F489381
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1065 | 428 | 2128 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0356061|Ga0466969_0356061_244_645 |
| Length | 133 |
| Sequence | MLLARFLNIESDWLFCLRYFEMKLVTAVVKPFKLDDVREALSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAVRDDMVDAVIEAVTRVASTGKIGDGKIFVSNLEQVIRIRTGETGPDAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 8 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005473 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 110 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 171 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 176 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 179 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 180 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 185 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 186 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 187 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 200 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 208 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 209 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 212 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 213 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 214 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 215 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 216 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 217 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 218 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 221 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 222 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 324 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 325 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 335 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 336 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 337 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 338 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 339 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 346 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 356 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 357 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 358 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 359 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 365 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 382 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 383 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 384 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 385 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 386 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 387 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 388 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 389 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 390 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 391 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 392 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 393 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 394 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 395 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 396 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 397 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 398 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 399 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 400 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 401 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 402 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 403 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 404 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 405 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 406 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 407 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 408 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 409 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 410 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 411 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 412 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 413 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 414 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 415 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 416 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 417 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 418 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 419 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 420 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 421 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 422 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 423 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 424 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 425 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 426 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 427 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 428 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.3 |
| Metatranscriptomes | 6.38 |
| Isolates | 4.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.51 |
| Nodule | 0.28 |
| Rhizoplane | 4.51 |
| Rhizosphere | 85.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466969_0356061 | 3300044656 | Bacteria | 663 |
| 2 | JGI25152J39213_1000003 | 3300002773 | Bacteria | 214804 |
| 3 | JGI25150J39212_1000404 | 3300002774 | Bacteria | 20212 |
| 4 | JGI25150J39212_1008202 | 3300002774 | Bacteria | 2057 |
| 5 | JGI25159J45721_1002231 | 3300002987 | Bacteria | 7497 |
| 6 | JGI25151J46595_10089191 | 3300003187 | Bacteria | 864 |
| 7 | JGI25153J46596_10027098 | 3300003215 | Bacteria | 2014 |
| 8 | JGI25153J46596_10073073 | 3300003215 | Bacteria | 880 |
| 9 | JGI25161J50226_1001011 | 3300003374 | Bacteria | 9810 |
| 10 | Ga0007417J51691_1088433 | 3300003544 | Bacteria | 990 |
| 11 | Ga0007410J51695_1026810 | 3300003574 | Bacteria | 552 |
| 12 | Ga0007410J51695_1065535 | 3300003574 | Bacteria | 796 |
| 13 | Ga0007409J51694_1029414 | 3300003575 | Bacteria | 1420 |
| 14 | Ga0006562J51391_1004973 | 3300003578 | Bacteria | 913 |
| 15 | Ga0032354_1062764 | 3300003693 | Bacteria | 871 |
| 16 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 17 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 18 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 19 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 20 | Ga0055525_1000029 | 3300003759 | Bacteria | 320663 |
| 21 | Ga0055542_1008314 | 3300003762 | Bacteria | 2039 |
| 22 | Ga0055526_1003670 | 3300003771 | Bacteria | 9605 |
| 23 | Ga0055537_1000022 | 3300003773 | Bacteria | 114484 |
| 24 | Ga0055537_1005411 | 3300003773 | Bacteria | 3431 |
| 25 | Ga0055524_1001646 | 3300003775 | Bacteria | 12461 |
| 26 | Ga0055524_1002887 | 3300003775 | Bacteria | 8596 |
| 27 | Ga0055534_1000468 | 3300003784 | Bacteria | 22901 |
| 28 | Ga0055534_1008665 | 3300003784 | Bacteria | 2283 |
| 29 | Ga0055528_1000473 | 3300003790 | Bacteria | 32133 |
| 30 | Ga0055530_10002395 | 3300003791 | Bacteria | 12139 |
| 31 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 32 | Ga0055541_1000043 | 3300003841 | Bacteria | 161703 |
| 33 | Ga0058692_1000067 | 3300003856 | Bacteria | 88996 |
| 34 | Ga0055543_1001364 | 3300004625 | Bacteria | 9848 |
| 35 | Ga0058862_12124498 | 3300004803 | Bacteria | 1211 |
| 36 | Ga0065165_1005566 | 3300005262 | Bacteria | 7004 |
| 37 | Ga0065165_1142271 | 3300005262 | Bacteria | 565 |
| 38 | Ga0065703_1000160 | 3300005272 | Bacteria | 29542 |
| 39 | Ga0065715_10593760 | 3300005293 | Bacteria | 712 |
| 40 | Ga0070658_10170065 | 3300005327 | Bacteria | 1830 |
| 41 | Ga0070658_10848537 | 3300005327 | Bacteria | 794 |
| 42 | Ga0070658_11637271 | 3300005327 | Bacteria | 557 |
| 43 | Ga0070690_100123259 | 3300005330 | Bacteria | 1742 |
| 44 | Ga0068869_100011386 | 3300005334 | Bacteria | 5831 |
| 45 | Ga0070666_10132760 | 3300005335 | Bacteria | 1731 |
| 46 | Ga0070666_10963727 | 3300005335 | Bacteria | 632 |
| 47 | Ga0068868_100071159 | 3300005338 | Bacteria | 2774 |
| 48 | Ga0070689_101655469 | 3300005340 | Bacteria | 582 |
| 49 | Ga0070661_100108577 | 3300005344 | Bacteria | 2070 |
| 50 | Ga0070668_100073025 | 3300005347 | Bacteria | 2674 |
| 51 | Ga0070668_100308148 | 3300005347 | Bacteria | 1330 |
| 52 | Ga0070668_100968616 | 3300005347 | Bacteria | 763 |
| 53 | Ga0070669_100000536 | 3300005353 | Bacteria | 28254 |
| 54 | Ga0070675_100192440 | 3300005354 | Bacteria | 1768 |
| 55 | Ga0070674_100149952 | 3300005356 | Bacteria | 1759 |
| 56 | Ga0070673_100006935 | 3300005364 | Bacteria | 7413 |
| 57 | Ga0070673_100286379 | 3300005364 | Bacteria | 1447 |
| 58 | Ga0070673_101092678 | 3300005364 | Bacteria | 745 |
| 59 | Ga0070688_100545218 | 3300005365 | Bacteria | 881 |
| 60 | Ga0070667_100758666 | 3300005367 | Bacteria | 900 |
| 61 | Ga0070694_100858968 | 3300005444 | Bacteria | 747 |
| 62 | Ga0070663_100512545 | 3300005455 | Bacteria | 998 |
| 63 | Ga0070662_101355640 | 3300005457 | Bacteria | 612 |
| 64 | Ga0068867_100149436 | 3300005459 | Bacteria | 1833 |
| 65 | Ga0068867_102077484 | 3300005459 | Bacteria | 538 |
| 66 | Ga0074250_12706 | 3300005473 | Bacteria | 1294 |
| 67 | Ga0070679_101272783 | 3300005530 | Bacteria | 681 |
| 68 | Ga0068853_100241225 | 3300005539 | Bacteria | 1657 |
| 69 | Ga0068853_100353340 | 3300005539 | Bacteria | 1368 |
| 70 | Ga0068853_100604893 | 3300005539 | Bacteria | 1041 |
| 71 | Ga0070695_100380392 | 3300005545 | Bacteria | 1065 |
| 72 | Ga0070665_100002224 | 3300005548 | Bacteria | 21625 |
| 73 | Ga0070665_102018032 | 3300005548 | Bacteria | 582 |
| 74 | Ga0068855_100000065 | 3300005563 | Bacteria | 129307 |
| 75 | Ga0068855_100077239 | 3300005563 | Bacteria | 3863 |
| 76 | Ga0068855_100183523 | 3300005563 | Bacteria | 2364 |
| 77 | Ga0068855_101142155 | 3300005563 | Bacteria | 812 |
| 78 | Ga0068854_100080165 | 3300005578 | Bacteria | 2408 |
| 79 | Ga0070702_100117395 | 3300005615 | Bacteria | 1660 |
| 80 | Ga0068852_100343980 | 3300005616 | Bacteria | 1454 |
| 81 | Ga0068852_100532531 | 3300005616 | Bacteria | 1173 |
| 82 | Ga0068859_100004713 | 3300005617 | Bacteria | 13857 |
| 83 | Ga0068864_100440095 | 3300005618 | Bacteria | 1245 |
| 84 | Ga0068866_10459263 | 3300005718 | Bacteria | 835 |
| 85 | Ga0068861_100110156 | 3300005719 | Bacteria | 2205 |
| 86 | Ga0068861_100665007 | 3300005719 | Bacteria | 964 |
| 87 | Ga0068861_101563688 | 3300005719 | Bacteria | 649 |
| 88 | Ga0068851_10612319 | 3300005834 | Bacteria | 664 |
| 89 | Ga0068870_10055178 | 3300005840 | Bacteria | 2116 |
| 90 | Ga0068863_100121660 | 3300005841 | Bacteria | 2489 |
| 91 | Ga0068858_100032501 | 3300005842 | Bacteria | 4845 |
| 92 | Ga0068860_100064662 | 3300005843 | Bacteria | 3474 |
| 93 | Ga0068862_100389805 | 3300005844 | Bacteria | 1301 |
| 94 | Ga0068862_100430499 | 3300005844 | Bacteria | 1240 |
| 95 | Ga0081540_1001860 | 3300005983 | Bacteria | 17663 |
| 96 | Ga0070717_10245289 | 3300006028 | Bacteria | 1581 |
| 97 | Ga0075364_10459794 | 3300006051 | Bacteria | 870 |
| 98 | Ga0097621_100879426 | 3300006237 | Bacteria | 834 |
| 99 | Ga0068871_100003921 | 3300006358 | Bacteria | 10261 |
| 100 | Ga0075433_10539499 | 3300006852 | Bacteria | 1026 |
| 101 | Ga0068865_100340057 | 3300006881 | Bacteria | 1213 |
| 102 | Ga0068865_100369625 | 3300006881 | Bacteria | 1167 |
| 103 | Ga0097620_100004713 | 3300006931 | Bacteria | 13857 |
| 104 | Ga0079104_1005362 | 3300006946 | Bacteria | 5143 |
| 105 | Ga0105250_10099037 | 3300009092 | Bacteria | 1189 |
| 106 | Ga0105240_10017404 | 3300009093 | Bacteria | 9687 |
| 107 | Ga0105240_10314567 | 3300009093 | Bacteria | 1787 |
| 108 | Ga0111539_10570651 | 3300009094 | Bacteria | 1318 |
| 109 | Ga0111539_11333038 | 3300009094 | Bacteria | 833 |
| 110 | Ga0105245_10140530 | 3300009098 | Bacteria | 2274 |
| 111 | Ga0105245_10168205 | 3300009098 | Bacteria | 2086 |
| 112 | Ga0105247_10024718 | 3300009101 | Bacteria | 3621 |
| 113 | Ga0105243_10000263 | 3300009148 | Bacteria | 59080 |
| 114 | Ga0105243_10024594 | 3300009148 | Bacteria | 4594 |
| 115 | Ga0105243_10312708 | 3300009148 | Bacteria | 1428 |
| 116 | Ga0105241_10193048 | 3300009174 | Bacteria | 1696 |
| 117 | Ga0105241_10653374 | 3300009174 | Bacteria | 955 |
| 118 | Ga0105242_10055392 | 3300009176 | Bacteria | 3244 |
| 119 | Ga0105242_10154773 | 3300009176 | Bacteria | 2002 |
| 120 | Ga0105248_10003110 | 3300009177 | Bacteria | 18377 |
| 121 | Ga0105237_10065345 | 3300009545 | Bacteria | 3634 |
| 122 | Ga0105237_10282893 | 3300009545 | Bacteria | 1661 |
| 123 | Ga0105238_10035766 | 3300009551 | Bacteria | 5049 |
| 124 | Ga0105238_10953456 | 3300009551 | Bacteria | 878 |
| 125 | Ga0105028_142612 | 3300009993 | Bacteria | 512 |
| 126 | Ga0105239_10046629 | 3300010375 | Bacteria | 4749 |
| 127 | Ga0105239_10063665 | 3300010375 | Bacteria | 4049 |
| 128 | Ga0105246_10121678 | 3300011119 | Bacteria | 1935 |
| 129 | Ga0157371_10000013 | 3300013102 | Bacteria | 352631 |
| 130 | Ga0157369_11071215 | 3300013105 | Bacteria | 824 |
| 131 | Ga0157374_10004388 | 3300013296 | Bacteria | 11871 |
| 132 | Ga0157374_10137275 | 3300013296 | Bacteria | 2372 |
| 133 | Ga0157378_10099534 | 3300013297 | Bacteria | 2653 |
| 134 | Ga0157372_10116772 | 3300013307 | Bacteria | 3060 |
| 135 | Ga0157372_10562494 | 3300013307 | Bacteria | 1329 |
| 136 | Ga0157372_11827872 | 3300013307 | Bacteria | 699 |
| 137 | Ga0157375_10035912 | 3300013308 | Bacteria | 4735 |
| 138 | Ga0163163_10011347 | 3300014325 | Bacteria | 8079 |
| 139 | Ga0163163_12629074 | 3300014325 | Bacteria | 561 |
| 140 | Ga0182008_10005570 | 3300014497 | Bacteria | 7152 |
| 141 | Ga0157379_10039306 | 3300014968 | Bacteria | 4221 |
| 142 | Ga0157376_10017972 | 3300014969 | Bacteria | 5408 |
| 143 | Ga0157376_10836258 | 3300014969 | Bacteria | 935 |
| 144 | Ga0182006_1000056 | 3300015261 | Bacteria | 169631 |
| 145 | Ga0182007_10041288 | 3300015262 | Bacteria | 1538 |
| 146 | Ga0182005_1000013 | 3300015265 | Bacteria | 396391 |
| 147 | Ga0206356_10036676 | 3300020070 | Bacteria | 564 |
| 148 | Ga0206356_10365692 | 3300020070 | Bacteria | 791 |
| 149 | Ga0206356_10546003 | 3300020070 | Bacteria | 669 |
| 150 | Ga0206351_10097662 | 3300020077 | Bacteria | 578 |
| 151 | Ga0206352_10359740 | 3300020078 | Bacteria | 581 |
| 152 | Ga0206354_10655136 | 3300020081 | Bacteria | 757 |
| 153 | Ga0154015_1538395 | 3300020610 | Bacteria | 541 |
| 154 | Ga0213872_10000494 | 3300021361 | Bacteria | 31496 |
| 155 | Ga0213872_10000502 | 3300021361 | Bacteria | 31150 |
| 156 | Ga0213872_10001215 | 3300021361 | Bacteria | 17431 |
| 157 | Ga0213872_10001327 | 3300021361 | Bacteria | 16362 |
| 158 | Ga0213872_10001385 | 3300021361 | Bacteria | 15949 |
| 159 | Ga0213872_10003003 | 3300021361 | Bacteria | 9533 |
| 160 | Ga0213872_10003978 | 3300021361 | Bacteria | 7970 |
| 161 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 162 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 163 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 164 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 165 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 166 | Ga0207425_1000173 | 3300025245 | Bacteria | 52861 |
| 167 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 168 | Ga0209677_114779 | 3300025253 | Bacteria | 1052 |
| 169 | Ga0209148_1000914 | 3300025254 | Bacteria | 19917 |
| 170 | Ga0209565_1000015 | 3300025263 | Bacteria | 494091 |
| 171 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 172 | Ga0209675_1000012 | 3300025291 | Bacteria | 494061 |
| 173 | Ga0209025_1007780 | 3300025294 | Bacteria | 7888 |
| 174 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 175 | Ga0209758_1000449 | 3300025297 | Bacteria | 68833 |
| 176 | Ga0209256_1000076 | 3300025299 | Bacteria | 234735 |
| 177 | Ga0207696_1013040 | 3300025711 | Bacteria | 2914 |
| 178 | Ga0207655_1029020 | 3300025728 | Bacteria | 2599 |
| 179 | Ga0207713_1002177 | 3300025735 | Bacteria | 14525 |
| 180 | Ga0207642_10300425 | 3300025899 | Bacteria | 930 |
| 181 | Ga0207710_10000183 | 3300025900 | Bacteria | 61804 |
| 182 | Ga0207710_10049959 | 3300025900 | Bacteria | 1875 |
| 183 | Ga0207645_10642290 | 3300025907 | Bacteria | 721 |
| 184 | Ga0207643_10167806 | 3300025908 | Bacteria | 1323 |
| 185 | Ga0207705_10003707 | 3300025909 | Bacteria | 11630 |
| 186 | Ga0207705_10474309 | 3300025909 | Bacteria | 971 |
| 187 | Ga0207654_10248701 | 3300025911 | Bacteria | 1191 |
| 188 | Ga0207654_10307684 | 3300025911 | Bacteria | 1080 |
| 189 | Ga0207695_10000475 | 3300025913 | Bacteria | 86957 |
| 190 | Ga0207695_10050605 | 3300025913 | Bacteria | 4369 |
| 191 | Ga0207671_10013593 | 3300025914 | Bacteria | 6476 |
| 192 | Ga0207671_10113146 | 3300025914 | Bacteria | 2067 |
| 193 | Ga0207657_10004691 | 3300025919 | Bacteria | 14430 |
| 194 | Ga0207657_10015820 | 3300025919 | Bacteria | 7292 |
| 195 | Ga0207681_10004469 | 3300025923 | Bacteria | 8606 |
| 196 | Ga0207694_10020740 | 3300025924 | Bacteria | 4975 |
| 197 | Ga0207659_10256392 | 3300025926 | Bacteria | 1421 |
| 198 | Ga0207687_10253146 | 3300025927 | Bacteria | 1401 |
| 199 | Ga0207687_10354619 | 3300025927 | Bacteria | 1196 |
| 200 | Ga0207690_10054319 | 3300025932 | Bacteria | 2693 |
| 201 | Ga0207690_10133789 | 3300025932 | Bacteria | 1818 |
| 202 | Ga0207706_10119248 | 3300025933 | Bacteria | 2320 |
| 203 | Ga0207706_10656689 | 3300025933 | Bacteria | 898 |
| 204 | Ga0207686_10132425 | 3300025934 | Bacteria | 1712 |
| 205 | Ga0207686_10463748 | 3300025934 | Bacteria | 977 |
| 206 | Ga0207709_10000158 | 3300025935 | Bacteria | 91810 |
| 207 | Ga0207709_10271703 | 3300025935 | Bacteria | 1248 |
| 208 | Ga0207709_10416579 | 3300025935 | Bacteria | 1031 |
| 209 | Ga0207704_10067319 | 3300025938 | Bacteria | 2252 |
| 210 | Ga0207711_10022452 | 3300025941 | Bacteria | 5276 |
| 211 | Ga0207689_10006227 | 3300025942 | Bacteria | 10567 |
| 212 | Ga0207661_11767614 | 3300025944 | Bacteria | 564 |
| 213 | Ga0207679_10435276 | 3300025945 | Bacteria | 1160 |
| 214 | Ga0207679_10929338 | 3300025945 | Bacteria | 796 |
| 215 | Ga0207667_10000025 | 3300025949 | Bacteria | 350159 |
| 216 | Ga0207667_10010688 | 3300025949 | Bacteria | 10710 |
| 217 | Ga0207667_10716204 | 3300025949 | Bacteria | 1002 |
| 218 | Ga0207651_10015435 | 3300025960 | Bacteria | 4438 |
| 219 | Ga0207651_10165484 | 3300025960 | Bacteria | 1738 |
| 220 | Ga0207668_10053200 | 3300025972 | Bacteria | 2805 |
| 221 | Ga0207668_10261186 | 3300025972 | Bacteria | 1411 |
| 222 | Ga0207640_10008256 | 3300025981 | Bacteria | 5776 |
| 223 | Ga0207658_10089692 | 3300025986 | Bacteria | 2381 |
| 224 | Ga0207658_11289812 | 3300025986 | Bacteria | 668 |
| 225 | Ga0207677_10061667 | 3300026023 | Bacteria | 2598 |
| 226 | Ga0207703_10012815 | 3300026035 | Bacteria | 6537 |
| 227 | Ga0207639_10557211 | 3300026041 | Bacteria | 1053 |
| 228 | Ga0207678_10568599 | 3300026067 | Bacteria | 992 |
| 229 | Ga0207678_10589887 | 3300026067 | Bacteria | 974 |
| 230 | Ga0207702_10150145 | 3300026078 | Bacteria | 2119 |
| 231 | Ga0207641_10323733 | 3300026088 | Bacteria | 1462 |
| 232 | Ga0207676_10722892 | 3300026095 | Bacteria | 966 |
| 233 | Ga0207675_100020532 | 3300026118 | Bacteria | 6157 |
| 234 | Ga0207683_10411424 | 3300026121 | Bacteria | 1245 |
| 235 | Ga0207698_11737103 | 3300026142 | Bacteria | 639 |
| 236 | Ga0209281_1008358 | 3300027111 | Bacteria | 2520 |
| 237 | Ga0209371_1000196 | 3300027312 | Bacteria | 89093 |
| 238 | Ga0268266_10003278 | 3300028379 | Bacteria | 16285 |
| 239 | Ga0268266_11825230 | 3300028379 | Bacteria | 582 |
| 240 | Ga0268265_10049828 | 3300028380 | Bacteria | 3152 |
| 241 | Ga0268265_10424500 | 3300028380 | Bacteria | 1235 |
| 242 | Ga0268264_10130920 | 3300028381 | Bacteria | 2224 |
| 243 | Ga0268256_1000158 | 3300030500 | Bacteria | 89061 |
| 244 | Ga0316182_1110679 | 3300030745 | Bacteria | 970 |
| 245 | Ga0265330_10136490 | 3300031235 | Bacteria | 1043 |
| 246 | Ga0265330_10240597 | 3300031235 | Bacteria | 763 |
| 247 | Ga0265339_10005282 | 3300031249 | Bacteria | 8613 |
| 248 | Ga0265316_10051906 | 3300031344 | Bacteria | 3219 |
| 249 | Ga0307408_100000403 | 3300031548 | Bacteria | 38869 |
| 250 | Ga0316575_10045814 | 3300031665 | Bacteria | 1737 |
| 251 | Ga0316575_10069334 | 3300031665 | Bacteria | 1415 |
| 252 | Ga0316575_10115773 | 3300031665 | Bacteria | 1095 |
| 253 | Ga0316575_10321817 | 3300031665 | Bacteria | 656 |
| 254 | Ga0316579_10000641 | 3300031691 | Bacteria | 11863 |
| 255 | Ga0316579_10002987 | 3300031691 | Bacteria | 6500 |
| 256 | Ga0316579_10012448 | 3300031691 | Bacteria | 3641 |
| 257 | Ga0316579_10015676 | 3300031691 | Bacteria | 3296 |
| 258 | Ga0316579_10026561 | 3300031691 | Bacteria | 2623 |
| 259 | Ga0316579_10131682 | 3300031691 | Bacteria | 1205 |
| 260 | Ga0316579_10158749 | 3300031691 | Bacteria | 1092 |
| 261 | Ga0316579_10422318 | 3300031691 | Bacteria | 645 |
| 262 | Ga0316579_10590728 | 3300031691 | Bacteria | 537 |
| 263 | Ga0265342_10038819 | 3300031712 | Bacteria | 2898 |
| 264 | Ga0265342_10320335 | 3300031712 | Bacteria | 813 |
| 265 | Ga0316576_10000696 | 3300031727 | Bacteria | 16540 |
| 266 | Ga0316576_10002369 | 3300031727 | Bacteria | 10720 |
| 267 | Ga0316576_10055452 | 3300031727 | Bacteria | 2892 |
| 268 | Ga0316576_10092706 | 3300031727 | Bacteria | 2251 |
| 269 | Ga0316576_10100589 | 3300031727 | Bacteria | 2160 |
| 270 | Ga0316576_10154517 | 3300031727 | Bacteria | 1729 |
| 271 | Ga0316576_10229603 | 3300031727 | Bacteria | 1395 |
| 272 | Ga0316576_10345918 | 3300031727 | Bacteria | 1107 |
| 273 | Ga0316576_10366163 | 3300031727 | Bacteria | 1071 |
| 274 | Ga0316576_10872124 | 3300031727 | Bacteria | 645 |
| 275 | Ga0316578_10000636 | 3300031728 | Bacteria | 12411 |
| 276 | Ga0316578_10006630 | 3300031728 | Bacteria | 5734 |
| 277 | Ga0316578_10009197 | 3300031728 | Bacteria | 5071 |
| 278 | Ga0316578_10053943 | 3300031728 | Bacteria | 2357 |
| 279 | Ga0316578_10058400 | 3300031728 | Bacteria | 2268 |
| 280 | Ga0316578_10058488 | 3300031728 | Bacteria | 2266 |
| 281 | Ga0316578_10068841 | 3300031728 | Bacteria | 2093 |
| 282 | Ga0316578_10076192 | 3300031728 | Bacteria | 1991 |
| 283 | Ga0316578_10088037 | 3300031728 | Bacteria | 1852 |
| 284 | Ga0316578_10095632 | 3300031728 | Bacteria | 1778 |
| 285 | Ga0316578_10135185 | 3300031728 | Bacteria | 1484 |
| 286 | Ga0316578_10180718 | 3300031728 | Bacteria | 1271 |
| 287 | Ga0316577_10019195 | 3300031733 | Bacteria | 3782 |
| 288 | Ga0316577_10020491 | 3300031733 | Bacteria | 3664 |
| 289 | Ga0316577_10044733 | 3300031733 | Bacteria | 2476 |
| 290 | Ga0316577_10318915 | 3300031733 | Bacteria | 881 |
| 291 | Ga0316577_10351590 | 3300031733 | Bacteria | 836 |
| 292 | Ga0307413_10014872 | 3300031824 | Bacteria | 3969 |
| 293 | Ga0307413_11112225 | 3300031824 | Bacteria | 683 |
| 294 | Ga0307411_10457449 | 3300032005 | Bacteria | 1069 |
| 295 | Ga0307415_101811035 | 3300032126 | Bacteria | 591 |
| 296 | Ga0316583_10009355 | 3300032133 | Bacteria | 3528 |
| 297 | Ga0316583_10064786 | 3300032133 | Bacteria | 1279 |
| 298 | Ga0316585_10005478 | 3300032137 | Bacteria | 3584 |
| 299 | Ga0316585_10027472 | 3300032137 | Bacteria | 1776 |
| 300 | Ga0316585_10034243 | 3300032137 | Bacteria | 1605 |
| 301 | Ga0316585_10037125 | 3300032137 | Bacteria | 1546 |
| 302 | Ga0316585_10088933 | 3300032137 | Bacteria | 1008 |
| 303 | Ga0316585_10105259 | 3300032137 | Bacteria | 927 |
| 304 | Ga0316585_10165057 | 3300032137 | Bacteria | 731 |
| 305 | Ga0316580_10001094 | 3300032139 | Bacteria | 6834 |
| 306 | Ga0316580_10003846 | 3300032139 | Bacteria | 4306 |
| 307 | Ga0316580_10047111 | 3300032139 | Bacteria | 1329 |
| 308 | Ga0316580_10257736 | 3300032139 | Bacteria | 539 |
| 309 | Ga0316593_10012553 | 3300032168 | Bacteria | 2489 |
| 310 | Ga0316593_10025717 | 3300032168 | Bacteria | 1877 |
| 311 | Ga0316593_10047074 | 3300032168 | Bacteria | 1449 |
| 312 | Ga0316593_10065646 | 3300032168 | Bacteria | 1248 |
| 313 | Ga0316592_1010691 | 3300033524 | Bacteria | 1855 |
| 314 | Ga0316592_1011728 | 3300033524 | Bacteria | 1787 |
| 315 | Ga0316592_1016320 | 3300033524 | Bacteria | 1551 |
| 316 | Ga0316592_1021387 | 3300033524 | Bacteria | 1378 |
| 317 | Ga0316592_1025438 | 3300033524 | Bacteria | 1276 |
| 318 | Ga0316592_1052741 | 3300033524 | Bacteria | 909 |
| 319 | Ga0316592_1138454 | 3300033524 | Bacteria | 570 |
| 320 | Ga0316586_1038739 | 3300033527 | Bacteria | 833 |
| 321 | Ga0316588_1007223 | 3300033528 | Bacteria | 2250 |
| 322 | Ga0316588_1013813 | 3300033528 | Bacteria | 1758 |
| 323 | Ga0316588_1023138 | 3300033528 | Bacteria | 1424 |
| 324 | Ga0316588_1028305 | 3300033528 | Bacteria | 1306 |
| 325 | Ga0316588_1028325 | 3300033528 | Bacteria | 1306 |
| 326 | Ga0316588_1058373 | 3300033528 | Bacteria | 940 |
| 327 | Ga0316588_1065775 | 3300033528 | Bacteria | 887 |
| 328 | Ga0316588_1085154 | 3300033528 | Bacteria | 785 |
| 329 | Ga0316587_1102154 | 3300033529 | Bacteria | 552 |
| 330 | Ga0316596_1006977 | 3300033541 | Bacteria | 2651 |
| 331 | Ga0316596_1010639 | 3300033541 | Bacteria | 2233 |
| 332 | Ga0316596_1011630 | 3300033541 | Bacteria | 2154 |
| 333 | Ga0316596_1014115 | 3300033541 | Bacteria | 1978 |
| 334 | Ga0316596_1015759 | 3300033541 | Bacteria | 1887 |
| 335 | Ga0316596_1016296 | 3300033541 | Bacteria | 1860 |
| 336 | Ga0316596_1016463 | 3300033541 | Bacteria | 1852 |
| 337 | Ga0316596_1032445 | 3300033541 | Bacteria | 1359 |
| 338 | Ga0316596_1042536 | 3300033541 | Bacteria | 1195 |
| 339 | Ga0316596_1042926 | 3300033541 | Bacteria | 1190 |
| 340 | Ga0316596_1053132 | 3300033541 | Bacteria | 1074 |
| 341 | Ga0316596_1063936 | 3300033541 | Bacteria | 983 |
| 342 | Ga0316596_1067864 | 3300033541 | Bacteria | 954 |
| 343 | Ga0316596_1242358 | 3300033541 | Bacteria | 507 |
| 344 | Ga0373948_0122092 | 3300034817 | Bacteria | 630 |
| 345 | Ga0373952_0000197 | 3300035092 | Bacteria | 9565 |
| 346 | Ga0373960_0011163 | 3300035121 | Bacteria | 2208 |
| 347 | Ga0373942_0138111 | 3300035207 | Bacteria | 774 |
| 348 | Ga0316574_0013409 | 3300035398 | Bacteria | 4711 |
| 349 | Ga0316574_0014091 | 3300035398 | Bacteria | 4612 |
| 350 | Ga0316574_0015990 | 3300035398 | Bacteria | 4363 |
| 351 | Ga0316574_0055523 | 3300035398 | Bacteria | 2475 |
| 352 | Ga0316574_0064536 | 3300035398 | Bacteria | 2304 |
| 353 | Ga0316574_0066311 | 3300035398 | Bacteria | 2274 |
| 354 | Ga0316574_0073010 | 3300035398 | Bacteria | 2169 |
| 355 | Ga0316574_0104404 | 3300035398 | Bacteria | 1814 |
| 356 | Ga0316574_0109527 | 3300035398 | Bacteria | 1770 |
| 357 | Ga0316574_0199331 | 3300035398 | Bacteria | 1286 |
| 358 | Ga0316574_0202035 | 3300035398 | Bacteria | 1276 |
| 359 | Ga0316574_0212555 | 3300035398 | Bacteria | 1241 |
| 360 | Ga0316574_0214818 | 3300035398 | Bacteria | 1233 |
| 361 | Ga0316574_0242867 | 3300035398 | Bacteria | 1151 |
| 362 | Ga0316574_0281001 | 3300035398 | Bacteria | 1060 |
| 363 | Ga0316574_0393600 | 3300035398 | Bacteria | 873 |
| 364 | Ga0316574_0411942 | 3300035398 | Bacteria | 850 |
| 365 | Ga0373937_1536288 | 3300036401 | Bacteria | 613 |
| 366 | Ga0316582_0024962 | 3300036647 | Bacteria | 3582 |
| 367 | Ga0316582_0025114 | 3300036647 | Bacteria | 3573 |
| 368 | Ga0316582_0037338 | 3300036647 | Bacteria | 3011 |
| 369 | Ga0316582_0109234 | 3300036647 | Bacteria | 1839 |
| 370 | Ga0316582_0126098 | 3300036647 | Bacteria | 1716 |
| 371 | Ga0316582_0161809 | 3300036647 | Bacteria | 1516 |
| 372 | Ga0316582_0278315 | 3300036647 | Bacteria | 1148 |
| 373 | Ga0316582_0451638 | 3300036647 | Bacteria | 886 |
| 374 | Ga0316582_1086043 | 3300036647 | Bacteria | 545 |
| 375 | Ga0316584_0002876 | 3300036712 | Bacteria | 11040 |
| 376 | Ga0316584_0006153 | 3300036712 | Bacteria | 8118 |
| 377 | Ga0316584_0006346 | 3300036712 | Bacteria | 8007 |
| 378 | Ga0316584_0007969 | 3300036712 | Bacteria | 7270 |
| 379 | Ga0316584_0086562 | 3300036712 | Bacteria | 2345 |
| 380 | Ga0316584_0151823 | 3300036712 | Bacteria | 1724 |
| 381 | Ga0316584_0272615 | 3300036712 | Bacteria | 1231 |
| 382 | Ga0316584_0307941 | 3300036712 | Bacteria | 1145 |
| 383 | Ga0316584_0373799 | 3300036712 | Bacteria | 1020 |
| 384 | Ga0316584_0402311 | 3300036712 | Bacteria | 975 |
| 385 | Ga0316584_0455243 | 3300036712 | Bacteria | 904 |
| 386 | Ga0395899_0002589 | 3300037312 | Bacteria | 14582 |
| 387 | Ga0395899_0015612 | 3300037312 | Bacteria | 5790 |
| 388 | Ga0395899_0053955 | 3300037312 | Bacteria | 2975 |
| 389 | Ga0395899_0087530 | 3300037312 | Bacteria | 2260 |
| 390 | Ga0395899_0171213 | 3300037312 | Bacteria | 1529 |
| 391 | Ga0395899_0325743 | 3300037312 | Bacteria | 1033 |
| 392 | Ga0395899_0521983 | 3300037312 | Bacteria | 767 |
| 393 | Ga0395900_0000229 | 3300037418 | Bacteria | 88118 |
| 394 | Ga0395900_0000263 | 3300037418 | Bacteria | 81724 |
| 395 | Ga0395900_0016748 | 3300037418 | Bacteria | 7477 |
| 396 | Ga0395900_0033712 | 3300037418 | Bacteria | 5269 |
| 397 | Ga0395900_0054735 | 3300037418 | Bacteria | 4108 |
| 398 | Ga0395900_0084298 | 3300037418 | Bacteria | 3265 |
| 399 | Ga0395900_0524971 | 3300037418 | Bacteria | 1131 |
| 400 | Ga0395900_0543450 | 3300037418 | Bacteria | 1107 |
| 401 | Ga0395900_0638201 | 3300037418 | Bacteria | 1002 |
| 402 | Ga0395900_0666714 | 3300037418 | Bacteria | 976 |
| 403 | Ga0395900_1248991 | 3300037418 | Bacteria | 657 |
| 404 | Ga0395900_1852173 | 3300037418 | Bacteria | 514 |
| 405 | Ga0395898_0040939 | 3300037466 | Bacteria | 4579 |
| 406 | Ga0395898_0451964 | 3300037466 | Bacteria | 1223 |
| 407 | Ga0395898_0825603 | 3300037466 | Bacteria | 867 |
| 408 | Ga0395898_0982341 | 3300037466 | Bacteria | 780 |
| 409 | Ga0395898_1056672 | 3300037466 | Bacteria | 746 |
| 410 | Ga0395898_1350128 | 3300037466 | Bacteria | 641 |
| 411 | Ga0395898_1736906 | 3300037466 | Bacteria | 546 |
| 412 | Ga0395905_0040521 | 3300037471 | Bacteria | 4369 |
| 413 | Ga0395905_0099915 | 3300037471 | Bacteria | 2724 |
| 414 | Ga0395905_0121406 | 3300037471 | Bacteria | 2456 |
| 415 | Ga0395905_0251335 | 3300037471 | Bacteria | 1651 |
| 416 | Ga0395905_0298545 | 3300037471 | Bacteria | 1498 |
| 417 | Ga0395905_0492590 | 3300037471 | Bacteria | 1125 |
| 418 | Ga0395905_0561639 | 3300037471 | Bacteria | 1042 |
| 419 | Ga0395905_1067982 | 3300037471 | Bacteria | 710 |
| 420 | Ga0316581_0004778 | 3300037588 | Bacteria | 3485 |
| 421 | Ga0316581_0020281 | 3300037588 | Bacteria | 1946 |
| 422 | Ga0316581_0058842 | 3300037588 | Bacteria | 1178 |
| 423 | Ga0316581_0084811 | 3300037588 | Bacteria | 975 |
| 424 | Ga0395901_0003564 | 3300038443 | Bacteria | 15698 |
| 425 | Ga0395901_0018100 | 3300038443 | Bacteria | 7189 |
| 426 | Ga0395901_0315058 | 3300038443 | Bacteria | 1619 |
| 427 | Ga0395901_0514272 | 3300038443 | Bacteria | 1217 |
| 428 | Ga0395901_1052974 | 3300038443 | Bacteria | 786 |
| 429 | Ga0400484_21924 | 3300038725 | Bacteria | 21393 |
| 430 | Ga0400483_000262 | 3300039062 | Bacteria | 7880 |
| 431 | Ga0400483_175488 | 3300039062 | Bacteria | 5715 |
| 432 | Ga0436361_0062839 | 3300039447 | Bacteria | 58101 |
| 433 | Ga0436361_0215738 | 3300039447 | Bacteria | 890 |
| 434 | Ga0436361_0228737 | 3300039447 | Bacteria | 6699 |
| 435 | Ga0436361_0288412 | 3300039447 | Bacteria | 24307 |
| 436 | Ga0436361_0441966 | 3300039447 | Bacteria | 9274 |
| 437 | Ga0436361_0579013 | 3300039447 | Bacteria | 26383 |
| 438 | Ga0436361_0738390 | 3300039447 | Bacteria | 658 |
| 439 | Ga0436361_0880017 | 3300039447 | Bacteria | 8784 |
| 440 | Ga0436361_1194171 | 3300039447 | Bacteria | 11012 |
| 441 | Ga0436363_1522905 | 3300039450 | Bacteria | 593 |
| 442 | Ga0439465_0115703 | 3300041413 | Bacteria | 937 |
| 443 | Ga0451853_2426511 | 3300041512 | Bacteria | 835 |
| 444 | Ga0439448_0047694 | 3300042005 | Bacteria | 1397 |
| 445 | Ga0439448_0217095 | 3300042005 | Bacteria | 672 |
| 446 | Ga0439454_050804 | 3300042011 | Bacteria | 700 |
| 447 | Ga0439455_0023062 | 3300042012 | Bacteria | 1496 |
| 448 | Ga0450911_019010 | 3300042115 | Bacteria | 901 |
| 449 | Ga0450923_063156 | 3300042125 | Bacteria | 811 |
| 450 | Ga0439458_0026524 | 3300042157 | Bacteria | 1363 |
| 451 | Ga0439458_0092824 | 3300042157 | Bacteria | 778 |
| 452 | Ga0466969_0199679 | 3300044656 | Bacteria | 912 |
| 453 | Ga0466969_0513019 | 3300044656 | Bacteria | 547 |
| 454 | Ga0466972_0009901 | 3300044658 | Bacteria | 4784 |
| 455 | Ga0466965_0007668 | 3300044683 | Bacteria | 4967 |
| 456 | Ga0466965_0057624 | 3300044683 | Bacteria | 1936 |
| 457 | Ga0466965_0614019 | 3300044683 | Bacteria | 618 |
| 458 | Ga0466966_0006340 | 3300044684 | Bacteria | 7820 |
| 459 | Ga0466966_0067575 | 3300044684 | Bacteria | 2244 |
| 460 | Ga0466966_0107254 | 3300044684 | Bacteria | 1723 |
| 461 | Ga0466966_0360395 | 3300044684 | Bacteria | 873 |
| 462 | Ga0466961_0044146 | 3300044693 | Bacteria | 2852 |
| 463 | Ga0466961_0339774 | 3300044693 | Bacteria | 914 |
| 464 | Ga0466963_0057228 | 3300044694 | Bacteria | 2596 |
| 465 | Ga0466963_0206317 | 3300044694 | Bacteria | 1375 |
| 466 | Ga0466963_0344455 | 3300044694 | Bacteria | 1049 |
| 467 | Ga0466964_0000658 | 3300044706 | Bacteria | 11027 |
| 468 | Ga0466964_0003582 | 3300044706 | Bacteria | 5674 |
| 469 | Ga0466964_0500380 | 3300044706 | Bacteria | 652 |
| 470 | Ga0453684_0000638 | 3300044712 | Bacteria | 126432 |
| 471 | Ga0453684_0001104 | 3300044712 | Bacteria | 84830 |
| 472 | Ga0453684_2338595 | 3300044712 | Bacteria | 531 |
| 473 | Ga0466971_0019568 | 3300044719 | Bacteria | 3007 |
| 474 | Ga0466971_0023381 | 3300044719 | Bacteria | 2755 |
| 475 | Ga0466968_0016796 | 3300044735 | Bacteria | 2917 |
| 476 | Ga0466968_0209423 | 3300044735 | Bacteria | 915 |
| 477 | Ga0466968_0481891 | 3300044735 | Bacteria | 616 |
| 478 | Ga0466957_0035226 | 3300044842 | Bacteria | 3003 |
| 479 | Ga0466957_0611943 | 3300044842 | Bacteria | 763 |
| 480 | Ga0466957_0823404 | 3300044842 | Bacteria | 660 |
| 481 | Ga0466959_0009426 | 3300045049 | Bacteria | 6944 |
| 482 | Ga0466959_0173645 | 3300045049 | Bacteria | 1510 |
| 483 | Ga0451576_2712766 | 3300045051 | Bacteria | 504 |
| 484 | Ga0466958_0019455 | 3300045836 | Bacteria | 3952 |
| 485 | Ga0466958_0210454 | 3300045836 | Bacteria | 1239 |
| 486 | Ga0466958_0439260 | 3300045836 | Bacteria | 844 |
| 487 | Ga0466958_0449740 | 3300045836 | Bacteria | 834 |
| 488 | Ga0466967_0138815 | 3300045976 | Bacteria | 2262 |
| 489 | Ga0466967_0271390 | 3300045976 | Bacteria | 1625 |
| 490 | Ga0466967_1288810 | 3300045976 | Bacteria | 728 |
| 491 | Ga0495617_000004 | 3300046452 | Bacteria | 511274 |
| 492 | Ga0495617_000009 | 3300046452 | Bacteria | 312936 |
| 493 | Ga0495617_003418 | 3300046452 | Bacteria | 5981 |
| 494 | Ga0495617_015961 | 3300046452 | Bacteria | 2541 |
| 495 | Ga0495627_000005 | 3300046453 | Bacteria | 630805 |
| 496 | Ga0495627_000226 | 3300046453 | Bacteria | 59863 |
| 497 | Ga0495627_033073 | 3300046453 | Bacteria | 1623 |
| 498 | Ga0495603_0034047 | 3300046455 | Bacteria | 3064 |
| 499 | Ga0495603_0048974 | 3300046455 | Bacteria | 2515 |
| 500 | Ga0495590_0000108 | 3300046457 | Bacteria | 50094 |
| 501 | Ga0495590_0009224 | 3300046457 | Bacteria | 3745 |
| 502 | Ga0495629_0601182 | 3300046459 | Bacteria | 735 |
| 503 | Ga0495629_0729382 | 3300046459 | Bacteria | 657 |
| 504 | Ga0495638_0036497 | 3300046460 | Bacteria | 3132 |
| 505 | Ga0495638_0098112 | 3300046460 | Bacteria | 1756 |
| 506 | Ga0495638_0139724 | 3300046460 | Bacteria | 1415 |
| 507 | Ga0495638_0528196 | 3300046460 | Bacteria | 590 |
| 508 | Ga0495653_0000004 | 3300046463 | Bacteria | 376003 |
| 509 | Ga0495653_0002873 | 3300046463 | Bacteria | 13772 |
| 510 | Ga0495653_0060842 | 3300046463 | Bacteria | 2859 |
| 511 | Ga0495653_0074078 | 3300046463 | Bacteria | 2538 |
| 512 | Ga0495650_0000086 | 3300046471 | Bacteria | 235224 |
| 513 | Ga0495650_0000171 | 3300046471 | Bacteria | 142895 |
| 514 | Ga0495650_0192115 | 3300046471 | Bacteria | 713 |
| 515 | Ga0495580_0198345 | 3300046472 | Bacteria | 1383 |
| 516 | Ga0495582_0006931 | 3300046473 | Bacteria | 6301 |
| 517 | Ga0495582_0033271 | 3300046473 | Bacteria | 2833 |
| 518 | Ga0495582_0531474 | 3300046473 | Bacteria | 680 |
| 519 | Ga0495605_0000183 | 3300046474 | Bacteria | 77763 |
| 520 | Ga0495605_0000226 | 3300046474 | Bacteria | 69648 |
| 521 | Ga0495605_0034014 | 3300046474 | Bacteria | 2583 |
| 522 | Ga0495605_0036135 | 3300046474 | Bacteria | 2492 |
| 523 | Ga0495605_0110241 | 3300046474 | Bacteria | 1256 |
| 524 | Ga0495605_0200025 | 3300046474 | Bacteria | 871 |
| 525 | Ga0495639_0257571 | 3300046475 | Bacteria | 864 |
| 526 | Ga0495639_0325796 | 3300046475 | Bacteria | 769 |
| 527 | Ga0495584_0000003 | 3300046491 | Bacteria | 323768 |
| 528 | Ga0495584_0003315 | 3300046491 | Bacteria | 8919 |
| 529 | Ga0495584_0013850 | 3300046491 | Bacteria | 4110 |
| 530 | Ga0495584_0015586 | 3300046491 | Bacteria | 3875 |
| 531 | Ga0495584_0069043 | 3300046491 | Bacteria | 1775 |
| 532 | Ga0495584_0071948 | 3300046491 | Bacteria | 1737 |
| 533 | Ga0495584_0076834 | 3300046491 | Bacteria | 1679 |
| 534 | Ga0495584_0106507 | 3300046491 | Bacteria | 1417 |
| 535 | Ga0495584_0295684 | 3300046491 | Bacteria | 822 |
| 536 | Ga0495584_0653440 | 3300046491 | Bacteria | 536 |
| 537 | Ga0495585_0001484 | 3300046492 | Bacteria | 18329 |
| 538 | Ga0495585_0002574 | 3300046492 | Bacteria | 12834 |
| 539 | Ga0495585_0002720 | 3300046492 | Bacteria | 12361 |
| 540 | Ga0495585_0006320 | 3300046492 | Bacteria | 7361 |
| 541 | Ga0495585_0024492 | 3300046492 | Bacteria | 3460 |
| 542 | Ga0495585_0033038 | 3300046492 | Bacteria | 2931 |
| 543 | Ga0495585_0102496 | 3300046492 | Bacteria | 1529 |
| 544 | Ga0495585_0123415 | 3300046492 | Bacteria | 1368 |
| 545 | Ga0495585_0206308 | 3300046492 | Bacteria | 998 |
| 546 | Ga0495594_0005140 | 3300046499 | Bacteria | 6731 |
| 547 | Ga0495594_0007131 | 3300046499 | Bacteria | 5751 |
| 548 | Ga0495594_0013446 | 3300046499 | Bacteria | 4275 |
| 549 | Ga0495594_0027138 | 3300046499 | Bacteria | 3084 |
| 550 | Ga0495594_0094277 | 3300046499 | Bacteria | 1679 |
| 551 | Ga0495594_0099841 | 3300046499 | Bacteria | 1632 |
| 552 | Ga0495594_0314291 | 3300046499 | Bacteria | 892 |
| 553 | Ga0495594_0396246 | 3300046499 | Bacteria | 785 |
| 554 | Ga0495596_0004660 | 3300046500 | Bacteria | 6631 |
| 555 | Ga0495596_0005043 | 3300046500 | Bacteria | 6303 |
| 556 | Ga0495596_0007077 | 3300046500 | Bacteria | 5083 |
| 557 | Ga0495596_0008268 | 3300046500 | Bacteria | 4639 |
| 558 | Ga0495596_0008555 | 3300046500 | Bacteria | 4548 |
| 559 | Ga0495596_0021910 | 3300046500 | Bacteria | 2603 |
| 560 | Ga0495596_0129921 | 3300046500 | Bacteria | 977 |
| 561 | Ga0495596_0223512 | 3300046500 | Bacteria | 731 |
| 562 | Ga0495596_0253804 | 3300046500 | Bacteria | 682 |
| 563 | Ga0495596_0260809 | 3300046500 | Bacteria | 672 |
| 564 | Ga0495607_0001474 | 3300046501 | Bacteria | 20941 |
| 565 | Ga0495607_0001979 | 3300046501 | Bacteria | 17252 |
| 566 | Ga0495607_0011083 | 3300046501 | Bacteria | 6018 |
| 567 | Ga0495607_0044490 | 3300046501 | Bacteria | 2618 |
| 568 | Ga0495607_0081282 | 3300046501 | Bacteria | 1780 |
| 569 | Ga0495607_0086220 | 3300046501 | Bacteria | 1712 |
| 570 | Ga0495607_0096167 | 3300046501 | Bacteria | 1595 |
| 571 | Ga0495607_0171127 | 3300046501 | Bacteria | 1097 |
| 572 | Ga0495583_0000942 | 3300046506 | Bacteria | 33862 |
| 573 | Ga0495583_0007435 | 3300046506 | Bacteria | 6882 |
| 574 | Ga0495583_0009045 | 3300046506 | Bacteria | 6000 |
| 575 | Ga0495583_0012703 | 3300046506 | Bacteria | 4744 |
| 576 | Ga0495583_0016269 | 3300046506 | Bacteria | 4008 |
| 577 | Ga0495583_0020877 | 3300046506 | Bacteria | 3379 |
| 578 | Ga0495583_0120857 | 3300046506 | Bacteria | 1103 |
| 579 | Ga0495583_0125658 | 3300046506 | Bacteria | 1076 |
| 580 | Ga0495583_0237250 | 3300046506 | Bacteria | 734 |
| 581 | Ga0495583_0432546 | 3300046506 | Bacteria | 516 |
| 582 | Ga0495606_0000075 | 3300046507 | Bacteria | 170038 |
| 583 | Ga0495606_0000106 | 3300046507 | Bacteria | 142138 |
| 584 | Ga0495606_0000376 | 3300046507 | Bacteria | 75612 |
| 585 | Ga0495606_0002574 | 3300046507 | Bacteria | 20774 |
| 586 | Ga0495606_0006323 | 3300046507 | Bacteria | 10967 |
| 587 | Ga0495606_0022126 | 3300046507 | Bacteria | 4643 |
| 588 | Ga0495606_0038185 | 3300046507 | Bacteria | 3251 |
| 589 | Ga0495606_0069729 | 3300046507 | Bacteria | 2219 |
| 590 | Ga0495606_0160434 | 3300046507 | Bacteria | 1312 |
| 591 | Ga0495606_0215277 | 3300046507 | Bacteria | 1086 |
| 592 | Ga0495606_0471438 | 3300046507 | Bacteria | 639 |
| 593 | Ga0495610_0000010 | 3300046512 | Bacteria | 538821 |
| 594 | Ga0495616_0000374 | 3300046513 | Bacteria | 34798 |
| 595 | Ga0495616_0011028 | 3300046513 | Bacteria | 5196 |
| 596 | Ga0495616_0013718 | 3300046513 | Bacteria | 4562 |
| 597 | Ga0495616_0016110 | 3300046513 | Bacteria | 4142 |
| 598 | Ga0495616_0023041 | 3300046513 | Bacteria | 3355 |
| 599 | Ga0495616_0029179 | 3300046513 | Bacteria | 2915 |
| 600 | Ga0495616_0145357 | 3300046513 | Bacteria | 1076 |
| 601 | Ga0495620_0008690 | 3300046515 | Bacteria | 5436 |
| 602 | Ga0495630_0024743 | 3300046517 | Bacteria | 4438 |
| 603 | Ga0495630_0091318 | 3300046517 | Bacteria | 2301 |
| 604 | Ga0495631_0000168 | 3300046518 | Bacteria | 44535 |
| 605 | Ga0495631_0001530 | 3300046518 | Bacteria | 13917 |
| 606 | Ga0495631_0008745 | 3300046518 | Bacteria | 5089 |
| 607 | Ga0495631_0012495 | 3300046518 | Bacteria | 4145 |
| 608 | Ga0495631_0033755 | 3300046518 | Bacteria | 2297 |
| 609 | Ga0495631_0045095 | 3300046518 | Bacteria | 1941 |
| 610 | Ga0495631_0067175 | 3300046518 | Bacteria | 1551 |
| 611 | Ga0495631_0069288 | 3300046518 | Bacteria | 1525 |
| 612 | Ga0495631_0134019 | 3300046518 | Bacteria | 1064 |
| 613 | Ga0495631_0258217 | 3300046518 | Bacteria | 742 |
| 614 | Ga0495632_0000244 | 3300046519 | Bacteria | 53886 |
| 615 | Ga0495632_0000245 | 3300046519 | Bacteria | 53759 |
| 616 | Ga0495632_0001734 | 3300046519 | Bacteria | 17685 |
| 617 | Ga0495632_0119576 | 3300046519 | Bacteria | 1232 |
| 618 | Ga0495637_0000056 | 3300046520 | Bacteria | 98978 |
| 619 | Ga0495637_0018216 | 3300046520 | Bacteria | 3259 |
| 620 | Ga0495637_0058161 | 3300046520 | Bacteria | 1594 |
| 621 | Ga0495637_0256248 | 3300046520 | Bacteria | 629 |
| 622 | Ga0495637_0330417 | 3300046520 | Bacteria | 537 |
| 623 | Ga0495643_0003748 | 3300046522 | Bacteria | 10994 |
| 624 | Ga0495643_0042330 | 3300046522 | Bacteria | 2481 |
| 625 | Ga0495643_0048527 | 3300046522 | Bacteria | 2294 |
| 626 | Ga0495643_0087375 | 3300046522 | Bacteria | 1613 |
| 627 | Ga0495644_0013401 | 3300046523 | Bacteria | 3145 |
| 628 | Ga0495648_0001175 | 3300046524 | Bacteria | 26445 |
| 629 | Ga0495648_0002931 | 3300046524 | Bacteria | 15324 |
| 630 | Ga0495648_0002962 | 3300046524 | Bacteria | 15237 |
| 631 | Ga0495648_0019255 | 3300046524 | Bacteria | 4806 |
| 632 | Ga0495648_0025562 | 3300046524 | Bacteria | 3994 |
| 633 | Ga0495648_0026147 | 3300046524 | Bacteria | 3934 |
| 634 | Ga0495648_0097422 | 3300046524 | Bacteria | 1631 |
| 635 | Ga0495648_0109465 | 3300046524 | Bacteria | 1506 |
| 636 | Ga0495648_0148629 | 3300046524 | Bacteria | 1224 |
| 637 | Ga0495663_0028286 | 3300046525 | Bacteria | 1649 |
| 638 | Ga0495663_0053973 | 3300046525 | Bacteria | 1250 |
| 639 | Ga0495663_0107493 | 3300046525 | Bacteria | 924 |
| 640 | Ga0495666_0000573 | 3300046526 | Bacteria | 16457 |
| 641 | Ga0495666_0000848 | 3300046526 | Bacteria | 14173 |
| 642 | Ga0495666_0011673 | 3300046526 | Bacteria | 4379 |
| 643 | Ga0495666_0040651 | 3300046526 | Bacteria | 2254 |
| 644 | Ga0495666_0092171 | 3300046526 | Bacteria | 1429 |
| 645 | Ga0495642_0000147 | 3300046528 | Bacteria | 40989 |
| 646 | Ga0495642_0001211 | 3300046528 | Bacteria | 11859 |
| 647 | Ga0495642_0001361 | 3300046528 | Bacteria | 10925 |
| 648 | Ga0495642_0011445 | 3300046528 | Bacteria | 3408 |
| 649 | Ga0495642_0022524 | 3300046528 | Bacteria | 2483 |
| 650 | Ga0495642_0053250 | 3300046528 | Bacteria | 1667 |
| 651 | Ga0495642_0058706 | 3300046528 | Bacteria | 1593 |
| 652 | Ga0495642_0076829 | 3300046528 | Bacteria | 1402 |
| 653 | Ga0495642_0109264 | 3300046528 | Bacteria | 1181 |
| 654 | Ga0495642_0125620 | 3300046528 | Bacteria | 1102 |
| 655 | Ga0495642_0166129 | 3300046528 | Bacteria | 958 |
| 656 | Ga0495642_0408148 | 3300046528 | Bacteria | 599 |
| 657 | Ga0495642_0566088 | 3300046528 | Bacteria | 504 |
| 658 | Ga0495652_0340388 | 3300046529 | Bacteria | 1078 |
| 659 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 660 | Ga0495654_0002925 | 3300046530 | Bacteria | 10705 |
| 661 | Ga0495654_0032024 | 3300046530 | Bacteria | 2666 |
| 662 | Ga0495654_0039085 | 3300046530 | Bacteria | 2369 |
| 663 | Ga0495654_0069688 | 3300046530 | Bacteria | 1669 |
| 664 | Ga0495654_0076725 | 3300046530 | Bacteria | 1574 |
| 665 | Ga0495665_0005117 | 3300046531 | Bacteria | 7072 |
| 666 | Ga0495665_0031815 | 3300046531 | Bacteria | 2822 |
| 667 | Ga0495640_0136571 | 3300046533 | Bacteria | 1583 |
| 668 | Ga0495640_0219118 | 3300046533 | Bacteria | 1201 |
| 669 | Ga0495640_0771411 | 3300046533 | Bacteria | 574 |
| 670 | Ga0495586_0008589 | 3300046535 | Bacteria | 5437 |
| 671 | Ga0495586_0020595 | 3300046535 | Bacteria | 3511 |
| 672 | Ga0495586_0021159 | 3300046535 | Bacteria | 3465 |
| 673 | Ga0495586_0505761 | 3300046535 | Bacteria | 697 |
| 674 | Ga0495587_0037046 | 3300046536 | Bacteria | 2931 |
| 675 | Ga0495609_0000324 | 3300046538 | Bacteria | 42443 |
| 676 | Ga0495609_0001837 | 3300046538 | Bacteria | 13597 |
| 677 | Ga0495609_0003534 | 3300046538 | Bacteria | 8908 |
| 678 | Ga0495609_0004966 | 3300046538 | Bacteria | 7130 |
| 679 | Ga0495609_0004967 | 3300046538 | Bacteria | 7130 |
| 680 | Ga0495609_0007122 | 3300046538 | Bacteria | 5623 |
| 681 | Ga0495609_0012428 | 3300046538 | Bacteria | 4039 |
| 682 | Ga0495609_0109910 | 3300046538 | Bacteria | 1190 |
| 683 | Ga0495609_0342188 | 3300046538 | Bacteria | 604 |
| 684 | Ga0495621_0180570 | 3300046539 | Bacteria | 842 |
| 685 | Ga0495621_0223569 | 3300046539 | Bacteria | 763 |
| 686 | Ga0495597_0000619 | 3300046542 | Bacteria | 29010 |
| 687 | Ga0495597_0001149 | 3300046542 | Bacteria | 19949 |
| 688 | Ga0495597_0001873 | 3300046542 | Bacteria | 14374 |
| 689 | Ga0495597_0033897 | 3300046542 | Bacteria | 2309 |
| 690 | Ga0495597_0042860 | 3300046542 | Bacteria | 2016 |
| 691 | Ga0495597_0073962 | 3300046542 | Bacteria | 1464 |
| 692 | Ga0495597_0083658 | 3300046542 | Bacteria | 1362 |
| 693 | Ga0495597_0160125 | 3300046542 | Bacteria | 919 |
| 694 | Ga0495597_0172607 | 3300046542 | Bacteria | 877 |
| 695 | Ga0495597_0224840 | 3300046542 | Bacteria | 744 |
| 696 | Ga0495597_0281676 | 3300046542 | Bacteria | 647 |
| 697 | Ga0495645_0390311 | 3300046543 | Bacteria | 889 |
| 698 | Ga0495645_0638052 | 3300046543 | Bacteria | 652 |
| 699 | Ga0495622_0009880 | 3300046557 | Bacteria | 4414 |
| 700 | Ga0495622_0012319 | 3300046557 | Bacteria | 3955 |
| 701 | Ga0495622_0018082 | 3300046557 | Bacteria | 3283 |
| 702 | Ga0495622_0071425 | 3300046557 | Bacteria | 1602 |
| 703 | Ga0495622_0092999 | 3300046557 | Bacteria | 1384 |
| 704 | Ga0495633_0002909 | 3300046558 | Bacteria | 11746 |
| 705 | Ga0495633_0008224 | 3300046558 | Bacteria | 5903 |
| 706 | Ga0495633_0018935 | 3300046558 | Bacteria | 3486 |
| 707 | Ga0495633_0082680 | 3300046558 | Bacteria | 1494 |
| 708 | Ga0495633_0083585 | 3300046558 | Bacteria | 1485 |
| 709 | Ga0495633_0131486 | 3300046558 | Bacteria | 1158 |
| 710 | Ga0495656_0034660 | 3300046615 | Bacteria | 2068 |
| 711 | Ga0495656_0085367 | 3300046615 | Bacteria | 1433 |
| 712 | Ga0495656_0113173 | 3300046615 | Bacteria | 1272 |
| 713 | Ga0495656_0170419 | 3300046615 | Bacteria | 1064 |
| 714 | Ga0495668_0000089 | 3300046616 | Bacteria | 145477 |
| 715 | Ga0495668_0000346 | 3300046616 | Bacteria | 61788 |
| 716 | Ga0495668_0002252 | 3300046616 | Bacteria | 16242 |
| 717 | Ga0495668_0004022 | 3300046616 | Bacteria | 10703 |
| 718 | Ga0495668_0006266 | 3300046616 | Bacteria | 7840 |
| 719 | Ga0495668_0009375 | 3300046616 | Bacteria | 6017 |
| 720 | Ga0495668_0026838 | 3300046616 | Bacteria | 3266 |
| 721 | Ga0495668_0171492 | 3300046616 | Bacteria | 1188 |
| 722 | Ga0495668_0229147 | 3300046616 | Bacteria | 1017 |
| 723 | Ga0495634_0364208 | 3300046642 | Bacteria | 864 |
| 724 | Ga0495611_0004040 | 3300046648 | Bacteria | 6384 |
| 725 | Ga0495611_0004163 | 3300046648 | Bacteria | 6295 |
| 726 | Ga0495611_0037061 | 3300046648 | Bacteria | 2166 |
| 727 | Ga0495611_0059344 | 3300046648 | Bacteria | 1736 |
| 728 | Ga0495611_0284693 | 3300046648 | Bacteria | 763 |
| 729 | Ga0495625_0048522 | 3300046660 | Bacteria | 3057 |
| 730 | Ga0495625_0062464 | 3300046660 | Bacteria | 2632 |
| 731 | Ga0495625_0064180 | 3300046660 | Bacteria | 2591 |
| 732 | Ga0495625_0101824 | 3300046660 | Bacteria | 1972 |
| 733 | Ga0495625_0189119 | 3300046660 | Bacteria | 1365 |
| 734 | Ga0495625_0233108 | 3300046660 | Bacteria | 1201 |
| 735 | Ga0495625_0274163 | 3300046660 | Bacteria | 1088 |
| 736 | Ga0495635_0012345 | 3300046663 | Bacteria | 5986 |
| 737 | Ga0495659_0012974 | 3300046664 | Bacteria | 2708 |
| 738 | Ga0495659_0247745 | 3300046664 | Bacteria | 742 |
| 739 | Ga0495661_0000544 | 3300046665 | Bacteria | 38960 |
| 740 | Ga0495661_0003256 | 3300046665 | Bacteria | 12082 |
| 741 | Ga0495661_0005272 | 3300046665 | Bacteria | 9188 |
| 742 | Ga0495661_0015461 | 3300046665 | Bacteria | 5094 |
| 743 | Ga0495661_0027005 | 3300046665 | Bacteria | 3691 |
| 744 | Ga0495661_0028564 | 3300046665 | Bacteria | 3568 |
| 745 | Ga0495661_0046160 | 3300046665 | Bacteria | 2661 |
| 746 | Ga0495661_0079896 | 3300046665 | Bacteria | 1889 |
| 747 | Ga0495661_0080154 | 3300046665 | Bacteria | 1885 |
| 748 | Ga0495661_0098090 | 3300046665 | Bacteria | 1654 |
| 749 | Ga0495661_0169092 | 3300046665 | Bacteria | 1167 |
| 750 | Ga0495661_0403414 | 3300046665 | Bacteria | 664 |
| 751 | Ga0495588_0000078 | 3300046674 | Bacteria | 214254 |
| 752 | Ga0495588_0011122 | 3300046674 | Bacteria | 4213 |
| 753 | Ga0495588_0048253 | 3300046674 | Bacteria | 2187 |
| 754 | Ga0495588_0051970 | 3300046674 | Bacteria | 2111 |
| 755 | Ga0495588_0054854 | 3300046674 | Bacteria | 2056 |
| 756 | Ga0495588_0079308 | 3300046674 | Bacteria | 1713 |
| 757 | Ga0495588_0092515 | 3300046674 | Bacteria | 1584 |
| 758 | Ga0495588_0097405 | 3300046674 | Bacteria | 1543 |
| 759 | Ga0495588_0141692 | 3300046674 | Bacteria | 1270 |
| 760 | Ga0495588_0168627 | 3300046674 | Bacteria | 1157 |
| 761 | Ga0495588_0186035 | 3300046674 | Bacteria | 1097 |
| 762 | Ga0495588_0306700 | 3300046674 | Bacteria | 835 |
| 763 | Ga0495588_0487380 | 3300046674 | Bacteria | 646 |
| 764 | Ga0495599_0537508 | 3300046678 | Bacteria | 685 |
| 765 | Ga0495623_0011273 | 3300046679 | Bacteria | 5782 |
| 766 | Ga0495623_0091922 | 3300046679 | Bacteria | 1861 |
| 767 | Ga0495623_0550156 | 3300046679 | Bacteria | 604 |
| 768 | Ga0495646_0073916 | 3300046680 | Bacteria | 2002 |
| 769 | Ga0495646_0215975 | 3300046680 | Bacteria | 1039 |
| 770 | Ga0495669_0000194 | 3300046684 | Bacteria | 37638 |
| 771 | Ga0495669_0000729 | 3300046684 | Bacteria | 14292 |
| 772 | Ga0495669_0000815 | 3300046684 | Bacteria | 13253 |
| 773 | Ga0495669_0017611 | 3300046684 | Bacteria | 3067 |
| 774 | Ga0495624_0025247 | 3300046690 | Bacteria | 3903 |
| 775 | Ga0495670_0000387 | 3300046691 | Bacteria | 21015 |
| 776 | Ga0495670_0007002 | 3300046691 | Bacteria | 5551 |
| 777 | Ga0495670_0014000 | 3300046691 | Bacteria | 3946 |
| 778 | Ga0495670_0022267 | 3300046691 | Bacteria | 3128 |
| 779 | Ga0495670_0117422 | 3300046691 | Bacteria | 1380 |
| 780 | Ga0495670_0125124 | 3300046691 | Bacteria | 1338 |
| 781 | Ga0495670_0153119 | 3300046691 | Bacteria | 1209 |
| 782 | Ga0495670_0262758 | 3300046691 | Bacteria | 921 |
| 783 | Ga0495670_0451582 | 3300046691 | Bacteria | 696 |
| 784 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 785 | Ga0495671_0000391 | 3300046692 | Bacteria | 36162 |
| 786 | Ga0495671_0015270 | 3300046692 | Bacteria | 4120 |
| 787 | Ga0495671_0016677 | 3300046692 | Bacteria | 3918 |
| 788 | Ga0495671_0028296 | 3300046692 | Bacteria | 2889 |
| 789 | Ga0495671_0040826 | 3300046692 | Bacteria | 2338 |
| 790 | Ga0495671_0202903 | 3300046692 | Bacteria | 961 |
| 791 | Ga0495649_0079112 | 3300046694 | Bacteria | 1759 |
| 792 | Ga0495649_0131884 | 3300046694 | Bacteria | 1318 |
| 793 | Ga0495649_0190846 | 3300046694 | Bacteria | 1066 |
| 794 | Ga0495649_0275929 | 3300046694 | Bacteria | 859 |
| 795 | Ga0495589_0000118 | 3300046794 | Bacteria | 73742 |
| 796 | Ga0495589_0000300 | 3300046794 | Bacteria | 39331 |
| 797 | Ga0495589_0005163 | 3300046794 | Bacteria | 6907 |
| 798 | Ga0495589_0006774 | 3300046794 | Bacteria | 6034 |
| 799 | Ga0495589_0012866 | 3300046794 | Bacteria | 4324 |
| 800 | Ga0495589_0114104 | 3300046794 | Bacteria | 1303 |
| 801 | Ga0495589_0134509 | 3300046794 | Bacteria | 1186 |
| 802 | Ga0495589_0420000 | 3300046794 | Bacteria | 613 |
| 803 | Ga0495600_0027057 | 3300046809 | Bacteria | 3705 |
| 804 | Ga0495660_0000070 | 3300046810 | Bacteria | 112800 |
| 805 | Ga0495660_0000845 | 3300046810 | Bacteria | 22629 |
| 806 | Ga0495660_0005038 | 3300046810 | Bacteria | 7937 |
| 807 | Ga0495660_0005264 | 3300046810 | Bacteria | 7757 |
| 808 | Ga0495660_0007998 | 3300046810 | Bacteria | 6209 |
| 809 | Ga0495660_0032020 | 3300046810 | Bacteria | 2954 |
| 810 | Ga0495660_0037071 | 3300046810 | Bacteria | 2717 |
| 811 | Ga0495660_0130427 | 3300046810 | Bacteria | 1261 |
| 812 | Ga0495660_0272965 | 3300046810 | Bacteria | 776 |
| 813 | Ga0495581_0002819 | 3300047315 | Bacteria | 9931 |
| 814 | Ga0495581_0008271 | 3300047315 | Bacteria | 6030 |
| 815 | Ga0495581_0079265 | 3300047315 | Bacteria | 1900 |
| 816 | Ga0495604_0012649 | 3300047317 | Bacteria | 6713 |
| 817 | Ga0495604_0023295 | 3300047317 | Bacteria | 4939 |
| 818 | Ga0495604_0084225 | 3300047317 | Bacteria | 2374 |
| 819 | Ga0495604_0124305 | 3300047317 | Bacteria | 1863 |
| 820 | Ga0495604_0405137 | 3300047317 | Bacteria | 898 |
| 821 | Ga0495636_0007354 | 3300047318 | Bacteria | 4334 |
| 822 | Ga0495636_0007447 | 3300047318 | Bacteria | 4308 |
| 823 | Ga0495636_0024460 | 3300047318 | Bacteria | 2449 |
| 824 | Ga0495636_0094706 | 3300047318 | Bacteria | 1300 |
| 825 | Ga0495636_0251802 | 3300047318 | Bacteria | 817 |
| 826 | Ga0495674_0546264 | 3300047319 | Bacteria | 923 |
| 827 | Ga0495672_0002603 | 3300047320 | Bacteria | 16359 |
| 828 | Ga0495672_0003246 | 3300047320 | Bacteria | 14113 |
| 829 | Ga0495672_0013037 | 3300047320 | Bacteria | 5753 |
| 830 | Ga0495672_0013704 | 3300047320 | Bacteria | 5579 |
| 831 | Ga0495672_0370624 | 3300047320 | Bacteria | 660 |
| 832 | Ga0495676_0000040 | 3300047321 | Bacteria | 106964 |
| 833 | Ga0495676_0033589 | 3300047321 | Bacteria | 4318 |
| 834 | Ga0495676_0106535 | 3300047321 | Bacteria | 2065 |
| 835 | Ga0495680_0028206 | 3300047322 | Bacteria | 4604 |
| 836 | Ga0495680_0857476 | 3300047322 | Bacteria | 590 |
| 837 | Ga0495683_0034154 | 3300047323 | Bacteria | 2587 |
| 838 | Ga0495683_0044558 | 3300047323 | Bacteria | 2231 |
| 839 | Ga0495683_0065123 | 3300047323 | Bacteria | 1798 |
| 840 | Ga0495683_0126073 | 3300047323 | Bacteria | 1211 |
| 841 | Ga0495683_0227032 | 3300047323 | Bacteria | 830 |
| 842 | Ga0495687_000230 | 3300047443 | Bacteria | 78342 |
| 843 | Ga0495687_000247 | 3300047443 | Bacteria | 73918 |
| 844 | Ga0495687_000396 | 3300047443 | Bacteria | 54169 |
| 845 | Ga0495687_000791 | 3300047443 | Bacteria | 34019 |
| 846 | Ga0495687_006061 | 3300047443 | Bacteria | 7525 |
| 847 | Ga0495687_042992 | 3300047443 | Bacteria | 1971 |
| 848 | Ga0495687_053595 | 3300047443 | Bacteria | 1697 |
| 849 | Ga0495675_0001760 | 3300047444 | Bacteria | 12929 |
| 850 | Ga0495675_0008788 | 3300047444 | Bacteria | 6271 |
| 851 | Ga0495675_0353847 | 3300047444 | Bacteria | 863 |
| 852 | Ga0495675_0563952 | 3300047444 | Bacteria | 648 |
| 853 | Ga0495677_0000171 | 3300047445 | Bacteria | 30903 |
| 854 | Ga0495677_0003938 | 3300047445 | Bacteria | 5736 |
| 855 | Ga0495677_0006767 | 3300047445 | Bacteria | 4313 |
| 856 | Ga0495677_0020540 | 3300047445 | Bacteria | 2394 |
| 857 | Ga0495677_0024627 | 3300047445 | Bacteria | 2183 |
| 858 | Ga0495677_0028534 | 3300047445 | Bacteria | 2027 |
| 859 | Ga0495677_0034133 | 3300047445 | Bacteria | 1855 |
| 860 | Ga0495677_0144699 | 3300047445 | Bacteria | 913 |
| 861 | Ga0495677_0351629 | 3300047445 | Bacteria | 581 |
| 862 | Ga0495677_0356332 | 3300047445 | Bacteria | 577 |
| 863 | Ga0495677_0393260 | 3300047445 | Bacteria | 548 |
| 864 | Ga0495679_008472 | 3300047446 | Bacteria | 4177 |
| 865 | Ga0495679_021051 | 3300047446 | Bacteria | 2261 |
| 866 | Ga0495679_039159 | 3300047446 | Bacteria | 1479 |
| 867 | Ga0495685_001643 | 3300047447 | Bacteria | 6896 |
| 868 | Ga0495685_054394 | 3300047447 | Bacteria | 1354 |
| 869 | Ga0495685_162031 | 3300047447 | Bacteria | 724 |
| 870 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 871 | Ga0495673_0000026 | 3300047469 | Bacteria | 476378 |
| 872 | Ga0495673_0000028 | 3300047469 | Bacteria | 473418 |
| 873 | Ga0495673_0007477 | 3300047469 | Bacteria | 6275 |
| 874 | Ga0495681_0000515 | 3300047470 | Bacteria | 29483 |
| 875 | Ga0495681_0000938 | 3300047470 | Bacteria | 22470 |
| 876 | Ga0495681_0006074 | 3300047470 | Bacteria | 7984 |
| 877 | Ga0495681_0008256 | 3300047470 | Bacteria | 6542 |
| 878 | Ga0495681_0026253 | 3300047470 | Bacteria | 3036 |
| 879 | Ga0495681_0033942 | 3300047470 | Bacteria | 2548 |
| 880 | Ga0495681_0135766 | 3300047470 | Bacteria | 1043 |
| 881 | Ga0495686_0000635 | 3300047472 | Bacteria | 48342 |
| 882 | Ga0495686_0000867 | 3300047472 | Bacteria | 38673 |
| 883 | Ga0495686_0001860 | 3300047472 | Bacteria | 21178 |
| 884 | Ga0495686_0015700 | 3300047472 | Bacteria | 5160 |
| 885 | Ga0495686_0321640 | 3300047472 | Bacteria | 848 |
| 886 | Ga0495593_0008646 | 3300047673 | Bacteria | 5920 |
| 887 | Ga0495593_0048210 | 3300047673 | Bacteria | 2264 |
| 888 | Ga0495602_0023328 | 3300048088 | Bacteria | 6031 |
| 889 | Ga0495602_0179258 | 3300048088 | Bacteria | 1636 |
| 890 | Ga0495602_0375147 | 3300048088 | Bacteria | 1020 |
| 891 | Ga0495614_0020227 | 3300048089 | Bacteria | 2879 |
| 892 | Ga0495614_0054079 | 3300048089 | Bacteria | 1721 |
| 893 | Ga0495615_0306632 | 3300048090 | Bacteria | 516 |
| 894 | Ga0495626_0000014 | 3300048091 | Bacteria | 246660 |
| 895 | Ga0495626_0000028 | 3300048091 | Bacteria | 204580 |
| 896 | Ga0495626_0001202 | 3300048091 | Bacteria | 21436 |
| 897 | Ga0495626_0010116 | 3300048091 | Bacteria | 5061 |
| 898 | Ga0495626_0010452 | 3300048091 | Bacteria | 4949 |
| 899 | Ga0495626_0041025 | 3300048091 | Bacteria | 2183 |
| 900 | Ga0495626_0048094 | 3300048091 | Bacteria | 1980 |
| 901 | Ga0495626_0112069 | 3300048091 | Bacteria | 1180 |
| 902 | Ga0495626_0172016 | 3300048091 | Bacteria | 902 |
| 903 | Ga0496100_0017614 | 3300048903 | Bacteria | 4222 |
| 904 | Ga0496100_0511022 | 3300048903 | Bacteria | 926 |
| 905 | Ga0496101_0158774 | 3300048904 | Bacteria | 1733 |
| 906 | Ga0496101_0968513 | 3300048904 | Bacteria | 669 |
| 907 | Ga0496102_0000285 | 3300048905 | Bacteria | 64637 |
| 908 | Ga0496102_0006994 | 3300048905 | Bacteria | 9630 |
| 909 | Ga0496102_0073317 | 3300048905 | Bacteria | 3146 |
| 910 | Ga0496102_0210752 | 3300048905 | Bacteria | 1832 |
| 911 | Ga0496102_0979288 | 3300048905 | Bacteria | 766 |
| 912 | Ga0496102_1915287 | 3300048905 | Bacteria | 509 |
| 913 | Ga0496103_0125855 | 3300048906 | Bacteria | 1634 |
| 914 | Ga0496103_0735590 | 3300048906 | Bacteria | 624 |
| 915 | Ga0496104_0002988 | 3300048907 | Bacteria | 14576 |
| 916 | Ga0496104_0013979 | 3300048907 | Bacteria | 7241 |
| 917 | Ga0496104_0148172 | 3300048907 | Bacteria | 2253 |
| 918 | Ga0496104_0193605 | 3300048907 | Bacteria | 1945 |
| 919 | Ga0496104_0391951 | 3300048907 | Bacteria | 1301 |
| 920 | Ga0496105_0000029 | 3300048908 | Bacteria | 139338 |
| 921 | Ga0496105_0021293 | 3300048908 | Bacteria | 5246 |
| 922 | Ga0496105_0021474 | 3300048908 | Bacteria | 5223 |
| 923 | Ga0496105_0170139 | 3300048908 | Bacteria | 1786 |
| 924 | Ga0496105_0229636 | 3300048908 | Bacteria | 1508 |
| 925 | Ga0496106_0036901 | 3300048909 | Bacteria | 3655 |
| 926 | Ga0496106_0317780 | 3300048909 | Bacteria | 1250 |
| 927 | Ga0496107_0757903 | 3300048910 | Bacteria | 712 |
| 928 | Ga0496108_1511522 | 3300048911 | Bacteria | 558 |
| 929 | Ga0496109_0349446 | 3300048912 | Bacteria | 1397 |
| 930 | Ga0496109_1476415 | 3300048912 | Bacteria | 615 |
| 931 | Ga0496110_0000403 | 3300048913 | Bacteria | 29296 |
| 932 | Ga0496110_0011504 | 3300048913 | Bacteria | 7245 |
| 933 | Ga0496110_0021417 | 3300048913 | Bacteria | 5473 |
| 934 | Ga0496111_0024300 | 3300048914 | Bacteria | 4265 |
| 935 | Ga0496111_0121241 | 3300048914 | Bacteria | 1931 |
| 936 | Ga0496111_0239290 | 3300048914 | Bacteria | 1348 |
| 937 | Ga0496111_0364837 | 3300048914 | Bacteria | 1069 |
| 938 | Ga0496112_0090675 | 3300048915 | Bacteria | 3025 |
| 939 | Ga0496112_0480646 | 3300048915 | Bacteria | 1179 |
| 940 | Ga0496113_0004883 | 3300048916 | Bacteria | 8303 |
| 941 | Ga0496113_0072672 | 3300048916 | Bacteria | 2618 |
| 942 | Ga0496113_1426466 | 3300048916 | Bacteria | 536 |
| 943 | Ga0496114_0064210 | 3300048917 | Bacteria | 3074 |
| 944 | Ga0496114_0369842 | 3300048917 | Bacteria | 1269 |
| 945 | Ga0496114_1043464 | 3300048917 | Unclassified | 701 |
| 946 | Ga0496115_0020962 | 3300048918 | Bacteria | 5043 |
| 947 | Ga0496115_0050321 | 3300048918 | Bacteria | 3337 |
| 948 | Ga0496115_0212036 | 3300048918 | Bacteria | 1599 |
| 949 | Ga0496115_0322358 | 3300048918 | Bacteria | 1263 |
| 950 | Ga0496116_0307155 | 3300048919 | Bacteria | 751 |
| 951 | Ga0496119_0000611 | 3300048922 | Bacteria | 48305 |
| 952 | Ga0496120_0034628 | 3300048923 | Bacteria | 3023 |
| 953 | Ga0496121_0025701 | 3300048924 | Bacteria | 5578 |
| 954 | Ga0496121_0130783 | 3300048924 | Bacteria | 1879 |
| 955 | Ga0496122_0014301 | 3300048925 | Bacteria | 7685 |
| 956 | Ga0496122_0057856 | 3300048925 | Bacteria | 2875 |
| 957 | Ga0496122_0412009 | 3300048925 | Bacteria | 682 |
| 958 | Ga0496123_0003046 | 3300048926 | Bacteria | 19295 |
| 959 | Ga0496123_0005925 | 3300048926 | Bacteria | 12041 |
| 960 | Ga0496123_0249518 | 3300048926 | Bacteria | 876 |
| 961 | Ga0496124_0012729 | 3300048927 | Bacteria | 8272 |
| 962 | Ga0496124_0017100 | 3300048927 | Bacteria | 6856 |
| 963 | Ga0496124_0099669 | 3300048927 | Bacteria | 2356 |
| 964 | Ga0496124_0108374 | 3300048927 | Bacteria | 2240 |
| 965 | Ga0496124_0151955 | 3300048927 | Bacteria | 1815 |
| 966 | Ga0496124_0204609 | 3300048927 | Bacteria | 1498 |
| 967 | Ga0496124_0422261 | 3300048927 | Bacteria | 918 |
| 968 | Ga0496125_0105551 | 3300048928 | Bacteria | 2059 |
| 969 | Ga0496126_0005047 | 3300048929 | Bacteria | 15323 |
| 970 | Ga0496126_0716389 | 3300048929 | Bacteria | 776 |
| 971 | Ga0495678_000006 | 3300049459 | Bacteria | 463690 |
| 972 | Ga0495678_000844 | 3300049459 | Bacteria | 27363 |
| 973 | Ga0495678_002130 | 3300049459 | Bacteria | 14032 |
| 974 | Ga0495678_002172 | 3300049459 | Bacteria | 13805 |
| 975 | Ga0495682_0002910 | 3300049460 | Bacteria | 7855 |
| 976 | Ga0495682_0070090 | 3300049460 | Bacteria | 1262 |
| 977 | Ga0501300_077789 | 3300049523 | Bacteria | 543 |
| 978 | Ga0501031_0760822 | 3300049568 | Bacteria | 621 |
| 979 | Ga0501034_0179113 | 3300049571 | Bacteria | 2085 |
| 980 | Ga0501039_0735640 | 3300049575 | Bacteria | 771 |
| 981 | Ga0501040_0643269 | 3300049576 | Bacteria | 766 |
| 982 | Ga0501041_0218858 | 3300049577 | Bacteria | 1195 |
| 983 | Ga0501047_0156902 | 3300049581 | Bacteria | 2149 |
| 984 | Ga0501048_0175522 | 3300049582 | Bacteria | 1519 |
| 985 | Ga0501071_0332410 | 3300049587 | Bacteria | 1155 |
| 986 | Ga0501076_1512184 | 3300049592 | Bacteria | 551 |
| 987 | Ga0501209_277855 | 3300049656 | Bacteria | 525 |
| 988 | Ga0501235_199279 | 3300049669 | Bacteria | 541 |
| 989 | Ga0501238_073964 | 3300049671 | Bacteria | 532 |
| 990 | Ga0501221_150304 | 3300049704 | Bacteria | 617 |
| 991 | Ga0501225_0347806 | 3300049705 | Bacteria | 512 |
| 992 | Ga0501035_0000813 | 3300049822 | Bacteria | 33299 |
| 993 | Ga0501044_0514835 | 3300049823 | Bacteria | 1097 |
| 994 | Ga0500594_0020311 | 3300053118 | Bacteria | 1656 |
| 995 | Ga0500618_000621 | 3300053125 | Bacteria | 21549 |
| 996 | Ga0500586_000876 | 3300053145 | Bacteria | 6221 |
| 997 | Ga0587084_133199 | 3300059477 | Bacteria | 533 |
| 998 | Ga0587066_036057 | 3300059490 | Bacteria | 908 |
| 999 | Ga0587070_176044 | 3300059491 | Bacteria | 554 |
| 1000 | Ga0587080_044697 | 3300059503 | Bacteria | 818 |
| 1001 | Ga0587082_011812 | 3300059504 | Bacteria | 1285 |
| 1002 | Ga0587083_0004461 | 3300059505 | Bacteria | 1947 |
| 1003 | Ga0587088_015507 | 3300059508 | Bacteria | 1201 |
| 1004 | Ga0587091_086509 | 3300059511 | Bacteria | 713 |
| 1005 | Ga0587098_028061 | 3300059604 | Bacteria | 759 |
| 1006 | Ga0587098_090480 | 3300059604 | Bacteria | 521 |
| 1007 | Ga0587101_018396 | 3300059623 | Bacteria | 979 |
| 1008 | Ga0587068_022379 | 3300059641 | Bacteria | 1047 |
| 1009 | Ga0587069_060244 | 3300059642 | Bacteria | 698 |
| 1010 | Ga0587072_013660 | 3300059643 | Bacteria | 1359 |
| 1011 | Ga0587075_070135 | 3300059644 | Bacteria | 649 |
| 1012 | Ga0587079_016099 | 3300059647 | Bacteria | 1280 |
| 1013 | Ga0587079_016700 | 3300059647 | Bacteria | 1264 |
| 1014 | Ga0587079_031439 | 3300059647 | Bacteria | 1023 |
| 1015 | Ga0587102_012097 | 3300059649 | Bacteria | 876 |
| 1016 | Ga0466962_0215044 | 3300061719 | Bacteria | 940 |
| 1017 | Ga0466962_0268787 | 3300061719 | Bacteria | 840 |
| 1018 | Ga0530510_0566659 | 3300061734 | Bacteria | 863 |
| 1019 | 2521557855 | 2521172590 | Bacteria | 5047645 |
| 1020 | 2552746448 | 2551306352 | Bacteria | 3873115 |
| 1021 | 2553002980 | 2551306416 | Bacteria | 6152985 |
| 1022 | 2601670246 | 2600255292 | Bacteria | 6300551 |
| 1023 | 2640736470 | 2639762793 | Bacteria | 3943681 |
| 1024 | 2643802696 | 2643221556 | Bacteria | 7251154 |
| 1025 | 2644215343 | 2643221638 | Bacteria | 6579467 |
| 1026 | 2644252048 | 2643221645 | Bacteria | 7207331 |
| 1027 | 2644360696 | 2643221664 | Bacteria | 7272945 |
| 1028 | 2644472201 | 2643221684 | Bacteria | 7145183 |
| 1029 | 2678229691 | 2675903507 | Bacteria | 3737791 |
| 1030 | 2738829024 | 2738541297 | Bacteria | 6549566 |
| 1031 | 2739152820 | 2738541357 | Bacteria | 6549408 |
| 1032 | 2739194740 | 2738543003 | Bacteria | 6549560 |
| 1033 | 2739321216 | 2738543026 | Bacteria | 6549408 |
| 1034 | 2739339457 | 2738543029 | Bacteria | 6549249 |
| 1035 | 2765568972 | 2765235838 | Bacteria | 5445269 |
| 1036 | 2774391385 | 2773857761 | Bacteria | 3837365 |
| 1037 | 2774436120 | 2773857770 | Bacteria | 3911866 |
| 1038 | 2809142653 | 2808606418 | Bacteria | 6724496 |
| 1039 | 2819542382 | 2818991436 | Bacteria | 5376622 |
| 1040 | 2819615003 | 2818991449 | Bacteria | 5518009 |
| 1041 | 2821133232 | 2821131069 | Bacteria | 6108407 |
| 1042 | 2839096146 | 2839094727 | Bacteria | 5534556 |
| 1043 | 2842717596 | 2842711865 | Bacteria | 7155354 |
| 1044 | 2857552181 | 2857547612 | Bacteria | 6179999 |
| 1045 | 2857553358 | 2857553236 | Bacteria | 6166726 |
| 1046 | 2857567432 | 2857564685 | Bacteria | 6290584 |
| 1047 | 2885082901 | 2885080285 | Bacteria | 6355622 |
| 1048 | 2904441383 | 2904439833 | Bacteria | 5931679 |
| 1049 | 2904531680 | 2904530477 | Bacteria | 5876334 |
| 1050 | 2904588095 | 2904584206 | Bacteria | 6028872 |
| 1051 | 2904589745 | 2904589729 | Bacteria | 6113573 |
| 1052 | 2904602869 | 2904601388 | Bacteria | 5884906 |
| 1053 | 2916700418 | 2916699645 | Bacteria | 3568996 |
| 1054 | 2919046319 | 2919046199 | Bacteria | 5567169 |
| 1055 | 2919079627 | 2919079590 | Bacteria | 5946433 |
| 1056 | 2919185210 | 2919182534 | Bacteria | 3907101 |
| 1057 | 2919479730 | 2919476304 | Bacteria | 5888696 |
| 1058 | 2919509204 | 2919506607 | Bacteria | 3392955 |
| 1059 | 2923511082 | 2923510766 | Bacteria | 5926163 |
| 1060 | 2928131025 | 2928130867 | Bacteria | 5467269 |
| 1061 | 2932413756 | 2932410948 | Bacteria | 6312192 |
| 1062 | 2932417816 | 2932416698 | Bacteria | 6315112 |
| 1063 | 2989393025 | 2989392574 | Bacteria | 4554005 |
| 1064 | 8047675314 | 8047673197 | Bacteria | 7395230 |
| 1065 | Ga0466969_0356061 | |||
| 1066 | JGI25152J39213_1000003 | |||
| 1067 | JGI25150J39212_1000404 | |||
| 1068 | JGI25150J39212_1008202 | |||
| 1069 | JGI25159J45721_1002231 | |||
| 1070 | JGI25151J46595_10089191 | |||
| 1071 | JGI25153J46596_10027098 | |||
| 1072 | JGI25153J46596_10073073 | |||
| 1073 | JGI25161J50226_1001011 | |||
| 1074 | Ga0007417J51691_1088433 | |||
| 1075 | Ga0007410J51695_1026810 | |||
| 1076 | Ga0007410J51695_1065535 | |||
| 1077 | Ga0007409J51694_1029414 | |||
| 1078 | Ga0006562J51391_1004973 | |||
| 1079 | Ga0032354_1062764 | |||
| 1080 | Ga0055538_1000002 | |||
| 1081 | Ga0055539_1000002 | |||
| 1082 | Ga0055533_1000004 | |||
| 1083 | Ga0055525_1000002 | |||
| 1084 | Ga0055525_1000029 | |||
| 1085 | Ga0055542_1008314 | |||
| 1086 | Ga0055526_1003670 | |||
| 1087 | Ga0055537_1000022 | |||
| 1088 | Ga0055537_1005411 | |||
| 1089 | Ga0055524_1001646 | |||
| 1090 | Ga0055524_1002887 | |||
| 1091 | Ga0055534_1000468 | |||
| 1092 | Ga0055534_1008665 | |||
| 1093 | Ga0055528_1000473 | |||
| 1094 | Ga0055530_10002395 | |||
| 1095 | Ga0055541_1000002 | |||
| 1096 | Ga0055541_1000043 | |||
| 1097 | Ga0058692_1000067 | |||
| 1098 | Ga0055543_1001364 | |||
| 1099 | Ga0058862_12124498 | |||
| 1100 | Ga0065165_1005566 | |||
| 1101 | Ga0065165_1142271 | |||
| 1102 | Ga0065703_1000160 | |||
| 1103 | Ga0065715_10593760 | |||
| 1104 | Ga0070658_10170065 | |||
| 1105 | Ga0070658_10848537 | |||
| 1106 | Ga0070658_11637271 | |||
| 1107 | Ga0070690_100123259 | |||
| 1108 | Ga0068869_100011386 | |||
| 1109 | Ga0070666_10132760 | |||
| 1110 | Ga0070666_10963727 | |||
| 1111 | Ga0068868_100071159 | |||
| 1112 | Ga0070689_101655469 | |||
| 1113 | Ga0070661_100108577 | |||
| 1114 | Ga0070668_100073025 | |||
| 1115 | Ga0070668_100308148 | |||
| 1116 | Ga0070668_100968616 | |||
| 1117 | Ga0070669_100000536 | |||
| 1118 | Ga0070675_100192440 | |||
| 1119 | Ga0070674_100149952 | |||
| 1120 | Ga0070673_100006935 | |||
| 1121 | Ga0070673_100286379 | |||
| 1122 | Ga0070673_101092678 | |||
| 1123 | Ga0070688_100545218 | |||
| 1124 | Ga0070667_100758666 | |||
| 1125 | Ga0070694_100858968 | |||
| 1126 | Ga0070663_100512545 | |||
| 1127 | Ga0070662_101355640 | |||
| 1128 | Ga0068867_100149436 | |||
| 1129 | Ga0068867_102077484 | |||
| 1130 | Ga0074250_12706 | |||
| 1131 | Ga0070679_101272783 | |||
| 1132 | Ga0068853_100241225 | |||
| 1133 | Ga0068853_100353340 | |||
| 1134 | Ga0068853_100604893 | |||
| 1135 | Ga0070695_100380392 | |||
| 1136 | Ga0070665_100002224 | |||
| 1137 | Ga0070665_102018032 | |||
| 1138 | Ga0068855_100000065 | |||
| 1139 | Ga0068855_100077239 | |||
| 1140 | Ga0068855_100183523 | |||
| 1141 | Ga0068855_101142155 | |||
| 1142 | Ga0068854_100080165 | |||
| 1143 | Ga0070702_100117395 | |||
| 1144 | Ga0068852_100343980 | |||
| 1145 | Ga0068852_100532531 | |||
| 1146 | Ga0068859_100004713 | |||
| 1147 | Ga0068864_100440095 | |||
| 1148 | Ga0068866_10459263 | |||
| 1149 | Ga0068861_100110156 | |||
| 1150 | Ga0068861_100665007 | |||
| 1151 | Ga0068861_101563688 | |||
| 1152 | Ga0068851_10612319 | |||
| 1153 | Ga0068870_10055178 | |||
| 1154 | Ga0068863_100121660 | |||
| 1155 | Ga0068858_100032501 | |||
| 1156 | Ga0068860_100064662 | |||
| 1157 | Ga0068862_100389805 | |||
| 1158 | Ga0068862_100430499 | |||
| 1159 | Ga0081540_1001860 | |||
| 1160 | Ga0070717_10245289 | |||
| 1161 | Ga0075364_10459794 | |||
| 1162 | Ga0097621_100879426 | |||
| 1163 | Ga0068871_100003921 | |||
| 1164 | Ga0075433_10539499 | |||
| 1165 | Ga0068865_100340057 | |||
| 1166 | Ga0068865_100369625 | |||
| 1167 | Ga0097620_100004713 | |||
| 1168 | Ga0079104_1005362 | |||
| 1169 | Ga0105250_10099037 | |||
| 1170 | Ga0105240_10017404 | |||
| 1171 | Ga0105240_10314567 | |||
| 1172 | Ga0111539_10570651 | |||
| 1173 | Ga0111539_11333038 | |||
| 1174 | Ga0105245_10140530 | |||
| 1175 | Ga0105245_10168205 | |||
| 1176 | Ga0105247_10024718 | |||
| 1177 | Ga0105243_10000263 | |||
| 1178 | Ga0105243_10024594 | |||
| 1179 | Ga0105243_10312708 | |||
| 1180 | Ga0105241_10193048 | |||
| 1181 | Ga0105241_10653374 | |||
| 1182 | Ga0105242_10055392 | |||
| 1183 | Ga0105242_10154773 | |||
| 1184 | Ga0105248_10003110 | |||
| 1185 | Ga0105237_10065345 | |||
| 1186 | Ga0105237_10282893 | |||
| 1187 | Ga0105238_10035766 | |||
| 1188 | Ga0105238_10953456 | |||
| 1189 | Ga0105028_142612 | |||
| 1190 | Ga0105239_10046629 | |||
| 1191 | Ga0105239_10063665 | |||
| 1192 | Ga0105246_10121678 | |||
| 1193 | Ga0157371_10000013 | |||
| 1194 | Ga0157369_11071215 | |||
| 1195 | Ga0157374_10004388 | |||
| 1196 | Ga0157374_10137275 | |||
| 1197 | Ga0157378_10099534 | |||
| 1198 | Ga0157372_10116772 | |||
| 1199 | Ga0157372_10562494 | |||
| 1200 | Ga0157372_11827872 | |||
| 1201 | Ga0157375_10035912 | |||
| 1202 | Ga0163163_10011347 | |||
| 1203 | Ga0163163_12629074 | |||
| 1204 | Ga0182008_10005570 | |||
| 1205 | Ga0157379_10039306 | |||
| 1206 | Ga0157376_10017972 | |||
| 1207 | Ga0157376_10836258 | |||
| 1208 | Ga0182006_1000056 | |||
| 1209 | Ga0182007_10041288 | |||
| 1210 | Ga0182005_1000013 | |||
| 1211 | Ga0206356_10036676 | |||
| 1212 | Ga0206356_10365692 | |||
| 1213 | Ga0206356_10546003 | |||
| 1214 | Ga0206351_10097662 | |||
| 1215 | Ga0206352_10359740 | |||
| 1216 | Ga0206354_10655136 | |||
| 1217 | Ga0154015_1538395 | |||
| 1218 | Ga0213872_10000494 | |||
| 1219 | Ga0213872_10000502 | |||
| 1220 | Ga0213872_10001215 | |||
| 1221 | Ga0213872_10001327 | |||
| 1222 | Ga0213872_10001385 | |||
| 1223 | Ga0213872_10003003 | |||
| 1224 | Ga0213872_10003978 | |||
| 1225 | Ga0209784_100002 | |||
| 1226 | Ga0209566_100003 | |||
| 1227 | Ga0209674_100004 | |||
| 1228 | Ga0209563_100003 | |||
| 1229 | Ga0209563_100006 | |||
| 1230 | Ga0207425_1000173 | |||
| 1231 | Ga0209677_100003 | |||
| 1232 | Ga0209677_114779 | |||
| 1233 | Ga0209148_1000914 | |||
| 1234 | Ga0209565_1000015 | |||
| 1235 | Ga0209673_1000017 | |||
| 1236 | Ga0209675_1000012 | |||
| 1237 | Ga0209025_1007780 | |||
| 1238 | Ga0209564_1000016 | |||
| 1239 | Ga0209758_1000449 | |||
| 1240 | Ga0209256_1000076 | |||
| 1241 | Ga0207696_1013040 | |||
| 1242 | Ga0207655_1029020 | |||
| 1243 | Ga0207713_1002177 | |||
| 1244 | Ga0207642_10300425 | |||
| 1245 | Ga0207710_10000183 | |||
| 1246 | Ga0207710_10049959 | |||
| 1247 | Ga0207645_10642290 | |||
| 1248 | Ga0207643_10167806 | |||
| 1249 | Ga0207705_10003707 | |||
| 1250 | Ga0207705_10474309 | |||
| 1251 | Ga0207654_10248701 | |||
| 1252 | Ga0207654_10307684 | |||
| 1253 | Ga0207695_10000475 | |||
| 1254 | Ga0207695_10050605 | |||
| 1255 | Ga0207671_10013593 | |||
| 1256 | Ga0207671_10113146 | |||
| 1257 | Ga0207657_10004691 | |||
| 1258 | Ga0207657_10015820 | |||
| 1259 | Ga0207681_10004469 | |||
| 1260 | Ga0207694_10020740 | |||
| 1261 | Ga0207659_10256392 | |||
| 1262 | Ga0207687_10253146 | |||
| 1263 | Ga0207687_10354619 | |||
| 1264 | Ga0207690_10054319 | |||
| 1265 | Ga0207690_10133789 | |||
| 1266 | Ga0207706_10119248 | |||
| 1267 | Ga0207706_10656689 | |||
| 1268 | Ga0207686_10132425 | |||
| 1269 | Ga0207686_10463748 | |||
| 1270 | Ga0207709_10000158 | |||
| 1271 | Ga0207709_10271703 | |||
| 1272 | Ga0207709_10416579 | |||
| 1273 | Ga0207704_10067319 | |||
| 1274 | Ga0207711_10022452 | |||
| 1275 | Ga0207689_10006227 | |||
| 1276 | Ga0207661_11767614 | |||
| 1277 | Ga0207679_10435276 | |||
| 1278 | Ga0207679_10929338 | |||
| 1279 | Ga0207667_10000025 | |||
| 1280 | Ga0207667_10010688 | |||
| 1281 | Ga0207667_10716204 | |||
| 1282 | Ga0207651_10015435 | |||
| 1283 | Ga0207651_10165484 | |||
| 1284 | Ga0207668_10053200 | |||
| 1285 | Ga0207668_10261186 | |||
| 1286 | Ga0207640_10008256 | |||
| 1287 | Ga0207658_10089692 | |||
| 1288 | Ga0207658_11289812 | |||
| 1289 | Ga0207677_10061667 | |||
| 1290 | Ga0207703_10012815 | |||
| 1291 | Ga0207639_10557211 | |||
| 1292 | Ga0207678_10568599 | |||
| 1293 | Ga0207678_10589887 | |||
| 1294 | Ga0207702_10150145 | |||
| 1295 | Ga0207641_10323733 | |||
| 1296 | Ga0207676_10722892 | |||
| 1297 | Ga0207675_100020532 | |||
| 1298 | Ga0207683_10411424 | |||
| 1299 | Ga0207698_11737103 | |||
| 1300 | Ga0209281_1008358 | |||
| 1301 | Ga0209371_1000196 | |||
| 1302 | Ga0268266_10003278 | |||
| 1303 | Ga0268266_11825230 | |||
| 1304 | Ga0268265_10049828 | |||
| 1305 | Ga0268265_10424500 | |||
| 1306 | Ga0268264_10130920 | |||
| 1307 | Ga0268256_1000158 | |||
| 1308 | Ga0316182_1110679 | |||
| 1309 | Ga0265330_10136490 | |||
| 1310 | Ga0265330_10240597 | |||
| 1311 | Ga0265339_10005282 | |||
| 1312 | Ga0265316_10051906 | |||
| 1313 | Ga0307408_100000403 | |||
| 1314 | Ga0316575_10045814 | |||
| 1315 | Ga0316575_10069334 | |||
| 1316 | Ga0316575_10115773 | |||
| 1317 | Ga0316575_10321817 | |||
| 1318 | Ga0316579_10000641 | |||
| 1319 | Ga0316579_10002987 | |||
| 1320 | Ga0316579_10012448 | |||
| 1321 | Ga0316579_10015676 | |||
| 1322 | Ga0316579_10026561 | |||
| 1323 | Ga0316579_10131682 | |||
| 1324 | Ga0316579_10158749 | |||
| 1325 | Ga0316579_10422318 | |||
| 1326 | Ga0316579_10590728 | |||
| 1327 | Ga0265342_10038819 | |||
| 1328 | Ga0265342_10320335 | |||
| 1329 | Ga0316576_10000696 | |||
| 1330 | Ga0316576_10002369 | |||
| 1331 | Ga0316576_10055452 | |||
| 1332 | Ga0316576_10092706 | |||
| 1333 | Ga0316576_10100589 | |||
| 1334 | Ga0316576_10154517 | |||
| 1335 | Ga0316576_10229603 | |||
| 1336 | Ga0316576_10345918 | |||
| 1337 | Ga0316576_10366163 | |||
| 1338 | Ga0316576_10872124 | |||
| 1339 | Ga0316578_10000636 | |||
| 1340 | Ga0316578_10006630 | |||
| 1341 | Ga0316578_10009197 | |||
| 1342 | Ga0316578_10053943 | |||
| 1343 | Ga0316578_10058400 | |||
| 1344 | Ga0316578_10058488 | |||
| 1345 | Ga0316578_10068841 | |||
| 1346 | Ga0316578_10076192 | |||
| 1347 | Ga0316578_10088037 | |||
| 1348 | Ga0316578_10095632 | |||
| 1349 | Ga0316578_10135185 | |||
| 1350 | Ga0316578_10180718 | |||
| 1351 | Ga0316577_10019195 | |||
| 1352 | Ga0316577_10020491 | |||
| 1353 | Ga0316577_10044733 | |||
| 1354 | Ga0316577_10318915 | |||
| 1355 | Ga0316577_10351590 | |||
| 1356 | Ga0307413_10014872 | |||
| 1357 | Ga0307413_11112225 | |||
| 1358 | Ga0307411_10457449 | |||
| 1359 | Ga0307415_101811035 | |||
| 1360 | Ga0316583_10009355 | |||
| 1361 | Ga0316583_10064786 | |||
| 1362 | Ga0316585_10005478 | |||
| 1363 | Ga0316585_10027472 | |||
| 1364 | Ga0316585_10034243 | |||
| 1365 | Ga0316585_10037125 | |||
| 1366 | Ga0316585_10088933 | |||
| 1367 | Ga0316585_10105259 | |||
| 1368 | Ga0316585_10165057 | |||
| 1369 | Ga0316580_10001094 | |||
| 1370 | Ga0316580_10003846 | |||
| 1371 | Ga0316580_10047111 | |||
| 1372 | Ga0316580_10257736 | |||
| 1373 | Ga0316593_10012553 | |||
| 1374 | Ga0316593_10025717 | |||
| 1375 | Ga0316593_10047074 | |||
| 1376 | Ga0316593_10065646 | |||
| 1377 | Ga0316592_1010691 | |||
| 1378 | Ga0316592_1011728 | |||
| 1379 | Ga0316592_1016320 | |||
| 1380 | Ga0316592_1021387 | |||
| 1381 | Ga0316592_1025438 | |||
| 1382 | Ga0316592_1052741 | |||
| 1383 | Ga0316592_1138454 | |||
| 1384 | Ga0316586_1038739 | |||
| 1385 | Ga0316588_1007223 | |||
| 1386 | Ga0316588_1013813 | |||
| 1387 | Ga0316588_1023138 | |||
| 1388 | Ga0316588_1028305 | |||
| 1389 | Ga0316588_1028325 | |||
| 1390 | Ga0316588_1058373 | |||
| 1391 | Ga0316588_1065775 | |||
| 1392 | Ga0316588_1085154 | |||
| 1393 | Ga0316587_1102154 | |||
| 1394 | Ga0316596_1006977 | |||
| 1395 | Ga0316596_1010639 | |||
| 1396 | Ga0316596_1011630 | |||
| 1397 | Ga0316596_1014115 | |||
| 1398 | Ga0316596_1015759 | |||
| 1399 | Ga0316596_1016296 | |||
| 1400 | Ga0316596_1016463 | |||
| 1401 | Ga0316596_1032445 | |||
| 1402 | Ga0316596_1042536 | |||
| 1403 | Ga0316596_1042926 | |||
| 1404 | Ga0316596_1053132 | |||
| 1405 | Ga0316596_1063936 | |||
| 1406 | Ga0316596_1067864 | |||
| 1407 | Ga0316596_1242358 | |||
| 1408 | Ga0373948_0122092 | |||
| 1409 | Ga0373952_0000197 | |||
| 1410 | Ga0373960_0011163 | |||
| 1411 | Ga0373942_0138111 | |||
| 1412 | Ga0316574_0013409 | |||
| 1413 | Ga0316574_0014091 | |||
| 1414 | Ga0316574_0015990 | |||
| 1415 | Ga0316574_0055523 | |||
| 1416 | Ga0316574_0064536 | |||
| 1417 | Ga0316574_0066311 | |||
| 1418 | Ga0316574_0073010 | |||
| 1419 | Ga0316574_0104404 | |||
| 1420 | Ga0316574_0109527 | |||
| 1421 | Ga0316574_0199331 | |||
| 1422 | Ga0316574_0202035 | |||
| 1423 | Ga0316574_0212555 | |||
| 1424 | Ga0316574_0214818 | |||
| 1425 | Ga0316574_0242867 | |||
| 1426 | Ga0316574_0281001 | |||
| 1427 | Ga0316574_0393600 | |||
| 1428 | Ga0316574_0411942 | |||
| 1429 | Ga0373937_1536288 | |||
| 1430 | Ga0316582_0024962 | |||
| 1431 | Ga0316582_0025114 | |||
| 1432 | Ga0316582_0037338 | |||
| 1433 | Ga0316582_0109234 | |||
| 1434 | Ga0316582_0126098 | |||
| 1435 | Ga0316582_0161809 | |||
| 1436 | Ga0316582_0278315 | |||
| 1437 | Ga0316582_0451638 | |||
| 1438 | Ga0316582_1086043 | |||
| 1439 | Ga0316584_0002876 | |||
| 1440 | Ga0316584_0006153 | |||
| 1441 | Ga0316584_0006346 | |||
| 1442 | Ga0316584_0007969 | |||
| 1443 | Ga0316584_0086562 | |||
| 1444 | Ga0316584_0151823 | |||
| 1445 | Ga0316584_0272615 | |||
| 1446 | Ga0316584_0307941 | |||
| 1447 | Ga0316584_0373799 | |||
| 1448 | Ga0316584_0402311 | |||
| 1449 | Ga0316584_0455243 | |||
| 1450 | Ga0395899_0002589 | |||
| 1451 | Ga0395899_0015612 | |||
| 1452 | Ga0395899_0053955 | |||
| 1453 | Ga0395899_0087530 | |||
| 1454 | Ga0395899_0171213 | |||
| 1455 | Ga0395899_0325743 | |||
| 1456 | Ga0395899_0521983 | |||
| 1457 | Ga0395900_0000229 | |||
| 1458 | Ga0395900_0000263 | |||
| 1459 | Ga0395900_0016748 | |||
| 1460 | Ga0395900_0033712 | |||
| 1461 | Ga0395900_0054735 | |||
| 1462 | Ga0395900_0084298 | |||
| 1463 | Ga0395900_0524971 | |||
| 1464 | Ga0395900_0543450 | |||
| 1465 | Ga0395900_0638201 | |||
| 1466 | Ga0395900_0666714 | |||
| 1467 | Ga0395900_1248991 | |||
| 1468 | Ga0395900_1852173 | |||
| 1469 | Ga0395898_0040939 | |||
| 1470 | Ga0395898_0451964 | |||
| 1471 | Ga0395898_0825603 | |||
| 1472 | Ga0395898_0982341 | |||
| 1473 | Ga0395898_1056672 | |||
| 1474 | Ga0395898_1350128 | |||
| 1475 | Ga0395898_1736906 | |||
| 1476 | Ga0395905_0040521 | |||
| 1477 | Ga0395905_0099915 | |||
| 1478 | Ga0395905_0121406 | |||
| 1479 | Ga0395905_0251335 | |||
| 1480 | Ga0395905_0298545 | |||
| 1481 | Ga0395905_0492590 | |||
| 1482 | Ga0395905_0561639 | |||
| 1483 | Ga0395905_1067982 | |||
| 1484 | Ga0316581_0004778 | |||
| 1485 | Ga0316581_0020281 | |||
| 1486 | Ga0316581_0058842 | |||
| 1487 | Ga0316581_0084811 | |||
| 1488 | Ga0395901_0003564 | |||
| 1489 | Ga0395901_0018100 | |||
| 1490 | Ga0395901_0315058 | |||
| 1491 | Ga0395901_0514272 | |||
| 1492 | Ga0395901_1052974 | |||
| 1493 | Ga0400484_21924 | |||
| 1494 | Ga0400483_000262 | |||
| 1495 | Ga0400483_175488 | |||
| 1496 | Ga0436361_0062839 | |||
| 1497 | Ga0436361_0215738 | |||
| 1498 | Ga0436361_0228737 | |||
| 1499 | Ga0436361_0288412 | |||
| 1500 | Ga0436361_0441966 | |||
| 1501 | Ga0436361_0579013 | |||
| 1502 | Ga0436361_0738390 | |||
| 1503 | Ga0436361_0880017 | |||
| 1504 | Ga0436361_1194171 | |||
| 1505 | Ga0436363_1522905 | |||
| 1506 | Ga0439465_0115703 | |||
| 1507 | Ga0451853_2426511 | |||
| 1508 | Ga0439448_0047694 | |||
| 1509 | Ga0439448_0217095 | |||
| 1510 | Ga0439454_050804 | |||
| 1511 | Ga0439455_0023062 | |||
| 1512 | Ga0450911_019010 | |||
| 1513 | Ga0450923_063156 | |||
| 1514 | Ga0439458_0026524 | |||
| 1515 | Ga0439458_0092824 | |||
| 1516 | Ga0466969_0199679 | |||
| 1517 | Ga0466969_0513019 | |||
| 1518 | Ga0466972_0009901 | |||
| 1519 | Ga0466965_0007668 | |||
| 1520 | Ga0466965_0057624 | |||
| 1521 | Ga0466965_0614019 | |||
| 1522 | Ga0466966_0006340 | |||
| 1523 | Ga0466966_0067575 | |||
| 1524 | Ga0466966_0107254 | |||
| 1525 | Ga0466966_0360395 | |||
| 1526 | Ga0466961_0044146 | |||
| 1527 | Ga0466961_0339774 | |||
| 1528 | Ga0466963_0057228 | |||
| 1529 | Ga0466963_0206317 | |||
| 1530 | Ga0466963_0344455 | |||
| 1531 | Ga0466964_0000658 | |||
| 1532 | Ga0466964_0003582 | |||
| 1533 | Ga0466964_0500380 | |||
| 1534 | Ga0453684_0000638 | |||
| 1535 | Ga0453684_0001104 | |||
| 1536 | Ga0453684_2338595 | |||
| 1537 | Ga0466971_0019568 | |||
| 1538 | Ga0466971_0023381 | |||
| 1539 | Ga0466968_0016796 | |||
| 1540 | Ga0466968_0209423 | |||
| 1541 | Ga0466968_0481891 | |||
| 1542 | Ga0466957_0035226 | |||
| 1543 | Ga0466957_0611943 | |||
| 1544 | Ga0466957_0823404 | |||
| 1545 | Ga0466959_0009426 | |||
| 1546 | Ga0466959_0173645 | |||
| 1547 | Ga0451576_2712766 | |||
| 1548 | Ga0466958_0019455 | |||
| 1549 | Ga0466958_0210454 | |||
| 1550 | Ga0466958_0439260 | |||
| 1551 | Ga0466958_0449740 | |||
| 1552 | Ga0466967_0138815 | |||
| 1553 | Ga0466967_0271390 | |||
| 1554 | Ga0466967_1288810 | |||
| 1555 | Ga0495617_000004 | |||
| 1556 | Ga0495617_000009 | |||
| 1557 | Ga0495617_003418 | |||
| 1558 | Ga0495617_015961 | |||
| 1559 | Ga0495627_000005 | |||
| 1560 | Ga0495627_000226 | |||
| 1561 | Ga0495627_033073 | |||
| 1562 | Ga0495603_0034047 | |||
| 1563 | Ga0495603_0048974 | |||
| 1564 | Ga0495590_0000108 | |||
| 1565 | Ga0495590_0009224 | |||
| 1566 | Ga0495629_0601182 | |||
| 1567 | Ga0495629_0729382 | |||
| 1568 | Ga0495638_0036497 | |||
| 1569 | Ga0495638_0098112 | |||
| 1570 | Ga0495638_0139724 | |||
| 1571 | Ga0495638_0528196 | |||
| 1572 | Ga0495653_0000004 | |||
| 1573 | Ga0495653_0002873 | |||
| 1574 | Ga0495653_0060842 | |||
| 1575 | Ga0495653_0074078 | |||
| 1576 | Ga0495650_0000086 | |||
| 1577 | Ga0495650_0000171 | |||
| 1578 | Ga0495650_0192115 | |||
| 1579 | Ga0495580_0198345 | |||
| 1580 | Ga0495582_0006931 | |||
| 1581 | Ga0495582_0033271 | |||
| 1582 | Ga0495582_0531474 | |||
| 1583 | Ga0495605_0000183 | |||
| 1584 | Ga0495605_0000226 | |||
| 1585 | Ga0495605_0034014 | |||
| 1586 | Ga0495605_0036135 | |||
| 1587 | Ga0495605_0110241 | |||
| 1588 | Ga0495605_0200025 | |||
| 1589 | Ga0495639_0257571 | |||
| 1590 | Ga0495639_0325796 | |||
| 1591 | Ga0495584_0000003 | |||
| 1592 | Ga0495584_0003315 | |||
| 1593 | Ga0495584_0013850 | |||
| 1594 | Ga0495584_0015586 | |||
| 1595 | Ga0495584_0069043 | |||
| 1596 | Ga0495584_0071948 | |||
| 1597 | Ga0495584_0076834 | |||
| 1598 | Ga0495584_0106507 | |||
| 1599 | Ga0495584_0295684 | |||
| 1600 | Ga0495584_0653440 | |||
| 1601 | Ga0495585_0001484 | |||
| 1602 | Ga0495585_0002574 | |||
| 1603 | Ga0495585_0002720 | |||
| 1604 | Ga0495585_0006320 | |||
| 1605 | Ga0495585_0024492 | |||
| 1606 | Ga0495585_0033038 | |||
| 1607 | Ga0495585_0102496 | |||
| 1608 | Ga0495585_0123415 | |||
| 1609 | Ga0495585_0206308 | |||
| 1610 | Ga0495594_0005140 | |||
| 1611 | Ga0495594_0007131 | |||
| 1612 | Ga0495594_0013446 | |||
| 1613 | Ga0495594_0027138 | |||
| 1614 | Ga0495594_0094277 | |||
| 1615 | Ga0495594_0099841 | |||
| 1616 | Ga0495594_0314291 | |||
| 1617 | Ga0495594_0396246 | |||
| 1618 | Ga0495596_0004660 | |||
| 1619 | Ga0495596_0005043 | |||
| 1620 | Ga0495596_0007077 | |||
| 1621 | Ga0495596_0008268 | |||
| 1622 | Ga0495596_0008555 | |||
| 1623 | Ga0495596_0021910 | |||
| 1624 | Ga0495596_0129921 | |||
| 1625 | Ga0495596_0223512 | |||
| 1626 | Ga0495596_0253804 | |||
| 1627 | Ga0495596_0260809 | |||
| 1628 | Ga0495607_0001474 | |||
| 1629 | Ga0495607_0001979 | |||
| 1630 | Ga0495607_0011083 | |||
| 1631 | Ga0495607_0044490 | |||
| 1632 | Ga0495607_0081282 | |||
| 1633 | Ga0495607_0086220 | |||
| 1634 | Ga0495607_0096167 | |||
| 1635 | Ga0495607_0171127 | |||
| 1636 | Ga0495583_0000942 | |||
| 1637 | Ga0495583_0007435 | |||
| 1638 | Ga0495583_0009045 | |||
| 1639 | Ga0495583_0012703 | |||
| 1640 | Ga0495583_0016269 | |||
| 1641 | Ga0495583_0020877 | |||
| 1642 | Ga0495583_0120857 | |||
| 1643 | Ga0495583_0125658 | |||
| 1644 | Ga0495583_0237250 | |||
| 1645 | Ga0495583_0432546 | |||
| 1646 | Ga0495606_0000075 | |||
| 1647 | Ga0495606_0000106 | |||
| 1648 | Ga0495606_0000376 | |||
| 1649 | Ga0495606_0002574 | |||
| 1650 | Ga0495606_0006323 | |||
| 1651 | Ga0495606_0022126 | |||
| 1652 | Ga0495606_0038185 | |||
| 1653 | Ga0495606_0069729 | |||
| 1654 | Ga0495606_0160434 | |||
| 1655 | Ga0495606_0215277 | |||
| 1656 | Ga0495606_0471438 | |||
| 1657 | Ga0495610_0000010 | |||
| 1658 | Ga0495616_0000374 | |||
| 1659 | Ga0495616_0011028 | |||
| 1660 | Ga0495616_0013718 | |||
| 1661 | Ga0495616_0016110 | |||
| 1662 | Ga0495616_0023041 | |||
| 1663 | Ga0495616_0029179 | |||
| 1664 | Ga0495616_0145357 | |||
| 1665 | Ga0495620_0008690 | |||
| 1666 | Ga0495630_0024743 | |||
| 1667 | Ga0495630_0091318 | |||
| 1668 | Ga0495631_0000168 | |||
| 1669 | Ga0495631_0001530 | |||
| 1670 | Ga0495631_0008745 | |||
| 1671 | Ga0495631_0012495 | |||
| 1672 | Ga0495631_0033755 | |||
| 1673 | Ga0495631_0045095 | |||
| 1674 | Ga0495631_0067175 | |||
| 1675 | Ga0495631_0069288 | |||
| 1676 | Ga0495631_0134019 | |||
| 1677 | Ga0495631_0258217 | |||
| 1678 | Ga0495632_0000244 | |||
| 1679 | Ga0495632_0000245 | |||
| 1680 | Ga0495632_0001734 | |||
| 1681 | Ga0495632_0119576 | |||
| 1682 | Ga0495637_0000056 | |||
| 1683 | Ga0495637_0018216 | |||
| 1684 | Ga0495637_0058161 | |||
| 1685 | Ga0495637_0256248 | |||
| 1686 | Ga0495637_0330417 | |||
| 1687 | Ga0495643_0003748 | |||
| 1688 | Ga0495643_0042330 | |||
| 1689 | Ga0495643_0048527 | |||
| 1690 | Ga0495643_0087375 | |||
| 1691 | Ga0495644_0013401 | |||
| 1692 | Ga0495648_0001175 | |||
| 1693 | Ga0495648_0002931 | |||
| 1694 | Ga0495648_0002962 | |||
| 1695 | Ga0495648_0019255 | |||
| 1696 | Ga0495648_0025562 | |||
| 1697 | Ga0495648_0026147 | |||
| 1698 | Ga0495648_0097422 | |||
| 1699 | Ga0495648_0109465 | |||
| 1700 | Ga0495648_0148629 | |||
| 1701 | Ga0495663_0028286 | |||
| 1702 | Ga0495663_0053973 | |||
| 1703 | Ga0495663_0107493 | |||
| 1704 | Ga0495666_0000573 | |||
| 1705 | Ga0495666_0000848 | |||
| 1706 | Ga0495666_0011673 | |||
| 1707 | Ga0495666_0040651 | |||
| 1708 | Ga0495666_0092171 | |||
| 1709 | Ga0495642_0000147 | |||
| 1710 | Ga0495642_0001211 | |||
| 1711 | Ga0495642_0001361 | |||
| 1712 | Ga0495642_0011445 | |||
| 1713 | Ga0495642_0022524 | |||
| 1714 | Ga0495642_0053250 | |||
| 1715 | Ga0495642_0058706 | |||
| 1716 | Ga0495642_0076829 | |||
| 1717 | Ga0495642_0109264 | |||
| 1718 | Ga0495642_0125620 | |||
| 1719 | Ga0495642_0166129 | |||
| 1720 | Ga0495642_0408148 | |||
| 1721 | Ga0495642_0566088 | |||
| 1722 | Ga0495652_0340388 | |||
| 1723 | Ga0495654_0000002 | |||
| 1724 | Ga0495654_0002925 | |||
| 1725 | Ga0495654_0032024 | |||
| 1726 | Ga0495654_0039085 | |||
| 1727 | Ga0495654_0069688 | |||
| 1728 | Ga0495654_0076725 | |||
| 1729 | Ga0495665_0005117 | |||
| 1730 | Ga0495665_0031815 | |||
| 1731 | Ga0495640_0136571 | |||
| 1732 | Ga0495640_0219118 | |||
| 1733 | Ga0495640_0771411 | |||
| 1734 | Ga0495586_0008589 | |||
| 1735 | Ga0495586_0020595 | |||
| 1736 | Ga0495586_0021159 | |||
| 1737 | Ga0495586_0505761 | |||
| 1738 | Ga0495587_0037046 | |||
| 1739 | Ga0495609_0000324 | |||
| 1740 | Ga0495609_0001837 | |||
| 1741 | Ga0495609_0003534 | |||
| 1742 | Ga0495609_0004966 | |||
| 1743 | Ga0495609_0004967 | |||
| 1744 | Ga0495609_0007122 | |||
| 1745 | Ga0495609_0012428 | |||
| 1746 | Ga0495609_0109910 | |||
| 1747 | Ga0495609_0342188 | |||
| 1748 | Ga0495621_0180570 | |||
| 1749 | Ga0495621_0223569 | |||
| 1750 | Ga0495597_0000619 | |||
| 1751 | Ga0495597_0001149 | |||
| 1752 | Ga0495597_0001873 | |||
| 1753 | Ga0495597_0033897 | |||
| 1754 | Ga0495597_0042860 | |||
| 1755 | Ga0495597_0073962 | |||
| 1756 | Ga0495597_0083658 | |||
| 1757 | Ga0495597_0160125 | |||
| 1758 | Ga0495597_0172607 | |||
| 1759 | Ga0495597_0224840 | |||
| 1760 | Ga0495597_0281676 | |||
| 1761 | Ga0495645_0390311 | |||
| 1762 | Ga0495645_0638052 | |||
| 1763 | Ga0495622_0009880 | |||
| 1764 | Ga0495622_0012319 | |||
| 1765 | Ga0495622_0018082 | |||
| 1766 | Ga0495622_0071425 | |||
| 1767 | Ga0495622_0092999 | |||
| 1768 | Ga0495633_0002909 | |||
| 1769 | Ga0495633_0008224 | |||
| 1770 | Ga0495633_0018935 | |||
| 1771 | Ga0495633_0082680 | |||
| 1772 | Ga0495633_0083585 | |||
| 1773 | Ga0495633_0131486 | |||
| 1774 | Ga0495656_0034660 | |||
| 1775 | Ga0495656_0085367 | |||
| 1776 | Ga0495656_0113173 | |||
| 1777 | Ga0495656_0170419 | |||
| 1778 | Ga0495668_0000089 | |||
| 1779 | Ga0495668_0000346 | |||
| 1780 | Ga0495668_0002252 | |||
| 1781 | Ga0495668_0004022 | |||
| 1782 | Ga0495668_0006266 | |||
| 1783 | Ga0495668_0009375 | |||
| 1784 | Ga0495668_0026838 | |||
| 1785 | Ga0495668_0171492 | |||
| 1786 | Ga0495668_0229147 | |||
| 1787 | Ga0495634_0364208 | |||
| 1788 | Ga0495611_0004040 | |||
| 1789 | Ga0495611_0004163 | |||
| 1790 | Ga0495611_0037061 | |||
| 1791 | Ga0495611_0059344 | |||
| 1792 | Ga0495611_0284693 | |||
| 1793 | Ga0495625_0048522 | |||
| 1794 | Ga0495625_0062464 | |||
| 1795 | Ga0495625_0064180 | |||
| 1796 | Ga0495625_0101824 | |||
| 1797 | Ga0495625_0189119 | |||
| 1798 | Ga0495625_0233108 | |||
| 1799 | Ga0495625_0274163 | |||
| 1800 | Ga0495635_0012345 | |||
| 1801 | Ga0495659_0012974 | |||
| 1802 | Ga0495659_0247745 | |||
| 1803 | Ga0495661_0000544 | |||
| 1804 | Ga0495661_0003256 | |||
| 1805 | Ga0495661_0005272 | |||
| 1806 | Ga0495661_0015461 | |||
| 1807 | Ga0495661_0027005 | |||
| 1808 | Ga0495661_0028564 | |||
| 1809 | Ga0495661_0046160 | |||
| 1810 | Ga0495661_0079896 | |||
| 1811 | Ga0495661_0080154 | |||
| 1812 | Ga0495661_0098090 | |||
| 1813 | Ga0495661_0169092 | |||
| 1814 | Ga0495661_0403414 | |||
| 1815 | Ga0495588_0000078 | |||
| 1816 | Ga0495588_0011122 | |||
| 1817 | Ga0495588_0048253 | |||
| 1818 | Ga0495588_0051970 | |||
| 1819 | Ga0495588_0054854 | |||
| 1820 | Ga0495588_0079308 | |||
| 1821 | Ga0495588_0092515 | |||
| 1822 | Ga0495588_0097405 | |||
| 1823 | Ga0495588_0141692 | |||
| 1824 | Ga0495588_0168627 | |||
| 1825 | Ga0495588_0186035 | |||
| 1826 | Ga0495588_0306700 | |||
| 1827 | Ga0495588_0487380 | |||
| 1828 | Ga0495599_0537508 | |||
| 1829 | Ga0495623_0011273 | |||
| 1830 | Ga0495623_0091922 | |||
| 1831 | Ga0495623_0550156 | |||
| 1832 | Ga0495646_0073916 | |||
| 1833 | Ga0495646_0215975 | |||
| 1834 | Ga0495669_0000194 | |||
| 1835 | Ga0495669_0000729 | |||
| 1836 | Ga0495669_0000815 | |||
| 1837 | Ga0495669_0017611 | |||
| 1838 | Ga0495624_0025247 | |||
| 1839 | Ga0495670_0000387 | |||
| 1840 | Ga0495670_0007002 | |||
| 1841 | Ga0495670_0014000 | |||
| 1842 | Ga0495670_0022267 | |||
| 1843 | Ga0495670_0117422 | |||
| 1844 | Ga0495670_0125124 | |||
| 1845 | Ga0495670_0153119 | |||
| 1846 | Ga0495670_0262758 | |||
| 1847 | Ga0495670_0451582 | |||
| 1848 | Ga0495671_0000002 | |||
| 1849 | Ga0495671_0000391 | |||
| 1850 | Ga0495671_0015270 | |||
| 1851 | Ga0495671_0016677 | |||
| 1852 | Ga0495671_0028296 | |||
| 1853 | Ga0495671_0040826 | |||
| 1854 | Ga0495671_0202903 | |||
| 1855 | Ga0495649_0079112 | |||
| 1856 | Ga0495649_0131884 | |||
| 1857 | Ga0495649_0190846 | |||
| 1858 | Ga0495649_0275929 | |||
| 1859 | Ga0495589_0000118 | |||
| 1860 | Ga0495589_0000300 | |||
| 1861 | Ga0495589_0005163 | |||
| 1862 | Ga0495589_0006774 | |||
| 1863 | Ga0495589_0012866 | |||
| 1864 | Ga0495589_0114104 | |||
| 1865 | Ga0495589_0134509 | |||
| 1866 | Ga0495589_0420000 | |||
| 1867 | Ga0495600_0027057 | |||
| 1868 | Ga0495660_0000070 | |||
| 1869 | Ga0495660_0000845 | |||
| 1870 | Ga0495660_0005038 | |||
| 1871 | Ga0495660_0005264 | |||
| 1872 | Ga0495660_0007998 | |||
| 1873 | Ga0495660_0032020 | |||
| 1874 | Ga0495660_0037071 | |||
| 1875 | Ga0495660_0130427 | |||
| 1876 | Ga0495660_0272965 | |||
| 1877 | Ga0495581_0002819 | |||
| 1878 | Ga0495581_0008271 | |||
| 1879 | Ga0495581_0079265 | |||
| 1880 | Ga0495604_0012649 | |||
| 1881 | Ga0495604_0023295 | |||
| 1882 | Ga0495604_0084225 | |||
| 1883 | Ga0495604_0124305 | |||
| 1884 | Ga0495604_0405137 | |||
| 1885 | Ga0495636_0007354 | |||
| 1886 | Ga0495636_0007447 | |||
| 1887 | Ga0495636_0024460 | |||
| 1888 | Ga0495636_0094706 | |||
| 1889 | Ga0495636_0251802 | |||
| 1890 | Ga0495674_0546264 | |||
| 1891 | Ga0495672_0002603 | |||
| 1892 | Ga0495672_0003246 | |||
| 1893 | Ga0495672_0013037 | |||
| 1894 | Ga0495672_0013704 | |||
| 1895 | Ga0495672_0370624 | |||
| 1896 | Ga0495676_0000040 | |||
| 1897 | Ga0495676_0033589 | |||
| 1898 | Ga0495676_0106535 | |||
| 1899 | Ga0495680_0028206 | |||
| 1900 | Ga0495680_0857476 | |||
| 1901 | Ga0495683_0034154 | |||
| 1902 | Ga0495683_0044558 | |||
| 1903 | Ga0495683_0065123 | |||
| 1904 | Ga0495683_0126073 | |||
| 1905 | Ga0495683_0227032 | |||
| 1906 | Ga0495687_000230 | |||
| 1907 | Ga0495687_000247 | |||
| 1908 | Ga0495687_000396 | |||
| 1909 | Ga0495687_000791 | |||
| 1910 | Ga0495687_006061 | |||
| 1911 | Ga0495687_042992 | |||
| 1912 | Ga0495687_053595 | |||
| 1913 | Ga0495675_0001760 | |||
| 1914 | Ga0495675_0008788 | |||
| 1915 | Ga0495675_0353847 | |||
| 1916 | Ga0495675_0563952 | |||
| 1917 | Ga0495677_0000171 | |||
| 1918 | Ga0495677_0003938 | |||
| 1919 | Ga0495677_0006767 | |||
| 1920 | Ga0495677_0020540 | |||
| 1921 | Ga0495677_0024627 | |||
| 1922 | Ga0495677_0028534 | |||
| 1923 | Ga0495677_0034133 | |||
| 1924 | Ga0495677_0144699 | |||
| 1925 | Ga0495677_0351629 | |||
| 1926 | Ga0495677_0356332 | |||
| 1927 | Ga0495677_0393260 | |||
| 1928 | Ga0495679_008472 | |||
| 1929 | Ga0495679_021051 | |||
| 1930 | Ga0495679_039159 | |||
| 1931 | Ga0495685_001643 | |||
| 1932 | Ga0495685_054394 | |||
| 1933 | Ga0495685_162031 | |||
| 1934 | Ga0495673_0000005 | |||
| 1935 | Ga0495673_0000026 | |||
| 1936 | Ga0495673_0000028 | |||
| 1937 | Ga0495673_0007477 | |||
| 1938 | Ga0495681_0000515 | |||
| 1939 | Ga0495681_0000938 | |||
| 1940 | Ga0495681_0006074 | |||
| 1941 | Ga0495681_0008256 | |||
| 1942 | Ga0495681_0026253 | |||
| 1943 | Ga0495681_0033942 | |||
| 1944 | Ga0495681_0135766 | |||
| 1945 | Ga0495686_0000635 | |||
| 1946 | Ga0495686_0000867 | |||
| 1947 | Ga0495686_0001860 | |||
| 1948 | Ga0495686_0015700 | |||
| 1949 | Ga0495686_0321640 | |||
| 1950 | Ga0495593_0008646 | |||
| 1951 | Ga0495593_0048210 | |||
| 1952 | Ga0495602_0023328 | |||
| 1953 | Ga0495602_0179258 | |||
| 1954 | Ga0495602_0375147 | |||
| 1955 | Ga0495614_0020227 | |||
| 1956 | Ga0495614_0054079 | |||
| 1957 | Ga0495615_0306632 | |||
| 1958 | Ga0495626_0000014 | |||
| 1959 | Ga0495626_0000028 | |||
| 1960 | Ga0495626_0001202 | |||
| 1961 | Ga0495626_0010116 | |||
| 1962 | Ga0495626_0010452 | |||
| 1963 | Ga0495626_0041025 | |||
| 1964 | Ga0495626_0048094 | |||
| 1965 | Ga0495626_0112069 | |||
| 1966 | Ga0495626_0172016 | |||
| 1967 | Ga0496100_0017614 | |||
| 1968 | Ga0496100_0511022 | |||
| 1969 | Ga0496101_0158774 | |||
| 1970 | Ga0496101_0968513 | |||
| 1971 | Ga0496102_0000285 | |||
| 1972 | Ga0496102_0006994 | |||
| 1973 | Ga0496102_0073317 | |||
| 1974 | Ga0496102_0210752 | |||
| 1975 | Ga0496102_0979288 | |||
| 1976 | Ga0496102_1915287 | |||
| 1977 | Ga0496103_0125855 | |||
| 1978 | Ga0496103_0735590 | |||
| 1979 | Ga0496104_0002988 | |||
| 1980 | Ga0496104_0013979 | |||
| 1981 | Ga0496104_0148172 | |||
| 1982 | Ga0496104_0193605 | |||
| 1983 | Ga0496104_0391951 | |||
| 1984 | Ga0496105_0000029 | |||
| 1985 | Ga0496105_0021293 | |||
| 1986 | Ga0496105_0021474 | |||
| 1987 | Ga0496105_0170139 | |||
| 1988 | Ga0496105_0229636 | |||
| 1989 | Ga0496106_0036901 | |||
| 1990 | Ga0496106_0317780 | |||
| 1991 | Ga0496107_0757903 | |||
| 1992 | Ga0496108_1511522 | |||
| 1993 | Ga0496109_0349446 | |||
| 1994 | Ga0496109_1476415 | |||
| 1995 | Ga0496110_0000403 | |||
| 1996 | Ga0496110_0011504 | |||
| 1997 | Ga0496110_0021417 | |||
| 1998 | Ga0496111_0024300 | |||
| 1999 | Ga0496111_0121241 | |||
| 2000 | Ga0496111_0239290 | |||
| 2001 | Ga0496111_0364837 | |||
| 2002 | Ga0496112_0090675 | |||
| 2003 | Ga0496112_0480646 | |||
| 2004 | Ga0496113_0004883 | |||
| 2005 | Ga0496113_0072672 | |||
| 2006 | Ga0496113_1426466 | |||
| 2007 | Ga0496114_0064210 | |||
| 2008 | Ga0496114_0369842 | |||
| 2009 | Ga0496114_1043464 | |||
| 2010 | Ga0496115_0020962 | |||
| 2011 | Ga0496115_0050321 | |||
| 2012 | Ga0496115_0212036 | |||
| 2013 | Ga0496115_0322358 | |||
| 2014 | Ga0496116_0307155 | |||
| 2015 | Ga0496119_0000611 | |||
| 2016 | Ga0496120_0034628 | |||
| 2017 | Ga0496121_0025701 | |||
| 2018 | Ga0496121_0130783 | |||
| 2019 | Ga0496122_0014301 | |||
| 2020 | Ga0496122_0057856 | |||
| 2021 | Ga0496122_0412009 | |||
| 2022 | Ga0496123_0003046 | |||
| 2023 | Ga0496123_0005925 | |||
| 2024 | Ga0496123_0249518 | |||
| 2025 | Ga0496124_0012729 | |||
| 2026 | Ga0496124_0017100 | |||
| 2027 | Ga0496124_0099669 | |||
| 2028 | Ga0496124_0108374 | |||
| 2029 | Ga0496124_0151955 | |||
| 2030 | Ga0496124_0204609 | |||
| 2031 | Ga0496124_0422261 | |||
| 2032 | Ga0496125_0105551 | |||
| 2033 | Ga0496126_0005047 | |||
| 2034 | Ga0496126_0716389 | |||
| 2035 | Ga0495678_000006 | |||
| 2036 | Ga0495678_000844 | |||
| 2037 | Ga0495678_002130 | |||
| 2038 | Ga0495678_002172 | |||
| 2039 | Ga0495682_0002910 | |||
| 2040 | Ga0495682_0070090 | |||
| 2041 | Ga0501300_077789 | |||
| 2042 | Ga0501031_0760822 | |||
| 2043 | Ga0501034_0179113 | |||
| 2044 | Ga0501039_0735640 | |||
| 2045 | Ga0501040_0643269 | |||
| 2046 | Ga0501041_0218858 | |||
| 2047 | Ga0501047_0156902 | |||
| 2048 | Ga0501048_0175522 | |||
| 2049 | Ga0501071_0332410 | |||
| 2050 | Ga0501076_1512184 | |||
| 2051 | Ga0501209_277855 | |||
| 2052 | Ga0501235_199279 | |||
| 2053 | Ga0501238_073964 | |||
| 2054 | Ga0501221_150304 | |||
| 2055 | Ga0501225_0347806 | |||
| 2056 | Ga0501035_0000813 | |||
| 2057 | Ga0501044_0514835 | |||
| 2058 | Ga0500594_0020311 | |||
| 2059 | Ga0500618_000621 | |||
| 2060 | Ga0500586_000876 | |||
| 2061 | Ga0587084_133199 | |||
| 2062 | Ga0587066_036057 | |||
| 2063 | Ga0587070_176044 | |||
| 2064 | Ga0587080_044697 | |||
| 2065 | Ga0587082_011812 | |||
| 2066 | Ga0587083_0004461 | |||
| 2067 | Ga0587088_015507 | |||
| 2068 | Ga0587091_086509 | |||
| 2069 | Ga0587098_028061 | |||
| 2070 | Ga0587098_090480 | |||
| 2071 | Ga0587101_018396 | |||
| 2072 | Ga0587068_022379 | |||
| 2073 | Ga0587069_060244 | |||
| 2074 | Ga0587072_013660 | |||
| 2075 | Ga0587075_070135 | |||
| 2076 | Ga0587079_016099 | |||
| 2077 | Ga0587079_016700 | |||
| 2078 | Ga0587079_031439 | |||
| 2079 | Ga0587102_012097 | |||
| 2080 | Ga0466962_0215044 | |||
| 2081 | Ga0466962_0268787 | |||
| 2082 | Ga0530510_0566659 | |||
| 2083 | 2521557855 | |||
| 2084 | 2552746448 | |||
| 2085 | 2553002980 | |||
| 2086 | 2601670246 | |||
| 2087 | 2640736470 | |||
| 2088 | 2643802696 | |||
| 2089 | 2644215343 | |||
| 2090 | 2644252048 | |||
| 2091 | 2644360696 | |||
| 2092 | 2644472201 | |||
| 2093 | 2678229691 | |||
| 2094 | 2738829024 | |||
| 2095 | 2739152820 | |||
| 2096 | 2739194740 | |||
| 2097 | 2739321216 | |||
| 2098 | 2739339457 | |||
| 2099 | 2765568972 | |||
| 2100 | 2774391385 | |||
| 2101 | 2774436120 | |||
| 2102 | 2809142653 | |||
| 2103 | 2819542382 | |||
| 2104 | 2819615003 | |||
| 2105 | 2821133232 | |||
| 2106 | 2839096146 | |||
| 2107 | 2842717596 | |||
| 2108 | 2857552181 | |||
| 2109 | 2857553358 | |||
| 2110 | 2857567432 | |||
| 2111 | 2885082901 | |||
| 2112 | 2904441383 | |||
| 2113 | 2904531680 | |||
| 2114 | 2904588095 | |||
| 2115 | 2904589745 | |||
| 2116 | 2904602869 | |||
| 2117 | 2916700418 | |||
| 2118 | 2919046319 | |||
| 2119 | 2919079627 | |||
| 2120 | 2919185210 | |||
| 2121 | 2919479730 | |||
| 2122 | 2919509204 | |||
| 2123 | 2923511082 | |||
| 2124 | 2928131025 | |||
| 2125 | 2932413756 | |||
| 2126 | 2932417816 | |||
| 2127 | 2989393025 | |||
| 2128 | 8047675314 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5l9n-assembly1.cif.gz_A | structure of uridylylated glnb from escherichia coli bound to atp | 0.7317 | 1 | 100 |
| 2eg1-assembly1.cif.gz_A | the crystal structure of pii protein | 0.7284 | 1 | 100 |
| 4c3k-assembly2.cif.gz_A | structure of mixed pii-adp complexes from s. elongatus | 0.724 | 1 | 100 |
| 4c3m-assembly1.cif.gz_B | structure of wildtype pii from s. elongatus at medium resolution | 0.7205 | 1 | 101 |
| 2gnk-assembly1.cif.gz_A | glnk, a signal protein from e. coli | 0.7202 | 1 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1sqhA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7903 | 8 | 64 | 3.40.630.30 |
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7114 | 1 | 100 | 3.30.70.120 |
| af_Q58095_241_444_3.10.28.10 | Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases | 0.7033 | 3 | 66 | 3.10.28.10 |
| af_Q57732_1_212_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.6985 | 4 | 63 | 3.40.50.150 |
| 3l7pE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.696 | 2 | 96 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1QLD1-F1-model_v4 | P-II family nitrogen regulator | 0.7895 | 1 | 70 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A4Q3B9A7-F1-model_v4 | deleted | 0.7845 | 1 | 69 |
|
| AF-A0A2N5A3S9-F1-model_v4 | Transcriptional regulator | 0.7826 | 1 | 68 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A348NQV9-F1-model_v4 | P-II family nitrogen regulator | 0.7782 | 1 | 70 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A3D5URX0-F1-model_v4 | Nitrogen regulatory protein P-II | 0.7778 | 1 | 70 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |