c1 3300050493 Bacteria 1085
930 nmdc:mga0k408_2540_c1 3300050493 Bacteria 9702
931 nmdc:mga0k408_276333_c1 3300050493 Bacteria 1003
932 nmdc:mga0k408_59463_c1 3300050493 Bacteria 2220
933 nmdc:mga0k408_62427_c1 3300050493 Bacteria 2167
934 nmdc:mga0k408_68971_c1 3300050493 Bacteria 2063
935 nmdc:mga06z11_112438_c1 3300050494 Bacteria 1510
936 nmdc:mga06z11_124950_c1 3300050494 Bacteria 1439
937 nmdc:mga06z11_177704_c1 3300050494 Bacteria 1226
938 nmdc:mga06z11_195557_c1 3300050494 Bacteria 1172
939 nmdc:mga04h51_72127_c1 3300050495 Bacteria 1208
940 nmdc:mga07m45_12108_c1 3300050496 Bacteria 4552
941 nmdc:mga07m45_13479_c1 3300050496 Bacteria 4339
942 nmdc:mga07m45_15545_c1 3300050496 Bacteria 4064
943 nmdc:mga07m45_210824_c1 3300050496 Bacteria 1130
944 nmdc:mga07m45_217611_c1 3300050496 Bacteria 1111
945 nmdc:mga07m45_24491_c1 3300050496 Bacteria 3307
946 nmdc:mga07m45_384765_c1 3300050496 Bacteria 815
947 nmdc:mga07m45_59332_c1 3300050496 Bacteria 2165
948 nmdc:mga07m45_6630_c1 3300050496 Bacteria 5869
949 nmdc:mga07m45_69720_c1 3300050496 Bacteria 1999
950 nmdc:mga07m45_76360_c1 3300050496 Bacteria 1910
951 nmdc:mga07m45_76816_c1 3300050496 Bacteria 1904
952 nmdc:mga07m45_85945_c2 3300050496 Bacteria 1337
953 nmdc:mga07m45_94757_c1 3300050496 Bacteria 1712
954 nmdc:mga07m45_98007_c1 3300050496 Bacteria 1683
955 nmdc:mga05p37_1181895_c1 3300050507 Bacteria 792
956 nmdc:mga05p37_299011_c1 3300050507 Bacteria 1913
957 nmdc:mga0qj67_313310_c1 3300050509 Bacteria 1270
958 nmdc:mga0qj67_48786_c1 3300050509 Bacteria 3345
959 nmdc:mga06r32_292876_c1 3300050510 Bacteria 1614
960 nmdc:mga08y16_266904_c1 3300050511 Bacteria 1767
961 nmdc:mga08y16_472713_c1 3300050511 Bacteria 1276
962 nmdc:mga08y16_547556_c1 3300050511 Bacteria 1171
963 nmdc:mga0n895_247511_c1 3300050512 Bacteria 1809
964 nmdc:mga0n895_811229_c1 3300050512 Bacteria 926
965 nmdc:mga0rr50_617544_c1 3300050513 Bacteria 924
966 nmdc:mga0a205_92616_c1 3300050515 Bacteria 2920
967 nmdc:mga0sz30_26942_c1 3300050516 Bacteria 2359
968 nmdc:mga0sz30_343609_c1 3300050516 Bacteria 667
969 nmdc:mga0sz30_86946_c1 3300050516 Bacteria 1357
970 nmdc:mga0sz30_95_c1 3300050516 Bacteria 33938
971 Ga0495601_0000048 3300053077 Bacteria 69310
972 Ga0495601_0013653 3300053077 Bacteria 4885
973 Ga0500610_0012836 3300053079 Bacteria 3874
974 Ga0500610_0013055 3300053079 Bacteria 3849
975 Ga0495655_0073347 3300053083 Bacteria 962
976 Ga0495655_0222123 3300053083 Bacteria 626
977 Ga0495595_0001916 3300053084 Bacteria 8078
978 Ga0495619_0051116 3300053085 Bacteria 2730
979 Ga0495619_0088889 3300053085 Bacteria 2090
980 Ga0495619_0310887 3300053085 Bacteria 1091
981 Ga0500643_001860 3300053087 Bacteria 11508
982 Ga0500644_0106454 3300053088 Bacteria 1074
983 Ga0500646_0260617 3300053090 Bacteria 613
984 Ga0500651_0000071 3300053093 Bacteria 66345
985 Ga0500566_0023831 3300053094 Bacteria 3594
986 Ga0500566_0068470 3300053094 Bacteria 1996
987 Ga0500641_0116669 3300053096 Bacteria 1150
988 Ga0500641_0140205 3300053096 Bacteria 1044
989 Ga0500641_0170957 3300053096 Bacteria 935
990 Ga0500555_056513 3300053103 Bacteria 1064
991 Ga0500571_000033 3300053110 Bacteria 44174
992 Ga0500572_012363 3300053111 Bacteria 2091
993 Ga0500593_000083 3300053117 Bacteria 34404
994 Ga0500594_0000739 3300053118 Bacteria 6940
995 Ga0500594_0107477 3300053118 Bacteria 865
996 Ga0500595_000333 3300053119 Bacteria 30925
997 Ga0500607_000789 3300053121 Bacteria 30582
998 Ga0500607_054964 3300053121 Bacteria 2106
999 Ga0500608_006602 3300053122 Bacteria 4734
1000 Ga0500608_258868 3300053122 Bacteria 673
1001 Ga0500626_010098 3300053128 Bacteria 3951
1002 Ga0500655_000311 3300053133 Bacteria 11006
1003 Ga0500655_020268 3300053133 Bacteria 1241
1004 Ga0500658_0000163 3300053134 Bacteria 32020
1005 Ga0500658_0000277 3300053134 Bacteria 23365
1006 Ga0500658_0281944 3300053134 Bacteria 764
1007 Ga0500559_0005246 3300053136 Bacteria 5974
1008 Ga0500561_0129143 3300053137 Bacteria 776
1009 Ga0500568_0003208 3300053139 Bacteria 9288
1010 Ga0500568_0012568 3300053139 Bacteria 3887
1011 Ga0500574_002832 3300053141 Bacteria 2946
1012 Ga0500603_000540 3300053150 Bacteria 9573
1013 Ga0500616_0051330 3300053153 Bacteria 2173
1014 Ga0500627_0002100 3300053158 Bacteria 5778
1015 Ga0500627_0313020 3300053158 Bacteria 683
1016 Ga0500633_0088609 3300053160 Bacteria 1128
1017 Ga0500633_0209149 3300053160 Bacteria 730
1018 Ga0500634_0019369 3300053161 Bacteria 3666
1019 Ga0500634_0031309 3300053161 Bacteria 2901
1020 Ga0500634_0089711 3300053161 Bacteria 1564
1021 Ga0500638_000857 3300053162 Bacteria 8514
1022 Ga0500638_007384 3300053162 Bacteria 4593
1023 Ga0500636_0025244 3300053177 Bacteria 3511
1024 Ga0500637_0000060 3300053178 Bacteria 38881
1025 Ga0500645_086401 3300053730 Bacteria 892
1026 Ga0500565_028234 3300053734 Bacteria 722
1027 Ga0500661_003670 3300055283 Bacteria 2884
1028 Ga0500661_023727 3300055283 Bacteria 1086
1029 2513227876 2513020051 Bacteria 6053213
1030 2513694709 2513237101 Bacteria 7952346
1031 2599625146 2599185214 Bacteria 8209958
1032 2599673402 2599185226 Bacteria 8233575
1033 2599683072 2599185227 Bacteria 8246414
1034 2599695010 2599185229 Bacteria 8216126
1035 2644328409 2643221658 Bacteria 6064537
1036 2644397478 2643221672 Bacteria 6322190
1037 2738722484 2738541277 Bacteria 7458140
1038 2738885414 2738541307 Bacteria 8606193
1039 2739251984 2738543013 Bacteria 5618633
1040 2739283055 2738543019 Bacteria 7459457
1041 2793077976
1042 2819600736 2818991446 Bacteria 7757362
1043 2831267318 2831265667 Bacteria 7184833
1044 2838060295 2838054893 Bacteria 7451788
1045 2874610157 2874604998 Bacteria 7834745
1046 2876815712 2876808645 Bacteria 8824342
1047 2879117033 2879110137 Bacteria 8907982
1048 2885198400 2885198086 Bacteria 7212419
1049 2885212220 2885211737 Bacteria 7212420
1050 2899931712 2899924645 Bacteria 7487985
1051 2904547522 2904541872 Bacteria 8915136
1052 2922366747 2922361189 Bacteria 7436256
1053 2922389350 2922386360 Bacteria 7017218
1054 2928043094 2928037797 Bacteria 7273642
1055 2928050247 2928044640 Bacteria 7271509
1056 2928056726 2928051484 Bacteria 7773759
1057 2928068814 2928064002 Bacteria 7419480
1058 2928075767 2928070936 Bacteria 8062541
1059 2928090314 2928084124 Bacteria 7159212
1060 2929164976 2929160207 Bacteria 9075316
1061 2945910393 2945909444 Bacteria 7065066
1062 2945987558 2945984333 Bacteria 7358892
1063 2954771109 2954767861 Bacteria 5535784
1064 8006993171 8006984368 Bacteria 9651211
1065 8056678196 8056673599 Bacteria 7871253
1066 Ga0395901_0851689
1067 JGI24740J21852_10021053
1068 JGI24735J21928_10075636
1069 JGI25158J39367_1007100
1070 JGI25152J39213_1008884
1071 JGI25150J39212_1010324
1072 JGI25150J39212_1033110
1073 JGI25159J45721_1003181
1074 JGI25159J45721_1019013
1075 JGI25151J46595_10026451
1076 JGI25406J46586_10000233
1077 JGI25406J46586_10022537
1078 JGI25153J46596_10002553
1079 JGI25153J46596_10030668
1080 rootH1_10067490
1081 JGI25160J50197_1001363
1082 JGI25160J50197_1004644
1083 JGI25161J50226_1002632
1084 JGI25161J50226_1009988
1085 JGI25404J52841_10004643
1086 JGI25404J52841_10008463
1087 JGI25404J52841_10012135
1088 JGI25404J52841_10024208
1089 JGI25404J52841_10039658
1090 JGI25404J52841_10095463
1091 Ga0055527_1007840
1092 Ga0055535_1000181
1093 Ga0055542_1000070
1094 Ga0055526_1007214
1095 Ga0055526_1008818
1096 Ga0055537_1003344
1097 Ga0055537_1007479
1098 Ga0055524_1006736
1099 Ga0055524_1009023
1100 Ga0055536_1001696
1101 Ga0055536_1008117
1102 Ga0055536_1018110
1103 Ga0055534_1001432
1104 Ga0055534_1013581
1105 Ga0055528_1007183
1106 Ga0055528_1031161
1107 Ga0055530_10000952
1108 Ga0055530_10009915
1109 Ga0055540_1010090
1110 Ga0055540_1028778
1111 Ga0055531_10002573
1112 Ga0055531_10005367
1113 Ga0055531_10011800
1114 Ga0055531_10048604
1115 JGI25405J52794_10037446
1116 Ga0055543_1013689
1117 Ga0055543_1014300
1118 Ga0065165_1003666
1119 Ga0065165_1059322
1120 Ga0065714_10018495
1121 Ga0065714_10019306
1122 Ga0065714_10035760
1123 Ga0065704_10397369
1124 Ga0065715_10026993
1125 Ga0070658_10361288
1126 Ga0070676_10049322
1127 Ga0070683_100071835
1128 Ga0070690_100103269
1129 Ga0070690_100782446
1130 Ga0070670_100062923
1131 Ga0070670_100264917
1132 Ga0070670_100543968
1133 Ga0070670_101103482
1134 Ga0068869_100171337
1135 Ga0068869_100440347
1136 Ga0068869_100646239
1137 Ga0070680_100536919
1138 Ga0068868_100041467
1139 Ga0068868_100263359
1140 Ga0068868_100307909
1141 Ga0068868_100309493
1142 Ga0068868_101366862
1143 Ga0070660_100015341
1144 Ga0070660_100712685
1145 Ga0070689_100387178
1146 Ga0070689_100932072
1147 Ga0070691_10142480
1148 Ga0070691_10180477
1149 Ga0070661_100042792
1150 Ga0070661_100175100
1151 Ga0070668_100939419
1152 Ga0070668_101002817
1153 Ga0070668_101188534
1154 Ga0070668_101335220
1155 Ga0070675_100248897
1156 Ga0070671_100184336
1157 Ga0070674_100007000
1158 Ga0070674_100063913
1159 Ga0070674_100363996
1160 Ga0070673_100143175
1161 Ga0070659_100146861
1162 Ga0070659_100873808
1163 Ga0070659_101894984
1164 Ga0070667_100024212
1165 Ga0070667_100068095
1166 Ga0070667_100173831
1167 Ga0070667_100190538
1168 Ga0070667_101252488
1169 Ga0070705_100901573
1170 Ga0070700_100010807
1171 Ga0070708_100080252
1172 Ga0070663_100027899
1173 Ga0070663_100040079
1174 Ga0070663_100066018
1175 Ga0070663_100237493
1176 Ga0070663_100678710
1177 Ga0070678_100292937
1178 Ga0070678_101450772
1179 Ga0070662_100037931
1180 Ga0070662_100196401
1181 Ga0070662_100268139
1182 Ga0070662_100351551
1183 Ga0070681_10153378
1184 Ga0070681_10460834
1185 Ga0068867_100120843
1186 Ga0068867_100169163
1187 Ga0068867_100171802
1188 Ga0068867_101353323
1189 Ga0070685_10454777
1190 Ga0070706_101008265
1191 Ga0070707_100056627
1192 Ga0070698_100301976
1193 Ga0070679_100515236
1194 Ga0070684_100049588
1195 Ga0070684_100053370
1196 Ga0070684_100520395
1197 Ga0070697_100175946
1198 Ga0070697_100583683
1199 Ga0068853_100070695
1200 Ga0068853_100080072
1201 Ga0068853_100291441
1202 Ga0070672_100031656
1203 Ga0070672_100047861
1204 Ga0070672_100423690
1205 Ga0070672_100447801
1206 Ga0070695_101046797
1207 Ga0070665_100145695
1208 Ga0070665_100164868
1209 Ga0070665_100313478
1210 Ga0070665_100904033
1211 Ga0070704_100131020
1212 Ga0068855_100126649
1213 Ga0068855_100335750
1214 Ga0068855_100373254
1215 Ga0068855_101052839
1216 Ga0070664_100277606
1217 Ga0070664_100336963
1218 Ga0068857_100026204
1219 Ga0068857_100117348
1220 Ga0068857_100535826
1221 Ga0068857_101297358
1222 Ga0068854_100190571
1223 Ga0068854_100209311
1224 Ga0068854_100701308
1225 Ga0068854_101159319
1226 Ga0068856_100028388
1227 Ga0068856_100464903
1228 Ga0068856_100637094
1229 Ga0068856_100697178
1230 Ga0070702_100092435
1231 Ga0068852_100057569
1232 Ga0068852_100129342
1233 Ga0068859_101139072
1234 Ga0068866_10069758
1235 Ga0068861_100003730
1236 Ga0068861_100265171
1237 Ga0068861_100540060
1238 Ga0068851_10011436
1239 Ga0068870_10417856
1240 Ga0068870_10651351
1241 Ga0068863_100750898
1242 Ga0068858_100329235
1243 Ga0068858_100689531
1244 Ga0068860_100022098
1245 Ga0068860_100484213
1246 Ga0068860_100485726
1247 Ga0068860_100836486
1248 Ga0068862_100067403
1249 Ga0068862_100126298
1250 Ga0068862_100325251
1251 Ga0068862_100727212
1252 Ga0081455_10002140
1253 Ga0081455_10011235
1254 Ga0081455_10020632
1255 Ga0081455_10038013
1256 Ga0081538_10064867
1257 Ga0081540_1002866
1258 Ga0081540_1018952
1259 Ga0081540_1021799
1260 Ga0081540_1028548
1261 Ga0081540_1043578
1262 Ga0081540_1072595
1263 Ga0081540_1079257
1264 Ga0081540_1197938
1265 Ga0081539_10000157
1266 Ga0081539_10002599
1267 Ga0081539_10044556
1268 Ga0081539_10045305
1269 Ga0070717_10994929
1270 Ga0075365_10025036
1271 Ga0075365_10160637
1272 Ga0075365_10296160
1273 Ga0075365_10531405
1274 Ga0075368_10067497
1275 Ga0075363_100133737
1276 Ga0075363_100224768
1277 Ga0075363_100368667
1278 Ga0075364_10128844
1279 Ga0075364_10332774
1280 Ga0070716_100259333
1281 Ga0070716_100332648
1282 Ga0070712_100178805
1283 Ga0075362_10004627
1284 Ga0075362_10062462
1285 Ga0075362_10102779
1286 Ga0075362_10131650
1287 Ga0075362_10323123
1288 Ga0075362_10350663
1289 Ga0075367_10005584
1290 Ga0075367_10017641
1291 Ga0075367_10034473
1292 Ga0075367_10046736
1293 Ga0075367_10216360
1294 Ga0075369_10000214
1295 Ga0075369_10024234
1296 Ga0075369_10201466
1297 Ga0075369_10255381
1298 Ga0075366_10001920
1299 Ga0075366_10026156
1300 Ga0075366_10043155
1301 Ga0075366_10072549
1302 Ga0075366_10093438
1303 Ga0075366_10097484
1304 Ga0075366_10104047
1305 Ga0075366_10278006
1306 Ga0075366_10559195
1307 Ga0075366_10670053
1308 Ga0097621_100111264
1309 Ga0097621_100213605
1310 Ga0097621_100894611
1311 Ga0097621_101323344
1312 Ga0075370_10012893
1313 Ga0075370_10020752
1314 Ga0075370_10021432
1315 Ga0075370_10027627
1316 Ga0075370_10034702
1317 Ga0075370_10050650
1318 Ga0075370_10061122
1319 Ga0075370_10074703
1320 Ga0075370_10093647
1321 Ga0075370_10235180
1322 Ga0075370_10308439
1323 Ga0075370_10343251
1324 Ga0068871_100295793
1325 Ga0068871_100681498
1326 Ga0075428_100074682
1327 Ga0075428_100271762
1328 Ga0075434_100066669
1329 Ga0075434_100502909
1330 Ga0075434_100757784
1331 Ga0075429_100298751
1332 Ga0075429_100666500
1333 Ga0068865_100008038
1334 Ga0068865_100008510
1335 Ga0068865_100078906
1336 Ga0097620_100295642
1337 Ga0097620_101139045
1338 Ga0099794_10025065
1339 Ga0099795_10011076
1340 Ga0099795_10011242
1341 Ga0105251_10112116
1342 Ga0105251_10170878
1343 Ga0105244_10001808
1344 Ga0105244_10117530
1345 Ga0105240_10020996
1346 Ga0105240_10033754
1347 Ga0105240_10360192
1348 Ga0105240_10556453
1349 Ga0105240_10908124
1350 Ga0105245_10032198
1351 Ga0105245_11021823
1352 Ga0105247_10159724
1353 Ga0114129_10172553
1354 Ga0114129_10749472
1355 Ga0105243_10004605
1356 Ga0105243_10123866
1357 Ga0105243_10217937
1358 Ga0105243_10521346
1359 Ga0105241_10269478
1360 Ga0105241_10355410
1361 Ga0105241_10957463
1362 Ga0105241_11469211
1363 Ga0105242_10133944
1364 Ga0105242_11086888
1365 Ga0105248_10137439
1366 Ga0105248_10616910
1367 Ga0105237_10146882
1368 Ga0105237_10231551
1369 Ga0105237_10284748
1370 Ga0105237_10466298
1371 Ga0105238_10047527
1372 Ga0105238_10053482
1373 Ga0105238_10133367
1374 Ga0105238_10248355
1375 Ga0105249_10197882
1376 Ga0105249_10259582
1377 Ga0105249_10260782
1378 Ga0099796_10014598
1379 Ga0099796_10133414
1380 Ga0105239_10096774
1381 Ga0105239_10257650
1382 Ga0105239_10290619
1383 Ga0105239_11165572
1384 Ga0105246_10312740
1385 Ga0105246_10898104
1386 Ga0105246_11046276
1387 Ga0157322_1023870
1388 Ga0157323_1012656
1389 Ga0157339_1005354
1390 Ga0157342_1021807
1391 Ga0157316_1010668
1392 Ga0157373_10040974
1393 Ga0157370_10018806
1394 Ga0157370_10225228
1395 Ga0157370_10393617
1396 Ga0157369_10005188
1397 Ga0157369_10067774
1398 Ga0157369_10113059
1399 Ga0157369_10319087
1400 Ga0157374_10439352
1401 Ga0157378_10181786
1402 Ga0157378_10300338
1403 Ga0163162_10005487
1404 Ga0163162_10377705
1405 Ga0163162_10426928
1406 Ga0163162_10438690
1407 Ga0163162_11559706
1408 Ga0157372_10060142
1409 Ga0157372_10082216
1410 Ga0157372_11303363
1411 Ga0157375_10358940
1412 Ga0157375_10361348
1413 Ga0157375_10586040
1414 Ga0163163_10010769
1415 Ga0163163_10334055
1416 Ga0163163_10371961
1417 Ga0157380_10135348
1418 Ga0182008_10001754
1419 Ga0182008_10001779
1420 Ga0182008_10301146
1421 Ga0157377_10302965
1422 Ga0157379_10067835
1423 Ga0157379_10155995
1424 Ga0157379_10215452
1425 Ga0157376_10003714
1426 Ga0157376_10491700
1427 Ga0157376_10849912
1428 Ga0182006_1002899
1429 Ga0182006_1028074
1430 Ga0182007_10002457
1431 Ga0182007_10003387
1432 Ga0182005_1048462
1433 Ga0183362_10001
1434 Ga0163161_10000554
1435 Ga0163161_10043568
1436 Ga0163161_10047639
1437 Ga0206356_11249118
1438 Ga0209436_101997
1439 Ga0209672_102600
1440 Ga0209147_100818
1441 Ga0209258_100018
1442 Ga0207425_1000579
1443 Ga0209148_1000030
1444 Ga0209129_1000114
1445 Ga0209129_1001990
1446 Ga0209129_1002798
1447 Ga0209565_1001445
1448 Ga0209565_1003173
1449 Ga0209673_1000417
1450 Ga0209673_1003002
1451 Ga0209130_1000997
1452 Ga0209130_1001138
1453 Ga0209130_1002198
1454 Ga0209130_1004584
1455 Ga0209675_1009639
1456 Ga0209675_1031059
1457 Ga0209676_1000004
1458 Ga0209676_1000538
1459 Ga0209676_1013442
1460 Ga0209676_1031154
1461 Ga0209025_1000343
1462 Ga0209025_1004621
1463 Ga0209025_1011201
1464 Ga0209025_1043412
1465 Ga0209564_1000070
1466 Ga0209564_1000295
1467 Ga0209564_1025311
1468 Ga0209758_1000180
1469 Ga0209758_1005089
1470 Ga0209758_1020867
1471 Ga0209758_1044076
1472 Ga0209050_1000002
1473 Ga0209050_1007320
1474 Ga0209050_1015534
1475 Ga0209256_1000047
1476 Ga0209256_1000157
1477 Ga0207426_1000184
1478 Ga0207426_1000204
1479 Ga0209051_1000002
1480 Ga0209051_1000820
1481 Ga0209051_1003554
1482 Ga0209051_1016772
1483 Ga0209257_1000002
1484 Ga0209257_1000096
1485 Ga0209257_1000149
1486 Ga0209257_1003517
1487 Ga0209257_1011042
1488 Ga0207655_1002512
1489 Ga0207655_1135937
1490 Ga0207653_10028276
1491 Ga0207682_10174381
1492 Ga0207642_10077529
1493 Ga0207710_10082799
1494 Ga0207688_10046362
1495 Ga0207688_10433666
1496 Ga0207680_10521540
1497 Ga0207647_10224956
1498 Ga0207645_10162232
1499 Ga0207643_10341290
1500 Ga0207705_10018984
1501 Ga0207705_10293441
1502 Ga0207705_10445903
1503 Ga0207684_10008664
1504 Ga0207684_10880578
1505 Ga0207654_10590207
1506 Ga0207707_10000613
1507 Ga0207695_10224579
1508 Ga0207695_10231748
1509 Ga0207695_10282140
1510 Ga0207695_10439023
1511 Ga0207671_10021771
1512 Ga0207671_10087793
1513 Ga0207671_10532643
1514 Ga0207663_10105327
1515 Ga0207660_10015097
1516 Ga0207660_10608673
1517 Ga0207657_10021660
1518 Ga0207657_10513331
1519 Ga0207649_10090170
1520 Ga0207649_10164082
1521 Ga0207649_10711924
1522 Ga0207652_10023997
1523 Ga0207652_10119188
1524 Ga0207646_10099838
1525 Ga0207681_11373958
1526 Ga0207694_10046553
1527 Ga0207694_10077217
1528 Ga0207694_10221004
1529 Ga0207694_10264525
1530 Ga0207694_10578726
1531 Ga0207650_10343713
1532 Ga0207650_10424857
1533 Ga0207659_10530613
1534 Ga0207659_10694060
1535 Ga0207687_10084331
1536 Ga0207644_10052900
1537 Ga0207690_10109417
1538 Ga0207690_10259522
1539 Ga0207690_10377018
1540 Ga0207690_10536464
1541 Ga0207690_10719922
1542 Ga0207690_10825397
1543 Ga0207706_10113136
1544 Ga0207706_10288281
1545 Ga0207706_11357269
1546 Ga0207686_10085193
1547 Ga0207686_10883532
1548 Ga0207709_10012501
1549 Ga0207709_10102910
1550 Ga0207670_10261547
1551 Ga0207670_10820931
1552 Ga0207669_10039682
1553 Ga0207669_10530855
1554 Ga0207704_10026450
1555 Ga0207704_10103145
1556 Ga0207704_10182716
1557 Ga0207691_10586937
1558 Ga0207691_10871044
1559 Ga0207689_10111455
1560 Ga0207689_10267866
1561 Ga0207661_10039366
1562 Ga0207661_10279575
1563 Ga0207679_10037172
1564 Ga0207679_10058416
1565 Ga0207679_10333550
1566 Ga0207667_10028504
1567 Ga0207667_10109036
1568 Ga0207667_10444399
1569 Ga0207651_10102168
1570 Ga0207651_10359083
1571 Ga0207712_10137505
1572 Ga0207712_10262372
1573 Ga0207712_10265375
1574 Ga0207668_10025674
1575 Ga0207668_10269689
1576 Ga0207668_10717025
1577 Ga0207640_10039886
1578 Ga0207640_10156521
1579 Ga0207640_10234272
1580 Ga0207640_10637684
1581 Ga0207658_10088692
1582 Ga0207658_10239814
1583 Ga0207658_10254518
1584 Ga0207658_10602331
1585 Ga0207658_10804100
1586 Ga0207677_10037687
1587 Ga0207677_10120554
1588 Ga0207703_10329839
1589 Ga0207703_10559626
1590 Ga0207703_10572846
1591 Ga0207639_10018068
1592 Ga0207639_10056817
1593 Ga0207639_10119099
1594 Ga0207678_10051459
1595 Ga0207678_10063191
1596 Ga0207678_10084486
1597 Ga0207678_10085166
1598 Ga0207678_10127217
1599 Ga0207678_10350281
1600 Ga0207708_10017331
1601 Ga0207708_10085748
1602 Ga0207702_11423424
1603 Ga0207641_10614958
1604 Ga0207641_10622035
1605 Ga0207641_10774829
1606 Ga0207648_10006213
1607 Ga0207648_10059935
1608 Ga0207648_10126250
1609 Ga0207648_10218714
1610 Ga0207676_10037774
1611 Ga0207674_10102413
1612 Ga0207674_10135758
1613 Ga0207674_10138132
1614 Ga0207674_10270306
1615 Ga0207674_10424457
1616 Ga0207674_10618827
1617 Ga0207675_100015760
1618 Ga0207675_100148877
1619 Ga0207675_100294218
1620 Ga0207675_100983785
1621 Ga0207683_10070377
1622 Ga0207683_10154825
1623 Ga0207683_10362082
1624 Ga0207683_10454574
1625 Ga0207698_10171166
1626 Ga0207698_10348204
1627 Ga0207698_11204436
1628 Ga0209588_1021371
1629 Ga0268266_10003191
1630 Ga0268266_10018212
1631 Ga0268266_10088853
1632 Ga0268266_10299308
1633 Ga0268266_10679708
1634 Ga0268266_10695368
1635 Ga0268265_10119385
1636 Ga0268265_10448564
1637 Ga0268265_10644054
1638 Ga0268265_10823801
1639 Ga0268264_10650633
1640 Ga0265337_1016314
1641 Ga0307517_10010277
1642 Ga0307517_10248972
1643 Ga0307515_10351259
1644 Ga0307515_10428172
1645 Ga0307515_10499810
1646 Ga0265338_10159825
1647 Ga0307512_10251225
1648 Ga0316182_1331932
1649 Ga0265330_10022510
1650 Ga0265325_10027929
1651 Ga0265325_10031667
1652 Ga0265325_10294432
1653 Ga0265339_10009653
1654 Ga0265327_10000851
1655 Ga0265316_10037388
1656 Ga0265316_10081542
1657 Ga0265316_10090976
1658 Ga0307513_10134134
1659 Ga0307513_10270685
1660 Ga0307513_10400042
1661 Ga0307509_10086316
1662 Ga0307408_100426605
1663 Ga0265313_10000062
1664 Ga0265313_10001372
1665 Ga0265313_10024898
1666 Ga0265313_10061361
1667 Ga0265313_10067779
1668 Ga0307508_10357034
1669 Ga0307514_10485766
1670 Ga0265314_10001182
1671 Ga0265314_10003622
1672 Ga0265314_10281468
1673 Ga0307516_10001245
1674 Ga0307516_10044179
1675 Ga0307516_10175345
1676 Ga0307516_10369622
1677 Ga0307516_10880179
1678 Ga0307405_10245328
1679 Ga0307410_10520184
1680 Ga0307410_11448420
1681 Ga0307406_10437707
1682 Ga0307406_10445914
1683 Ga0307406_10880113
1684 Ga0307407_10083432
1685 Ga0307412_10195692
1686 Ga0307412_10550504
1687 Ga0307412_11326897
1688 Ga0307416_100028565
1689 Ga0307416_100287321
1690 Ga0307416_100850581
1691 Ga0307416_101678654
1692 Ga0307415_100637705
1693 Ga0307510_10182663
1694 Ga0373926_0037109
1695 Ga0373936_0133317
1696 Ga0373939_0001277
1697 Ga0373957_0024419
1698 Ga0373943_0073263
1699 Ga0373943_0196570
1700 Ga0373955_0030881
1701 Ga0373931_0217856
1702 Ga0373931_0248904
1703 Ga0373927_0005689
1704 Ga0373927_0028642
1705 Ga0373927_0382120
1706 Ga0373927_0620632
1707 Ga0373933_0219872
1708 Ga0373947_0017691
1709 Ga0373947_0172392
1710 Ga0373947_0199112
1711 Ga0373947_0409925
1712 Ga0373937_0002154
1713 Ga0373925_0005806
1714 Ga0373925_0329269
1715 Ga0373925_1123280
1716 Ga0395899_0002741
1717 Ga0395899_0038874
1718 Ga0395899_0060710
1719 Ga0395900_0009354
1720 Ga0395900_0056282
1721 Ga0395900_0107563
1722 Ga0395900_0890065
1723 Ga0395898_0148039
1724 Ga0395905_0039610
1725 Ga0395905_0413336
1726 Ga0395905_0528220
1727 Ga0395901_0042375
1728 Ga0395901_0065280
1729 Ga0395901_0114966
1730 Ga0395901_0487733
1731 Ga0436365_0805345
1732 Ga0436360_0035685
1733 Ga0439465_0142733
1734 Ga0451795_0193704
1735 Ga0451807_0994696
1736 Ga0451841_0333288
1737 Ga0451851_0341021
1738 Ga0439463_100494
1739 Ga0439458_0005013
1740 Ga0451577_0111006
1741 Ga0451577_0474877
1742 Ga0466961_0269194
1743 Ga0453684_0003325
1744 Ga0453684_0755369
1745 Ga0466968_0081706
1746 Ga0466957_0452003
1747 Ga0466959_0359736
1748 Ga0451576_0302630
1749 Ga0495617_116035
1750 Ga0495627_004050
1751 Ga0495627_031474
1752 Ga0495592_0001467
1753 Ga0495592_0645095
1754 Ga0495603_0125073
1755 Ga0495603_0274344
1756 Ga0495603_0748615
1757 Ga0495590_0015626
1758 Ga0495590_0049279
1759 Ga0495629_0070519
1760 Ga0495629_0204200
1761 Ga0495629_0500577
1762 Ga0495638_0024829
1763 Ga0495641_0209408
1764 Ga0495641_0328875
1765 Ga0495651_0054642
1766 Ga0495651_0156551
1767 Ga0495653_0325123
1768 Ga0495650_0021840
1769 Ga0495650_0053026
1770 Ga0495650_0079742
1771 Ga0495580_0276651
1772 Ga0495580_0490489
1773 Ga0495582_0077374
1774 Ga0495605_0204643
1775 Ga0495639_0008572
1776 Ga0495639_0320209
1777 Ga0495585_0143880
1778 Ga0495594_0206013
1779 Ga0495594_0219945
1780 Ga0495607_0055080
1781 Ga0495606_0011174
1782 Ga0495606_0114549
1783 Ga0495606_0314392
1784 Ga0495610_0099080
1785 Ga0495616_0005361
1786 Ga0495620_0039477
1787 Ga0495620_0145618
1788 Ga0495628_0003085
1789 Ga0495628_0233259
1790 Ga0495630_0096508
1791 Ga0495630_0406428
1792 Ga0495631_0000271
1793 Ga0495632_0002822
1794 Ga0495632_0074542
1795 Ga0495644_0034321
1796 Ga0495648_0328056
1797 Ga0495663_0013380
1798 Ga0495663_0301502
1799 Ga0495666_0301960
1800 Ga0495642_0069068
1801 Ga0495652_0002252
1802 Ga0495654_0012115
1803 Ga0495654_0204965
1804 Ga0495654_0270648
1805 Ga0495640_0271894
1806 Ga0495586_0055750
1807 Ga0495587_0401068
1808 Ga0495598_0116840
1809 Ga0495609_0043971
1810 Ga0495609_0255209
1811 Ga0495621_0025169
1812 Ga0495621_0252931
1813 Ga0495621_0385596
1814 Ga0495597_0034401
1815 Ga0495645_0000223
1816 Ga0495645_0079139
1817 Ga0495622_0095768
1818 Ga0495622_0163802
1819 Ga0495622_0337975
1820 Ga0495633_0252472
1821 Ga0495633_0271883
1822 Ga0495667_0080383
1823 Ga0495656_0006560
1824 Ga0495656_0007454
1825 Ga0495656_0066211
1826 Ga0495656_0583482
1827 Ga0495668_0043443
1828 Ga0495668_0134784
1829 Ga0495668_0280810
1830 Ga0495668_0340212
1831 Ga0495634_0143811
1832 Ga0495634_0374191
1833 Ga0495611_0171757
1834 Ga0495625_0104617
1835 Ga0495625_0148767
1836 Ga0495625_0336795
1837 Ga0495625_0377979
1838 Ga0495635_0087265
1839 Ga0495659_0009998
1840 Ga0495659_0277614
1841 Ga0495661_0103581
1842 Ga0495661_0297927
1843 Ga0495588_0178527
1844 Ga0495588_0203667
1845 Ga0495588_0297053
1846 Ga0495657_0403820
1847 Ga0495599_0001359
1848 Ga0495623_0006317
1849 Ga0495646_0461471
1850 Ga0495658_0232273
1851 Ga0495658_0385180
1852 Ga0495669_0220294
1853 Ga0495669_0279449
1854 Ga0495613_0150544
1855 Ga0495613_0337159
1856 Ga0495624_0179967
1857 Ga0495670_0039435
1858 Ga0495670_0115351
1859 Ga0495670_0185694
1860 Ga0495671_0001942
1861 Ga0495649_0003779
1862 Ga0495589_0188912
1863 Ga0495660_0011983
1864 Ga0495660_0069559
1865 Ga0495581_0477963
1866 Ga0495604_0001128
1867 Ga0495636_0051155
1868 Ga0495636_0065206
1869 Ga0495674_0668443
1870 Ga0495672_0014087
1871 Ga0495676_0059100
1872 Ga0495676_0324590
1873 Ga0495687_000454
1874 Ga0495687_003986
1875 Ga0495687_007598
1876 Ga0495675_0577708
1877 Ga0495677_0109037
1878 Ga0495673_0145614
1879 Ga0495681_0144134
1880 Ga0495681_0166736
1881 Ga0495686_0096145
1882 Ga0495686_0247005
1883 Ga0495593_0019013
1884 Ga0495593_0072165
1885 Ga0495602_0471732
1886 Ga0495614_0062248
1887 Ga0495615_0000971
1888 Ga0495615_0038722
1889 Ga0496100_0021706
1890 Ga0496101_0006611
1891 Ga0496101_0014125
1892 Ga0496101_0372094
1893 Ga0496101_1153634
1894 Ga0496102_0018035
1895 Ga0496102_0144286
1896 Ga0496102_0368963
1897 Ga0496102_0426939
1898 Ga0496102_0440083
1899 Ga0496103_0050404
1900 Ga0496103_0395196
1901 Ga0496104_0000537
1902 Ga0496104_0004825
1903 Ga0496104_0011832
1904 Ga0496104_0636087
1905 Ga0496105_0014924
1906 Ga0496105_0040565
1907 Ga0496105_0056143
1908 Ga0496106_0226243
1909 Ga0496106_0284724
1910 Ga0496106_0312225
1911 Ga0496107_0039012
1912 Ga0496107_0293698
1913 Ga0496107_0850197
1914 Ga0496108_0066093
1915 Ga0496108_0081616
1916 Ga0496108_0150792
1917 Ga0496108_0861720
1918 Ga0496108_1474605
1919 Ga0496109_0087720
1920 Ga0496109_0391540
1921 Ga0496110_0058046
1922 Ga0496110_0400131
1923 Ga0496110_0490069
1924 Ga0496110_0496476
1925 Ga0496111_0036982
1926 Ga0496111_0045794
1927 Ga0496111_0112765
1928 Ga0496111_0201283
1929 Ga0496111_0272830
1930 Ga0496111_0433882
1931 Ga0496112_0000035
1932 Ga0496112_0296964
1933 Ga0496112_0686115
1934 Ga0496112_0862064
1935 Ga0496113_0045494
1936 Ga0496114_0170792
1937 Ga0496114_0391617
1938 Ga0496114_0507988
1939 Ga0496115_0265483
1940 Ga0496115_0431840
1941 Ga0496116_0025379
1942 Ga0496117_0022719
1943 Ga0496117_0193301
1944 Ga0496118_0017843
1945 Ga0496118_0195702
1946 Ga0496119_0101374
1947 Ga0496121_0030123
1948 Ga0496121_0045922
1949 Ga0496121_0342173
1950 Ga0496121_0516092
1951 Ga0496122_0014937
1952 Ga0496122_0075668
1953 Ga0496122_0164552
1954 Ga0496123_0041873
1955 Ga0496123_0154698
1956 Ga0496124_0011741
1957 Ga0496125_0050182
1958 Ga0496125_0258353
1959 Ga0496126_0003472
1960 Ga0496126_0052471
1961 Ga0496126_0169399
1962 Ga0495682_0071438
1963 Ga0501034_0087141
1964 Ga0501039_0132296
1965 Ga0501043_0232610
1966 Ga0501048_0619211
1967 Ga0501067_0331420
1968 Ga0501069_0153590
1969 Ga0501075_0741675
1970 Ga0501076_0522117
1971 Ga0501079_0102231
1972 Ga0501080_0062757
1973 Ga0501080_1201459
1974 Ga0501035_0302515
1975 Ga0501044_0270157
1976 nmdc:mga03683_20442_c1
1977 nmdc:mga03683_23202_c1
1978 nmdc:mga03683_269461_c1
1979 nmdc:mga03683_371901_c1
1980 nmdc:mga03683_99957_c1
1981 nmdc:mga03n38_20900_c1
1982 nmdc:mga03n38_3607_c1
1983 nmdc:mga03n38_723420_c1
1984 nmdc:mga00v17_256487_c1
1985 nmdc:mga00v17_261525_c1
1986 nmdc:mga0yw44_128590_c1
1987 nmdc:mga0yw44_47856_c1
1988 nmdc:mga0yw44_606624_c1
1989 nmdc:mga0yw44_67988_c1
1990 nmdc:mga0yw44_731544_c1
1991 nmdc:mga0yw44_90214_c1
1992 nmdc:mga0k408_155748_c1
1993 nmdc:mga0k408_203237_c1
1994 nmdc:mga0k408_238751_c1
1995 nmdc:mga0k408_2540_c1
1996 nmdc:mga0k408_276333_c1
1997 nmdc:mga0k408_59463_c1
1998 nmdc:mga0k408_62427_c1
1999 nmdc:mga0k408_68971_c1
2000 nmdc:mga06z11_112438_c1
2001 nmdc:mga06z11_124950_c1
2002 nmdc:mga06z11_177704_c1
2003 nmdc:mga06z11_195557_c1
2004 nmdc:mga04h51_72127_c1
2005 nmdc:mga07m45_12108_c1
2006 nmdc:mga07m45_13479_c1
2007 nmdc:mga07m45_15545_c1
2008 nmdc:mga07m45_210824_c1
2009 nmdc:mga07m45_217611_c1
2010 nmdc:mga07m45_24491_c1
2011 nmdc:mga07m45_384765_c1
2012 nmdc:mga07m45_59332_c1
2013 nmdc:mga07m45_6630_c1
2014 nmdc:mga07m45_69720_c1
2015 nmdc:mga07m45_76360_c1
2016 nmdc:mga07m45_76816_c1
2017 nmdc:mga07m45_85945_c2
2018 nmdc:mga07m45_94757_c1
2019 nmdc:mga07m45_98007_c1
2020 nmdc:mga05p37_1181895_c1
2021 nmdc:mga05p37_299011_c1
2022 nmdc:mga0qj67_313310_c1
2023 nmdc:mga0qj67_48786_c1
2024 nmdc:mga06r32_292876_c1
2025 nmdc:mga08y16_266904_c1
2026 nmdc:mga08y16_472713_c1
2027 nmdc:mga08y16_547556_c1
2028 nmdc:mga0n895_247511_c1
2029 nmdc:mga0n895_811229_c1
2030 nmdc:mga0rr50_617544_c1
2031 nmdc:mga0a205_92616_c1
2032 nmdc:mga0sz30_26942_c1
2033 nmdc:mga0sz30_343609_c1
2034 nmdc:mga0sz30_86946_c1
2035 nmdc:mga0sz30_95_c1
2036 Ga0495601_0000048
2037 Ga0495601_0013653
2038 Ga0500610_0012836
2039 Ga0500610_0013055
2040 Ga0495655_0073347
2041 Ga0495655_0222123
2042 Ga0495595_0001916
2043 Ga0495619_0051116
2044 Ga0495619_0088889
2045 Ga0495619_0310887
2046 Ga0500643_001860
2047 Ga0500644_0106454
2048 Ga0500646_0260617
2049 Ga0500651_0000071
2050 Ga0500566_0023831
2051 Ga0500566_0068470
2052 Ga0500641_0116669
2053 Ga0500641_0140205
2054 Ga0500641_0170957
2055 Ga0500555_056513
2056 Ga0500571_000033
2057 Ga0500572_012363
2058 Ga0500593_000083
2059 Ga0500594_0000739
2060 Ga0500594_0107477
2061 Ga0500595_000333
2062 Ga0500607_000789
2063 Ga0500607_054964
2064 Ga0500608_006602
2065 Ga0500608_258868
2066 Ga0500626_010098
2067 Ga0500655_000311
2068 Ga0500655_020268
2069 Ga0500658_0000163
2070 Ga0500658_0000277
2071 Ga0500658_0281944
2072 Ga0500559_0005246
2073 Ga0500561_0129143
2074 Ga0500568_0003208
2075 Ga0500568_0012568
2076 Ga0500574_002832
2077 Ga0500603_000540
2078 Ga0500616_0051330
2079 Ga0500627_0002100
2080 Ga0500627_0313020
2081 Ga0500633_0088609
2082 Ga0500633_0209149
2083 Ga0500634_0019369
2084 Ga0500634_0031309
2085 Ga0500634_0089711
2086 Ga0500638_000857
2087 Ga0500638_007384
2088 Ga0500636_0025244
2089 Ga0500637_0000060
2090 Ga0500645_086401
2091 Ga0500565_028234
2092 Ga0500661_003670
2093 Ga0500661_023727
2094 2513227876
2095 2513694709
2096 2599625146
2097 2599673402
2098 2599683072
2099 2599695010
2100 2644328409
2101 2644397478
2102 2738722484
2103 2738885414
2104 2739251984
2105 2739283055
2106 2793077976
2107 2819600736
2108 2831267318
2109 2838060295
2110 2874610157
2111 2876815712
2112 2879117033
2113 2885198400
2114 2885212220
2115 2899931712
2116 2904547522
2117 2922366747
2118 2922389350
2119 2928043094
2120 2928050247
2121 2928056726
2122 2928068814
2123 2928075767
2124 2928090314
2125 2929164976
2126 2945910393
2127 2945987558
2128 2954771109
2129 8006993171
2130 8056678196

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

55

187

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ceo-assembly1.cif.gz_c yeast rna polymerase ii transcription pre-initiation complex with core mediator and the +1 nucleosome 0.669 83 172
6z1u-assembly1.cif.gz_M bovine atp synthase f1c8-peripheral stalk domain, state 3 0.6557 86 158
5m48-assembly1.cif.gz_A-2 coiled coil domain of rtt103p 0.6534 83 173
6zik-assembly1.cif.gz_O bovine atp synthase rotor domain, state 3 0.643 89 159
7tkh-assembly1.cif.gz_6 yeast atp synthase state 2catalytic(b) with 10 mm atp backbone model 0.6373 78 158
ID Description Score Start End Superfamily
af_Q9NP81_58_171_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8044 87 156 1.10.287.40
af_O17010_2_324_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7381 89 157 1.20.1070.10
af_E1JIB0_51_138_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7252 59 155 1.20.120.350
af_Q2RA30_2_105_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7056 58 154 1.20.58.90
af_E1JIB0_51_138_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7031 59 155 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A3L9Y3L5-F1-model_v4 TRAP transporter small permease protein 0.8581 8 157 GO:0005886
GO:0015740
GO:0022857
AF-A0A839V8E0-F1-model_v4 TRAP transporter small permease protein 0.8469 14 161 GO:0005886
GO:0015740
GO:0022857
AF-A0A1F4F3F3-F1-model_v4 TRAP transporter small permease protein 0.8346 10 158 GO:0005886
GO:0022857
AF-A0A1X7PQV7-F1-model_v4 TRAP transporter small permease protein 0.833 9 157 GO:0005886
GO:0015740
GO:0022857
AF-A0A6N9T5E4-F1-model_v4 TRAP transporter small permease protein 0.8326 10 160 GO:0005886
GO:0015740
GO:0022857

Map