F489381

General Info

Members Datasets Scaffolds Average Seq Length
1065 428 2128 112

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0356061|Ga0466969_0356061_244_645
Length 133
Sequence MLLARFLNIESDWLFCLRYFEMKLVTAVVKPFKLDDVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAVRDDMVDAVIEAVTRVASTGKIGDGKIFVSNLEQVIRIRTGETGPDAV

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005473 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
180 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
185 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
186 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
187 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
208 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
217 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
218 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
234 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
272 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
273 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
305 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
308 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
309 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
310 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
311 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
317 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
339 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
344 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
345 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
356 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
357 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
358 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
359 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
363 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
364 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
365 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
383 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
384 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
385 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
386 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
387 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
388 2643221556 Massilia sp. Root1485 Isolate Unclassified
389 2643221638 Duganella sp. Root336D2 Isolate Unclassified
390 2643221645 Massilia sp. Root351 Isolate Unclassified
391 2643221664 Massilia sp. Root418 Isolate Unclassified
392 2643221684 Massilia sp. Root133 Isolate Unclassified
393 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
394 2738541297 Duganella sp. GV083 Isolate Unclassified
395 2738541357 Duganella sp. GV053 Isolate Unclassified
396 2738543003 Duganella sp. GV066 Isolate Unclassified
397 2738543026 Duganella sp. GV089 Isolate Unclassified
398 2738543029 Duganella sp. GV039 Isolate Unclassified
399 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
400 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
401 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
402 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
403 2818991436 Collimonas arenae 515 Isolate Unclassified
404 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
405 2821131069 Duganella sp. 1224 Isolate Unclassified
406 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
407 2842711865 Duganella sp. R-73148 Isolate Unclassified
408 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
409 2857553236 Duganella sp. R-74557 Isolate Unclassified
410 2857564685 Duganella sp. R-74599 Isolate Unclassified
411 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
412 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
413 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
414 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
415 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
416 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
417 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
418 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
419 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
420 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
421 2919476304 Duganella sp. 3397 Isolate Unclassified
422 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
423 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
424 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
425 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
426 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
427 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
428 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.3
Metatranscriptomes 6.38
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 0.28
Rhizoplane 4.51
Rhizosphere 85.16
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0356061 3300044656 Bacteria 663
2 JGI25152J39213_1000003 3300002773 Bacteria 214804
3 JGI25150J39212_1000404 3300002774 Bacteria 20212
4 JGI25150J39212_1008202 3300002774 Bacteria 2057
5 JGI25159J45721_1002231 3300002987 Bacteria 7497
6 JGI25151J46595_10089191 3300003187 Bacteria 864
7 JGI25153J46596_10027098 3300003215 Bacteria 2014
8 JGI25153J46596_10073073 3300003215 Bacteria 880
9 JGI25161J50226_1001011 3300003374 Bacteria 9810
10 Ga0007417J51691_1088433 3300003544 Bacteria 990
11 Ga0007410J51695_1026810 3300003574 Bacteria 552
12 Ga0007410J51695_1065535 3300003574 Bacteria 796
13 Ga0007409J51694_1029414 3300003575 Bacteria 1420
14 Ga0006562J51391_1004973 3300003578 Bacteria 913
15 Ga0032354_1062764 3300003693 Bacteria 871
16 Ga0055538_1000002 3300003751 Bacteria 999437
17 Ga0055539_1000002 3300003752 Bacteria 999437
18 Ga0055533_1000004 3300003756 Bacteria 999437
19 Ga0055525_1000002 3300003759 Bacteria 999437
20 Ga0055525_1000029 3300003759 Bacteria 320663
21 Ga0055542_1008314 3300003762 Bacteria 2039
22 Ga0055526_1003670 3300003771 Bacteria 9605
23 Ga0055537_1000022 3300003773 Bacteria 114484
24 Ga0055537_1005411 3300003773 Bacteria 3431
25 Ga0055524_1001646 3300003775 Bacteria 12461
26 Ga0055524_1002887 3300003775 Bacteria 8596
27 Ga0055534_1000468 3300003784 Bacteria 22901
28 Ga0055534_1008665 3300003784 Bacteria 2283
29 Ga0055528_1000473 3300003790 Bacteria 32133
30 Ga0055530_10002395 3300003791 Bacteria 12139
31 Ga0055541_1000002 3300003841 Bacteria 896405
32 Ga0055541_1000043 3300003841 Bacteria 161703
33 Ga0058692_1000067 3300003856 Bacteria 88996
34 Ga0055543_1001364 3300004625 Bacteria 9848
35 Ga0058862_12124498 3300004803 Bacteria 1211
36 Ga0065165_1005566 3300005262 Bacteria 7004
37 Ga0065165_1142271 3300005262 Bacteria 565
38 Ga0065703_1000160 3300005272 Bacteria 29542
39 Ga0065715_10593760 3300005293 Bacteria 712
40 Ga0070658_10170065 3300005327 Bacteria 1830
41 Ga0070658_10848537 3300005327 Bacteria 794
42 Ga0070658_11637271 3300005327 Bacteria 557
43 Ga0070690_100123259 3300005330 Bacteria 1742
44 Ga0068869_100011386 3300005334 Bacteria 5831
45 Ga0070666_10132760 3300005335 Bacteria 1731
46 Ga0070666_10963727 3300005335 Bacteria 632
47 Ga0068868_100071159 3300005338 Bacteria 2774
48 Ga0070689_101655469 3300005340 Bacteria 582
49 Ga0070661_100108577 3300005344 Bacteria 2070
50 Ga0070668_100073025 3300005347 Bacteria 2674
51 Ga0070668_100308148 3300005347 Bacteria 1330
52 Ga0070668_100968616 3300005347 Bacteria 763
53 Ga0070669_100000536 3300005353 Bacteria 28254
54 Ga0070675_100192440 3300005354 Bacteria 1768
55 Ga0070674_100149952 3300005356 Bacteria 1759
56 Ga0070673_100006935 3300005364 Bacteria 7413
57 Ga0070673_100286379 3300005364 Bacteria 1447
58 Ga0070673_101092678 3300005364 Bacteria 745
59 Ga0070688_100545218 3300005365 Bacteria 881
60 Ga0070667_100758666 3300005367 Bacteria 900
61 Ga0070694_100858968 3300005444 Bacteria 747
62 Ga0070663_100512545 3300005455 Bacteria 998
63 Ga0070662_101355640 3300005457 Bacteria 612
64 Ga0068867_100149436 3300005459 Bacteria 1833
65 Ga0068867_102077484 3300005459 Bacteria 538
66 Ga0074250_12706 3300005473 Bacteria 1294
67 Ga0070679_101272783 3300005530 Bacteria 681
68 Ga0068853_100241225 3300005539 Bacteria 1657
69 Ga0068853_100353340 3300005539 Bacteria 1368
70 Ga0068853_100604893 3300005539 Bacteria 1041
71 Ga0070695_100380392 3300005545 Bacteria 1065
72 Ga0070665_100002224 3300005548 Bacteria 21625
73 Ga0070665_102018032 3300005548 Bacteria 582
74 Ga0068855_100000065 3300005563 Bacteria 129307
75 Ga0068855_100077239 3300005563 Bacteria 3863
76 Ga0068855_100183523 3300005563 Bacteria 2364
77 Ga0068855_101142155 3300005563 Bacteria 812
78 Ga0068854_100080165 3300005578 Bacteria 2408
79 Ga0070702_100117395 3300005615 Bacteria 1660
80 Ga0068852_100343980 3300005616 Bacteria 1454
81 Ga0068852_100532531 3300005616 Bacteria 1173
82 Ga0068859_100004713 3300005617 Bacteria 13857
83 Ga0068864_100440095 3300005618 Bacteria 1245
84 Ga0068866_10459263 3300005718 Bacteria 835
85 Ga0068861_100110156 3300005719 Bacteria 2205
86 Ga0068861_100665007 3300005719 Bacteria 964
87 Ga0068861_101563688 3300005719 Bacteria 649
88 Ga0068851_10612319 3300005834 Bacteria 664
89 Ga0068870_10055178 3300005840 Bacteria 2116
90 Ga0068863_100121660 3300005841 Bacteria 2489
91 Ga0068858_100032501 3300005842 Bacteria 4845
92 Ga0068860_100064662 3300005843 Bacteria 3474
93 Ga0068862_100389805 3300005844 Bacteria 1301
94 Ga0068862_100430499 3300005844 Bacteria 1240
95 Ga0081540_1001860 3300005983 Bacteria 17663
96 Ga0070717_10245289 3300006028 Bacteria 1581
97 Ga0075364_10459794 3300006051 Bacteria 870
98 Ga0097621_100879426 3300006237 Bacteria 834
99 Ga0068871_100003921 3300006358 Bacteria 10261
100 Ga0075433_10539499 3300006852 Bacteria 1026
101 Ga0068865_100340057 3300006881 Bacteria 1213
102 Ga0068865_100369625 3300006881 Bacteria 1167
103 Ga0097620_100004713 3300006931 Bacteria 13857
104 Ga0079104_1005362 3300006946 Bacteria 5143
105 Ga0105250_10099037 3300009092 Bacteria 1189
106 Ga0105240_10017404 3300009093 Bacteria 9687
107 Ga0105240_10314567 3300009093 Bacteria 1787
108 Ga0111539_10570651 3300009094 Bacteria 1318
109 Ga0111539_11333038 3300009094 Bacteria 833
110 Ga0105245_10140530 3300009098 Bacteria 2274
111 Ga0105245_10168205 3300009098 Bacteria 2086
112 Ga0105247_10024718 3300009101 Bacteria 3621
113 Ga0105243_10000263 3300009148 Bacteria 59080
114 Ga0105243_10024594 3300009148 Bacteria 4594
115 Ga0105243_10312708 3300009148 Bacteria 1428
116 Ga0105241_10193048 3300009174 Bacteria 1696
117 Ga0105241_10653374 3300009174 Bacteria 955
118 Ga0105242_10055392 3300009176 Bacteria 3244
119 Ga0105242_10154773 3300009176 Bacteria 2002
120 Ga0105248_10003110 3300009177 Bacteria 18377
121 Ga0105237_10065345 3300009545 Bacteria 3634
122 Ga0105237_10282893 3300009545 Bacteria 1661
123 Ga0105238_10035766 3300009551 Bacteria 5049
124 Ga0105238_10953456 3300009551 Bacteria 878
125 Ga0105028_142612 3300009993 Bacteria 512
126 Ga0105239_10046629 3300010375 Bacteria 4749
127 Ga0105239_10063665 3300010375 Bacteria 4049
128 Ga0105246_10121678 3300011119 Bacteria 1935
129 Ga0157371_10000013 3300013102 Bacteria 352631
130 Ga0157369_11071215 3300013105 Bacteria 824
131 Ga0157374_10004388 3300013296 Bacteria 11871
132 Ga0157374_10137275 3300013296 Bacteria 2372
133 Ga0157378_10099534 3300013297 Bacteria 2653
134 Ga0157372_10116772 3300013307 Bacteria 3060
135 Ga0157372_10562494 3300013307 Bacteria 1329
136 Ga0157372_11827872 3300013307 Bacteria 699
137 Ga0157375_10035912 3300013308 Bacteria 4735
138 Ga0163163_10011347 3300014325 Bacteria 8079
139 Ga0163163_12629074 3300014325 Bacteria 561
140 Ga0182008_10005570 3300014497 Bacteria 7152
141 Ga0157379_10039306 3300014968 Bacteria 4221
142 Ga0157376_10017972 3300014969 Bacteria 5408
143 Ga0157376_10836258 3300014969 Bacteria 935
144 Ga0182006_1000056 3300015261 Bacteria 169631
145 Ga0182007_10041288 3300015262 Bacteria 1538
146 Ga0182005_1000013 3300015265 Bacteria 396391
147 Ga0206356_10036676 3300020070 Bacteria 564
148 Ga0206356_10365692 3300020070 Bacteria 791
149 Ga0206356_10546003 3300020070 Bacteria 669
150 Ga0206351_10097662 3300020077 Bacteria 578
151 Ga0206352_10359740 3300020078 Bacteria 581
152 Ga0206354_10655136 3300020081 Bacteria 757
153 Ga0154015_1538395 3300020610 Bacteria 541
154 Ga0213872_10000494 3300021361 Bacteria 31496
155 Ga0213872_10000502 3300021361 Bacteria 31150
156 Ga0213872_10001215 3300021361 Bacteria 17431
157 Ga0213872_10001327 3300021361 Bacteria 16362
158 Ga0213872_10001385 3300021361 Bacteria 15949
159 Ga0213872_10003003 3300021361 Bacteria 9533
160 Ga0213872_10003978 3300021361 Bacteria 7970
161 Ga0209784_100002 3300025224 Bacteria 1753105
162 Ga0209566_100003 3300025225 Bacteria 1753105
163 Ga0209674_100004 3300025226 Bacteria 1753105
164 Ga0209563_100003 3300025230 Bacteria 1932942
165 Ga0209563_100006 3300025230 Bacteria 1753105
166 Ga0207425_1000173 3300025245 Bacteria 52861
167 Ga0209677_100003 3300025253 Bacteria 1753105
168 Ga0209677_114779 3300025253 Bacteria 1052
169 Ga0209148_1000914 3300025254 Bacteria 19917
170 Ga0209565_1000015 3300025263 Bacteria 494091
171 Ga0209673_1000017 3300025273 Bacteria 492994
172 Ga0209675_1000012 3300025291 Bacteria 494061
173 Ga0209025_1007780 3300025294 Bacteria 7888
174 Ga0209564_1000016 3300025295 Bacteria 613131
175 Ga0209758_1000449 3300025297 Bacteria 68833
176 Ga0209256_1000076 3300025299 Bacteria 234735
177 Ga0207696_1013040 3300025711 Bacteria 2914
178 Ga0207655_1029020 3300025728 Bacteria 2599
179 Ga0207713_1002177 3300025735 Bacteria 14525
180 Ga0207642_10300425 3300025899 Bacteria 930
181 Ga0207710_10000183 3300025900 Bacteria 61804
182 Ga0207710_10049959 3300025900 Bacteria 1875
183 Ga0207645_10642290 3300025907 Bacteria 721
184 Ga0207643_10167806 3300025908 Bacteria 1323
185 Ga0207705_10003707 3300025909 Bacteria 11630
186 Ga0207705_10474309 3300025909 Bacteria 971
187 Ga0207654_10248701 3300025911 Bacteria 1191
188 Ga0207654_10307684 3300025911 Bacteria 1080
189 Ga0207695_10000475 3300025913 Bacteria 86957
190 Ga0207695_10050605 3300025913 Bacteria 4369
191 Ga0207671_10013593 3300025914 Bacteria 6476
192 Ga0207671_10113146 3300025914 Bacteria 2067
193 Ga0207657_10004691 3300025919 Bacteria 14430
194 Ga0207657_10015820 3300025919 Bacteria 7292
195 Ga0207681_10004469 3300025923 Bacteria 8606
196 Ga0207694_10020740 3300025924 Bacteria 4975
197 Ga0207659_10256392 3300025926 Bacteria 1421
198 Ga0207687_10253146 3300025927 Bacteria 1401
199 Ga0207687_10354619 3300025927 Bacteria 1196
200 Ga0207690_10054319 3300025932 Bacteria 2693
201 Ga0207690_10133789 3300025932 Bacteria 1818
202 Ga0207706_10119248 3300025933 Bacteria 2320
203 Ga0207706_10656689 3300025933 Bacteria 898
204 Ga0207686_10132425 3300025934 Bacteria 1712
205 Ga0207686_10463748 3300025934 Bacteria 977
206 Ga0207709_10000158 3300025935 Bacteria 91810
207 Ga0207709_10271703 3300025935 Bacteria 1248
208 Ga0207709_10416579 3300025935 Bacteria 1031
209 Ga0207704_10067319 3300025938 Bacteria 2252
210 Ga0207711_10022452 3300025941 Bacteria 5276
211 Ga0207689_10006227 3300025942 Bacteria 10567
212 Ga0207661_11767614 3300025944 Bacteria 564
213 Ga0207679_10435276 3300025945 Bacteria 1160
214 Ga0207679_10929338 3300025945 Bacteria 796
215 Ga0207667_10000025 3300025949 Bacteria 350159
216 Ga0207667_10010688 3300025949 Bacteria 10710
217 Ga0207667_10716204 3300025949 Bacteria 1002
218 Ga0207651_10015435 3300025960 Bacteria 4438
219 Ga0207651_10165484 3300025960 Bacteria 1738
220 Ga0207668_10053200 3300025972 Bacteria 2805
221 Ga0207668_10261186 3300025972 Bacteria 1411
222 Ga0207640_10008256 3300025981 Bacteria 5776
223 Ga0207658_10089692 3300025986 Bacteria 2381
224 Ga0207658_11289812 3300025986 Bacteria 668
225 Ga0207677_10061667 3300026023 Bacteria 2598
226 Ga0207703_10012815 3300026035 Bacteria 6537
227 Ga0207639_10557211 3300026041 Bacteria 1053
228 Ga0207678_10568599 3300026067 Bacteria 992
229 Ga0207678_10589887 3300026067 Bacteria 974
230 Ga0207702_10150145 3300026078 Bacteria 2119
231 Ga0207641_10323733 3300026088 Bacteria 1462
232 Ga0207676_10722892 3300026095 Bacteria 966
233 Ga0207675_100020532 3300026118 Bacteria 6157
234 Ga0207683_10411424 3300026121 Bacteria 1245
235 Ga0207698_11737103 3300026142 Bacteria 639
236 Ga0209281_1008358 3300027111 Bacteria 2520
237 Ga0209371_1000196 3300027312 Bacteria 89093
238 Ga0268266_10003278 3300028379 Bacteria 16285
239 Ga0268266_11825230 3300028379 Bacteria 582
240 Ga0268265_10049828 3300028380 Bacteria 3152
241 Ga0268265_10424500 3300028380 Bacteria 1235
242 Ga0268264_10130920 3300028381 Bacteria 2224
243 Ga0268256_1000158 3300030500 Bacteria 89061
244 Ga0316182_1110679 3300030745 Bacteria 970
245 Ga0265330_10136490 3300031235 Bacteria 1043
246 Ga0265330_10240597 3300031235 Bacteria 763
247 Ga0265339_10005282 3300031249 Bacteria 8613
248 Ga0265316_10051906 3300031344 Bacteria 3219
249 Ga0307408_100000403 3300031548 Bacteria 38869
250 Ga0316575_10045814 3300031665 Bacteria 1737
251 Ga0316575_10069334 3300031665 Bacteria 1415
252 Ga0316575_10115773 3300031665 Bacteria 1095
253 Ga0316575_10321817 3300031665 Bacteria 656
254 Ga0316579_10000641 3300031691 Bacteria 11863
255 Ga0316579_10002987 3300031691 Bacteria 6500
256 Ga0316579_10012448 3300031691 Bacteria 3641
257 Ga0316579_10015676 3300031691 Bacteria 3296
258 Ga0316579_10026561 3300031691 Bacteria 2623
259 Ga0316579_10131682 3300031691 Bacteria 1205
260 Ga0316579_10158749 3300031691 Bacteria 1092
261 Ga0316579_10422318 3300031691 Bacteria 645
262 Ga0316579_10590728 3300031691 Bacteria 537
263 Ga0265342_10038819 3300031712 Bacteria 2898
264 Ga0265342_10320335 3300031712 Bacteria 813
265 Ga0316576_10000696 3300031727 Bacteria 16540
266 Ga0316576_10002369 3300031727 Bacteria 10720
267 Ga0316576_10055452 3300031727 Bacteria 2892
268 Ga0316576_10092706 3300031727 Bacteria 2251
269 Ga0316576_10100589 3300031727 Bacteria 2160
270 Ga0316576_10154517 3300031727 Bacteria 1729
271 Ga0316576_10229603 3300031727 Bacteria 1395
272 Ga0316576_10345918 3300031727 Bacteria 1107
273 Ga0316576_10366163 3300031727 Bacteria 1071
274 Ga0316576_10872124 3300031727 Bacteria 645
275 Ga0316578_10000636 3300031728 Bacteria 12411
276 Ga0316578_10006630 3300031728 Bacteria 5734
277 Ga0316578_10009197 3300031728 Bacteria 5071
278 Ga0316578_10053943 3300031728 Bacteria 2357
279 Ga0316578_10058400 3300031728 Bacteria 2268
280 Ga0316578_10058488 3300031728 Bacteria 2266
281 Ga0316578_10068841 3300031728 Bacteria 2093
282 Ga0316578_10076192 3300031728 Bacteria 1991
283 Ga0316578_10088037 3300031728 Bacteria 1852
284 Ga0316578_10095632 3300031728 Bacteria 1778
285 Ga0316578_10135185 3300031728 Bacteria 1484
286 Ga0316578_10180718 3300031728 Bacteria 1271
287 Ga0316577_10019195 3300031733 Bacteria 3782
288 Ga0316577_10020491 3300031733 Bacteria 3664
289 Ga0316577_10044733 3300031733 Bacteria 2476
290 Ga0316577_10318915 3300031733 Bacteria 881
291 Ga0316577_10351590 3300031733 Bacteria 836
292 Ga0307413_10014872 3300031824 Bacteria 3969
293 Ga0307413_11112225 3300031824 Bacteria 683
294 Ga0307411_10457449 3300032005 Bacteria 1069
295 Ga0307415_101811035 3300032126 Bacteria 591
296 Ga0316583_10009355 3300032133 Bacteria 3528
297 Ga0316583_10064786 3300032133 Bacteria 1279
298 Ga0316585_10005478 3300032137 Bacteria 3584
299 Ga0316585_10027472 3300032137 Bacteria 1776
300 Ga0316585_10034243 3300032137 Bacteria 1605
301 Ga0316585_10037125 3300032137 Bacteria 1546
302 Ga0316585_10088933 3300032137 Bacteria 1008
303 Ga0316585_10105259 3300032137 Bacteria 927
304 Ga0316585_10165057 3300032137 Bacteria 731
305 Ga0316580_10001094 3300032139 Bacteria 6834
306 Ga0316580_10003846 3300032139 Bacteria 4306
307 Ga0316580_10047111 3300032139 Bacteria 1329
308 Ga0316580_10257736 3300032139 Bacteria 539
309 Ga0316593_10012553 3300032168 Bacteria 2489
310 Ga0316593_10025717 3300032168 Bacteria 1877
311 Ga0316593_10047074 3300032168 Bacteria 1449
312 Ga0316593_10065646 3300032168 Bacteria 1248
313 Ga0316592_1010691 3300033524 Bacteria 1855
314 Ga0316592_1011728 3300033524 Bacteria 1787
315 Ga0316592_1016320 3300033524 Bacteria 1551
316 Ga0316592_1021387 3300033524 Bacteria 1378
317 Ga0316592_1025438 3300033524 Bacteria 1276
318 Ga0316592_1052741 3300033524 Bacteria 909
319 Ga0316592_1138454 3300033524 Bacteria 570
320 Ga0316586_1038739 3300033527 Bacteria 833
321 Ga0316588_1007223 3300033528 Bacteria 2250
322 Ga0316588_1013813 3300033528 Bacteria 1758
323 Ga0316588_1023138 3300033528 Bacteria 1424
324 Ga0316588_1028305 3300033528 Bacteria 1306
325 Ga0316588_1028325 3300033528 Bacteria 1306
326 Ga0316588_1058373 3300033528 Bacteria 940
327 Ga0316588_1065775 3300033528 Bacteria 887
328 Ga0316588_1085154 3300033528 Bacteria 785
329 Ga0316587_1102154 3300033529 Bacteria 552
330 Ga0316596_1006977 3300033541 Bacteria 2651
331 Ga0316596_1010639 3300033541 Bacteria 2233
332 Ga0316596_1011630 3300033541 Bacteria 2154
333 Ga0316596_1014115 3300033541 Bacteria 1978
334 Ga0316596_1015759 3300033541 Bacteria 1887
335 Ga0316596_1016296 3300033541 Bacteria 1860
336 Ga0316596_1016463 3300033541 Bacteria 1852
337 Ga0316596_1032445 3300033541 Bacteria 1359
338 Ga0316596_1042536 3300033541 Bacteria 1195
339 Ga0316596_1042926 3300033541 Bacteria 1190
340 Ga0316596_1053132 3300033541 Bacteria 1074
341 Ga0316596_1063936 3300033541 Bacteria 983
342 Ga0316596_1067864 3300033541 Bacteria 954
343 Ga0316596_1242358 3300033541 Bacteria 507
344 Ga0373948_0122092 3300034817 Bacteria 630
345 Ga0373952_0000197 3300035092 Bacteria 9565
346 Ga0373960_0011163 3300035121 Bacteria 2208
347 Ga0373942_0138111 3300035207 Bacteria 774
348 Ga0316574_0013409 3300035398 Bacteria 4711
349 Ga0316574_0014091 3300035398 Bacteria 4612
350 Ga0316574_0015990 3300035398 Bacteria 4363
351 Ga0316574_0055523 3300035398 Bacteria 2475
352 Ga0316574_0064536 3300035398 Bacteria 2304
353 Ga0316574_0066311 3300035398 Bacteria 2274
354 Ga0316574_0073010 3300035398 Bacteria 2169
355 Ga0316574_0104404 3300035398 Bacteria 1814
356 Ga0316574_0109527 3300035398 Bacteria 1770
357 Ga0316574_0199331 3300035398 Bacteria 1286
358 Ga0316574_0202035 3300035398 Bacteria 1276
359 Ga0316574_0212555 3300035398 Bacteria 1241
360 Ga0316574_0214818 3300035398 Bacteria 1233
361 Ga0316574_0242867 3300035398 Bacteria 1151
362 Ga0316574_0281001 3300035398 Bacteria 1060
363 Ga0316574_0393600 3300035398 Bacteria 873
364 Ga0316574_0411942 3300035398 Bacteria 850
365 Ga0373937_1536288 3300036401 Bacteria 613
366 Ga0316582_0024962 3300036647 Bacteria 3582
367 Ga0316582_0025114 3300036647 Bacteria 3573
368 Ga0316582_0037338 3300036647 Bacteria 3011
369 Ga0316582_0109234 3300036647 Bacteria 1839
370 Ga0316582_0126098 3300036647 Bacteria 1716
371 Ga0316582_0161809 3300036647 Bacteria 1516
372 Ga0316582_0278315 3300036647 Bacteria 1148
373 Ga0316582_0451638 3300036647 Bacteria 886
374 Ga0316582_1086043 3300036647 Bacteria 545
375 Ga0316584_0002876 3300036712 Bacteria 11040
376 Ga0316584_0006153 3300036712 Bacteria 8118
377 Ga0316584_0006346 3300036712 Bacteria 8007
378 Ga0316584_0007969 3300036712 Bacteria 7270
379 Ga0316584_0086562 3300036712 Bacteria 2345
380 Ga0316584_0151823 3300036712 Bacteria 1724
381 Ga0316584_0272615 3300036712 Bacteria 1231
382 Ga0316584_0307941 3300036712 Bacteria 1145
383 Ga0316584_0373799 3300036712 Bacteria 1020
384 Ga0316584_0402311 3300036712 Bacteria 975
385 Ga0316584_0455243 3300036712 Bacteria 904
386 Ga0395899_0002589 3300037312 Bacteria 14582
387 Ga0395899_0015612 3300037312 Bacteria 5790
388 Ga0395899_0053955 3300037312 Bacteria 2975
389 Ga0395899_0087530 3300037312 Bacteria 2260
390 Ga0395899_0171213 3300037312 Bacteria 1529
391 Ga0395899_0325743 3300037312 Bacteria 1033
392 Ga0395899_0521983 3300037312 Bacteria 767
393 Ga0395900_0000229 3300037418 Bacteria 88118
394 Ga0395900_0000263 3300037418 Bacteria 81724
395 Ga0395900_0016748 3300037418 Bacteria 7477
396 Ga0395900_0033712 3300037418 Bacteria 5269
397 Ga0395900_0054735 3300037418 Bacteria 4108
398 Ga0395900_0084298 3300037418 Bacteria 3265
399 Ga0395900_0524971 3300037418 Bacteria 1131
400 Ga0395900_0543450 3300037418 Bacteria 1107
401 Ga0395900_0638201 3300037418 Bacteria 1002
402 Ga0395900_0666714 3300037418 Bacteria 976
403 Ga0395900_1248991 3300037418 Bacteria 657
404 Ga0395900_1852173 3300037418 Bacteria 514
405 Ga0395898_0040939 3300037466 Bacteria 4579
406 Ga0395898_0451964 3300037466 Bacteria 1223
407 Ga0395898_0825603 3300037466 Bacteria 867
408 Ga0395898_0982341 3300037466 Bacteria 780
409 Ga0395898_1056672 3300037466 Bacteria 746
410 Ga0395898_1350128 3300037466 Bacteria 641
411 Ga0395898_1736906 3300037466 Bacteria 546
412 Ga0395905_0040521 3300037471 Bacteria 4369
413 Ga0395905_0099915 3300037471 Bacteria 2724
414 Ga0395905_0121406 3300037471 Bacteria 2456
415 Ga0395905_0251335 3300037471 Bacteria 1651
416 Ga0395905_0298545 3300037471 Bacteria 1498
417 Ga0395905_0492590 3300037471 Bacteria 1125
418 Ga0395905_0561639 3300037471 Bacteria 1042
419 Ga0395905_1067982 3300037471 Bacteria 710
420 Ga0316581_0004778 3300037588 Bacteria 3485
421 Ga0316581_0020281 3300037588 Bacteria 1946
422 Ga0316581_0058842 3300037588 Bacteria 1178
423 Ga0316581_0084811 3300037588 Bacteria 975
424 Ga0395901_0003564 3300038443 Bacteria 15698
425 Ga0395901_0018100 3300038443 Bacteria 7189
426 Ga0395901_0315058 3300038443 Bacteria 1619
427 Ga0395901_0514272 3300038443 Bacteria 1217
428 Ga0395901_1052974 3300038443 Bacteria 786
429 Ga0400484_21924 3300038725 Bacteria 21393
430 Ga0400483_000262 3300039062 Bacteria 7880
431 Ga0400483_175488 3300039062 Bacteria 5715
432 Ga0436361_0062839 3300039447 Bacteria 58101
433 Ga0436361_0215738 3300039447 Bacteria 890
434 Ga0436361_0228737 3300039447 Bacteria 6699
435 Ga0436361_0288412 3300039447 Bacteria 24307
436 Ga0436361_0441966 3300039447 Bacteria 9274
437 Ga0436361_0579013 3300039447 Bacteria 26383
438 Ga0436361_0738390 3300039447 Bacteria 658
439 Ga0436361_0880017 3300039447 Bacteria 8784
440 Ga0436361_1194171 3300039447 Bacteria 11012
441 Ga0436363_1522905 3300039450 Bacteria 593
442 Ga0439465_0115703 3300041413 Bacteria 937
443 Ga0451853_2426511 3300041512 Bacteria 835
444 Ga0439448_0047694 3300042005 Bacteria 1397
445 Ga0439448_0217095 3300042005 Bacteria 672
446 Ga0439454_050804 3300042011 Bacteria 700
447 Ga0439455_0023062 3300042012 Bacteria 1496
448 Ga0450911_019010 3300042115 Bacteria 901
449 Ga0450923_063156 3300042125 Bacteria 811
450 Ga0439458_0026524 3300042157 Bacteria 1363
451 Ga0439458_0092824 3300042157 Bacteria 778
452 Ga0466969_0199679 3300044656 Bacteria 912
453 Ga0466969_0513019 3300044656 Bacteria 547
454 Ga0466972_0009901 3300044658 Bacteria 4784
455 Ga0466965_0007668 3300044683 Bacteria 4967
456 Ga0466965_0057624 3300044683 Bacteria 1936
457 Ga0466965_0614019 3300044683 Bacteria 618
458 Ga0466966_0006340 3300044684 Bacteria 7820
459 Ga0466966_0067575 3300044684 Bacteria 2244
460 Ga0466966_0107254 3300044684 Bacteria 1723
461 Ga0466966_0360395 3300044684 Bacteria 873
462 Ga0466961_0044146 3300044693 Bacteria 2852
463 Ga0466961_0339774 3300044693 Bacteria 914
464 Ga0466963_0057228 3300044694 Bacteria 2596
465 Ga0466963_0206317 3300044694 Bacteria 1375
466 Ga0466963_0344455 3300044694 Bacteria 1049
467 Ga0466964_0000658 3300044706 Bacteria 11027
468 Ga0466964_0003582 3300044706 Bacteria 5674
469 Ga0466964_0500380 3300044706 Bacteria 652
470 Ga0453684_0000638 3300044712 Bacteria 126432
471 Ga0453684_0001104 3300044712 Bacteria 84830
472 Ga0453684_2338595 3300044712 Bacteria 531
473 Ga0466971_0019568 3300044719 Bacteria 3007
474 Ga0466971_0023381 3300044719 Bacteria 2755
475 Ga0466968_0016796 3300044735 Bacteria 2917
476 Ga0466968_0209423 3300044735 Bacteria 915
477 Ga0466968_0481891 3300044735 Bacteria 616
478 Ga0466957_0035226 3300044842 Bacteria 3003
479 Ga0466957_0611943 3300044842 Bacteria 763
480 Ga0466957_0823404 3300044842 Bacteria 660
481 Ga0466959_0009426 3300045049 Bacteria 6944
482 Ga0466959_0173645 3300045049 Bacteria 1510
483 Ga0451576_2712766 3300045051 Bacteria 504
484 Ga0466958_0019455 3300045836 Bacteria 3952
485 Ga0466958_0210454 3300045836 Bacteria 1239
486 Ga0466958_0439260 3300045836 Bacteria 844
487 Ga0466958_0449740 3300045836 Bacteria 834
488 Ga0466967_0138815 3300045976 Bacteria 2262
489 Ga0466967_0271390 3300045976 Bacteria 1625
490 Ga0466967_1288810 3300045976 Bacteria 728
491 Ga0495617_000004 3300046452 Bacteria 511274
492 Ga0495617_000009 3300046452 Bacteria 312936
493 Ga0495617_003418 3300046452 Bacteria 5981
494 Ga0495617_015961 3300046452 Bacteria 2541
495 Ga0495627_000005 3300046453 Bacteria 630805
496 Ga0495627_000226 3300046453 Bacteria 59863
497 Ga0495627_033073 3300046453 Bacteria 1623
498 Ga0495603_0034047 3300046455 Bacteria 3064
499 Ga0495603_0048974 3300046455 Bacteria 2515
500 Ga0495590_0000108 3300046457 Bacteria 50094
501 Ga0495590_0009224 3300046457 Bacteria 3745
502 Ga0495629_0601182 3300046459 Bacteria 735
503 Ga0495629_0729382 3300046459 Bacteria 657
504 Ga0495638_0036497 3300046460 Bacteria 3132
505 Ga0495638_0098112 3300046460 Bacteria 1756
506 Ga0495638_0139724 3300046460 Bacteria 1415
507 Ga0495638_0528196 3300046460 Bacteria 590
508 Ga0495653_0000004 3300046463 Bacteria 376003
509 Ga0495653_0002873 3300046463 Bacteria 13772
510 Ga0495653_0060842 3300046463 Bacteria 2859
511 Ga0495653_0074078 3300046463 Bacteria 2538
512 Ga0495650_0000086 3300046471 Bacteria 235224
513 Ga0495650_0000171 3300046471 Bacteria 142895
514 Ga0495650_0192115 3300046471 Bacteria 713
515 Ga0495580_0198345 3300046472 Bacteria 1383
516 Ga0495582_0006931 3300046473 Bacteria 6301
517 Ga0495582_0033271 3300046473 Bacteria 2833
518 Ga0495582_0531474 3300046473 Bacteria 680
519 Ga0495605_0000183 3300046474 Bacteria 77763
520 Ga0495605_0000226 3300046474 Bacteria 69648
521 Ga0495605_0034014 3300046474 Bacteria 2583
522 Ga0495605_0036135 3300046474 Bacteria 2492
523 Ga0495605_0110241 3300046474 Bacteria 1256
524 Ga0495605_0200025 3300046474 Bacteria 871
525 Ga0495639_0257571 3300046475 Bacteria 864
526 Ga0495639_0325796 3300046475 Bacteria 769
527 Ga0495584_0000003 3300046491 Bacteria 323768
528 Ga0495584_0003315 3300046491 Bacteria 8919
529 Ga0495584_0013850 3300046491 Bacteria 4110
530 Ga0495584_0015586 3300046491 Bacteria 3875
531 Ga0495584_0069043 3300046491 Bacteria 1775
532 Ga0495584_0071948 3300046491 Bacteria 1737
533 Ga0495584_0076834 3300046491 Bacteria 1679
534 Ga0495584_0106507 3300046491 Bacteria 1417
535 Ga0495584_0295684 3300046491 Bacteria 822
536 Ga0495584_0653440 3300046491 Bacteria 536
537 Ga0495585_0001484 3300046492 Bacteria 18329
538 Ga0495585_0002574 3300046492 Bacteria 12834
539 Ga0495585_0002720 3300046492 Bacteria 12361
540 Ga0495585_0006320 3300046492 Bacteria 7361
541 Ga0495585_0024492 3300046492 Bacteria 3460
542 Ga0495585_0033038 3300046492 Bacteria 2931
543 Ga0495585_0102496 3300046492 Bacteria 1529
544 Ga0495585_0123415 3300046492 Bacteria 1368
545 Ga0495585_0206308 3300046492 Bacteria 998
546 Ga0495594_0005140 3300046499 Bacteria 6731
547 Ga0495594_0007131 3300046499 Bacteria 5751
548 Ga0495594_0013446 3300046499 Bacteria 4275
549 Ga0495594_0027138 3300046499 Bacteria 3084
550 Ga0495594_0094277 3300046499 Bacteria 1679
551 Ga0495594_0099841 3300046499 Bacteria 1632
552 Ga0495594_0314291 3300046499 Bacteria 892
553 Ga0495594_0396246 3300046499 Bacteria 785
554 Ga0495596_0004660 3300046500 Bacteria 6631
555 Ga0495596_0005043 3300046500 Bacteria 6303
556 Ga0495596_0007077 3300046500 Bacteria 5083
557 Ga0495596_0008268 3300046500 Bacteria 4639
558 Ga0495596_0008555 3300046500 Bacteria 4548
559 Ga0495596_0021910 3300046500 Bacteria 2603
560 Ga0495596_0129921 3300046500 Bacteria 977
561 Ga0495596_0223512 3300046500 Bacteria 731
562 Ga0495596_0253804 3300046500 Bacteria 682
563 Ga0495596_0260809 3300046500 Bacteria 672
564 Ga0495607_0001474 3300046501 Bacteria 20941
565 Ga0495607_0001979 3300046501 Bacteria 17252
566 Ga0495607_0011083 3300046501 Bacteria 6018
567 Ga0495607_0044490 3300046501 Bacteria 2618
568 Ga0495607_0081282 3300046501 Bacteria 1780
569 Ga0495607_0086220 3300046501 Bacteria 1712
570 Ga0495607_0096167 3300046501 Bacteria 1595
571 Ga0495607_0171127 3300046501 Bacteria 1097
572 Ga0495583_0000942 3300046506 Bacteria 33862
573 Ga0495583_0007435 3300046506 Bacteria 6882
574 Ga0495583_0009045 3300046506 Bacteria 6000
575 Ga0495583_0012703 3300046506 Bacteria 4744
576 Ga0495583_0016269 3300046506 Bacteria 4008
577 Ga0495583_0020877 3300046506 Bacteria 3379
578 Ga0495583_0120857 3300046506 Bacteria 1103
579 Ga0495583_0125658 3300046506 Bacteria 1076
580 Ga0495583_0237250 3300046506 Bacteria 734
581 Ga0495583_0432546 3300046506 Bacteria 516
582 Ga0495606_0000075 3300046507 Bacteria 170038
583 Ga0495606_0000106 3300046507 Bacteria 142138
584 Ga0495606_0000376 3300046507 Bacteria 75612
585 Ga0495606_0002574 3300046507 Bacteria 20774
586 Ga0495606_0006323 3300046507 Bacteria 10967
587 Ga0495606_0022126 3300046507 Bacteria 4643
588 Ga0495606_0038185 3300046507 Bacteria 3251
589 Ga0495606_0069729 3300046507 Bacteria 2219
590 Ga0495606_0160434 3300046507 Bacteria 1312
591 Ga0495606_0215277 3300046507 Bacteria 1086
592 Ga0495606_0471438 3300046507 Bacteria 639
593 Ga0495610_0000010 3300046512 Bacteria 538821
594 Ga0495616_0000374 3300046513 Bacteria 34798
595 Ga0495616_0011028 3300046513 Bacteria 5196
596 Ga0495616_0013718 3300046513 Bacteria 4562
597 Ga0495616_0016110 3300046513 Bacteria 4142
598 Ga0495616_0023041 3300046513 Bacteria 3355
599 Ga0495616_0029179 3300046513 Bacteria 2915
600 Ga0495616_0145357 3300046513 Bacteria 1076
601 Ga0495620_0008690 3300046515 Bacteria 5436
602 Ga0495630_0024743 3300046517 Bacteria 4438
603 Ga0495630_0091318 3300046517 Bacteria 2301
604 Ga0495631_0000168 3300046518 Bacteria 44535
605 Ga0495631_0001530 3300046518 Bacteria 13917
606 Ga0495631_0008745 3300046518 Bacteria 5089
607 Ga0495631_0012495 3300046518 Bacteria 4145
608 Ga0495631_0033755 3300046518 Bacteria 2297
609 Ga0495631_0045095 3300046518 Bacteria 1941
610 Ga0495631_0067175 3300046518 Bacteria 1551
611 Ga0495631_0069288 3300046518 Bacteria 1525
612 Ga0495631_0134019 3300046518 Bacteria 1064
613 Ga0495631_0258217 3300046518 Bacteria 742
614 Ga0495632_0000244 3300046519 Bacteria 53886
615 Ga0495632_0000245 3300046519 Bacteria 53759
616 Ga0495632_0001734 3300046519 Bacteria 17685
617 Ga0495632_0119576 3300046519 Bacteria 1232
618 Ga0495637_0000056 3300046520 Bacteria 98978
619 Ga0495637_0018216 3300046520 Bacteria 3259
620 Ga0495637_0058161 3300046520 Bacteria 1594
621 Ga0495637_0256248 3300046520 Bacteria 629
622 Ga0495637_0330417 3300046520 Bacteria 537
623 Ga0495643_0003748 3300046522 Bacteria 10994
624 Ga0495643_0042330 3300046522 Bacteria 2481
625 Ga0495643_0048527 3300046522 Bacteria 2294
626 Ga0495643_0087375 3300046522 Bacteria 1613
627 Ga0495644_0013401 3300046523 Bacteria 3145
628 Ga0495648_0001175 3300046524 Bacteria 26445
629 Ga0495648_0002931 3300046524 Bacteria 15324
630 Ga0495648_0002962 3300046524 Bacteria 15237
631 Ga0495648_0019255 3300046524 Bacteria 4806
632 Ga0495648_0025562 3300046524 Bacteria 3994
633 Ga0495648_0026147 3300046524 Bacteria 3934
634 Ga0495648_0097422 3300046524 Bacteria 1631
635 Ga0495648_0109465 3300046524 Bacteria 1506
636 Ga0495648_0148629 3300046524 Bacteria 1224
637 Ga0495663_0028286 3300046525 Bacteria 1649
638 Ga0495663_0053973 3300046525 Bacteria 1250
639 Ga0495663_0107493 3300046525 Bacteria 924
640 Ga0495666_0000573 3300046526 Bacteria 16457
641 Ga0495666_0000848 3300046526 Bacteria 14173
642 Ga0495666_0011673 3300046526 Bacteria 4379
643 Ga0495666_0040651 3300046526 Bacteria 2254
644 Ga0495666_0092171 3300046526 Bacteria 1429
645 Ga0495642_0000147 3300046528 Bacteria 40989
646 Ga0495642_0001211 3300046528 Bacteria 11859
647 Ga0495642_0001361 3300046528 Bacteria 10925
648 Ga0495642_0011445 3300046528 Bacteria 3408
649 Ga0495642_0022524 3300046528 Bacteria 2483
650 Ga0495642_0053250 3300046528 Bacteria 1667
651 Ga0495642_0058706 3300046528 Bacteria 1593
652 Ga0495642_0076829 3300046528 Bacteria 1402
653 Ga0495642_0109264 3300046528 Bacteria 1181
654 Ga0495642_0125620 3300046528 Bacteria 1102
655 Ga0495642_0166129 3300046528 Bacteria 958
656 Ga0495642_0408148 3300046528 Bacteria 599
657 Ga0495642_0566088 3300046528 Bacteria 504
658 Ga0495652_0340388 3300046529 Bacteria 1078
659 Ga0495654_0000002 3300046530 Bacteria 1021205
660 Ga0495654_0002925 3300046530 Bacteria 10705
661 Ga0495654_0032024 3300046530 Bacteria 2666
662 Ga0495654_0039085 3300046530 Bacteria 2369
663 Ga0495654_0069688 3300046530 Bacteria 1669
664 Ga0495654_0076725 3300046530 Bacteria 1574
665 Ga0495665_0005117 3300046531 Bacteria 7072
666 Ga0495665_0031815 3300046531 Bacteria 2822
667 Ga0495640_0136571 3300046533 Bacteria 1583
668 Ga0495640_0219118 3300046533 Bacteria 1201
669 Ga0495640_0771411 3300046533 Bacteria 574
670 Ga0495586_0008589 3300046535 Bacteria 5437
671 Ga0495586_0020595 3300046535 Bacteria 3511
672 Ga0495586_0021159 3300046535 Bacteria 3465
673 Ga0495586_0505761 3300046535 Bacteria 697
674 Ga0495587_0037046 3300046536 Bacteria 2931
675 Ga0495609_0000324 3300046538 Bacteria 42443
676 Ga0495609_0001837 3300046538 Bacteria 13597
677 Ga0495609_0003534 3300046538 Bacteria 8908
678 Ga0495609_0004966 3300046538 Bacteria 7130
679 Ga0495609_0004967 3300046538 Bacteria 7130
680 Ga0495609_0007122 3300046538 Bacteria 5623
681 Ga0495609_0012428 3300046538 Bacteria 4039
682 Ga0495609_0109910 3300046538 Bacteria 1190
683 Ga0495609_0342188 3300046538 Bacteria 604
684 Ga0495621_0180570 3300046539 Bacteria 842
685 Ga0495621_0223569 3300046539 Bacteria 763
686 Ga0495597_0000619 3300046542 Bacteria 29010
687 Ga0495597_0001149 3300046542 Bacteria 19949
688 Ga0495597_0001873 3300046542 Bacteria 14374
689 Ga0495597_0033897 3300046542 Bacteria 2309
690 Ga0495597_0042860 3300046542 Bacteria 2016
691 Ga0495597_0073962 3300046542 Bacteria 1464
692 Ga0495597_0083658 3300046542 Bacteria 1362
693 Ga0495597_0160125 3300046542 Bacteria 919
694 Ga0495597_0172607 3300046542 Bacteria 877
695 Ga0495597_0224840 3300046542 Bacteria 744
696 Ga0495597_0281676 3300046542 Bacteria 647
697 Ga0495645_0390311 3300046543 Bacteria 889
698 Ga0495645_0638052 3300046543 Bacteria 652
699 Ga0495622_0009880 3300046557 Bacteria 4414
700 Ga0495622_0012319 3300046557 Bacteria 3955
701 Ga0495622_0018082 3300046557 Bacteria 3283
702 Ga0495622_0071425 3300046557 Bacteria 1602
703 Ga0495622_0092999 3300046557 Bacteria 1384
704 Ga0495633_0002909 3300046558 Bacteria 11746
705 Ga0495633_0008224 3300046558 Bacteria 5903
706 Ga0495633_0018935 3300046558 Bacteria 3486
707 Ga0495633_0082680 3300046558 Bacteria 1494
708 Ga0495633_0083585 3300046558 Bacteria 1485
709 Ga0495633_0131486 3300046558 Bacteria 1158
710 Ga0495656_0034660 3300046615 Bacteria 2068
711 Ga0495656_0085367 3300046615 Bacteria 1433
712 Ga0495656_0113173 3300046615 Bacteria 1272
713 Ga0495656_0170419 3300046615 Bacteria 1064
714 Ga0495668_0000089 3300046616 Bacteria 145477
715 Ga0495668_0000346 3300046616 Bacteria 61788
716 Ga0495668_0002252 3300046616 Bacteria 16242
717 Ga0495668_0004022 3300046616 Bacteria 10703
718 Ga0495668_0006266 3300046616 Bacteria 7840
719 Ga0495668_0009375 3300046616 Bacteria 6017
720 Ga0495668_0026838 3300046616 Bacteria 3266
721 Ga0495668_0171492 3300046616 Bacteria 1188
722 Ga0495668_0229147 3300046616 Bacteria 1017
723 Ga0495634_0364208 3300046642 Bacteria 864
724 Ga0495611_0004040 3300046648 Bacteria 6384
725 Ga0495611_0004163 3300046648 Bacteria 6295
726 Ga0495611_0037061 3300046648 Bacteria 2166
727 Ga0495611_0059344 3300046648 Bacteria 1736
728 Ga0495611_0284693 3300046648 Bacteria 763
729 Ga0495625_0048522 3300046660 Bacteria 3057
730 Ga0495625_0062464 3300046660 Bacteria 2632
731 Ga0495625_0064180 3300046660 Bacteria 2591
732 Ga0495625_0101824 3300046660 Bacteria 1972
733 Ga0495625_0189119 3300046660 Bacteria 1365
734 Ga0495625_0233108 3300046660 Bacteria 1201
735 Ga0495625_0274163 3300046660 Bacteria 1088
736 Ga0495635_0012345 3300046663 Bacteria 5986
737 Ga0495659_0012974 3300046664 Bacteria 2708
738 Ga0495659_0247745 3300046664 Bacteria 742
739 Ga0495661_0000544 3300046665 Bacteria 38960
740 Ga0495661_0003256 3300046665 Bacteria 12082
741 Ga0495661_0005272 3300046665 Bacteria 9188
742 Ga0495661_0015461 3300046665 Bacteria 5094
743 Ga0495661_0027005 3300046665 Bacteria 3691
744 Ga0495661_0028564 3300046665 Bacteria 3568
745 Ga0495661_0046160 3300046665 Bacteria 2661
746 Ga0495661_0079896 3300046665 Bacteria 1889
747 Ga0495661_0080154 3300046665 Bacteria 1885
748 Ga0495661_0098090 3300046665 Bacteria 1654
749 Ga0495661_0169092 3300046665 Bacteria 1167
750 Ga0495661_0403414 3300046665 Bacteria 664
751 Ga0495588_0000078 3300046674 Bacteria 214254
752 Ga0495588_0011122 3300046674 Bacteria 4213
753 Ga0495588_0048253 3300046674 Bacteria 2187
754 Ga0495588_0051970 3300046674 Bacteria 2111
755 Ga0495588_0054854 3300046674 Bacteria 2056
756 Ga0495588_0079308 3300046674 Bacteria 1713
757 Ga0495588_0092515 3300046674 Bacteria 1584
758 Ga0495588_0097405 3300046674 Bacteria 1543
759 Ga0495588_0141692 3300046674 Bacteria 1270
760 Ga0495588_0168627 3300046674 Bacteria 1157
761 Ga0495588_0186035 3300046674 Bacteria 1097
762 Ga0495588_0306700 3300046674 Bacteria 835
763 Ga0495588_0487380 3300046674 Bacteria 646
764 Ga0495599_0537508 3300046678 Bacteria 685
765 Ga0495623_0011273 3300046679 Bacteria 5782
766 Ga0495623_0091922 3300046679 Bacteria 1861
767 Ga0495623_0550156 3300046679 Bacteria 604
768 Ga0495646_0073916 3300046680 Bacteria 2002
769 Ga0495646_0215975 3300046680 Bacteria 1039
770 Ga0495669_0000194 3300046684 Bacteria 37638
771 Ga0495669_0000729 3300046684 Bacteria 14292
772 Ga0495669_0000815 3300046684 Bacteria 13253
773 Ga0495669_0017611 3300046684 Bacteria 3067
774 Ga0495624_0025247 3300046690 Bacteria 3903
775 Ga0495670_0000387 3300046691 Bacteria 21015
776 Ga0495670_0007002 3300046691 Bacteria 5551
777 Ga0495670_0014000 3300046691 Bacteria 3946
778 Ga0495670_0022267 3300046691 Bacteria 3128
779 Ga0495670_0117422 3300046691 Bacteria 1380
780 Ga0495670_0125124 3300046691 Bacteria 1338
781 Ga0495670_0153119 3300046691 Bacteria 1209
782 Ga0495670_0262758 3300046691 Bacteria 921
783 Ga0495670_0451582 3300046691 Bacteria 696
784 Ga0495671_0000002 3300046692 Bacteria 1136189
785 Ga0495671_0000391 3300046692 Bacteria 36162
786 Ga0495671_0015270 3300046692 Bacteria 4120
787 Ga0495671_0016677 3300046692 Bacteria 3918
788 Ga0495671_0028296 3300046692 Bacteria 2889
789 Ga0495671_0040826 3300046692 Bacteria 2338
790 Ga0495671_0202903 3300046692 Bacteria 961
791 Ga0495649_0079112 3300046694 Bacteria 1759
792 Ga0495649_0131884 3300046694 Bacteria 1318
793 Ga0495649_0190846 3300046694 Bacteria 1066
794 Ga0495649_0275929 3300046694 Bacteria 859
795 Ga0495589_0000118 3300046794 Bacteria 73742
796 Ga0495589_0000300 3300046794 Bacteria 39331
797 Ga0495589_0005163 3300046794 Bacteria 6907
798 Ga0495589_0006774 3300046794 Bacteria 6034
799 Ga0495589_0012866 3300046794 Bacteria 4324
800 Ga0495589_0114104 3300046794 Bacteria 1303
801 Ga0495589_0134509 3300046794 Bacteria 1186
802 Ga0495589_0420000 3300046794 Bacteria 613
803 Ga0495600_0027057 3300046809 Bacteria 3705
804 Ga0495660_0000070 3300046810 Bacteria 112800
805 Ga0495660_0000845 3300046810 Bacteria 22629
806 Ga0495660_0005038 3300046810 Bacteria 7937
807 Ga0495660_0005264 3300046810 Bacteria 7757
808 Ga0495660_0007998 3300046810 Bacteria 6209
809 Ga0495660_0032020 3300046810 Bacteria 2954
810 Ga0495660_0037071 3300046810 Bacteria 2717
811 Ga0495660_0130427 3300046810 Bacteria 1261
812 Ga0495660_0272965 3300046810 Bacteria 776
813 Ga0495581_0002819 3300047315 Bacteria 9931
814 Ga0495581_0008271 3300047315 Bacteria 6030
815 Ga0495581_0079265 3300047315 Bacteria 1900
816 Ga0495604_0012649 3300047317 Bacteria 6713
817 Ga0495604_0023295 3300047317 Bacteria 4939
818 Ga0495604_0084225 3300047317 Bacteria 2374
819 Ga0495604_0124305 3300047317 Bacteria 1863
820 Ga0495604_0405137 3300047317 Bacteria 898
821 Ga0495636_0007354 3300047318 Bacteria 4334
822 Ga0495636_0007447 3300047318 Bacteria 4308
823 Ga0495636_0024460 3300047318 Bacteria 2449
824 Ga0495636_0094706 3300047318 Bacteria 1300
825 Ga0495636_0251802 3300047318 Bacteria 817
826 Ga0495674_0546264 3300047319 Bacteria 923
827 Ga0495672_0002603 3300047320 Bacteria 16359
828 Ga0495672_0003246 3300047320 Bacteria 14113
829 Ga0495672_0013037 3300047320 Bacteria 5753
830 Ga0495672_0013704 3300047320 Bacteria 5579
831 Ga0495672_0370624 3300047320 Bacteria 660
832 Ga0495676_0000040 3300047321 Bacteria 106964
833 Ga0495676_0033589 3300047321 Bacteria 4318
834 Ga0495676_0106535 3300047321 Bacteria 2065
835 Ga0495680_0028206 3300047322 Bacteria 4604
836 Ga0495680_0857476 3300047322 Bacteria 590
837 Ga0495683_0034154 3300047323 Bacteria 2587
838 Ga0495683_0044558 3300047323 Bacteria 2231
839 Ga0495683_0065123 3300047323 Bacteria 1798
840 Ga0495683_0126073 3300047323 Bacteria 1211
841 Ga0495683_0227032 3300047323 Bacteria 830
842 Ga0495687_000230 3300047443 Bacteria 78342
843 Ga0495687_000247 3300047443 Bacteria 73918
844 Ga0495687_000396 3300047443 Bacteria 54169
845 Ga0495687_000791 3300047443 Bacteria 34019
846 Ga0495687_006061 3300047443 Bacteria 7525
847 Ga0495687_042992 3300047443 Bacteria 1971
848 Ga0495687_053595 3300047443 Bacteria 1697
849 Ga0495675_0001760 3300047444 Bacteria 12929
850 Ga0495675_0008788 3300047444 Bacteria 6271
851 Ga0495675_0353847 3300047444 Bacteria 863
852 Ga0495675_0563952 3300047444 Bacteria 648
853 Ga0495677_0000171 3300047445 Bacteria 30903
854 Ga0495677_0003938 3300047445 Bacteria 5736
855 Ga0495677_0006767 3300047445 Bacteria 4313
856 Ga0495677_0020540 3300047445 Bacteria 2394
857 Ga0495677_0024627 3300047445 Bacteria 2183
858 Ga0495677_0028534 3300047445 Bacteria 2027
859 Ga0495677_0034133 3300047445 Bacteria 1855
860 Ga0495677_0144699 3300047445 Bacteria 913
861 Ga0495677_0351629 3300047445 Bacteria 581
862 Ga0495677_0356332 3300047445 Bacteria 577
863 Ga0495677_0393260 3300047445 Bacteria 548
864 Ga0495679_008472 3300047446 Bacteria 4177
865 Ga0495679_021051 3300047446 Bacteria 2261
866 Ga0495679_039159 3300047446 Bacteria 1479
867 Ga0495685_001643 3300047447 Bacteria 6896
868 Ga0495685_054394 3300047447 Bacteria 1354
869 Ga0495685_162031 3300047447 Bacteria 724
870 Ga0495673_0000005 3300047469 Bacteria 943364
871 Ga0495673_0000026 3300047469 Bacteria 476378
872 Ga0495673_0000028 3300047469 Bacteria 473418
873 Ga0495673_0007477 3300047469 Bacteria 6275
874 Ga0495681_0000515 3300047470 Bacteria 29483
875 Ga0495681_0000938 3300047470 Bacteria 22470
876 Ga0495681_0006074 3300047470 Bacteria 7984
877 Ga0495681_0008256 3300047470 Bacteria 6542
878 Ga0495681_0026253 3300047470 Bacteria 3036
879 Ga0495681_0033942 3300047470 Bacteria 2548
880 Ga0495681_0135766 3300047470 Bacteria 1043
881 Ga0495686_0000635 3300047472 Bacteria 48342
882 Ga0495686_0000867 3300047472 Bacteria 38673
883 Ga0495686_0001860 3300047472 Bacteria 21178
884 Ga0495686_0015700 3300047472 Bacteria 5160
885 Ga0495686_0321640 3300047472 Bacteria 848
886 Ga0495593_0008646 3300047673 Bacteria 5920
887 Ga0495593_0048210 3300047673 Bacteria 2264
888 Ga0495602_0023328 3300048088 Bacteria 6031
889 Ga0495602_0179258 3300048088 Bacteria 1636
890 Ga0495602_0375147 3300048088 Bacteria 1020
891 Ga0495614_0020227 3300048089 Bacteria 2879
892 Ga0495614_0054079 3300048089 Bacteria 1721
893 Ga0495615_0306632 3300048090 Bacteria 516
894 Ga0495626_0000014 3300048091 Bacteria 246660
895 Ga0495626_0000028 3300048091 Bacteria 204580
896 Ga0495626_0001202 3300048091 Bacteria 21436
897 Ga0495626_0010116 3300048091 Bacteria 5061
898 Ga0495626_0010452 3300048091 Bacteria 4949
899 Ga0495626_0041025 3300048091 Bacteria 2183
900 Ga0495626_0048094 3300048091 Bacteria 1980
901 Ga0495626_0112069 3300048091 Bacteria 1180
902 Ga0495626_0172016 3300048091 Bacteria 902
903 Ga0496100_0017614 3300048903 Bacteria 4222
904 Ga0496100_0511022 3300048903 Bacteria 926
905 Ga0496101_0158774 3300048904 Bacteria 1733
906 Ga0496101_0968513 3300048904 Bacteria 669
907 Ga0496102_0000285 3300048905 Bacteria 64637
908 Ga0496102_0006994 3300048905 Bacteria 9630
909 Ga0496102_0073317 3300048905 Bacteria 3146
910 Ga0496102_0210752 3300048905 Bacteria 1832
911 Ga0496102_0979288 3300048905 Bacteria 766
912 Ga0496102_1915287 3300048905 Bacteria 509
913 Ga0496103_0125855 3300048906 Bacteria 1634
914 Ga0496103_0735590 3300048906 Bacteria 624
915 Ga0496104_0002988 3300048907 Bacteria 14576
916 Ga0496104_0013979 3300048907 Bacteria 7241
917 Ga0496104_0148172 3300048907 Bacteria 2253
918 Ga0496104_0193605 3300048907 Bacteria 1945
919 Ga0496104_0391951 3300048907 Bacteria 1301
920 Ga0496105_0000029 3300048908 Bacteria 139338
921 Ga0496105_0021293 3300048908 Bacteria 5246
922 Ga0496105_0021474 3300048908 Bacteria 5223
923 Ga0496105_0170139 3300048908 Bacteria 1786
924 Ga0496105_0229636 3300048908 Bacteria 1508
925 Ga0496106_0036901 3300048909 Bacteria 3655
926 Ga0496106_0317780 3300048909 Bacteria 1250
927 Ga0496107_0757903 3300048910 Bacteria 712
928 Ga0496108_1511522 3300048911 Bacteria 558
929 Ga0496109_0349446 3300048912 Bacteria 1397
930 Ga0496109_1476415 3300048912 Bacteria 615
931 Ga0496110_0000403 3300048913 Bacteria 29296
932 Ga0496110_0011504 3300048913 Bacteria 7245
933 Ga0496110_0021417 3300048913 Bacteria 5473
934 Ga0496111_0024300 3300048914 Bacteria 4265
935 Ga0496111_0121241 3300048914 Bacteria 1931
936 Ga0496111_0239290 3300048914 Bacteria 1348
937 Ga0496111_0364837 3300048914 Bacteria 1069
938 Ga0496112_0090675 3300048915 Bacteria 3025
939 Ga0496112_0480646 3300048915 Bacteria 1179
940 Ga0496113_0004883 3300048916 Bacteria 8303
941 Ga0496113_0072672 3300048916 Bacteria 2618
942 Ga0496113_1426466 3300048916 Bacteria 536
943 Ga0496114_0064210 3300048917 Bacteria 3074
944 Ga0496114_0369842 3300048917 Bacteria 1269
945 Ga0496114_1043464 3300048917 Unclassified 701
946 Ga0496115_0020962 3300048918 Bacteria 5043
947 Ga0496115_0050321 3300048918 Bacteria 3337
948 Ga0496115_0212036 3300048918 Bacteria 1599
949 Ga0496115_0322358 3300048918 Bacteria 1263
950 Ga0496116_0307155 3300048919 Bacteria 751
951 Ga0496119_0000611 3300048922 Bacteria 48305
952 Ga0496120_0034628 3300048923 Bacteria 3023
953 Ga0496121_0025701 3300048924 Bacteria 5578
954 Ga0496121_0130783 3300048924 Bacteria 1879
955 Ga0496122_0014301 3300048925 Bacteria 7685
956 Ga0496122_0057856 3300048925 Bacteria 2875
957 Ga0496122_0412009 3300048925 Bacteria 682
958 Ga0496123_0003046 3300048926 Bacteria 19295
959 Ga0496123_0005925 3300048926 Bacteria 12041
960 Ga0496123_0249518 3300048926 Bacteria 876
961 Ga0496124_0012729 3300048927 Bacteria 8272
962 Ga0496124_0017100 3300048927 Bacteria 6856
963 Ga0496124_0099669 3300048927 Bacteria 2356
964 Ga0496124_0108374 3300048927 Bacteria 2240
965 Ga0496124_0151955 3300048927 Bacteria 1815
966 Ga0496124_0204609 3300048927 Bacteria 1498
967 Ga0496124_0422261 3300048927 Bacteria 918
968 Ga0496125_0105551 3300048928 Bacteria 2059
969 Ga0496126_0005047 3300048929 Bacteria 15323
970 Ga0496126_0716389 3300048929 Bacteria 776
971 Ga0495678_000006 3300049459 Bacteria 463690
972 Ga0495678_000844 3300049459 Bacteria 27363
973 Ga0495678_002130 3300049459 Bacteria 14032
974 Ga0495678_002172 3300049459 Bacteria 13805
975 Ga0495682_0002910 3300049460 Bacteria 7855
976 Ga0495682_0070090 3300049460 Bacteria 1262
977 Ga0501300_077789 3300049523 Bacteria 543
978 Ga0501031_0760822 3300049568 Bacteria 621
979 Ga0501034_0179113 3300049571 Bacteria 2085
980 Ga0501039_0735640 3300049575 Bacteria 771
981 Ga0501040_0643269 3300049576 Bacteria 766
982 Ga0501041_0218858 3300049577 Bacteria 1195
983 Ga0501047_0156902 3300049581 Bacteria 2149
984 Ga0501048_0175522 3300049582 Bacteria 1519
985 Ga0501071_0332410 3300049587 Bacteria 1155
986 Ga0501076_1512184 3300049592 Bacteria 551
987 Ga0501209_277855 3300049656 Bacteria 525
988 Ga0501235_199279 3300049669 Bacteria 541
989 Ga0501238_073964 3300049671 Bacteria 532
990 Ga0501221_150304 3300049704 Bacteria 617
991 Ga0501225_0347806 3300049705 Bacteria 512
992 Ga0501035_0000813 3300049822 Bacteria 33299
993 Ga0501044_0514835 3300049823 Bacteria 1097
994 Ga0500594_0020311 3300053118 Bacteria 1656
995 Ga0500618_000621 3300053125 Bacteria 21549
996 Ga0500586_000876 3300053145 Bacteria 6221
997 Ga0587084_133199 3300059477 Bacteria 533
998 Ga0587066_036057 3300059490 Bacteria 908
999 Ga0587070_176044 3300059491 Bacteria 554
1000 Ga0587080_044697 3300059503 Bacteria 818
1001 Ga0587082_011812 3300059504 Bacteria 1285
1002 Ga0587083_0004461 3300059505 Bacteria 1947
1003 Ga0587088_015507 3300059508 Bacteria 1201
1004 Ga0587091_086509 3300059511 Bacteria 713
1005 Ga0587098_028061 3300059604 Bacteria 759
1006 Ga0587098_090480 3300059604 Bacteria 521
1007 Ga0587101_018396 3300059623 Bacteria 979
1008 Ga0587068_022379 3300059641 Bacteria 1047
1009 Ga0587069_060244 3300059642 Bacteria 698
1010 Ga0587072_013660 3300059643 Bacteria 1359
1011 Ga0587075_070135 3300059644 Bacteria 649
1012 Ga0587079_016099 3300059647 Bacteria 1280
1013 Ga0587079_016700 3300059647 Bacteria 1264
1014 Ga0587079_031439 3300059647 Bacteria 1023
1015 Ga0587102_012097 3300059649 Bacteria 876
1016 Ga0466962_0215044 3300061719 Bacteria 940
1017 Ga0466962_0268787 3300061719 Bacteria 840
1018 Ga0530510_0566659 3300061734 Bacteria 863
1019 2521557855 2521172590 Bacteria 5047645
1020 2552746448 2551306352 Bacteria 3873115
1021 2553002980 2551306416 Bacteria 6152985
1022 2601670246 2600255292 Bacteria 6300551
1023 2640736470 2639762793 Bacteria 3943681
1024 2643802696 2643221556 Bacteria 7251154
1025 2644215343 2643221638 Bacteria 6579467
1026 2644252048 2643221645 Bacteria 7207331
1027 2644360696 2643221664 Bacteria 7272945
1028 2644472201 2643221684 Bacteria 7145183
1029 2678229691 2675903507 Bacteria 3737791
1030 2738829024 2738541297 Bacteria 6549566
1031 2739152820 2738541357 Bacteria 6549408
1032 2739194740 2738543003 Bacteria 6549560
1033 2739321216 2738543026 Bacteria 6549408
1034 2739339457 2738543029 Bacteria 6549249
1035 2765568972 2765235838 Bacteria 5445269
1036 2774391385 2773857761 Bacteria 3837365
1037 2774436120 2773857770 Bacteria 3911866
1038 2809142653 2808606418 Bacteria 6724496
1039 2819542382 2818991436 Bacteria 5376622
1040 2819615003 2818991449 Bacteria 5518009
1041 2821133232 2821131069 Bacteria 6108407
1042 2839096146 2839094727 Bacteria 5534556
1043 2842717596 2842711865 Bacteria 7155354
1044 2857552181 2857547612 Bacteria 6179999
1045 2857553358 2857553236 Bacteria 6166726
1046 2857567432 2857564685 Bacteria 6290584
1047 2885082901 2885080285 Bacteria 6355622
1048 2904441383 2904439833 Bacteria 5931679
1049 2904531680 2904530477 Bacteria 5876334
1050 2904588095 2904584206 Bacteria 6028872
1051 2904589745 2904589729 Bacteria 6113573
1052 2904602869 2904601388 Bacteria 5884906
1053 2916700418 2916699645 Bacteria 3568996
1054 2919046319 2919046199 Bacteria 5567169
1055 2919079627 2919079590 Bacteria 5946433
1056 2919185210 2919182534 Bacteria 3907101
1057 2919479730 2919476304 Bacteria 5888696
1058 2919509204 2919506607 Bacteria 3392955
1059 2923511082 2923510766 Bacteria 5926163
1060 2928131025 2928130867 Bacteria 5467269
1061 2932413756 2932410948 Bacteria 6312192
1062 2932417816 2932416698 Bacteria 6315112
1063 2989393025 2989392574 Bacteria 4554005
1064 8047675314 8047673197 Bacteria 7395230
1065 Ga0466969_0356061
1066 JGI25152J39213_1000003
1067 JGI25150J39212_1000404
1068 JGI25150J39212_1008202
1069 JGI25159J45721_1002231
1070 JGI25151J46595_10089191
1071 JGI25153J46596_10027098
1072 JGI25153J46596_10073073
1073 JGI25161J50226_1001011
1074 Ga0007417J51691_1088433
1075 Ga0007410J51695_1026810
1076 Ga0007410J51695_1065535
1077 Ga0007409J51694_1029414
1078 Ga0006562J51391_1004973
1079 Ga0032354_1062764
1080 Ga0055538_1000002
1081 Ga0055539_1000002
1082 Ga0055533_1000004
1083 Ga0055525_1000002
1084 Ga0055525_1000029
1085 Ga0055542_1008314
1086 Ga0055526_1003670
1087 Ga0055537_1000022
1088 Ga0055537_1005411
1089 Ga0055524_1001646
1090 Ga0055524_1002887
1091 Ga0055534_1000468
1092 Ga0055534_1008665
1093 Ga0055528_1000473
1094 Ga0055530_10002395
1095 Ga0055541_1000002
1096 Ga0055541_1000043
1097 Ga0058692_1000067
1098 Ga0055543_1001364
1099 Ga0058862_12124498
1100 Ga0065165_1005566
1101 Ga0065165_1142271
1102 Ga0065703_1000160
1103 Ga0065715_10593760
1104 Ga0070658_10170065
1105 Ga0070658_10848537
1106 Ga0070658_11637271
1107 Ga0070690_100123259
1108 Ga0068869_100011386
1109 Ga0070666_10132760
1110 Ga0070666_10963727
1111 Ga0068868_100071159
1112 Ga0070689_101655469
1113 Ga0070661_100108577
1114 Ga0070668_100073025
1115 Ga0070668_100308148
1116 Ga0070668_100968616
1117 Ga0070669_100000536
1118 Ga0070675_100192440
1119 Ga0070674_100149952
1120 Ga0070673_100006935
1121 Ga0070673_100286379
1122 Ga0070673_101092678
1123 Ga0070688_100545218
1124 Ga0070667_100758666
1125 Ga0070694_100858968
1126 Ga0070663_100512545
1127 Ga0070662_101355640
1128 Ga0068867_100149436
1129 Ga0068867_102077484
1130 Ga0074250_12706
1131 Ga0070679_101272783
1132 Ga0068853_100241225
1133 Ga0068853_100353340
1134 Ga0068853_100604893
1135 Ga0070695_100380392
1136 Ga0070665_100002224
1137 Ga0070665_102018032
1138 Ga0068855_100000065
1139 Ga0068855_100077239
1140 Ga0068855_100183523
1141 Ga0068855_101142155
1142 Ga0068854_100080165
1143 Ga0070702_100117395
1144 Ga0068852_100343980
1145 Ga0068852_100532531
1146 Ga0068859_100004713
1147 Ga0068864_100440095
1148 Ga0068866_10459263
1149 Ga0068861_100110156
1150 Ga0068861_100665007
1151 Ga0068861_101563688
1152 Ga0068851_10612319
1153 Ga0068870_10055178
1154 Ga0068863_100121660
1155 Ga0068858_100032501
1156 Ga0068860_100064662
1157 Ga0068862_100389805
1158 Ga0068862_100430499
1159 Ga0081540_1001860
1160 Ga0070717_10245289
1161 Ga0075364_10459794
1162 Ga0097621_100879426
1163 Ga0068871_100003921
1164 Ga0075433_10539499
1165 Ga0068865_100340057
1166 Ga0068865_100369625
1167 Ga0097620_100004713
1168 Ga0079104_1005362
1169 Ga0105250_10099037
1170 Ga0105240_10017404
1171 Ga0105240_10314567
1172 Ga0111539_10570651
1173 Ga0111539_11333038
1174 Ga0105245_10140530
1175 Ga0105245_10168205
1176 Ga0105247_10024718
1177 Ga0105243_10000263
1178 Ga0105243_10024594
1179 Ga0105243_10312708
1180 Ga0105241_10193048
1181 Ga0105241_10653374
1182 Ga0105242_10055392
1183 Ga0105242_10154773
1184 Ga0105248_10003110
1185 Ga0105237_10065345
1186 Ga0105237_10282893
1187 Ga0105238_10035766
1188 Ga0105238_10953456
1189 Ga0105028_142612
1190 Ga0105239_10046629
1191 Ga0105239_10063665
1192 Ga0105246_10121678
1193 Ga0157371_10000013
1194 Ga0157369_11071215
1195 Ga0157374_10004388
1196 Ga0157374_10137275
1197 Ga0157378_10099534
1198 Ga0157372_10116772
1199 Ga0157372_10562494
1200 Ga0157372_11827872
1201 Ga0157375_10035912
1202 Ga0163163_10011347
1203 Ga0163163_12629074
1204 Ga0182008_10005570
1205 Ga0157379_10039306
1206 Ga0157376_10017972
1207 Ga0157376_10836258
1208 Ga0182006_1000056
1209 Ga0182007_10041288
1210 Ga0182005_1000013
1211 Ga0206356_10036676
1212 Ga0206356_10365692
1213 Ga0206356_10546003
1214 Ga0206351_10097662
1215 Ga0206352_10359740
1216 Ga0206354_10655136
1217 Ga0154015_1538395
1218 Ga0213872_10000494
1219 Ga0213872_10000502
1220 Ga0213872_10001215
1221 Ga0213872_10001327
1222 Ga0213872_10001385
1223 Ga0213872_10003003
1224 Ga0213872_10003978
1225 Ga0209784_100002
1226 Ga0209566_100003
1227 Ga0209674_100004
1228 Ga0209563_100003
1229 Ga0209563_100006
1230 Ga0207425_1000173
1231 Ga0209677_100003
1232 Ga0209677_114779
1233 Ga0209148_1000914
1234 Ga0209565_1000015
1235 Ga0209673_1000017
1236 Ga0209675_1000012
1237 Ga0209025_1007780
1238 Ga0209564_1000016
1239 Ga0209758_1000449
1240 Ga0209256_1000076
1241 Ga0207696_1013040
1242 Ga0207655_1029020
1243 Ga0207713_1002177
1244 Ga0207642_10300425
1245 Ga0207710_10000183
1246 Ga0207710_10049959
1247 Ga0207645_10642290
1248 Ga0207643_10167806
1249 Ga0207705_10003707
1250 Ga0207705_10474309
1251 Ga0207654_10248701
1252 Ga0207654_10307684
1253 Ga0207695_10000475
1254 Ga0207695_10050605
1255 Ga0207671_10013593
1256 Ga0207671_10113146
1257 Ga0207657_10004691
1258 Ga0207657_10015820
1259 Ga0207681_10004469
1260 Ga0207694_10020740
1261 Ga0207659_10256392
1262 Ga0207687_10253146
1263 Ga0207687_10354619
1264 Ga0207690_10054319
1265 Ga0207690_10133789
1266 Ga0207706_10119248
1267 Ga0207706_10656689
1268 Ga0207686_10132425
1269 Ga0207686_10463748
1270 Ga0207709_10000158
1271 Ga0207709_10271703
1272 Ga0207709_10416579
1273 Ga0207704_10067319
1274 Ga0207711_10022452
1275 Ga0207689_10006227
1276 Ga0207661_11767614
1277 Ga0207679_10435276
1278 Ga0207679_10929338
1279 Ga0207667_10000025
1280 Ga0207667_10010688
1281 Ga0207667_10716204
1282 Ga0207651_10015435
1283 Ga0207651_10165484
1284 Ga0207668_10053200
1285 Ga0207668_10261186
1286 Ga0207640_10008256
1287 Ga0207658_10089692
1288 Ga0207658_11289812
1289 Ga0207677_10061667
1290 Ga0207703_10012815
1291 Ga0207639_10557211
1292 Ga0207678_10568599
1293 Ga0207678_10589887
1294 Ga0207702_10150145
1295 Ga0207641_10323733
1296 Ga0207676_10722892
1297 Ga0207675_100020532
1298 Ga0207683_10411424
1299 Ga0207698_11737103
1300 Ga0209281_1008358
1301 Ga0209371_1000196
1302 Ga0268266_10003278
1303 Ga0268266_11825230
1304 Ga0268265_10049828
1305 Ga0268265_10424500
1306 Ga0268264_10130920
1307 Ga0268256_1000158
1308 Ga0316182_1110679
1309 Ga0265330_10136490
1310 Ga0265330_10240597
1311 Ga0265339_10005282
1312 Ga0265316_10051906
1313 Ga0307408_100000403
1314 Ga0316575_10045814
1315 Ga0316575_10069334
1316 Ga0316575_10115773
1317 Ga0316575_10321817
1318 Ga0316579_10000641
1319 Ga0316579_10002987
1320 Ga0316579_10012448
1321 Ga0316579_10015676
1322 Ga0316579_10026561
1323 Ga0316579_10131682
1324 Ga0316579_10158749
1325 Ga0316579_10422318
1326 Ga0316579_10590728
1327 Ga0265342_10038819
1328 Ga0265342_10320335
1329 Ga0316576_10000696
1330 Ga0316576_10002369
1331 Ga0316576_10055452
1332 Ga0316576_10092706
1333 Ga0316576_10100589
1334 Ga0316576_10154517
1335 Ga0316576_10229603
1336 Ga0316576_10345918
1337 Ga0316576_10366163
1338 Ga0316576_10872124
1339 Ga0316578_10000636
1340 Ga0316578_10006630
1341 Ga0316578_10009197
1342 Ga0316578_10053943
1343 Ga0316578_10058400
1344 Ga0316578_10058488
1345 Ga0316578_10068841
1346 Ga0316578_10076192
1347 Ga0316578_10088037
1348 Ga0316578_10095632
1349 Ga0316578_10135185
1350 Ga0316578_10180718
1351 Ga0316577_10019195
1352 Ga0316577_10020491
1353 Ga0316577_10044733
1354 Ga0316577_10318915
1355 Ga0316577_10351590
1356 Ga0307413_10014872
1357 Ga0307413_11112225
1358 Ga0307411_10457449
1359 Ga0307415_101811035
1360 Ga0316583_10009355
1361 Ga0316583_10064786
1362 Ga0316585_10005478
1363 Ga0316585_10027472
1364 Ga0316585_10034243
1365 Ga0316585_10037125
1366 Ga0316585_10088933
1367 Ga0316585_10105259
1368 Ga0316585_10165057
1369 Ga0316580_10001094
1370 Ga0316580_10003846
1371 Ga0316580_10047111
1372 Ga0316580_10257736
1373 Ga0316593_10012553
1374 Ga0316593_10025717
1375 Ga0316593_10047074
1376 Ga0316593_10065646
1377 Ga0316592_1010691
1378 Ga0316592_1011728
1379 Ga0316592_1016320
1380 Ga0316592_1021387
1381 Ga0316592_1025438
1382 Ga0316592_1052741
1383 Ga0316592_1138454
1384 Ga0316586_1038739
1385 Ga0316588_1007223
1386 Ga0316588_1013813
1387 Ga0316588_1023138
1388 Ga0316588_1028305
1389 Ga0316588_1028325
1390 Ga0316588_1058373
1391 Ga0316588_1065775
1392 Ga0316588_1085154
1393 Ga0316587_1102154
1394 Ga0316596_1006977
1395 Ga0316596_1010639
1396 Ga0316596_1011630
1397 Ga0316596_1014115
1398 Ga0316596_1015759
1399 Ga0316596_1016296
1400 Ga0316596_1016463
1401 Ga0316596_1032445
1402 Ga0316596_1042536
1403 Ga0316596_1042926
1404 Ga0316596_1053132
1405 Ga0316596_1063936
1406 Ga0316596_1067864
1407 Ga0316596_1242358
1408 Ga0373948_0122092
1409 Ga0373952_0000197
1410 Ga0373960_0011163
1411 Ga0373942_0138111
1412 Ga0316574_0013409
1413 Ga0316574_0014091
1414 Ga0316574_0015990
1415 Ga0316574_0055523
1416 Ga0316574_0064536
1417 Ga0316574_0066311
1418 Ga0316574_0073010
1419 Ga0316574_0104404
1420 Ga0316574_0109527
1421 Ga0316574_0199331
1422 Ga0316574_0202035
1423 Ga0316574_0212555
1424 Ga0316574_0214818
1425 Ga0316574_0242867
1426 Ga0316574_0281001
1427 Ga0316574_0393600
1428 Ga0316574_0411942
1429 Ga0373937_1536288
1430 Ga0316582_0024962
1431 Ga0316582_0025114
1432 Ga0316582_0037338
1433 Ga0316582_0109234
1434 Ga0316582_0126098
1435 Ga0316582_0161809
1436 Ga0316582_0278315
1437 Ga0316582_0451638
1438 Ga0316582_1086043
1439 Ga0316584_0002876
1440 Ga0316584_0006153
1441 Ga0316584_0006346
1442 Ga0316584_0007969
1443 Ga0316584_0086562
1444 Ga0316584_0151823
1445 Ga0316584_0272615
1446 Ga0316584_0307941
1447 Ga0316584_0373799
1448 Ga0316584_0402311
1449 Ga0316584_0455243
1450 Ga0395899_0002589
1451 Ga0395899_0015612
1452 Ga0395899_0053955
1453 Ga0395899_0087530
1454 Ga0395899_0171213
1455 Ga0395899_0325743
1456 Ga0395899_0521983
1457 Ga0395900_0000229
1458 Ga0395900_0000263
1459 Ga0395900_0016748
1460 Ga0395900_0033712
1461 Ga0395900_0054735
1462 Ga0395900_0084298
1463 Ga0395900_0524971
1464 Ga0395900_0543450
1465 Ga0395900_0638201
1466 Ga0395900_0666714
1467 Ga0395900_1248991
1468 Ga0395900_1852173
1469 Ga0395898_0040939
1470 Ga0395898_0451964
1471 Ga0395898_0825603
1472 Ga0395898_0982341
1473 Ga0395898_1056672
1474 Ga0395898_1350128
1475 Ga0395898_1736906
1476 Ga0395905_0040521
1477 Ga0395905_0099915
1478 Ga0395905_0121406
1479 Ga0395905_0251335
1480 Ga0395905_0298545
1481 Ga0395905_0492590
1482 Ga0395905_0561639
1483 Ga0395905_1067982
1484 Ga0316581_0004778
1485 Ga0316581_0020281
1486 Ga0316581_0058842
1487 Ga0316581_0084811
1488 Ga0395901_0003564
1489 Ga0395901_0018100
1490 Ga0395901_0315058
1491 Ga0395901_0514272
1492 Ga0395901_1052974
1493 Ga0400484_21924
1494 Ga0400483_000262
1495 Ga0400483_175488
1496 Ga0436361_0062839
1497 Ga0436361_0215738
1498 Ga0436361_0228737
1499 Ga0436361_0288412
1500 Ga0436361_0441966
1501 Ga0436361_0579013
1502 Ga0436361_0738390
1503 Ga0436361_0880017
1504 Ga0436361_1194171
1505 Ga0436363_1522905
1506 Ga0439465_0115703
1507 Ga0451853_2426511
1508 Ga0439448_0047694
1509 Ga0439448_0217095
1510 Ga0439454_050804
1511 Ga0439455_0023062
1512 Ga0450911_019010
1513 Ga0450923_063156
1514 Ga0439458_0026524
1515 Ga0439458_0092824
1516 Ga0466969_0199679
1517 Ga0466969_0513019
1518 Ga0466972_0009901
1519 Ga0466965_0007668
1520 Ga0466965_0057624
1521 Ga0466965_0614019
1522 Ga0466966_0006340
1523 Ga0466966_0067575
1524 Ga0466966_0107254
1525 Ga0466966_0360395
1526 Ga0466961_0044146
1527 Ga0466961_0339774
1528 Ga0466963_0057228
1529 Ga0466963_0206317
1530 Ga0466963_0344455
1531 Ga0466964_0000658
1532 Ga0466964_0003582
1533 Ga0466964_0500380
1534 Ga0453684_0000638
1535 Ga0453684_0001104
1536 Ga0453684_2338595
1537 Ga0466971_0019568
1538 Ga0466971_0023381
1539 Ga0466968_0016796
1540 Ga0466968_0209423
1541 Ga0466968_0481891
1542 Ga0466957_0035226
1543 Ga0466957_0611943
1544 Ga0466957_0823404
1545 Ga0466959_0009426
1546 Ga0466959_0173645
1547 Ga0451576_2712766
1548 Ga0466958_0019455
1549 Ga0466958_0210454
1550 Ga0466958_0439260
1551 Ga0466958_0449740
1552 Ga0466967_0138815
1553 Ga0466967_0271390
1554 Ga0466967_1288810
1555 Ga0495617_000004
1556 Ga0495617_000009
1557 Ga0495617_003418
1558 Ga0495617_015961
1559 Ga0495627_000005
1560 Ga0495627_000226
1561 Ga0495627_033073
1562 Ga0495603_0034047
1563 Ga0495603_0048974
1564 Ga0495590_0000108
1565 Ga0495590_0009224
1566 Ga0495629_0601182
1567 Ga0495629_0729382
1568 Ga0495638_0036497
1569 Ga0495638_0098112
1570 Ga0495638_0139724
1571 Ga0495638_0528196
1572 Ga0495653_0000004
1573 Ga0495653_0002873
1574 Ga0495653_0060842
1575 Ga0495653_0074078
1576 Ga0495650_0000086
1577 Ga0495650_0000171
1578 Ga0495650_0192115
1579 Ga0495580_0198345
1580 Ga0495582_0006931
1581 Ga0495582_0033271
1582 Ga0495582_0531474
1583 Ga0495605_0000183
1584 Ga0495605_0000226
1585 Ga0495605_0034014
1586 Ga0495605_0036135
1587 Ga0495605_0110241
1588 Ga0495605_0200025
1589 Ga0495639_0257571
1590 Ga0495639_0325796
1591 Ga0495584_0000003
1592 Ga0495584_0003315
1593 Ga0495584_0013850
1594 Ga0495584_0015586
1595 Ga0495584_0069043
1596 Ga0495584_0071948
1597 Ga0495584_0076834
1598 Ga0495584_0106507
1599 Ga0495584_0295684
1600 Ga0495584_0653440
1601 Ga0495585_0001484
1602 Ga0495585_0002574
1603 Ga0495585_0002720
1604 Ga0495585_0006320
1605 Ga0495585_0024492
1606 Ga0495585_0033038
1607 Ga0495585_0102496
1608 Ga0495585_0123415
1609 Ga0495585_0206308
1610 Ga0495594_0005140
1611 Ga0495594_0007131
1612 Ga0495594_0013446
1613 Ga0495594_0027138
1614 Ga0495594_0094277
1615 Ga0495594_0099841
1616 Ga0495594_0314291
1617 Ga0495594_0396246
1618 Ga0495596_0004660
1619 Ga0495596_0005043
1620 Ga0495596_0007077
1621 Ga0495596_0008268
1622 Ga0495596_0008555
1623 Ga0495596_0021910
1624 Ga0495596_0129921
1625 Ga0495596_0223512
1626 Ga0495596_0253804
1627 Ga0495596_0260809
1628 Ga0495607_0001474
1629 Ga0495607_0001979
1630 Ga0495607_0011083
1631 Ga0495607_0044490
1632 Ga0495607_0081282
1633 Ga0495607_0086220
1634 Ga0495607_0096167
1635 Ga0495607_0171127
1636 Ga0495583_0000942
1637 Ga0495583_0007435
1638 Ga0495583_0009045
1639 Ga0495583_0012703
1640 Ga0495583_0016269
1641 Ga0495583_0020877
1642 Ga0495583_0120857
1643 Ga0495583_0125658
1644 Ga0495583_0237250
1645 Ga0495583_0432546
1646 Ga0495606_0000075
1647 Ga0495606_0000106
1648 Ga0495606_0000376
1649 Ga0495606_0002574
1650 Ga0495606_0006323
1651 Ga0495606_0022126
1652 Ga0495606_0038185
1653 Ga0495606_0069729
1654 Ga0495606_0160434
1655 Ga0495606_0215277
1656 Ga0495606_0471438
1657 Ga0495610_0000010
1658 Ga0495616_0000374
1659 Ga0495616_0011028
1660 Ga0495616_0013718
1661 Ga0495616_0016110
1662 Ga0495616_0023041
1663 Ga0495616_0029179
1664 Ga0495616_0145357
1665 Ga0495620_0008690
1666 Ga0495630_0024743
1667 Ga0495630_0091318
1668 Ga0495631_0000168
1669 Ga0495631_0001530
1670 Ga0495631_0008745
1671 Ga0495631_0012495
1672 Ga0495631_0033755
1673 Ga0495631_0045095
1674 Ga0495631_0067175
1675 Ga0495631_0069288
1676 Ga0495631_0134019
1677 Ga0495631_0258217
1678 Ga0495632_0000244
1679 Ga0495632_0000245
1680 Ga0495632_0001734
1681 Ga0495632_0119576
1682 Ga0495637_0000056
1683 Ga0495637_0018216
1684 Ga0495637_0058161
1685 Ga0495637_0256248
1686 Ga0495637_0330417
1687 Ga0495643_0003748
1688 Ga0495643_0042330
1689 Ga0495643_0048527
1690 Ga0495643_0087375
1691 Ga0495644_0013401
1692 Ga0495648_0001175
1693 Ga0495648_0002931
1694 Ga0495648_0002962
1695 Ga0495648_0019255
1696 Ga0495648_0025562
1697 Ga0495648_0026147
1698 Ga0495648_0097422
1699 Ga0495648_0109465
1700 Ga0495648_0148629
1701 Ga0495663_0028286
1702 Ga0495663_0053973
1703 Ga0495663_0107493
1704 Ga0495666_0000573
1705 Ga0495666_0000848
1706 Ga0495666_0011673
1707 Ga0495666_0040651
1708 Ga0495666_0092171
1709 Ga0495642_0000147
1710 Ga0495642_0001211
1711 Ga0495642_0001361
1712 Ga0495642_0011445
1713 Ga0495642_0022524
1714 Ga0495642_0053250
1715 Ga0495642_0058706
1716 Ga0495642_0076829
1717 Ga0495642_0109264
1718 Ga0495642_0125620
1719 Ga0495642_0166129
1720 Ga0495642_0408148
1721 Ga0495642_0566088
1722 Ga0495652_0340388
1723 Ga0495654_0000002
1724 Ga0495654_0002925
1725 Ga0495654_0032024
1726 Ga0495654_0039085
1727 Ga0495654_0069688
1728 Ga0495654_0076725
1729 Ga0495665_0005117
1730 Ga0495665_0031815
1731 Ga0495640_0136571
1732 Ga0495640_0219118
1733 Ga0495640_0771411
1734 Ga0495586_0008589
1735 Ga0495586_0020595
1736 Ga0495586_0021159
1737 Ga0495586_0505761
1738 Ga0495587_0037046
1739 Ga0495609_0000324
1740 Ga0495609_0001837
1741 Ga0495609_0003534
1742 Ga0495609_0004966
1743 Ga0495609_0004967
1744 Ga0495609_0007122
1745 Ga0495609_0012428
1746 Ga0495609_0109910
1747 Ga0495609_0342188
1748 Ga0495621_0180570
1749 Ga0495621_0223569
1750 Ga0495597_0000619
1751 Ga0495597_0001149
1752 Ga0495597_0001873
1753 Ga0495597_0033897
1754 Ga0495597_0042860
1755 Ga0495597_0073962
1756 Ga0495597_0083658
1757 Ga0495597_0160125
1758 Ga0495597_0172607
1759 Ga0495597_0224840
1760 Ga0495597_0281676
1761 Ga0495645_0390311
1762 Ga0495645_0638052
1763 Ga0495622_0009880
1764 Ga0495622_0012319
1765 Ga0495622_0018082
1766 Ga0495622_0071425
1767 Ga0495622_0092999
1768 Ga0495633_0002909
1769 Ga0495633_0008224
1770 Ga0495633_0018935
1771 Ga0495633_0082680
1772 Ga0495633_0083585
1773 Ga0495633_0131486
1774 Ga0495656_0034660
1775 Ga0495656_0085367
1776 Ga0495656_0113173
1777 Ga0495656_0170419
1778 Ga0495668_0000089
1779 Ga0495668_0000346
1780 Ga0495668_0002252
1781 Ga0495668_0004022
1782 Ga0495668_0006266
1783 Ga0495668_0009375
1784 Ga0495668_0026838
1785 Ga0495668_0171492
1786 Ga0495668_0229147
1787 Ga0495634_0364208
1788 Ga0495611_0004040
1789 Ga0495611_0004163
1790 Ga0495611_0037061
1791 Ga0495611_0059344
1792 Ga0495611_0284693
1793 Ga0495625_0048522
1794 Ga0495625_0062464
1795 Ga0495625_0064180
1796 Ga0495625_0101824
1797 Ga0495625_0189119
1798 Ga0495625_0233108
1799 Ga0495625_0274163
1800 Ga0495635_0012345
1801 Ga0495659_0012974
1802 Ga0495659_0247745
1803 Ga0495661_0000544
1804 Ga0495661_0003256
1805 Ga0495661_0005272
1806 Ga0495661_0015461
1807 Ga0495661_0027005
1808 Ga0495661_0028564
1809 Ga0495661_0046160
1810 Ga0495661_0079896
1811 Ga0495661_0080154
1812 Ga0495661_0098090
1813 Ga0495661_0169092
1814 Ga0495661_0403414
1815 Ga0495588_0000078
1816 Ga0495588_0011122
1817 Ga0495588_0048253
1818 Ga0495588_0051970
1819 Ga0495588_0054854
1820 Ga0495588_0079308
1821 Ga0495588_0092515
1822 Ga0495588_0097405
1823 Ga0495588_0141692
1824 Ga0495588_0168627
1825 Ga0495588_0186035
1826 Ga0495588_0306700
1827 Ga0495588_0487380
1828 Ga0495599_0537508
1829 Ga0495623_0011273
1830 Ga0495623_0091922
1831 Ga0495623_0550156
1832 Ga0495646_0073916
1833 Ga0495646_0215975
1834 Ga0495669_0000194
1835 Ga0495669_0000729
1836 Ga0495669_0000815
1837 Ga0495669_0017611
1838 Ga0495624_0025247
1839 Ga0495670_0000387
1840 Ga0495670_0007002
1841 Ga0495670_0014000
1842 Ga0495670_0022267
1843 Ga0495670_0117422
1844 Ga0495670_0125124
1845 Ga0495670_0153119
1846 Ga0495670_0262758
1847 Ga0495670_0451582
1848 Ga0495671_0000002
1849 Ga0495671_0000391
1850 Ga0495671_0015270
1851 Ga0495671_0016677
1852 Ga0495671_0028296
1853 Ga0495671_0040826
1854 Ga0495671_0202903
1855 Ga0495649_0079112
1856 Ga0495649_0131884
1857 Ga0495649_0190846
1858 Ga0495649_0275929
1859 Ga0495589_0000118
1860 Ga0495589_0000300
1861 Ga0495589_0005163
1862 Ga0495589_0006774
1863 Ga0495589_0012866
1864 Ga0495589_0114104
1865 Ga0495589_0134509
1866 Ga0495589_0420000
1867 Ga0495600_0027057
1868 Ga0495660_0000070
1869 Ga0495660_0000845
1870 Ga0495660_0005038
1871 Ga0495660_0005264
1872 Ga0495660_0007998
1873 Ga0495660_0032020
1874 Ga0495660_0037071
1875 Ga0495660_0130427
1876 Ga0495660_0272965
1877 Ga0495581_0002819
1878 Ga0495581_0008271
1879 Ga0495581_0079265
1880 Ga0495604_0012649
1881 Ga0495604_0023295
1882 Ga0495604_0084225
1883 Ga0495604_0124305
1884 Ga0495604_0405137
1885 Ga0495636_0007354
1886 Ga0495636_0007447
1887 Ga0495636_0024460
1888 Ga0495636_0094706
1889 Ga0495636_0251802
1890 Ga0495674_0546264
1891 Ga0495672_0002603
1892 Ga0495672_0003246
1893 Ga0495672_0013037
1894 Ga0495672_0013704
1895 Ga0495672_0370624
1896 Ga0495676_0000040
1897 Ga0495676_0033589
1898 Ga0495676_0106535
1899 Ga0495680_0028206
1900 Ga0495680_0857476
1901 Ga0495683_0034154
1902 Ga0495683_0044558
1903 Ga0495683_0065123
1904 Ga0495683_0126073
1905 Ga0495683_0227032
1906 Ga0495687_000230
1907 Ga0495687_000247
1908 Ga0495687_000396
1909 Ga0495687_000791
1910 Ga0495687_006061
1911 Ga0495687_042992
1912 Ga0495687_053595
1913 Ga0495675_0001760
1914 Ga0495675_0008788
1915 Ga0495675_0353847
1916 Ga0495675_0563952
1917 Ga0495677_0000171
1918 Ga0495677_0003938
1919 Ga0495677_0006767
1920 Ga0495677_0020540
1921 Ga0495677_0024627
1922 Ga0495677_0028534
1923 Ga0495677_0034133
1924 Ga0495677_0144699
1925 Ga0495677_0351629
1926 Ga0495677_0356332
1927 Ga0495677_0393260
1928 Ga0495679_008472
1929 Ga0495679_021051
1930 Ga0495679_039159
1931 Ga0495685_001643
1932 Ga0495685_054394
1933 Ga0495685_162031
1934 Ga0495673_0000005
1935 Ga0495673_0000026
1936 Ga0495673_0000028
1937 Ga0495673_0007477
1938 Ga0495681_0000515
1939 Ga0495681_0000938
1940 Ga0495681_0006074
1941 Ga0495681_0008256
1942 Ga0495681_0026253
1943 Ga0495681_0033942
1944 Ga0495681_0135766
1945 Ga0495686_0000635
1946 Ga0495686_0000867
1947 Ga0495686_0001860
1948 Ga0495686_0015700
1949 Ga0495686_0321640
1950 Ga0495593_0008646
1951 Ga0495593_0048210
1952 Ga0495602_0023328
1953 Ga0495602_0179258
1954 Ga0495602_0375147
1955 Ga0495614_0020227
1956 Ga0495614_0054079
1957 Ga0495615_0306632
1958 Ga0495626_0000014
1959 Ga0495626_0000028
1960 Ga0495626_0001202
1961 Ga0495626_0010116
1962 Ga0495626_0010452
1963 Ga0495626_0041025
1964 Ga0495626_0048094
1965 Ga0495626_0112069
1966 Ga0495626_0172016
1967 Ga0496100_0017614
1968 Ga0496100_0511022
1969 Ga0496101_0158774
1970 Ga0496101_0968513
1971 Ga0496102_0000285
1972 Ga0496102_0006994
1973 Ga0496102_0073317
1974 Ga0496102_0210752
1975 Ga0496102_0979288
1976 Ga0496102_1915287
1977 Ga0496103_0125855
1978 Ga0496103_0735590
1979 Ga0496104_0002988
1980 Ga0496104_0013979
1981 Ga0496104_0148172
1982 Ga0496104_0193605
1983 Ga0496104_0391951
1984 Ga0496105_0000029
1985 Ga0496105_0021293
1986 Ga0496105_0021474
1987 Ga0496105_0170139
1988 Ga0496105_0229636
1989 Ga0496106_0036901
1990 Ga0496106_0317780
1991 Ga0496107_0757903
1992 Ga0496108_1511522
1993 Ga0496109_0349446
1994 Ga0496109_1476415
1995 Ga0496110_0000403
1996 Ga0496110_0011504
1997 Ga0496110_0021417
1998 Ga0496111_0024300
1999 Ga0496111_0121241
2000 Ga0496111_0239290
2001 Ga0496111_0364837
2002 Ga0496112_0090675
2003 Ga0496112_0480646
2004 Ga0496113_0004883
2005 Ga0496113_0072672
2006 Ga0496113_1426466
2007 Ga0496114_0064210
2008 Ga0496114_0369842
2009 Ga0496114_1043464
2010 Ga0496115_0020962
2011 Ga0496115_0050321
2012 Ga0496115_0212036
2013 Ga0496115_0322358
2014 Ga0496116_0307155
2015 Ga0496119_0000611
2016 Ga0496120_0034628
2017 Ga0496121_0025701
2018 Ga0496121_0130783
2019 Ga0496122_0014301
2020 Ga0496122_0057856
2021 Ga0496122_0412009
2022 Ga0496123_0003046
2023 Ga0496123_0005925
2024 Ga0496123_0249518
2025 Ga0496124_0012729
2026 Ga0496124_0017100
2027 Ga0496124_0099669
2028 Ga0496124_0108374
2029 Ga0496124_0151955
2030 Ga0496124_0204609
2031 Ga0496124_0422261
2032 Ga0496125_0105551
2033 Ga0496126_0005047
2034 Ga0496126_0716389
2035 Ga0495678_000006
2036 Ga0495678_000844
2037 Ga0495678_002130
2038 Ga0495678_002172
2039 Ga0495682_0002910
2040 Ga0495682_0070090
2041 Ga0501300_077789
2042 Ga0501031_0760822
2043 Ga0501034_0179113
2044 Ga0501039_0735640
2045 Ga0501040_0643269
2046 Ga0501041_0218858
2047 Ga0501047_0156902
2048 Ga0501048_0175522
2049 Ga0501071_0332410
2050 Ga0501076_1512184
2051 Ga0501209_277855
2052 Ga0501235_199279
2053 Ga0501238_073964
2054 Ga0501221_150304
2055 Ga0501225_0347806
2056 Ga0501035_0000813
2057 Ga0501044_0514835
2058 Ga0500594_0020311
2059 Ga0500618_000621
2060 Ga0500586_000876
2061 Ga0587084_133199
2062 Ga0587066_036057
2063 Ga0587070_176044
2064 Ga0587080_044697
2065 Ga0587082_011812
2066 Ga0587083_0004461
2067 Ga0587088_015507
2068 Ga0587091_086509
2069 Ga0587098_028061
2070 Ga0587098_090480
2071 Ga0587101_018396
2072 Ga0587068_022379
2073 Ga0587069_060244
2074 Ga0587072_013660
2075 Ga0587075_070135
2076 Ga0587079_016099
2077 Ga0587079_016700
2078 Ga0587079_031439
2079 Ga0587102_012097
2080 Ga0466962_0215044
2081 Ga0466962_0268787
2082 Ga0530510_0566659
2083 2521557855
2084 2552746448
2085 2553002980
2086 2601670246
2087 2640736470
2088 2643802696
2089 2644215343
2090 2644252048
2091 2644360696
2092 2644472201
2093 2678229691
2094 2738829024
2095 2739152820
2096 2739194740
2097 2739321216
2098 2739339457
2099 2765568972
2100 2774391385
2101 2774436120
2102 2809142653
2103 2819542382
2104 2819615003
2105 2821133232
2106 2839096146
2107 2842717596
2108 2857552181
2109 2857553358
2110 2857567432
2111 2885082901
2112 2904441383
2113 2904531680
2114 2904588095
2115 2904589745
2116 2904602869
2117 2916700418
2118 2919046319
2119 2919079627
2120 2919185210
2121 2919479730
2122 2919509204
2123 2923511082
2124 2928131025
2125 2932413756
2126 2932417816
2127 2989393025
2128 8047675314

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

22

127

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l9n-assembly1.cif.gz_A structure of uridylylated glnb from escherichia coli bound to atp 0.7317 1 100
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.7284 1 100
4c3k-assembly2.cif.gz_A structure of mixed pii-adp complexes from s. elongatus 0.724 1 100
4c3m-assembly1.cif.gz_B structure of wildtype pii from s. elongatus at medium resolution 0.7205 1 101
2gnk-assembly1.cif.gz_A glnk, a signal protein from e. coli 0.7202 1 100
ID Description Score Start End Superfamily
1sqhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7903 8 64 3.40.630.30
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7114 1 100 3.30.70.120
af_Q58095_241_444_3.10.28.10 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.7033 3 66 3.10.28.10
af_Q57732_1_212_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6985 4 63 3.40.50.150
3l7pE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.696 2 96 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A7W1QLD1-F1-model_v4 P-II family nitrogen regulator 0.7895 1 70 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A4Q3B9A7-F1-model_v4 deleted 0.7845 1 69
AF-A0A2N5A3S9-F1-model_v4 Transcriptional regulator 0.7826 1 68 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A348NQV9-F1-model_v4 P-II family nitrogen regulator 0.7782 1 70 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A3D5URX0-F1-model_v4 Nitrogen regulatory protein P-II 0.7778 1 70 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Map