F489385

General Info

Members Datasets Scaffolds Average Seq Length
1065 349 2130 212

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0055066|Ga0501073_0055066_1364_2122
Length 252
Sequence VHSVPAESAKAGNAEAPADVLAGTLRVNEVFFSIQGESTWAGEPCVFVRLTGCPLRCTYCDTEYAFREGETRTIASVVQQVESFGCRVVEVTGGEPLAQKRCLDLVRVLCERGCTVLIETSGAVDIGPVDSRAIRIVDLKTPGSGEMERNLWSNMQQLRPRDEVKFVVTSREDYDWAKQQMTRLDLAGMVQRGQLRAVLMSAAWEQRKGLEIAGCAGLHPRTLAEWILADRLPVRMQSQLHKIIWDPQTRGV

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
207 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
208 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
221 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
222 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
223 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
224 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
225 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
226 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
232 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
233 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
234 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
235 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
236 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
237 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
278 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
279 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
280 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
281 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
282 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
283 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
284 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
304 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
305 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
306 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
307 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
308 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
309 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
310 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
311 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
312 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
313 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
314 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
315 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
316 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
317 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
318 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
319 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
320 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
321 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
322 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
327 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
328 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
329 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
330 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
331 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
332 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 1.6
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0055066 3300049589 Bacteria 2784
2 JGI24751J29686_10021274 3300002459 Bacteria 1344
3 Ga0065704_10015486 3300005289 Bacteria 1781
4 Ga0065704_10140576 3300005289 Unclassified 1521
5 Ga0065712_10087465 3300005290 Unclassified 2576
6 Ga0065712_10128456 3300005290 Bacteria 1578
7 Ga0065712_10187895 3300005290 Unclassified 1161
8 Ga0065712_10276063 3300005290 Bacteria 905
9 Ga0065715_10022852 3300005293 Bacteria 1819
10 Ga0065715_10142070 3300005293 Bacteria 1839
11 Ga0065707_10137543 3300005295 Bacteria 1819
12 Ga0065707_10338296 3300005295 Bacteria 938
13 Ga0070676_10007566 3300005328 Bacteria 5833
14 Ga0070676_10151114 3300005328 Bacteria 1486
15 Ga0070676_10427478 3300005328 Bacteria 927
16 Ga0070683_100013326 3300005329 Bacteria 7167
17 Ga0070683_100169018 3300005329 Bacteria 2075
18 Ga0070683_100529077 3300005329 Bacteria 1127
19 Ga0070690_100000336 3300005330 Bacteria 24075
20 Ga0070690_100004162 3300005330 Bacteria 8002
21 Ga0070690_100035498 3300005330 Bacteria 3129
22 Ga0070690_100050976 3300005330 Bacteria 2641
23 Ga0070670_100002699 3300005331 Bacteria 14659
24 Ga0070670_100035231 3300005331 Bacteria 4309
25 Ga0070670_100119293 3300005331 Unclassified 2275
26 Ga0070670_100627597 3300005331 Bacteria 963
27 Ga0070670_100640967 3300005331 Bacteria 953
28 Ga0070677_10005848 3300005333 Bacteria 4073
29 Ga0070677_10143361 3300005333 Bacteria 1104
30 Ga0068869_100032669 3300005334 Bacteria 3669
31 Ga0068869_100283775 3300005334 Bacteria 1332
32 Ga0070666_10007593 3300005335 Bacteria 6690
33 Ga0070666_10008555 3300005335 Bacteria 6358
34 Ga0070666_10232264 3300005335 Bacteria 1303
35 Ga0070680_100167068 3300005336 Bacteria 1850
36 Ga0070680_100235862 3300005336 Bacteria 1545
37 Ga0068868_100061553 3300005338 Bacteria 2974
38 Ga0068868_100076743 3300005338 Bacteria 2672
39 Ga0068868_100130709 3300005338 Bacteria 2054
40 Ga0068868_100200115 3300005338 Bacteria 1665
41 Ga0068868_100300052 3300005338 Bacteria 1364
42 Ga0068868_100392814 3300005338 Bacteria 1196
43 Ga0070660_100012311 3300005339 Bacteria 6105
44 Ga0070660_100104112 3300005339 Bacteria 2251
45 Ga0070689_100000066 3300005340 Bacteria 62639
46 Ga0070689_100089945 3300005340 Bacteria 2418
47 Ga0070689_100095286 3300005340 Unclassified 2351
48 Ga0070689_100137192 3300005340 Bacteria 1965
49 Ga0070689_100176621 3300005340 Bacteria 1733
50 Ga0070689_100324812 3300005340 Bacteria 1286
51 Ga0070689_100460076 3300005340 Bacteria 1084
52 Ga0070689_100630372 3300005340 Unclassified 931
53 Ga0070687_100232773 3300005343 Bacteria 1135
54 Ga0070661_100018875 3300005344 Bacteria 4909
55 Ga0070692_10001597 3300005345 Bacteria 8322
56 Ga0070692_10035483 3300005345 Bacteria 2525
57 Ga0070668_100275499 3300005347 Unclassified 1404
58 Ga0070668_100338028 3300005347 Unclassified 1271
59 Ga0070669_100001454 3300005353 Bacteria 17172
60 Ga0070669_100012223 3300005353 Bacteria 6094
61 Ga0070669_100016030 3300005353 Bacteria 5348
62 Ga0070669_100081558 3300005353 Bacteria 2410
63 Ga0070669_100105804 3300005353 Bacteria 2129
64 Ga0070669_100112110 3300005353 Bacteria 2071
65 Ga0070669_100341127 3300005353 Bacteria 1214
66 Ga0070675_100000147 3300005354 Bacteria 42295
67 Ga0070675_100003888 3300005354 Bacteria 11318
68 Ga0070675_100008321 3300005354 Bacteria 8046
69 Ga0070675_100048236 3300005354 Bacteria 3491
70 Ga0070675_100051067 3300005354 Bacteria 3397
71 Ga0070675_100247922 3300005354 Bacteria 1558
72 Ga0070675_100356514 3300005354 Bacteria 1298
73 Ga0070675_100390088 3300005354 Bacteria 1241
74 Ga0070675_100668551 3300005354 Unclassified 945
75 Ga0070671_100007961 3300005355 Bacteria 8477
76 Ga0070671_100032528 3300005355 Bacteria 4312
77 Ga0070671_100164771 3300005355 Bacteria 1874
78 Ga0070674_100002716 3300005356 Bacteria 9792
79 Ga0070674_100064531 3300005356 Bacteria 2566
80 Ga0070674_100814911 3300005356 Bacteria 807
81 Ga0070673_100000103 3300005364 Bacteria 38215
82 Ga0070673_100003965 3300005364 Bacteria 9304
83 Ga0070673_100009418 3300005364 Bacteria 6554
84 Ga0070673_100713120 3300005364 Bacteria 922
85 Ga0070688_100001477 3300005365 Bacteria 11687
86 Ga0070688_100003218 3300005365 Bacteria 8369
87 Ga0070688_100023138 3300005365 Bacteria 3651
88 Ga0070688_100055066 3300005365 Bacteria 2494
89 Ga0070688_100065786 3300005365 Bacteria 2305
90 Ga0070688_100105296 3300005365 Bacteria 1867
91 Ga0070688_100416269 3300005365 Bacteria 998
92 Ga0070688_100623179 3300005365 Bacteria 828
93 Ga0070659_100349461 3300005366 Unclassified 1240
94 Ga0070659_100375231 3300005366 Bacteria 1197
95 Ga0070667_100083176 3300005367 Bacteria 2742
96 Ga0070667_100325363 3300005367 Bacteria 1388
97 Ga0070703_10031065 3300005406 Bacteria 1613
98 Ga0070703_10040636 3300005406 Bacteria 1447
99 Ga0070703_10232710 3300005406 Bacteria 739
100 Ga0070709_10132027 3300005434 Bacteria 1706
101 Ga0070714_100253206 3300005435 Unclassified 1629
102 Ga0070710_10027928 3300005437 Bacteria 3014
103 Ga0070701_10000020 3300005438 Bacteria 41399
104 Ga0070701_10051314 3300005438 Bacteria 2140
105 Ga0070701_10138561 3300005438 Bacteria 1389
106 Ga0070701_10155126 3300005438 Bacteria 1322
107 Ga0070701_10286350 3300005438 Bacteria 1008
108 Ga0070701_10524117 3300005438 Bacteria 773
109 Ga0070711_100439564 3300005439 Unclassified 1066
110 Ga0070711_100465652 3300005439 Bacteria 1037
111 Ga0070705_100038491 3300005440 Bacteria 2706
112 Ga0070705_100042809 3300005440 Bacteria 2591
113 Ga0070705_100069953 3300005440 Bacteria 2118
114 Ga0070705_100186311 3300005440 Bacteria 1410
115 Ga0070705_100401137 3300005440 Unclassified 1015
116 Ga0070700_100000818 3300005441 Bacteria 15281
117 Ga0070700_100004171 3300005441 Bacteria 7535
118 Ga0070700_100004954 3300005441 Bacteria 7006
119 Ga0070700_100143607 3300005441 Bacteria 1625
120 Ga0070700_100694100 3300005441 Bacteria 808
121 Ga0070700_100776910 3300005441 Bacteria 769
122 Ga0070694_100047946 3300005444 Bacteria 2872
123 Ga0070694_100054370 3300005444 Bacteria 2712
124 Ga0070694_100106143 3300005444 Bacteria 1994
125 Ga0070694_100116412 3300005444 Unclassified 1912
126 Ga0070694_100397414 3300005444 Bacteria 1078
127 Ga0070708_100022317 3300005445 Bacteria 5367
128 Ga0070708_100101619 3300005445 Bacteria 2633
129 Ga0070708_100260591 3300005445 Bacteria 1630
130 Ga0070708_100422162 3300005445 Unclassified 1258
131 Ga0070708_100905832 3300005445 Bacteria 828
132 Ga0070663_100009569 3300005455 Bacteria 6006
133 Ga0070663_100032089 3300005455 Bacteria 3617
134 Ga0070678_100002436 3300005456 Bacteria 10191
135 Ga0070678_100016979 3300005456 Bacteria 4673
136 Ga0070678_100032871 3300005456 Bacteria 3595
137 Ga0070678_100055019 3300005456 Bacteria 2903
138 Ga0070678_100071199 3300005456 Bacteria 2602
139 Ga0070678_100137887 3300005456 Bacteria 1948
140 Ga0070678_101014404 3300005456 Bacteria 763
141 Ga0070662_100027204 3300005457 Bacteria 3967
142 Ga0070662_100100568 3300005457 Bacteria 2188
143 Ga0070662_100276377 3300005457 Bacteria 1358
144 Ga0070662_100989909 3300005457 Unclassified 719
145 Ga0070681_10014199 3300005458 Bacteria 7925
146 Ga0070681_10073223 3300005458 Bacteria 3388
147 Ga0070681_10129868 3300005458 Bacteria 2451
148 Ga0068867_100001096 3300005459 Bacteria 18486
149 Ga0068867_100002876 3300005459 Bacteria 12113
150 Ga0068867_100027704 3300005459 Bacteria 4075
151 Ga0068867_100093506 3300005459 Bacteria 2285
152 Ga0068867_100094484 3300005459 Bacteria 2274
153 Ga0068867_100345586 3300005459 Bacteria 1240
154 Ga0068867_100383805 3300005459 Bacteria 1181
155 Ga0068867_101115018 3300005459 Unclassified 721
156 Ga0070685_10000069 3300005466 Bacteria 60941
157 Ga0070685_10019371 3300005466 Bacteria 3670
158 Ga0070685_10031005 3300005466 Bacteria 2983
159 Ga0070685_10062750 3300005466 Bacteria 2180
160 Ga0070685_10139038 3300005466 Bacteria 1527
161 Ga0070685_10165941 3300005466 Bacteria 1411
162 Ga0070685_10167642 3300005466 Bacteria 1405
163 Ga0070706_100096995 3300005467 Bacteria 2738
164 Ga0070706_100144241 3300005467 Bacteria 2223
165 Ga0070706_100631082 3300005467 Bacteria 995
166 Ga0070707_100000021 3300005468 Bacteria 130642
167 Ga0070707_100038006 3300005468 Bacteria 4597
168 Ga0070707_100041900 3300005468 Bacteria 4383
169 Ga0070707_100069599 3300005468 Bacteria 3388
170 Ga0070707_100669326 3300005468 Unclassified 1001
171 Ga0070698_100029698 3300005471 Bacteria 5675
172 Ga0070698_100196500 3300005471 Bacteria 1954
173 Ga0070698_100289952 3300005471 Unclassified 1568
174 Ga0070699_100001737 3300005518 Bacteria 19888
175 Ga0070699_100002012 3300005518 Bacteria 18361
176 Ga0070699_100037057 3300005518 Bacteria 4219
177 Ga0070699_100053591 3300005518 Bacteria 3491
178 Ga0070699_100218236 3300005518 Bacteria 1699
179 Ga0070699_100335870 3300005518 Unclassified 1359
180 Ga0070679_100171169 3300005530 Bacteria 2144
181 Ga0070684_100768542 3300005535 Bacteria 900
182 Ga0070697_100048178 3300005536 Bacteria 3455
183 Ga0070697_100061083 3300005536 Bacteria 3073
184 Ga0070697_100139549 3300005536 Bacteria 2037
185 Ga0070697_100178419 3300005536 Bacteria 1800
186 Ga0070697_100538973 3300005536 Bacteria 1023
187 Ga0068853_100459082 3300005539 Bacteria 1199
188 Ga0070672_100002045 3300005543 Bacteria 12704
189 Ga0070672_100011300 3300005543 Bacteria 6227
190 Ga0070672_100045389 3300005543 Bacteria 3398
191 Ga0070672_100093050 3300005543 Bacteria 2435
192 Ga0070672_100136771 3300005543 Bacteria 2018
193 Ga0070672_100151381 3300005543 Bacteria 1919
194 Ga0070672_100227374 3300005543 Bacteria 1566
195 Ga0070686_100000100 3300005544 Bacteria 59351
196 Ga0070686_100002508 3300005544 Bacteria 10110
197 Ga0070686_100022866 3300005544 Bacteria 3729
198 Ga0070686_100040570 3300005544 Bacteria 2905
199 Ga0070686_100118755 3300005544 Bacteria 1813
200 Ga0070695_100005877 3300005545 Bacteria 7240
201 Ga0070695_100050017 3300005545 Bacteria 2677
202 Ga0070695_100063731 3300005545 Bacteria 2396
203 Ga0070695_100189390 3300005545 Bacteria 1463
204 Ga0070695_100575094 3300005545 Bacteria 881
205 Ga0070695_100799634 3300005545 Bacteria 755
206 Ga0070696_100002986 3300005546 Bacteria 11235
207 Ga0070696_100003911 3300005546 Bacteria 9952
208 Ga0070696_100011890 3300005546 Bacteria 5834
209 Ga0070696_100073659 3300005546 Bacteria 2407
210 Ga0070696_100101272 3300005546 Bacteria 2064
211 Ga0070696_100190801 3300005546 Unclassified 1525
212 Ga0070696_100250978 3300005546 Bacteria 1338
213 Ga0070696_100259553 3300005546 Bacteria 1317
214 Ga0070693_100169167 3300005547 Bacteria 1398
215 Ga0070665_100340116 3300005548 Unclassified 1505
216 Ga0070665_100422305 3300005548 Bacteria 1342
217 Ga0070665_100470014 3300005548 Bacteria 1268
218 Ga0070704_100003197 3300005549 Bacteria 9366
219 Ga0070704_100008135 3300005549 Bacteria 6271
220 Ga0070704_100009518 3300005549 Bacteria 5877
221 Ga0070704_100012684 3300005549 Bacteria 5214
222 Ga0070704_100040734 3300005549 Bacteria 3200
223 Ga0070704_100139194 3300005549 Bacteria 1892
224 Ga0070704_100175606 3300005549 Unclassified 1708
225 Ga0070704_100187522 3300005549 Bacteria 1660
226 Ga0070704_100631817 3300005549 Bacteria 944
227 Ga0070704_100708027 3300005549 Unclassified 893
228 Ga0068855_100098552 3300005563 Bacteria 3367
229 Ga0068855_100112064 3300005563 Bacteria 3131
230 Ga0070664_100000584 3300005564 Bacteria 27791
231 Ga0070664_100013313 3300005564 Bacteria 6698
232 Ga0070664_100029223 3300005564 Bacteria 4594
233 Ga0070664_100091172 3300005564 Bacteria 2638
234 Ga0070664_100107093 3300005564 Bacteria 2437
235 Ga0070664_100447347 3300005564 Bacteria 1186
236 Ga0070664_100590851 3300005564 Unclassified 1029
237 Ga0068857_100020770 3300005577 Bacteria 5778
238 Ga0068854_100174919 3300005578 Bacteria 1673
239 Ga0070702_100023978 3300005615 Bacteria 3249
240 Ga0070702_100116927 3300005615 Bacteria 1663
241 Ga0070702_100432589 3300005615 Bacteria 950
242 Ga0068852_101377789 3300005616 Unclassified 727
243 Ga0068859_100004613 3300005617 Bacteria 14046
244 Ga0068859_100051697 3300005617 Bacteria 4131
245 Ga0068859_100095636 3300005617 Bacteria 3023
246 Ga0068859_100174261 3300005617 Bacteria 2233
247 Ga0068859_100343076 3300005617 Bacteria 1588
248 Ga0068859_100481130 3300005617 Bacteria 1337
249 Ga0068864_100008151 3300005618 Bacteria 8641
250 Ga0068864_100029037 3300005618 Bacteria 4679
251 Ga0068864_100038432 3300005618 Bacteria 4087
252 Ga0068864_100111730 3300005618 Bacteria 2435
253 Ga0068864_100177764 3300005618 Bacteria 1944
254 Ga0068864_100471794 3300005618 Bacteria 1203
255 Ga0068866_10002332 3300005718 Bacteria 7869
256 Ga0068866_10202778 3300005718 Bacteria 1186
257 Ga0068861_100005416 3300005719 Bacteria 8639
258 Ga0068861_100045160 3300005719 Bacteria 3316
259 Ga0068861_100053791 3300005719 Bacteria 3065
260 Ga0068861_100253404 3300005719 Bacteria 1503
261 Ga0068861_100454974 3300005719 Unclassified 1148
262 Ga0068861_100685254 3300005719 Bacteria 951
263 Ga0068870_10001025 3300005840 Bacteria 11049
264 Ga0068870_10006146 3300005840 Bacteria 5280
265 Ga0068863_100002234 3300005841 Bacteria 19218
266 Ga0068863_100165117 3300005841 Bacteria 2123
267 Ga0068863_100168822 3300005841 Bacteria 2098
268 Ga0068858_100001888 3300005842 Bacteria 21404
269 Ga0068858_100030600 3300005842 Bacteria 4999
270 Ga0068858_100038117 3300005842 Bacteria 4458
271 Ga0068858_100126799 3300005842 Bacteria 2391
272 Ga0068858_100292889 3300005842 Bacteria 1552
273 Ga0068858_100833859 3300005842 Bacteria 900
274 Ga0068858_100986190 3300005842 Bacteria 825
275 Ga0068860_100033522 3300005843 Bacteria 4927
276 Ga0068860_100033985 3300005843 Bacteria 4892
277 Ga0068860_100054885 3300005843 Bacteria 3787
278 Ga0068860_100066357 3300005843 Bacteria 3428
279 Ga0068860_100484848 3300005843 Bacteria 1233
280 Ga0068862_100006477 3300005844 Bacteria 9723
281 Ga0068862_100018207 3300005844 Bacteria 5848
282 Ga0068862_100030874 3300005844 Bacteria 4518
283 Ga0068862_100042813 3300005844 Bacteria 3858
284 Ga0068862_100218963 3300005844 Bacteria 1723
285 Ga0081455_10000786 3300005937 Bacteria 40744
286 Ga0081455_10214401 3300005937 Bacteria 1432
287 Ga0081539_10146522 3300005985 Bacteria 1141
288 Ga0070715_10015855 3300006163 Bacteria 2819
289 Ga0070716_100206208 3300006173 Bacteria 1310
290 Ga0070716_100220732 3300006173 Bacteria 1273
291 Ga0070716_100514022 3300006173 Bacteria 886
292 Ga0070716_100639853 3300006173 Unclassified 805
293 Ga0070712_100135942 3300006175 Bacteria 1869
294 Ga0097621_100001601 3300006237 Bacteria 15491
295 Ga0097621_100007328 3300006237 Bacteria 7885
296 Ga0097621_100023648 3300006237 Bacteria 4786
297 Ga0097621_100056007 3300006237 Bacteria 3220
298 Ga0097621_100086311 3300006237 Bacteria 2619
299 Ga0097621_100091837 3300006237 Bacteria 2542
300 Ga0068871_100001107 3300006358 Bacteria 18079
301 Ga0068871_100010328 3300006358 Bacteria 6806
302 Ga0068871_100026278 3300006358 Bacteria 4541
303 Ga0068871_100033300 3300006358 Bacteria 4080
304 Ga0068871_100193809 3300006358 Bacteria 1751
305 Ga0068871_100340182 3300006358 Bacteria 1325
306 Ga0068871_100352776 3300006358 Bacteria 1301
307 Ga0075428_100012493 3300006844 Bacteria 9444
308 Ga0075428_100018081 3300006844 Bacteria 7790
309 Ga0075428_100037061 3300006844 Bacteria 5371
310 Ga0075428_100055313 3300006844 Bacteria 4348
311 Ga0075428_100066734 3300006844 Bacteria 3939
312 Ga0075428_100109374 3300006844 Bacteria 3011
313 Ga0075428_100388623 3300006844 Bacteria 1496
314 Ga0075428_100565104 3300006844 Bacteria 1216
315 Ga0075430_100001196 3300006846 Bacteria 20813
316 Ga0075430_100003466 3300006846 Bacteria 13203
317 Ga0075430_100006133 3300006846 Bacteria 10128
318 Ga0075430_100009586 3300006846 Bacteria 8182
319 Ga0075430_100180315 3300006846 Bacteria 1757
320 Ga0075430_100700891 3300006846 Bacteria 835
321 Ga0075431_100028775 3300006847 Bacteria 5713
322 Ga0075431_100073904 3300006847 Bacteria 3517
323 Ga0075431_100111492 3300006847 Bacteria 2823
324 Ga0075431_100177222 3300006847 Bacteria 2189
325 Ga0075431_100535423 3300006847 Bacteria 1160
326 Ga0075431_101174045 3300006847 Unclassified 731
327 Ga0075433_10000936 3300006852 Bacteria 20611
328 Ga0075433_10001275 3300006852 Bacteria 18416
329 Ga0075433_10013705 3300006852 Bacteria 6602
330 Ga0075433_10067320 3300006852 Bacteria 3143
331 Ga0075433_10110458 3300006852 Bacteria 2439
332 Ga0075433_10129334 3300006852 Bacteria 2243
333 Ga0075433_10338702 3300006852 Bacteria 1329
334 Ga0075433_10381076 3300006852 Bacteria 1245
335 Ga0075433_10492670 3300006852 Bacteria 1079
336 Ga0075433_10540806 3300006852 Bacteria 1024
337 Ga0075434_100000049 3300006871 Bacteria 57417
338 Ga0075434_100011998 3300006871 Bacteria 8199
339 Ga0075434_100021443 3300006871 Bacteria 6278
340 Ga0075434_100025831 3300006871 Bacteria 5749
341 Ga0075434_100046934 3300006871 Bacteria 4286
342 Ga0075434_100047314 3300006871 Bacteria 4268
343 Ga0075434_100132783 3300006871 Unclassified 2509
344 Ga0075434_100187017 3300006871 Bacteria 2091
345 Ga0075434_100634562 3300006871 Bacteria 1087
346 Ga0075429_100001236 3300006880 Bacteria 20721
347 Ga0075429_100018761 3300006880 Bacteria 5990
348 Ga0075429_100044586 3300006880 Bacteria 3857
349 Ga0075429_100161158 3300006880 Bacteria 1964
350 Ga0075429_100213590 3300006880 Bacteria 1690
351 Ga0075429_100215362 3300006880 Bacteria 1683
352 Ga0075429_100425496 3300006880 Bacteria 1163
353 Ga0068865_100086899 3300006881 Bacteria 2258
354 Ga0068865_100266952 3300006881 Bacteria 1357
355 Ga0068865_100339852 3300006881 Bacteria 1213
356 Ga0075436_100000420 3300006914 Bacteria 27162
357 Ga0075436_100019413 3300006914 Bacteria 4658
358 Ga0075436_100019739 3300006914 Bacteria 4621
359 Ga0075436_100025325 3300006914 Bacteria 4082
360 Ga0075436_100037192 3300006914 Bacteria 3360
361 Ga0075436_100322257 3300006914 Unclassified 1110
362 Ga0097620_100004613 3300006931 Bacteria 14046
363 Ga0097620_100051695 3300006931 Bacteria 4131
364 Ga0097620_100095631 3300006931 Bacteria 3023
365 Ga0097620_100174262 3300006931 Bacteria 2233
366 Ga0097620_100343077 3300006931 Bacteria 1588
367 Ga0097620_100481101 3300006931 Bacteria 1337
368 Ga0075435_100000059 3300007076 Bacteria 56189
369 Ga0075435_100004605 3300007076 Bacteria 9499
370 Ga0075435_100005562 3300007076 Bacteria 8819
371 Ga0075435_100013234 3300007076 Bacteria 6131
372 Ga0075435_100057562 3300007076 Bacteria 3145
373 Ga0075435_100154261 3300007076 Bacteria 1932
374 Ga0075435_100233022 3300007076 Bacteria 1564
375 Ga0075435_100287762 3300007076 Unclassified 1404
376 Ga0075435_100318908 3300007076 Bacteria 1330
377 Ga0111539_10000326 3300009094 Bacteria 58218
378 Ga0111539_10004673 3300009094 Bacteria 17895
379 Ga0111539_10004769 3300009094 Bacteria 17699
380 Ga0111539_10007551 3300009094 Bacteria 13899
381 Ga0111539_10010427 3300009094 Bacteria 11694
382 Ga0111539_10017167 3300009094 Bacteria 8959
383 Ga0111539_10042960 3300009094 Bacteria 5423
384 Ga0111539_10054412 3300009094 Bacteria 4762
385 Ga0111539_10057964 3300009094 Bacteria 4597
386 Ga0111539_10078245 3300009094 Bacteria 3891
387 Ga0111539_10123247 3300009094 Bacteria 3038
388 Ga0111539_10621651 3300009094 Bacteria 1258
389 Ga0111539_10646306 3300009094 Bacteria 1232
390 Ga0105245_10267491 3300009098 Unclassified 1666
391 Ga0105247_10003020 3300009101 Bacteria 11147
392 Ga0105247_10010076 3300009101 Bacteria 5726
393 Ga0105247_10270811 3300009101 Bacteria 1168
394 Ga0114129_10002862 3300009147 Bacteria 24132
395 Ga0114129_10004893 3300009147 Bacteria 18907
396 Ga0114129_10006748 3300009147 Bacteria 16297
397 Ga0114129_10008062 3300009147 Bacteria 15009
398 Ga0114129_10018292 3300009147 Bacteria 9981
399 Ga0114129_10027396 3300009147 Bacteria 8068
400 Ga0114129_10031782 3300009147 Bacteria 7463
401 Ga0114129_10038284 3300009147 Bacteria 6766
402 Ga0114129_10049334 3300009147 Bacteria 5914
403 Ga0114129_10056630 3300009147 Bacteria 5490
404 Ga0114129_10063676 3300009147 Bacteria 5148
405 Ga0114129_10082166 3300009147 Bacteria 4477
406 Ga0114129_10094153 3300009147 Bacteria 4149
407 Ga0114129_10126682 3300009147 Bacteria 3510
408 Ga0114129_10204942 3300009147 Bacteria 2669
409 Ga0114129_10252394 3300009147 Bacteria 2367
410 Ga0114129_10706218 3300009147 Bacteria 1295
411 Ga0114129_10753893 3300009147 Bacteria 1246
412 Ga0114129_10787619 3300009147 Bacteria 1214
413 Ga0114129_10951071 3300009147 Bacteria 1085
414 Ga0105243_10000238 3300009148 Bacteria 63019
415 Ga0105243_10025094 3300009148 Bacteria 4552
416 Ga0105243_10872003 3300009148 Unclassified 893
417 Ga0105242_10001243 3300009176 Bacteria 20071
418 Ga0105242_10004726 3300009176 Bacteria 10547
419 Ga0105242_10007339 3300009176 Bacteria 8485
420 Ga0105242_10098152 3300009176 Bacteria 2478
421 Ga0105242_10259609 3300009176 Bacteria 1569
422 Ga0105242_10847090 3300009176 Bacteria 909
423 Ga0105248_10013509 3300009177 Bacteria 8989
424 Ga0105248_10017801 3300009177 Bacteria 7840
425 Ga0105248_10056753 3300009177 Bacteria 4393
426 Ga0105248_10081647 3300009177 Bacteria 3634
427 Ga0105248_10126720 3300009177 Bacteria 2880
428 Ga0105248_10139979 3300009177 Bacteria 2729
429 Ga0105248_10151210 3300009177 Bacteria 2619
430 Ga0105248_10271331 3300009177 Bacteria 1910
431 Ga0105248_10811528 3300009177 Unclassified 1056
432 Ga0105248_11395260 3300009177 Bacteria 793
433 Ga0105238_10686821 3300009551 Bacteria 1035
434 Ga0105249_10051517 3300009553 Bacteria 3755
435 Ga0105249_10269044 3300009553 Bacteria 1697
436 Ga0105249_11078758 3300009553 Bacteria 873
437 Ga0157371_10184330 3300013102 Bacteria 1493
438 Ga0157370_10640920 3300013104 Bacteria 971
439 Ga0157369_10337892 3300013105 Bacteria 1564
440 Ga0157374_10064849 3300013296 Bacteria 3429
441 Ga0157374_10496237 3300013296 Unclassified 1225
442 Ga0157374_10504422 3300013296 Bacteria 1215
443 Ga0157374_10554208 3300013296 Unclassified 1157
444 Ga0157378_10002332 3300013297 Bacteria 16867
445 Ga0157378_10174325 3300013297 Bacteria 2019
446 Ga0157378_10659056 3300013297 Bacteria 1063
447 Ga0163162_10102935 3300013306 Bacteria 2949
448 Ga0163162_10465786 3300013306 Bacteria 1395
449 Ga0163162_11271088 3300013306 Bacteria 836
450 Ga0157375_10022418 3300013308 Bacteria 5813
451 Ga0157375_10050333 3300013308 Bacteria 4086
452 Ga0157375_10089852 3300013308 Bacteria 3129
453 Ga0157375_10115922 3300013308 Bacteria 2782
454 Ga0157375_10212801 3300013308 Bacteria 2091
455 Ga0157375_10535202 3300013308 Bacteria 1334
456 Ga0163163_10401399 3300014325 Bacteria 1429
457 Ga0157380_10002955 3300014326 Bacteria 11565
458 Ga0157380_10003616 3300014326 Bacteria 10632
459 Ga0157380_10010138 3300014326 Bacteria 6772
460 Ga0157380_10029391 3300014326 Bacteria 4201
461 Ga0157380_10104200 3300014326 Bacteria 2369
462 Ga0157380_10106662 3300014326 Bacteria 2345
463 Ga0157380_10197607 3300014326 Bacteria 1781
464 Ga0157380_10265843 3300014326 Bacteria 1561
465 Ga0157380_10319912 3300014326 Bacteria 1438
466 Ga0157380_10486371 3300014326 Bacteria 1195
467 Ga0157380_10791525 3300014326 Bacteria 964
468 Ga0157380_11151838 3300014326 Bacteria 817
469 Ga0157380_11331560 3300014326 Bacteria 766
470 Ga0157377_10018169 3300014745 Bacteria 3652
471 Ga0157377_10018864 3300014745 Bacteria 3593
472 Ga0157377_10047355 3300014745 Bacteria 2408
473 Ga0157377_10095111 3300014745 Bacteria 1766
474 Ga0157377_10248787 3300014745 Bacteria 1151
475 Ga0157379_10009913 3300014968 Bacteria 8299
476 Ga0157379_10017365 3300014968 Bacteria 6340
477 Ga0157379_10067559 3300014968 Bacteria 3195
478 Ga0157376_10048960 3300014969 Bacteria 3499
479 Ga0157376_10160959 3300014969 Bacteria 2035
480 Ga0157376_10431110 3300014969 Bacteria 1281
481 Ga0157376_10455653 3300014969 Bacteria 1249
482 Ga0157376_10650086 3300014969 Unclassified 1055
483 Ga0163161_10031367 3300017792 Bacteria 3787
484 Ga0163161_10161833 3300017792 Bacteria 1707
485 Ga0207697_10000575 3300025315 Bacteria 20854
486 Ga0207682_10001469 3300025893 Bacteria 10886
487 Ga0207682_10011353 3300025893 Bacteria 3478
488 Ga0207682_10030408 3300025893 Bacteria 2163
489 Ga0207682_10033322 3300025893 Bacteria 2073
490 Ga0207682_10129069 3300025893 Bacteria 1127
491 Ga0207692_10035866 3300025898 Bacteria 2413
492 Ga0207692_10060517 3300025898 Bacteria 1959
493 Ga0207642_10017132 3300025899 Bacteria 2748
494 Ga0207642_10110274 3300025899 Bacteria 1400
495 Ga0207710_10003937 3300025900 Bacteria 6552
496 Ga0207710_10047460 3300025900 Unclassified 1920
497 Ga0207710_10365696 3300025900 Bacteria 736
498 Ga0207688_10000078 3300025901 Bacteria 37290
499 Ga0207688_10221170 3300025901 Bacteria 1141
500 Ga0207680_10051609 3300025903 Bacteria 2460
501 Ga0207680_10765267 3300025903 Bacteria 692
502 Ga0207685_10011619 3300025905 Bacteria 2654
503 Ga0207685_10107174 3300025905 Bacteria 1205
504 Ga0207645_10002104 3300025907 Bacteria 15935
505 Ga0207645_10002597 3300025907 Bacteria 14090
506 Ga0207645_10007763 3300025907 Bacteria 7551
507 Ga0207645_10128802 3300025907 Bacteria 1646
508 Ga0207643_10000706 3300025908 Bacteria 20718
509 Ga0207643_10084543 3300025908 Bacteria 1842
510 Ga0207684_10000737 3300025910 Bacteria 38452
511 Ga0207684_10031826 3300025910 Bacteria 4487
512 Ga0207684_10142894 3300025910 Bacteria 2058
513 Ga0207684_10296558 3300025910 Unclassified 1394
514 Ga0207684_10681152 3300025910 Bacteria 875
515 Ga0207654_10091248 3300025911 Unclassified 1857
516 Ga0207707_10002734 3300025912 Bacteria 15763
517 Ga0207707_10070129 3300025912 Bacteria 3054
518 Ga0207693_10013276 3300025915 Bacteria 6645
519 Ga0207663_10870600 3300025916 Bacteria 720
520 Ga0207660_10004716 3300025917 Bacteria 8877
521 Ga0207660_10037729 3300025917 Bacteria 3369
522 Ga0207660_10142675 3300025917 Bacteria 1832
523 Ga0207662_10001063 3300025918 Bacteria 12911
524 Ga0207662_10001208 3300025918 Bacteria 12343
525 Ga0207662_10140373 3300025918 Bacteria 1530
526 Ga0207662_10333653 3300025918 Bacteria 1015
527 Ga0207662_10483314 3300025918 Bacteria 851
528 Ga0207657_10060146 3300025919 Bacteria 3261
529 Ga0207657_10093048 3300025919 Bacteria 2511
530 Ga0207649_10018165 3300025920 Bacteria 3994
531 Ga0207649_10029456 3300025920 Bacteria 3242
532 Ga0207652_10124757 3300025921 Bacteria 2293
533 Ga0207646_10000231 3300025922 Bacteria 76772
534 Ga0207646_10000547 3300025922 Bacteria 49465
535 Ga0207646_10127744 3300025922 Bacteria 2286
536 Ga0207646_10611216 3300025922 Unclassified 978
537 Ga0207681_10023929 3300025923 Bacteria 3913
538 Ga0207681_10064590 3300025923 Bacteria 2528
539 Ga0207681_10095334 3300025923 Bacteria 2134
540 Ga0207681_10162286 3300025923 Bacteria 1686
541 Ga0207681_10194009 3300025923 Bacteria 1556
542 Ga0207694_10130066 3300025924 Bacteria 2017
543 Ga0207650_10007478 3300025925 Bacteria 7445
544 Ga0207650_10070542 3300025925 Bacteria 2626
545 Ga0207650_10114607 3300025925 Unclassified 2091
546 Ga0207650_10150803 3300025925 Bacteria 1834
547 Ga0207650_10261694 3300025925 Bacteria 1403
548 Ga0207650_10601054 3300025925 Bacteria 925
549 Ga0207659_10000075 3300025926 Bacteria 63221
550 Ga0207659_10000939 3300025926 Bacteria 17393
551 Ga0207659_10002741 3300025926 Bacteria 10504
552 Ga0207659_10010800 3300025926 Bacteria 5748
553 Ga0207659_10132383 3300025926 Bacteria 1926
554 Ga0207659_10168017 3300025926 Bacteria 1728
555 Ga0207659_10270178 3300025926 Bacteria 1387
556 Ga0207659_10289572 3300025926 Bacteria 1341
557 Ga0207659_10635974 3300025926 Bacteria 911
558 Ga0207659_10870072 3300025926 Bacteria 775
559 Ga0207687_10057635 3300025927 Bacteria 2730
560 Ga0207700_11125101 3300025928 Bacteria 702
561 Ga0207644_10096143 3300025931 Bacteria 2216
562 Ga0207644_10102458 3300025931 Bacteria 2153
563 Ga0207644_10107568 3300025931 Bacteria 2104
564 Ga0207706_10005586 3300025933 Bacteria 11718
565 Ga0207706_10026033 3300025933 Bacteria 5237
566 Ga0207706_10402085 3300025933 Bacteria 1187
567 Ga0207706_10403920 3300025933 Bacteria 1184
568 Ga0207706_10483263 3300025933 Unclassified 1070
569 Ga0207706_10672387 3300025933 Bacteria 886
570 Ga0207686_10004046 3300025934 Bacteria 7869
571 Ga0207686_10015028 3300025934 Bacteria 4322
572 Ga0207686_10032259 3300025934 Bacteria 3117
573 Ga0207686_10237243 3300025934 Bacteria 1325
574 Ga0207709_10005269 3300025935 Bacteria 7354
575 Ga0207670_10000098 3300025936 Bacteria 60320
576 Ga0207670_10018572 3300025936 Bacteria 4231
577 Ga0207670_10018961 3300025936 Bacteria 4194
578 Ga0207670_10064879 3300025936 Bacteria 2505
579 Ga0207670_10114531 3300025936 Bacteria 1949
580 Ga0207670_10153793 3300025936 Bacteria 1710
581 Ga0207670_10281125 3300025936 Bacteria 1297
582 Ga0207669_10038016 3300025937 Bacteria 2767
583 Ga0207669_10095631 3300025937 Bacteria 1948
584 Ga0207669_10377503 3300025937 Bacteria 1104
585 Ga0207669_10411894 3300025937 Bacteria 1061
586 Ga0207704_10006357 3300025938 Bacteria 5505
587 Ga0207704_10145885 3300025938 Bacteria 1662
588 Ga0207704_10173104 3300025938 Bacteria 1551
589 Ga0207704_10883530 3300025938 Bacteria 751
590 Ga0207665_10129988 3300025939 Bacteria 1786
591 Ga0207665_10135890 3300025939 Bacteria 1749
592 Ga0207665_10294556 3300025939 Bacteria 1211
593 Ga0207691_10000209 3300025940 Bacteria 56763
594 Ga0207691_10008047 3300025940 Bacteria 10134
595 Ga0207691_10016035 3300025940 Bacteria 7118
596 Ga0207691_10030425 3300025940 Bacteria 5044
597 Ga0207691_10064712 3300025940 Bacteria 3312
598 Ga0207691_10200556 3300025940 Bacteria 1737
599 Ga0207691_10374381 3300025940 Bacteria 1216
600 Ga0207691_10569750 3300025940 Bacteria 960
601 Ga0207691_10713245 3300025940 Unclassified 845
602 Ga0207711_10007687 3300025941 Bacteria 9013
603 Ga0207711_10076709 3300025941 Bacteria 2911
604 Ga0207711_10174978 3300025941 Bacteria 1949
605 Ga0207711_10691119 3300025941 Bacteria 951
606 Ga0207711_10825436 3300025941 Unclassified 863
607 Ga0207689_10003806 3300025942 Bacteria 13754
608 Ga0207689_10004341 3300025942 Bacteria 12917
609 Ga0207689_10009073 3300025942 Bacteria 8612
610 Ga0207689_10111980 3300025942 Bacteria 2243
611 Ga0207689_10182618 3300025942 Bacteria 1730
612 Ga0207689_10578185 3300025942 Unclassified 944
613 Ga0207661_10053538 3300025944 Bacteria 3230
614 Ga0207661_10723134 3300025944 Bacteria 916
615 Ga0207679_10002301 3300025945 Bacteria 11774
616 Ga0207679_10003057 3300025945 Bacteria 10362
617 Ga0207679_10004433 3300025945 Bacteria 8744
618 Ga0207679_10024651 3300025945 Bacteria 4126
619 Ga0207679_10285976 3300025945 Bacteria 1416
620 Ga0207667_10175780 3300025949 Bacteria 2200
621 Ga0207651_10000027 3300025960 Bacteria 69165
622 Ga0207651_10001655 3300025960 Bacteria 10222
623 Ga0207651_10139926 3300025960 Bacteria 1868
624 Ga0207651_10233236 3300025960 Unclassified 1495
625 Ga0207651_10580045 3300025960 Unclassified 978
626 Ga0207712_10411109 3300025961 Bacteria 1139
627 Ga0207668_10203382 3300025972 Bacteria 1579
628 Ga0207668_10804354 3300025972 Bacteria 832
629 Ga0207640_10620184 3300025981 Bacteria 918
630 Ga0207640_10896771 3300025981 Bacteria 774
631 Ga0207658_10011910 3300025986 Bacteria 5930
632 Ga0207658_10092466 3300025986 Bacteria 2350
633 Ga0207658_10374305 3300025986 Bacteria 1246
634 Ga0207677_10232312 3300026023 Bacteria 1486
635 Ga0207677_10394383 3300026023 Bacteria 1172
636 Ga0207677_10423021 3300026023 Bacteria 1135
637 Ga0207703_10010388 3300026035 Bacteria 7283
638 Ga0207703_10015685 3300026035 Bacteria 5909
639 Ga0207703_10053921 3300026035 Bacteria 3269
640 Ga0207703_10236358 3300026035 Bacteria 1641
641 Ga0207703_10326843 3300026035 Bacteria 1406
642 Ga0207678_10011052 3300026067 Bacteria 7930
643 Ga0207678_10029975 3300026067 Bacteria 4750
644 Ga0207708_10000853 3300026075 Bacteria 22965
645 Ga0207708_10001575 3300026075 Bacteria 17042
646 Ga0207708_10002902 3300026075 Bacteria 12636
647 Ga0207708_10004792 3300026075 Bacteria 9964
648 Ga0207708_10320605 3300026075 Bacteria 1265
649 Ga0207708_10337523 3300026075 Bacteria 1233
650 Ga0207708_10441513 3300026075 Bacteria 1082
651 Ga0207708_10590216 3300026075 Unclassified 940
652 Ga0207641_10005189 3300026088 Bacteria 11136
653 Ga0207641_10029000 3300026088 Bacteria 4575
654 Ga0207641_10147973 3300026088 Bacteria 2125
655 Ga0207641_10465013 3300026088 Bacteria 1224
656 Ga0207641_10540184 3300026088 Bacteria 1136
657 Ga0207641_10718470 3300026088 Bacteria 985
658 Ga0207641_10781211 3300026088 Bacteria 944
659 Ga0207641_11090744 3300026088 Bacteria 797
660 Ga0207648_10000543 3300026089 Bacteria 42056
661 Ga0207648_10001158 3300026089 Bacteria 29542
662 Ga0207648_10004219 3300026089 Bacteria 14853
663 Ga0207648_10005943 3300026089 Bacteria 12209
664 Ga0207648_10203058 3300026089 Bacteria 1758
665 Ga0207648_10276221 3300026089 Unclassified 1502
666 Ga0207648_10549894 3300026089 Bacteria 1060
667 Ga0207648_10637825 3300026089 Bacteria 984
668 Ga0207676_10009537 3300026095 Bacteria 6910
669 Ga0207676_10020875 3300026095 Bacteria 4799
670 Ga0207676_10070443 3300026095 Bacteria 2804
671 Ga0207676_10316048 3300026095 Bacteria 1432
672 Ga0207676_10648925 3300026095 Bacteria 1018
673 Ga0207674_10029412 3300026116 Bacteria 5784
674 Ga0207674_10426578 3300026116 Bacteria 1281
675 Ga0207675_100004884 3300026118 Bacteria 12928
676 Ga0207675_100025879 3300026118 Bacteria 5459
677 Ga0207675_100126472 3300026118 Bacteria 2421
678 Ga0207675_100992494 3300026118 Bacteria 858
679 Ga0207683_10001107 3300026121 Bacteria 24547
680 Ga0207683_10002196 3300026121 Bacteria 17160
681 Ga0207683_10011362 3300026121 Bacteria 7597
682 Ga0207683_10017195 3300026121 Bacteria 6159
683 Ga0207683_10031021 3300026121 Bacteria 4637
684 Ga0207683_10075220 3300026121 Bacteria 2989
685 Ga0207683_10116045 3300026121 Bacteria 2400
686 Ga0207683_10187113 3300026121 Bacteria 1879
687 Ga0207698_10304153 3300026142 Bacteria 1486
688 Ga0209969_1000120 3300027360 Bacteria 9962
689 Ga0209967_1000144 3300027364 Bacteria 9733
690 Ga0209967_1003541 3300027364 Bacteria 2056
691 Ga0209981_1000003 3300027378 Bacteria 30420
692 Ga0209996_1000058 3300027395 Bacteria 15054
693 Ga0209984_1000444 3300027424 Bacteria 4509
694 Ga0209984_1010133 3300027424 Unclassified 1205
695 Ga0210000_1000024 3300027462 Bacteria 23307
696 Ga0209995_1000087 3300027471 Bacteria 14662
697 Ga0209995_1018580 3300027471 Bacteria 1147
698 Ga0209968_1000019 3300027526 Bacteria 32234
699 Ga0209999_1000055 3300027543 Bacteria 12672
700 Ga0209982_1001564 3300027552 Bacteria 3145
701 Ga0209970_1000013 3300027614 Bacteria 24097
702 Ga0210002_1000024 3300027617 Bacteria 23321
703 Ga0209983_1001530 3300027665 Bacteria 5144
704 Ga0209983_1028790 3300027665 Bacteria 1180
705 Ga0209971_1000232 3300027682 Bacteria 15872
706 Ga0209966_1000331 3300027695 Bacteria 14989
707 Ga0209998_10000094 3300027717 Bacteria 35182
708 Ga0209998_10095011 3300027717 Bacteria 734
709 Ga0209974_10001696 3300027876 Bacteria 7979
710 Ga0209974_10028942 3300027876 Bacteria 1835
711 Ga0209974_10150074 3300027876 Unclassified 841
712 Ga0207428_10000089 3300027907 Bacteria 127333
713 Ga0207428_10000529 3300027907 Bacteria 45592
714 Ga0207428_10005145 3300027907 Bacteria 12252
715 Ga0207428_10006577 3300027907 Bacteria 10711
716 Ga0207428_10009135 3300027907 Bacteria 8908
717 Ga0207428_10036379 3300027907 Bacteria 4015
718 Ga0207428_10041262 3300027907 Bacteria 3737
719 Ga0207428_10087031 3300027907 Bacteria 2431
720 Ga0207428_10096747 3300027907 Bacteria 2286
721 Ga0268266_10261906 3300028379 Bacteria 1603
722 Ga0268266_10356310 3300028379 Bacteria 1376
723 Ga0268266_10773398 3300028379 Unclassified 927
724 Ga0268265_10014428 3300028380 Bacteria 5383
725 Ga0268265_10033808 3300028380 Bacteria 3720
726 Ga0268265_10047123 3300028380 Bacteria 3228
727 Ga0268265_10468822 3300028380 Bacteria 1180
728 Ga0268265_10779926 3300028380 Bacteria 930
729 Ga0268265_10886111 3300028380 Bacteria 875
730 Ga0268264_10042594 3300028381 Bacteria 3759
731 Ga0268264_10058684 3300028381 Bacteria 3223
732 Ga0268264_10073918 3300028381 Bacteria 2894
733 Ga0265332_10114114 3300031238 Bacteria 1137
734 Ga0307408_100013769 3300031548 Bacteria 5368
735 Ga0307408_100173814 3300031548 Unclassified 1722
736 Ga0307408_100278417 3300031548 Bacteria 1392
737 Ga0307405_10586391 3300031731 Bacteria 907
738 Ga0307413_10596162 3300031824 Bacteria 903
739 Ga0307410_10296321 3300031852 Bacteria 1275
740 Ga0307412_10034734 3300031911 Bacteria 3215
741 Ga0307409_100370716 3300031995 Bacteria 1358
742 Ga0307416_100052642 3300032002 Bacteria 3261
743 Ga0307416_100105257 3300032002 Unclassified 2469
744 Ga0307416_100138240 3300032002 Bacteria 2209
745 Ga0307416_100390432 3300032002 Bacteria 1426
746 Ga0307416_100497949 3300032002 Bacteria 1282
747 Ga0307416_100656294 3300032002 Bacteria 1134
748 Ga0307414_10050348 3300032004 Bacteria 2885
749 Ga0307411_10474862 3300032005 Bacteria 1052
750 Ga0307415_100077488 3300032126 Unclassified 2361
751 Ga0307415_100126033 3300032126 Bacteria 1930
752 Ga0307415_100358610 3300032126 Bacteria 1230
753 Ga0373958_0034645 3300034819 Bacteria 1007
754 Ga0373958_0042935 3300034819 Bacteria 930
755 Ga0373926_0030225 3300035083 Unclassified 1907
756 Ga0373926_0084736 3300035083 Bacteria 1175
757 Ga0373940_0106412 3300035088 Bacteria 857
758 Ga0373949_0111813 3300035090 Bacteria 759
759 Ga0373949_0133286 3300035090 Unclassified 706
760 Ga0373952_0012701 3300035092 Bacteria 1661
761 Ga0373923_0236918 3300035111 Bacteria 852
762 Ga0373939_0177465 3300035114 Unclassified 792
763 Ga0373941_0098558 3300035115 Unclassified 1014
764 Ga0373941_0149254 3300035115 Unclassified 856
765 Ga0373945_0023198 3300035116 Bacteria 2143
766 Ga0373960_0009345 3300035121 Bacteria 2373
767 Ga0373943_0223882 3300035170 Unclassified 1049
768 Ga0373931_0009512 3300035691 Bacteria 4647
769 Ga0373927_0525940 3300035695 Bacteria 782
770 Ga0373933_0048168 3300035724 Bacteria 2537
771 Ga0373937_0086289 3300036401 Bacteria 2905
772 Ga0373937_0103302 3300036401 Bacteria 2647
773 Ga0373937_0285603 3300036401 Bacteria 1559
774 Ga0373937_0631625 3300036401 Bacteria 1016
775 Ga0373937_0631680 3300036401 Bacteria 1016
776 Ga0373925_0027581 3300037068 Bacteria 4157
777 Ga0373925_0552846 3300037068 Bacteria 947
778 Ga0400490_10325 3300038726 Bacteria 52681
779 Ga0400491_11348 3300038727 Bacteria 7348
780 Ga0400489_76132 3300039093 Bacteria 1104
781 Ga0439438_058205 3300041405 Bacteria 971
782 Ga0439447_010933 3300041407 Bacteria 2673
783 Ga0439453_0003992 3300041408 Bacteria 2167
784 Ga0439461_0035251 3300041410 Bacteria 1061
785 Ga0451853_1940769 3300041512 Unclassified 1591
786 Ga0451853_2329500 3300041512 Bacteria 1103
787 Ga0439433_0017488 3300041999 Bacteria 1592
788 Ga0439441_003072 3300042001 Bacteria 2420
789 Ga0439448_0035817 3300042005 Bacteria 1591
790 Ga0439432_035110 3300042006 Bacteria 1607
791 Ga0439450_000289 3300042008 Bacteria 6222
792 Ga0439450_019708 3300042008 Bacteria 1432
793 Ga0439450_125750 3300042008 Bacteria 662
794 Ga0439451_016701 3300042009 Bacteria 1478
795 Ga0439452_013979 3300042010 Bacteria 2240
796 Ga0439456_015300 3300042013 Unclassified 1602
797 Ga0439456_056997 3300042013 Bacteria 857
798 Ga0450923_016385 3300042125 Bacteria 1395
799 Ga0450923_065484 3300042125 Archaea 799
800 Ga0450896_002429 3300042133 Bacteria 2402
801 Ga0450896_015549 3300042133 Bacteria 1090
802 Ga0439446_0045893 3300042156 Bacteria 1296
803 Ga0439446_0068646 3300042156 Bacteria 1081
804 Ga0450909_027822 3300042185 Bacteria 854
805 Ga0439434_0003138 3300042435 Bacteria 4858
806 Ga0439434_0110659 3300042435 Bacteria 890
807 Ga0439434_0115256 3300042435 Bacteria 873
808 Ga0439435_0021616 3300042436 Bacteria 1672
809 Ga0439435_0185312 3300042436 Bacteria 681
810 Ga0439460_0076306 3300042461 Unclassified 1045
811 Ga0451577_0000099 3300042876 Bacteria 191842
812 Ga0451577_0010642 3300042876 Bacteria 8765
813 Ga0451577_0035953 3300042876 Bacteria 4462
814 Ga0451577_0039088 3300042876 Bacteria 4264
815 Ga0451577_0091136 3300042876 Bacteria 2721
816 Ga0451577_0179114 3300042876 Bacteria 1911
817 Ga0439440_0063986 3300042993 Unclassified 944
818 Ga0453683_0105451 3300044673 Unclassified 1770
819 Ga0453684_0000350 3300044712 Bacteria 191841
820 Ga0453684_0011762 3300044712 Bacteria 14591
821 Ga0453684_0027518 3300044712 Bacteria 8150
822 Ga0453684_0039023 3300044712 Bacteria 6477
823 Ga0453684_0143678 3300044712 Bacteria 2845
824 Ga0451576_0000471 3300045051 Bacteria 91500
825 Ga0451576_0005198 3300045051 Bacteria 16438
826 Ga0451576_0021687 3300045051 Bacteria 6978
827 Ga0451576_0135313 3300045051 Bacteria 2569
828 Ga0451576_0359059 3300045051 Bacteria 1526
829 Ga0495629_0014650 3300046459 Bacteria 5640
830 Ga0495594_0018424 3300046499 Bacteria 3697
831 Ga0495594_0025661 3300046499 Unclassified 3168
832 Ga0495594_0052839 3300046499 Bacteria 2237
833 Ga0495628_0302254 3300046516 Unclassified 1184
834 Ga0495628_0406239 3300046516 Bacteria 994
835 Ga0495652_0417177 3300046529 Bacteria 947
836 Ga0495640_0332069 3300046533 Unclassified 940
837 Ga0495586_0338789 3300046535 Bacteria 863
838 Ga0495598_0027179 3300046537 Bacteria 1576
839 Ga0495598_0161640 3300046537 Bacteria 788
840 Ga0495621_0000253 3300046539 Bacteria 12748
841 Ga0495633_0155955 3300046558 Bacteria 1054
842 Ga0495659_0017881 3300046664 Bacteria 2356
843 Ga0495599_0363725 3300046678 Bacteria 866
844 Ga0495647_0184952 3300046681 Bacteria 908
845 Ga0495658_0018821 3300046683 Bacteria 3597
846 Ga0495670_0254419 3300046691 Bacteria 937
847 Ga0495581_0010104 3300047315 Bacteria 5461
848 Ga0495636_0066656 3300047318 Bacteria 1531
849 Ga0495672_0000911 3300047320 Bacteria 30934
850 Ga0495676_0198153 3300047321 Bacteria 1397
851 Ga0495614_0080214 3300048089 Bacteria 1413
852 Ga0496101_0398909 3300048904 Bacteria 1083
853 Ga0496104_0076988 3300048907 Bacteria 3178
854 Ga0496104_0208295 3300048907 Bacteria 1867
855 Ga0496105_0886466 3300048908 Bacteria 673
856 Ga0496106_0308293 3300048909 Bacteria 1270
857 Ga0496106_0417224 3300048909 Bacteria 1079
858 Ga0496108_0082559 3300048911 Bacteria 2725
859 Ga0496108_0685324 3300048911 Bacteria 889
860 Ga0496109_0222921 3300048912 Unclassified 1773
861 Ga0496110_0035808 3300048913 Bacteria 4309
862 Ga0496112_0005329 3300048915 Bacteria 11101
863 Ga0496112_0005642 3300048915 Bacteria 10865
864 Ga0496112_0110221 3300048915 Bacteria 2723
865 Ga0496112_0435803 3300048915 Bacteria 1249
866 Ga0496113_0049333 3300048916 Bacteria 3134
867 Ga0496113_0462915 3300048916 Bacteria 1019
868 Ga0496114_0052718 3300048917 Bacteria 3389
869 Ga0501291_000488 3300049514 Bacteria 4616
870 Ga0501293_004272 3300049516 Bacteria 1123
871 Ga0501295_000527 3300049518 Bacteria 3586
872 Ga0501298_000073 3300049521 Bacteria 11007
873 Ga0501298_032825 3300049521 Bacteria 1026
874 Ga0501299_000048 3300049522 Bacteria 13201
875 Ga0501299_023155 3300049522 Unclassified 1150
876 Ga0501300_000939 3300049523 Bacteria 4450
877 Ga0501301_000833 3300049524 Bacteria 1917
878 Ga0501303_001510 3300049526 Bacteria 1739
879 Ga0501031_0021701 3300049568 Bacteria 4186
880 Ga0501031_0342664 3300049568 Unclassified 967
881 Ga0501033_0091133 3300049570 Bacteria 2230
882 Ga0501034_0468185 3300049571 Bacteria 1176
883 Ga0501036_0301083 3300049572 Bacteria 1341
884 Ga0501036_0341214 3300049572 Bacteria 1251
885 Ga0501036_0437191 3300049572 Unclassified 1090
886 Ga0501038_0254514 3300049574 Bacteria 1390
887 Ga0501039_0127983 3300049575 Unclassified 1993
888 Ga0501039_0458174 3300049575 Bacteria 1001
889 Ga0501039_0629334 3300049575 Unclassified 840
890 Ga0501040_0011021 3300049576 Bacteria 5910
891 Ga0501040_0013239 3300049576 Bacteria 5426
892 Ga0501040_0128933 3300049576 Bacteria 1778
893 Ga0501041_0018990 3300049577 Bacteria 4097
894 Ga0501041_0069816 3300049577 Bacteria 2156
895 Ga0501041_0113525 3300049577 Unclassified 1682
896 Ga0501041_0171110 3300049577 Bacteria 1359
897 Ga0501041_0173713 3300049577 Bacteria 1348
898 Ga0501042_0106405 3300049578 Bacteria 2019
899 Ga0501042_0197623 3300049578 Bacteria 1450
900 Ga0501042_0237533 3300049578 Bacteria 1315
901 Ga0501042_0245446 3300049578 Bacteria 1292
902 Ga0501046_0298905 3300049580 Bacteria 1176
903 Ga0501048_0064134 3300049582 Bacteria 2598
904 Ga0501048_0191872 3300049582 Bacteria 1448
905 Ga0501048_0197359 3300049582 Bacteria 1426
906 Ga0501048_0280676 3300049582 Bacteria 1184
907 Ga0501068_0018839 3300049584 Bacteria 4000
908 Ga0501071_0120294 3300049587 Bacteria 1946
909 Ga0501071_0305490 3300049587 Unclassified 1206
910 Ga0501072_0235406 3300049588 Bacteria 1458
911 Ga0501072_0556800 3300049588 Bacteria 905
912 Ga0501073_0002831 3300049589 Bacteria 13000
913 Ga0501074_0201538 3300049590 Bacteria 1418
914 Ga0501075_0035944 3300049591 Bacteria 3696
915 Ga0501075_0291361 3300049591 Unclassified 1243
916 Ga0501075_0413234 3300049591 Bacteria 1029
917 Ga0501076_0018458 3300049592 Bacteria 5318
918 Ga0501076_0107571 3300049592 Bacteria 2252
919 Ga0501076_0232805 3300049592 Bacteria 1506
920 Ga0501076_0242849 3300049592 Bacteria 1473
921 Ga0501076_0458420 3300049592 Unclassified 1050
922 Ga0501076_0464334 3300049592 Unclassified 1042
923 Ga0501076_0776991 3300049592 Bacteria 790
924 Ga0501077_0014054 3300049593 Bacteria 5022
925 Ga0501077_0025415 3300049593 Bacteria 3762
926 Ga0501077_0437545 3300049593 Unclassified 837
927 Ga0501199_000966 3300049650 Bacteria 2575
928 Ga0501202_002220 3300049652 Bacteria 3241
929 Ga0501202_102510 3300049652 Bacteria 699
930 Ga0501208_004521 3300049655 Bacteria 1644
931 Ga0501209_000634 3300049656 Bacteria 4353
932 Ga0501217_010982 3300049661 Bacteria 1996
933 Ga0501217_044275 3300049661 Bacteria 1143
934 Ga0501227_077089 3300049665 Bacteria 871
935 Ga0501233_001024 3300049668 Bacteria 4752
936 Ga0501235_005843 3300049669 Bacteria 2679
937 Ga0501236_025732 3300049670 Bacteria 901
938 Ga0501243_001231 3300049675 Bacteria 3669
939 Ga0501246_000121 3300049676 Bacteria 4745
940 Ga0501249_032973 3300049679 Bacteria 1159
941 Ga0501251_000290 3300049681 Bacteria 4440
942 Ga0501256_005709 3300049685 Bacteria 1104
943 Ga0501257_011113 3300049686 Bacteria 2052
944 Ga0501261_004095 3300049690 Bacteria 1793
945 Ga0501221_002583 3300049704 Bacteria 2986
946 Ga0501225_0020194 3300049705 Bacteria 1841
947 Ga0501229_000424 3300049706 Bacteria 4772
948 Ga0501234_000290 3300049707 Bacteria 7353
949 Ga0501079_0048048 3300049741 Bacteria 3293
950 Ga0501079_0089110 3300049741 Bacteria 2389
951 Ga0501079_0115525 3300049741 Bacteria 2086
952 Ga0501079_0486125 3300049741 Unclassified 970
953 Ga0501080_0062248 3300049742 Bacteria 3473
954 Ga0501080_0085095 3300049742 Bacteria 2938
955 Ga0501080_0872456 3300049742 Bacteria 786
956 Ga0501081_0090955 3300049743 Bacteria 2146
957 Ga0501081_0160934 3300049743 Bacteria 1618
958 Ga0501081_1037128 3300049743 Bacteria 620
959 Ga0501263_026085 3300049760 Bacteria 807
960 Ga0501264_000674 3300049761 Bacteria 4684
961 Ga0501266_001401 3300049763 Bacteria 3079
962 Ga0501278_001930 3300049774 Bacteria 1459
963 Ga0501279_002809 3300049775 Bacteria 2270
964 Ga0501281_00924 3300049777 Bacteria 2474
965 Ga0501283_004328 3300049779 Bacteria 1914
966 Ga0501283_007596 3300049779 Bacteria 1547
967 Ga0501045_0258946 3300049824 Bacteria 1295
968 Ga0501045_0621411 3300049824 Unclassified 799
969 nmdc:mga05p37_1214327_c1 3300050507 Bacteria 778
970 nmdc:mga05p37_127165_c1 3300050507 Bacteria 3129
971 nmdc:mga05p37_156259_c1 3300050507 Bacteria 2787
972 nmdc:mga05p37_176866_c1 3300050507 Bacteria 2599
973 nmdc:mga05p37_193021_c1 3300050507 Bacteria 2471
974 nmdc:mga05p37_2169_c1 3300050507 Bacteria 22888
975 nmdc:mga05p37_30866_c1 3300050507 Bacteria 6541
976 nmdc:mga05p37_35207_c1 3300050507 Bacteria 6138
977 nmdc:mga05p37_376704_c1 3300050507 Bacteria 1664
978 nmdc:mga05p37_411232_c2 3300050507 Bacteria 1182
979 nmdc:mga05p37_53643_c2 3300050507 Bacteria 4487
980 nmdc:mga05p37_6745_c1 3300050507 Bacteria 13538
981 nmdc:mga05p37_74645_c1 3300050507 Bacteria 4174
982 nmdc:mga05p37_74813_c1 3300050507 Bacteria 4169
983 nmdc:mga05p37_75048_c1 3300050507 Bacteria 4162
984 nmdc:mga05p37_760502_c1 3300050507 Unclassified 1066
985 nmdc:mga09592_123314_c1 3300050508 Bacteria 2227
986 nmdc:mga09592_142368_c1 3300050508 Bacteria 2067
987 nmdc:mga09592_160271_c1 3300050508 Bacteria 1943
988 nmdc:mga09592_397043_c1 3300050508 Bacteria 1192
989 nmdc:mga09592_477817_c1 3300050508 Bacteria 1074
990 nmdc:mga09592_4935_c1 3300050508 Bacteria 10818
991 nmdc:mga09592_57742_c1 3300050508 Bacteria 3281
992 nmdc:mga0qj67_116349_c1 3300050509 Bacteria 2160
993 nmdc:mga0qj67_212178_c1 3300050509 Bacteria 1572
994 nmdc:mga0qj67_256855_c1 3300050509 Bacteria 1418
995 nmdc:mga0qj67_8816_c1 3300050509 Bacteria 7485
996 nmdc:mga06r32_1105884_c1 3300050510 Bacteria 741
997 nmdc:mga06r32_1114373_c1 3300050510 Unclassified 738
998 nmdc:mga06r32_1232812_c1 3300050510 Unclassified 693
999 nmdc:mga06r32_185062_c1 3300050510 Bacteria 2069
1000 nmdc:mga06r32_55337_c1 3300050510 Bacteria 3805
1001 nmdc:mga06r32_58087_c1 3300050510 Bacteria 3718
1002 nmdc:mga08y16_1340_c1 3300050511 Bacteria 24552
1003 nmdc:mga08y16_1540_c1 3300050511 Bacteria 23195
1004 nmdc:mga08y16_159603_c1 3300050511 Bacteria 2343
1005 nmdc:mga08y16_2229_c1 3300050511 Bacteria 19859
1006 nmdc:mga08y16_244510_c1 3300050511 Bacteria 1854
1007 nmdc:mga08y16_2595_c1 3300050511 Bacteria 18556
1008 nmdc:mga08y16_45702_c1 3300050511 Bacteria 4587
1009 nmdc:mga08y16_55323_c1 3300050511 Bacteria 4147
1010 nmdc:mga08y16_7280_c1 3300050511 Bacteria 11614
1011 nmdc:mga08y16_75653_c1 3300050511 Bacteria 3510
1012 nmdc:mga0n895_108093_c1 3300050512 Unclassified 2796
1013 nmdc:mga0n895_14984_c1 3300050512 Bacteria 7062
1014 nmdc:mga0n895_1500_c1 3300050512 Bacteria 17509
1015 nmdc:mga0n895_18994_c1 3300050512 Bacteria 6377
1016 nmdc:mga0n895_223446_c1 3300050512 Bacteria 1911
1017 nmdc:mga0n895_291448_c1 3300050512 Bacteria 1655
1018 nmdc:mga0n895_308498_c1 3300050512 Bacteria 1604
1019 nmdc:mga0n895_378447_c1 3300050512 Unclassified 1433
1020 nmdc:mga0n895_408790_c1 3300050512 Bacteria 1373
1021 nmdc:mga0n895_702168_c1 3300050512 Bacteria 1007
1022 nmdc:mga0n895_95_c1 3300050512 Bacteria 52030
1023 nmdc:mga0rr50_102750_c1 3300050513 Bacteria 2249
1024 nmdc:mga0rr50_105623_c1 3300050513 Bacteria 2221
1025 nmdc:mga0rr50_13491_c1 3300050513 Bacteria 5321
1026 nmdc:mga0rr50_17771_c1 3300050513 Bacteria 4759
1027 nmdc:mga0rr50_193363_c1 3300050513 Bacteria 1669
1028 nmdc:mga0rr50_283931_c1 3300050513 Bacteria 1382
1029 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
1030 nmdc:mga0rr50_4559_c1 3300050513 Bacteria 8153
1031 nmdc:mga0rr50_46608_c1 3300050513 Bacteria 3192
1032 nmdc:mga0rr50_788376_c1 3300050513 Bacteria 811
1033 nmdc:mga0rr50_864788_c1 3300050513 Bacteria 771
1034 nmdc:mga08x19_11377_c1 3300050514 Bacteria 5356
1035 nmdc:mga08x19_121_c1 3300050514 Bacteria 69968
1036 nmdc:mga08x19_28970_c1 3300050514 Bacteria 3472
1037 nmdc:mga08x19_55142_c1 3300050514 Bacteria 2561
1038 nmdc:mga08x19_58793_c1 3300050514 Bacteria 2488
1039 nmdc:mga08x19_62829_c1 3300050514 Bacteria 2408
1040 nmdc:mga08x19_91733_c1 3300050514 Bacteria 2005
1041 nmdc:mga0a205_1053_c2 3300050515 Bacteria 7492
1042 nmdc:mga0a205_33911_c1 3300050515 Bacteria 4896
1043 nmdc:mga0a205_35961_c1 3300050515 Bacteria 4757
1044 nmdc:mga0a205_384820_c1 3300050515 Bacteria 1268
1045 nmdc:mga0a205_431012_c1 3300050515 Bacteria 1180
1046 nmdc:mga0a205_476_c1 3300050515 Bacteria 31298
1047 nmdc:mga0a205_538846_c1 3300050515 Unclassified 1023
1048 nmdc:mga0a205_53893_c1 3300050515 Bacteria 3882
1049 nmdc:mga0a205_552440_c1 3300050515 Bacteria 1007
1050 nmdc:mga0a205_5677_c1 3300050515 Bacteria 11242
1051 nmdc:mga0a205_6503_c1 3300050515 Bacteria 10566
1052 nmdc:mga0a205_78431_c1 3300050515 Unclassified 3191
1053 Ga0495601_0009411 3300053077 Bacteria 5778
1054 Ga0495601_0147173 3300053077 Bacteria 1537
1055 Ga0495619_0487330 3300053085 Unclassified 848
1056 Ga0500555_005302 3300053103 Bacteria 3657
1057 Ga0501084_0054920 3300054114 Bacteria 3332
1058 Ga0590075_004459 3300059424 Bacteria 3316
1059 Ga0501082_0069283 3300060353 Bacteria 3037
1060 Ga0501082_0381461 3300060353 Bacteria 1230
1061 Ga0501082_0471300 3300060353 Bacteria 1097
1062 Ga0501082_0644367 3300060353 Unclassified 927
1063 Ga0501082_0703868 3300060353 Bacteria 884
1064 Ga0530510_0066955 3300061734 Bacteria 2605
1065 Ga0530510_0288448 3300061734 Bacteria 1227
1066 Ga0501073_0055066
1067 JGI24751J29686_10021274
1068 Ga0065704_10015486
1069 Ga0065704_10140576
1070 Ga0065712_10087465
1071 Ga0065712_10128456
1072 Ga0065712_10187895
1073 Ga0065712_10276063
1074 Ga0065715_10022852
1075 Ga0065715_10142070
1076 Ga0065707_10137543
1077 Ga0065707_10338296
1078 Ga0070676_10007566
1079 Ga0070676_10151114
1080 Ga0070676_10427478
1081 Ga0070683_100013326
1082 Ga0070683_100169018
1083 Ga0070683_100529077
1084 Ga0070690_100000336
1085 Ga0070690_100004162
1086 Ga0070690_100035498
1087 Ga0070690_100050976
1088 Ga0070670_100002699
1089 Ga0070670_100035231
1090 Ga0070670_100119293
1091 Ga0070670_100627597
1092 Ga0070670_100640967
1093 Ga0070677_10005848
1094 Ga0070677_10143361
1095 Ga0068869_100032669
1096 Ga0068869_100283775
1097 Ga0070666_10007593
1098 Ga0070666_10008555
1099 Ga0070666_10232264
1100 Ga0070680_100167068
1101 Ga0070680_100235862
1102 Ga0068868_100061553
1103 Ga0068868_100076743
1104 Ga0068868_100130709
1105 Ga0068868_100200115
1106 Ga0068868_100300052
1107 Ga0068868_100392814
1108 Ga0070660_100012311
1109 Ga0070660_100104112
1110 Ga0070689_100000066
1111 Ga0070689_100089945
1112 Ga0070689_100095286
1113 Ga0070689_100137192
1114 Ga0070689_100176621
1115 Ga0070689_100324812
1116 Ga0070689_100460076
1117 Ga0070689_100630372
1118 Ga0070687_100232773
1119 Ga0070661_100018875
1120 Ga0070692_10001597
1121 Ga0070692_10035483
1122 Ga0070668_100275499
1123 Ga0070668_100338028
1124 Ga0070669_100001454
1125 Ga0070669_100012223
1126 Ga0070669_100016030
1127 Ga0070669_100081558
1128 Ga0070669_100105804
1129 Ga0070669_100112110
1130 Ga0070669_100341127
1131 Ga0070675_100000147
1132 Ga0070675_100003888
1133 Ga0070675_100008321
1134 Ga0070675_100048236
1135 Ga0070675_100051067
1136 Ga0070675_100247922
1137 Ga0070675_100356514
1138 Ga0070675_100390088
1139 Ga0070675_100668551
1140 Ga0070671_100007961
1141 Ga0070671_100032528
1142 Ga0070671_100164771
1143 Ga0070674_100002716
1144 Ga0070674_100064531
1145 Ga0070674_100814911
1146 Ga0070673_100000103
1147 Ga0070673_100003965
1148 Ga0070673_100009418
1149 Ga0070673_100713120
1150 Ga0070688_100001477
1151 Ga0070688_100003218
1152 Ga0070688_100023138
1153 Ga0070688_100055066
1154 Ga0070688_100065786
1155 Ga0070688_100105296
1156 Ga0070688_100416269
1157 Ga0070688_100623179
1158 Ga0070659_100349461
1159 Ga0070659_100375231
1160 Ga0070667_100083176
1161 Ga0070667_100325363
1162 Ga0070703_10031065
1163 Ga0070703_10040636
1164 Ga0070703_10232710
1165 Ga0070709_10132027
1166 Ga0070714_100253206
1167 Ga0070710_10027928
1168 Ga0070701_10000020
1169 Ga0070701_10051314
1170 Ga0070701_10138561
1171 Ga0070701_10155126
1172 Ga0070701_10286350
1173 Ga0070701_10524117
1174 Ga0070711_100439564
1175 Ga0070711_100465652
1176 Ga0070705_100038491
1177 Ga0070705_100042809
1178 Ga0070705_100069953
1179 Ga0070705_100186311
1180 Ga0070705_100401137
1181 Ga0070700_100000818
1182 Ga0070700_100004171
1183 Ga0070700_100004954
1184 Ga0070700_100143607
1185 Ga0070700_100694100
1186 Ga0070700_100776910
1187 Ga0070694_100047946
1188 Ga0070694_100054370
1189 Ga0070694_100106143
1190 Ga0070694_100116412
1191 Ga0070694_100397414
1192 Ga0070708_100022317
1193 Ga0070708_100101619
1194 Ga0070708_100260591
1195 Ga0070708_100422162
1196 Ga0070708_100905832
1197 Ga0070663_100009569
1198 Ga0070663_100032089
1199 Ga0070678_100002436
1200 Ga0070678_100016979
1201 Ga0070678_100032871
1202 Ga0070678_100055019
1203 Ga0070678_100071199
1204 Ga0070678_100137887
1205 Ga0070678_101014404
1206 Ga0070662_100027204
1207 Ga0070662_100100568
1208 Ga0070662_100276377
1209 Ga0070662_100989909
1210 Ga0070681_10014199
1211 Ga0070681_10073223
1212 Ga0070681_10129868
1213 Ga0068867_100001096
1214 Ga0068867_100002876
1215 Ga0068867_100027704
1216 Ga0068867_100093506
1217 Ga0068867_100094484
1218 Ga0068867_100345586
1219 Ga0068867_100383805
1220 Ga0068867_101115018
1221 Ga0070685_10000069
1222 Ga0070685_10019371
1223 Ga0070685_10031005
1224 Ga0070685_10062750
1225 Ga0070685_10139038
1226 Ga0070685_10165941
1227 Ga0070685_10167642
1228 Ga0070706_100096995
1229 Ga0070706_100144241
1230 Ga0070706_100631082
1231 Ga0070707_100000021
1232 Ga0070707_100038006
1233 Ga0070707_100041900
1234 Ga0070707_100069599
1235 Ga0070707_100669326
1236 Ga0070698_100029698
1237 Ga0070698_100196500
1238 Ga0070698_100289952
1239 Ga0070699_100001737
1240 Ga0070699_100002012
1241 Ga0070699_100037057
1242 Ga0070699_100053591
1243 Ga0070699_100218236
1244 Ga0070699_100335870
1245 Ga0070679_100171169
1246 Ga0070684_100768542
1247 Ga0070697_100048178
1248 Ga0070697_100061083
1249 Ga0070697_100139549
1250 Ga0070697_100178419
1251 Ga0070697_100538973
1252 Ga0068853_100459082
1253 Ga0070672_100002045
1254 Ga0070672_100011300
1255 Ga0070672_100045389
1256 Ga0070672_100093050
1257 Ga0070672_100136771
1258 Ga0070672_100151381
1259 Ga0070672_100227374
1260 Ga0070686_100000100
1261 Ga0070686_100002508
1262 Ga0070686_100022866
1263 Ga0070686_100040570
1264 Ga0070686_100118755
1265 Ga0070695_100005877
1266 Ga0070695_100050017
1267 Ga0070695_100063731
1268 Ga0070695_100189390
1269 Ga0070695_100575094
1270 Ga0070695_100799634
1271 Ga0070696_100002986
1272 Ga0070696_100003911
1273 Ga0070696_100011890
1274 Ga0070696_100073659
1275 Ga0070696_100101272
1276 Ga0070696_100190801
1277 Ga0070696_100250978
1278 Ga0070696_100259553
1279 Ga0070693_100169167
1280 Ga0070665_100340116
1281 Ga0070665_100422305
1282 Ga0070665_100470014
1283 Ga0070704_100003197
1284 Ga0070704_100008135
1285 Ga0070704_100009518
1286 Ga0070704_100012684
1287 Ga0070704_100040734
1288 Ga0070704_100139194
1289 Ga0070704_100175606
1290 Ga0070704_100187522
1291 Ga0070704_100631817
1292 Ga0070704_100708027
1293 Ga0068855_100098552
1294 Ga0068855_100112064
1295 Ga0070664_100000584
1296 Ga0070664_100013313
1297 Ga0070664_100029223
1298 Ga0070664_100091172
1299 Ga0070664_100107093
1300 Ga0070664_100447347
1301 Ga0070664_100590851
1302 Ga0068857_100020770
1303 Ga0068854_100174919
1304 Ga0070702_100023978
1305 Ga0070702_100116927
1306 Ga0070702_100432589
1307 Ga0068852_101377789
1308 Ga0068859_100004613
1309 Ga0068859_100051697
1310 Ga0068859_100095636
1311 Ga0068859_100174261
1312 Ga0068859_100343076
1313 Ga0068859_100481130
1314 Ga0068864_100008151
1315 Ga0068864_100029037
1316 Ga0068864_100038432
1317 Ga0068864_100111730
1318 Ga0068864_100177764
1319 Ga0068864_100471794
1320 Ga0068866_10002332
1321 Ga0068866_10202778
1322 Ga0068861_100005416
1323 Ga0068861_100045160
1324 Ga0068861_100053791
1325 Ga0068861_100253404
1326 Ga0068861_100454974
1327 Ga0068861_100685254
1328 Ga0068870_10001025
1329 Ga0068870_10006146
1330 Ga0068863_100002234
1331 Ga0068863_100165117
1332 Ga0068863_100168822
1333 Ga0068858_100001888
1334 Ga0068858_100030600
1335 Ga0068858_100038117
1336 Ga0068858_100126799
1337 Ga0068858_100292889
1338 Ga0068858_100833859
1339 Ga0068858_100986190
1340 Ga0068860_100033522
1341 Ga0068860_100033985
1342 Ga0068860_100054885
1343 Ga0068860_100066357
1344 Ga0068860_100484848
1345 Ga0068862_100006477
1346 Ga0068862_100018207
1347 Ga0068862_100030874
1348 Ga0068862_100042813
1349 Ga0068862_100218963
1350 Ga0081455_10000786
1351 Ga0081455_10214401
1352 Ga0081539_10146522
1353 Ga0070715_10015855
1354 Ga0070716_100206208
1355 Ga0070716_100220732
1356 Ga0070716_100514022
1357 Ga0070716_100639853
1358 Ga0070712_100135942
1359 Ga0097621_100001601
1360 Ga0097621_100007328
1361 Ga0097621_100023648
1362 Ga0097621_100056007
1363 Ga0097621_100086311
1364 Ga0097621_100091837
1365 Ga0068871_100001107
1366 Ga0068871_100010328
1367 Ga0068871_100026278
1368 Ga0068871_100033300
1369 Ga0068871_100193809
1370 Ga0068871_100340182
1371 Ga0068871_100352776
1372 Ga0075428_100012493
1373 Ga0075428_100018081
1374 Ga0075428_100037061
1375 Ga0075428_100055313
1376 Ga0075428_100066734
1377 Ga0075428_100109374
1378 Ga0075428_100388623
1379 Ga0075428_100565104
1380 Ga0075430_100001196
1381 Ga0075430_100003466
1382 Ga0075430_100006133
1383 Ga0075430_100009586
1384 Ga0075430_100180315
1385 Ga0075430_100700891
1386 Ga0075431_100028775
1387 Ga0075431_100073904
1388 Ga0075431_100111492
1389 Ga0075431_100177222
1390 Ga0075431_100535423
1391 Ga0075431_101174045
1392 Ga0075433_10000936
1393 Ga0075433_10001275
1394 Ga0075433_10013705
1395 Ga0075433_10067320
1396 Ga0075433_10110458
1397 Ga0075433_10129334
1398 Ga0075433_10338702
1399 Ga0075433_10381076
1400 Ga0075433_10492670
1401 Ga0075433_10540806
1402 Ga0075434_100000049
1403 Ga0075434_100011998
1404 Ga0075434_100021443
1405 Ga0075434_100025831
1406 Ga0075434_100046934
1407 Ga0075434_100047314
1408 Ga0075434_100132783
1409 Ga0075434_100187017
1410 Ga0075434_100634562
1411 Ga0075429_100001236
1412 Ga0075429_100018761
1413 Ga0075429_100044586
1414 Ga0075429_100161158
1415 Ga0075429_100213590
1416 Ga0075429_100215362
1417 Ga0075429_100425496
1418 Ga0068865_100086899
1419 Ga0068865_100266952
1420 Ga0068865_100339852
1421 Ga0075436_100000420
1422 Ga0075436_100019413
1423 Ga0075436_100019739
1424 Ga0075436_100025325
1425 Ga0075436_100037192
1426 Ga0075436_100322257
1427 Ga0097620_100004613
1428 Ga0097620_100051695
1429 Ga0097620_100095631
1430 Ga0097620_100174262
1431 Ga0097620_100343077
1432 Ga0097620_100481101
1433 Ga0075435_100000059
1434 Ga0075435_100004605
1435 Ga0075435_100005562
1436 Ga0075435_100013234
1437 Ga0075435_100057562
1438 Ga0075435_100154261
1439 Ga0075435_100233022
1440 Ga0075435_100287762
1441 Ga0075435_100318908
1442 Ga0111539_10000326
1443 Ga0111539_10004673
1444 Ga0111539_10004769
1445 Ga0111539_10007551
1446 Ga0111539_10010427
1447 Ga0111539_10017167
1448 Ga0111539_10042960
1449 Ga0111539_10054412
1450 Ga0111539_10057964
1451 Ga0111539_10078245
1452 Ga0111539_10123247
1453 Ga0111539_10621651
1454 Ga0111539_10646306
1455 Ga0105245_10267491
1456 Ga0105247_10003020
1457 Ga0105247_10010076
1458 Ga0105247_10270811
1459 Ga0114129_10002862
1460 Ga0114129_10004893
1461 Ga0114129_10006748
1462 Ga0114129_10008062
1463 Ga0114129_10018292
1464 Ga0114129_10027396
1465 Ga0114129_10031782
1466 Ga0114129_10038284
1467 Ga0114129_10049334
1468 Ga0114129_10056630
1469 Ga0114129_10063676
1470 Ga0114129_10082166
1471 Ga0114129_10094153
1472 Ga0114129_10126682
1473 Ga0114129_10204942
1474 Ga0114129_10252394
1475 Ga0114129_10706218
1476 Ga0114129_10753893
1477 Ga0114129_10787619
1478 Ga0114129_10951071
1479 Ga0105243_10000238
1480 Ga0105243_10025094
1481 Ga0105243_10872003
1482 Ga0105242_10001243
1483 Ga0105242_10004726
1484 Ga0105242_10007339
1485 Ga0105242_10098152
1486 Ga0105242_10259609
1487 Ga0105242_10847090
1488 Ga0105248_10013509
1489 Ga0105248_10017801
1490 Ga0105248_10056753
1491 Ga0105248_10081647
1492 Ga0105248_10126720
1493 Ga0105248_10139979
1494 Ga0105248_10151210
1495 Ga0105248_10271331
1496 Ga0105248_10811528
1497 Ga0105248_11395260
1498 Ga0105238_10686821
1499 Ga0105249_10051517
1500 Ga0105249_10269044
1501 Ga0105249_11078758
1502 Ga0157371_10184330
1503 Ga0157370_10640920
1504 Ga0157369_10337892
1505 Ga0157374_10064849
1506 Ga0157374_10496237
1507 Ga0157374_10504422
1508 Ga0157374_10554208
1509 Ga0157378_10002332
1510 Ga0157378_10174325
1511 Ga0157378_10659056
1512 Ga0163162_10102935
1513 Ga0163162_10465786
1514 Ga0163162_11271088
1515 Ga0157375_10022418
1516 Ga0157375_10050333
1517 Ga0157375_10089852
1518 Ga0157375_10115922
1519 Ga0157375_10212801
1520 Ga0157375_10535202
1521 Ga0163163_10401399
1522 Ga0157380_10002955
1523 Ga0157380_10003616
1524 Ga0157380_10010138
1525 Ga0157380_10029391
1526 Ga0157380_10104200
1527 Ga0157380_10106662
1528 Ga0157380_10197607
1529 Ga0157380_10265843
1530 Ga0157380_10319912
1531 Ga0157380_10486371
1532 Ga0157380_10791525
1533 Ga0157380_11151838
1534 Ga0157380_11331560
1535 Ga0157377_10018169
1536 Ga0157377_10018864
1537 Ga0157377_10047355
1538 Ga0157377_10095111
1539 Ga0157377_10248787
1540 Ga0157379_10009913
1541 Ga0157379_10017365
1542 Ga0157379_10067559
1543 Ga0157376_10048960
1544 Ga0157376_10160959
1545 Ga0157376_10431110
1546 Ga0157376_10455653
1547 Ga0157376_10650086
1548 Ga0163161_10031367
1549 Ga0163161_10161833
1550 Ga0207697_10000575
1551 Ga0207682_10001469
1552 Ga0207682_10011353
1553 Ga0207682_10030408
1554 Ga0207682_10033322
1555 Ga0207682_10129069
1556 Ga0207692_10035866
1557 Ga0207692_10060517
1558 Ga0207642_10017132
1559 Ga0207642_10110274
1560 Ga0207710_10003937
1561 Ga0207710_10047460
1562 Ga0207710_10365696
1563 Ga0207688_10000078
1564 Ga0207688_10221170
1565 Ga0207680_10051609
1566 Ga0207680_10765267
1567 Ga0207685_10011619
1568 Ga0207685_10107174
1569 Ga0207645_10002104
1570 Ga0207645_10002597
1571 Ga0207645_10007763
1572 Ga0207645_10128802
1573 Ga0207643_10000706
1574 Ga0207643_10084543
1575 Ga0207684_10000737
1576 Ga0207684_10031826
1577 Ga0207684_10142894
1578 Ga0207684_10296558
1579 Ga0207684_10681152
1580 Ga0207654_10091248
1581 Ga0207707_10002734
1582 Ga0207707_10070129
1583 Ga0207693_10013276
1584 Ga0207663_10870600
1585 Ga0207660_10004716
1586 Ga0207660_10037729
1587 Ga0207660_10142675
1588 Ga0207662_10001063
1589 Ga0207662_10001208
1590 Ga0207662_10140373
1591 Ga0207662_10333653
1592 Ga0207662_10483314
1593 Ga0207657_10060146
1594 Ga0207657_10093048
1595 Ga0207649_10018165
1596 Ga0207649_10029456
1597 Ga0207652_10124757
1598 Ga0207646_10000231
1599 Ga0207646_10000547
1600 Ga0207646_10127744
1601 Ga0207646_10611216
1602 Ga0207681_10023929
1603 Ga0207681_10064590
1604 Ga0207681_10095334
1605 Ga0207681_10162286
1606 Ga0207681_10194009
1607 Ga0207694_10130066
1608 Ga0207650_10007478
1609 Ga0207650_10070542
1610 Ga0207650_10114607
1611 Ga0207650_10150803
1612 Ga0207650_10261694
1613 Ga0207650_10601054
1614 Ga0207659_10000075
1615 Ga0207659_10000939
1616 Ga0207659_10002741
1617 Ga0207659_10010800
1618 Ga0207659_10132383
1619 Ga0207659_10168017
1620 Ga0207659_10270178
1621 Ga0207659_10289572
1622 Ga0207659_10635974
1623 Ga0207659_10870072
1624 Ga0207687_10057635
1625 Ga0207700_11125101
1626 Ga0207644_10096143
1627 Ga0207644_10102458
1628 Ga0207644_10107568
1629 Ga0207706_10005586
1630 Ga0207706_10026033
1631 Ga0207706_10402085
1632 Ga0207706_10403920
1633 Ga0207706_10483263
1634 Ga0207706_10672387
1635 Ga0207686_10004046
1636 Ga0207686_10015028
1637 Ga0207686_10032259
1638 Ga0207686_10237243
1639 Ga0207709_10005269
1640 Ga0207670_10000098
1641 Ga0207670_10018572
1642 Ga0207670_10018961
1643 Ga0207670_10064879
1644 Ga0207670_10114531
1645 Ga0207670_10153793
1646 Ga0207670_10281125
1647 Ga0207669_10038016
1648 Ga0207669_10095631
1649 Ga0207669_10377503
1650 Ga0207669_10411894
1651 Ga0207704_10006357
1652 Ga0207704_10145885
1653 Ga0207704_10173104
1654 Ga0207704_10883530
1655 Ga0207665_10129988
1656 Ga0207665_10135890
1657 Ga0207665_10294556
1658 Ga0207691_10000209
1659 Ga0207691_10008047
1660 Ga0207691_10016035
1661 Ga0207691_10030425
1662 Ga0207691_10064712
1663 Ga0207691_10200556
1664 Ga0207691_10374381
1665 Ga0207691_10569750
1666 Ga0207691_10713245
1667 Ga0207711_10007687
1668 Ga0207711_10076709
1669 Ga0207711_10174978
1670 Ga0207711_10691119
1671 Ga0207711_10825436
1672 Ga0207689_10003806
1673 Ga0207689_10004341
1674 Ga0207689_10009073
1675 Ga0207689_10111980
1676 Ga0207689_10182618
1677 Ga0207689_10578185
1678 Ga0207661_10053538
1679 Ga0207661_10723134
1680 Ga0207679_10002301
1681 Ga0207679_10003057
1682 Ga0207679_10004433
1683 Ga0207679_10024651
1684 Ga0207679_10285976
1685 Ga0207667_10175780
1686 Ga0207651_10000027
1687 Ga0207651_10001655
1688 Ga0207651_10139926
1689 Ga0207651_10233236
1690 Ga0207651_10580045
1691 Ga0207712_10411109
1692 Ga0207668_10203382
1693 Ga0207668_10804354
1694 Ga0207640_10620184
1695 Ga0207640_10896771
1696 Ga0207658_10011910
1697 Ga0207658_10092466
1698 Ga0207658_10374305
1699 Ga0207677_10232312
1700 Ga0207677_10394383
1701 Ga0207677_10423021
1702 Ga0207703_10010388
1703 Ga0207703_10015685
1704 Ga0207703_10053921
1705 Ga0207703_10236358
1706 Ga0207703_10326843
1707 Ga0207678_10011052
1708 Ga0207678_10029975
1709 Ga0207708_10000853
1710 Ga0207708_10001575
1711 Ga0207708_10002902
1712 Ga0207708_10004792
1713 Ga0207708_10320605
1714 Ga0207708_10337523
1715 Ga0207708_10441513
1716 Ga0207708_10590216
1717 Ga0207641_10005189
1718 Ga0207641_10029000
1719 Ga0207641_10147973
1720 Ga0207641_10465013
1721 Ga0207641_10540184
1722 Ga0207641_10718470
1723 Ga0207641_10781211
1724 Ga0207641_11090744
1725 Ga0207648_10000543
1726 Ga0207648_10001158
1727 Ga0207648_10004219
1728 Ga0207648_10005943
1729 Ga0207648_10203058
1730 Ga0207648_10276221
1731 Ga0207648_10549894
1732 Ga0207648_10637825
1733 Ga0207676_10009537
1734 Ga0207676_10020875
1735 Ga0207676_10070443
1736 Ga0207676_10316048
1737 Ga0207676_10648925
1738 Ga0207674_10029412
1739 Ga0207674_10426578
1740 Ga0207675_100004884
1741 Ga0207675_100025879
1742 Ga0207675_100126472
1743 Ga0207675_100992494
1744 Ga0207683_10001107
1745 Ga0207683_10002196
1746 Ga0207683_10011362
1747 Ga0207683_10017195
1748 Ga0207683_10031021
1749 Ga0207683_10075220
1750 Ga0207683_10116045
1751 Ga0207683_10187113
1752 Ga0207698_10304153
1753 Ga0209969_1000120
1754 Ga0209967_1000144
1755 Ga0209967_1003541
1756 Ga0209981_1000003
1757 Ga0209996_1000058
1758 Ga0209984_1000444
1759 Ga0209984_1010133
1760 Ga0210000_1000024
1761 Ga0209995_1000087
1762 Ga0209995_1018580
1763 Ga0209968_1000019
1764 Ga0209999_1000055
1765 Ga0209982_1001564
1766 Ga0209970_1000013
1767 Ga0210002_1000024
1768 Ga0209983_1001530
1769 Ga0209983_1028790
1770 Ga0209971_1000232
1771 Ga0209966_1000331
1772 Ga0209998_10000094
1773 Ga0209998_10095011
1774 Ga0209974_10001696
1775 Ga0209974_10028942
1776 Ga0209974_10150074
1777 Ga0207428_10000089
1778 Ga0207428_10000529
1779 Ga0207428_10005145
1780 Ga0207428_10006577
1781 Ga0207428_10009135
1782 Ga0207428_10036379
1783 Ga0207428_10041262
1784 Ga0207428_10087031
1785 Ga0207428_10096747
1786 Ga0268266_10261906
1787 Ga0268266_10356310
1788 Ga0268266_10773398
1789 Ga0268265_10014428
1790 Ga0268265_10033808
1791 Ga0268265_10047123
1792 Ga0268265_10468822
1793 Ga0268265_10779926
1794 Ga0268265_10886111
1795 Ga0268264_10042594
1796 Ga0268264_10058684
1797 Ga0268264_10073918
1798 Ga0265332_10114114
1799 Ga0307408_100013769
1800 Ga0307408_100173814
1801 Ga0307408_100278417
1802 Ga0307405_10586391
1803 Ga0307413_10596162
1804 Ga0307410_10296321
1805 Ga0307412_10034734
1806 Ga0307409_100370716
1807 Ga0307416_100052642
1808 Ga0307416_100105257
1809 Ga0307416_100138240
1810 Ga0307416_100390432
1811 Ga0307416_100497949
1812 Ga0307416_100656294
1813 Ga0307414_10050348
1814 Ga0307411_10474862
1815 Ga0307415_100077488
1816 Ga0307415_100126033
1817 Ga0307415_100358610
1818 Ga0373958_0034645
1819 Ga0373958_0042935
1820 Ga0373926_0030225
1821 Ga0373926_0084736
1822 Ga0373940_0106412
1823 Ga0373949_0111813
1824 Ga0373949_0133286
1825 Ga0373952_0012701
1826 Ga0373923_0236918
1827 Ga0373939_0177465
1828 Ga0373941_0098558
1829 Ga0373941_0149254
1830 Ga0373945_0023198
1831 Ga0373960_0009345
1832 Ga0373943_0223882
1833 Ga0373931_0009512
1834 Ga0373927_0525940
1835 Ga0373933_0048168
1836 Ga0373937_0086289
1837 Ga0373937_0103302
1838 Ga0373937_0285603
1839 Ga0373937_0631625
1840 Ga0373937_0631680
1841 Ga0373925_0027581
1842 Ga0373925_0552846
1843 Ga0400490_10325
1844 Ga0400491_11348
1845 Ga0400489_76132
1846 Ga0439438_058205
1847 Ga0439447_010933
1848 Ga0439453_0003992
1849 Ga0439461_0035251
1850 Ga0451853_1940769
1851 Ga0451853_2329500
1852 Ga0439433_0017488
1853 Ga0439441_003072
1854 Ga0439448_0035817
1855 Ga0439432_035110
1856 Ga0439450_000289
1857 Ga0439450_019708
1858 Ga0439450_125750
1859 Ga0439451_016701
1860 Ga0439452_013979
1861 Ga0439456_015300
1862 Ga0439456_056997
1863 Ga0450923_016385
1864 Ga0450923_065484
1865 Ga0450896_002429
1866 Ga0450896_015549
1867 Ga0439446_0045893
1868 Ga0439446_0068646
1869 Ga0450909_027822
1870 Ga0439434_0003138
1871 Ga0439434_0110659
1872 Ga0439434_0115256
1873 Ga0439435_0021616
1874 Ga0439435_0185312
1875 Ga0439460_0076306
1876 Ga0451577_0000099
1877 Ga0451577_0010642
1878 Ga0451577_0035953
1879 Ga0451577_0039088
1880 Ga0451577_0091136
1881 Ga0451577_0179114
1882 Ga0439440_0063986
1883 Ga0453683_0105451
1884 Ga0453684_0000350
1885 Ga0453684_0011762
1886 Ga0453684_0027518
1887 Ga0453684_0039023
1888 Ga0453684_0143678
1889 Ga0451576_0000471
1890 Ga0451576_0005198
1891 Ga0451576_0021687
1892 Ga0451576_0135313
1893 Ga0451576_0359059
1894 Ga0495629_0014650
1895 Ga0495594_0018424
1896 Ga0495594_0025661
1897 Ga0495594_0052839
1898 Ga0495628_0302254
1899 Ga0495628_0406239
1900 Ga0495652_0417177
1901 Ga0495640_0332069
1902 Ga0495586_0338789
1903 Ga0495598_0027179
1904 Ga0495598_0161640
1905 Ga0495621_0000253
1906 Ga0495633_0155955
1907 Ga0495659_0017881
1908 Ga0495599_0363725
1909 Ga0495647_0184952
1910 Ga0495658_0018821
1911 Ga0495670_0254419
1912 Ga0495581_0010104
1913 Ga0495636_0066656
1914 Ga0495672_0000911
1915 Ga0495676_0198153
1916 Ga0495614_0080214
1917 Ga0496101_0398909
1918 Ga0496104_0076988
1919 Ga0496104_0208295
1920 Ga0496105_0886466
1921 Ga0496106_0308293
1922 Ga0496106_0417224
1923 Ga0496108_0082559
1924 Ga0496108_0685324
1925 Ga0496109_0222921
1926 Ga0496110_0035808
1927 Ga0496112_0005329
1928 Ga0496112_0005642
1929 Ga0496112_0110221
1930 Ga0496112_0435803
1931 Ga0496113_0049333
1932 Ga0496113_0462915
1933 Ga0496114_0052718
1934 Ga0501291_000488
1935 Ga0501293_004272
1936 Ga0501295_000527
1937 Ga0501298_000073
1938 Ga0501298_032825
1939 Ga0501299_000048
1940 Ga0501299_023155
1941 Ga0501300_000939
1942 Ga0501301_000833
1943 Ga0501303_001510
1944 Ga0501031_0021701
1945 Ga0501031_0342664
1946 Ga0501033_0091133
1947 Ga0501034_0468185
1948 Ga0501036_0301083
1949 Ga0501036_0341214
1950 Ga0501036_0437191
1951 Ga0501038_0254514
1952 Ga0501039_0127983
1953 Ga0501039_0458174
1954 Ga0501039_0629334
1955 Ga0501040_0011021
1956 Ga0501040_0013239
1957 Ga0501040_0128933
1958 Ga0501041_0018990
1959 Ga0501041_0069816
1960 Ga0501041_0113525
1961 Ga0501041_0171110
1962 Ga0501041_0173713
1963 Ga0501042_0106405
1964 Ga0501042_0197623
1965 Ga0501042_0237533
1966 Ga0501042_0245446
1967 Ga0501046_0298905
1968 Ga0501048_0064134
1969 Ga0501048_0191872
1970 Ga0501048_0197359
1971 Ga0501048_0280676
1972 Ga0501068_0018839
1973 Ga0501071_0120294
1974 Ga0501071_0305490
1975 Ga0501072_0235406
1976 Ga0501072_0556800
1977 Ga0501073_0002831
1978 Ga0501074_0201538
1979 Ga0501075_0035944
1980 Ga0501075_0291361
1981 Ga0501075_0413234
1982 Ga0501076_0018458
1983 Ga0501076_0107571
1984 Ga0501076_0232805
1985 Ga0501076_0242849
1986 Ga0501076_0458420
1987 Ga0501076_0464334
1988 Ga0501076_0776991
1989 Ga0501077_0014054
1990 Ga0501077_0025415
1991 Ga0501077_0437545
1992 Ga0501199_000966
1993 Ga0501202_002220
1994 Ga0501202_102510
1995 Ga0501208_004521
1996 Ga0501209_000634
1997 Ga0501217_010982
1998 Ga0501217_044275
1999 Ga0501227_077089
2000 Ga0501233_001024
2001 Ga0501235_005843
2002 Ga0501236_025732
2003 Ga0501243_001231
2004 Ga0501246_000121
2005 Ga0501249_032973
2006 Ga0501251_000290
2007 Ga0501256_005709
2008 Ga0501257_011113
2009 Ga0501261_004095
2010 Ga0501221_002583
2011 Ga0501225_0020194
2012 Ga0501229_000424
2013 Ga0501234_000290
2014 Ga0501079_0048048
2015 Ga0501079_0089110
2016 Ga0501079_0115525
2017 Ga0501079_0486125
2018 Ga0501080_0062248
2019 Ga0501080_0085095
2020 Ga0501080_0872456
2021 Ga0501081_0090955
2022 Ga0501081_0160934
2023 Ga0501081_1037128
2024 Ga0501263_026085
2025 Ga0501264_000674
2026 Ga0501266_001401
2027 Ga0501278_001930
2028 Ga0501279_002809
2029 Ga0501281_00924
2030 Ga0501283_004328
2031 Ga0501283_007596
2032 Ga0501045_0258946
2033 Ga0501045_0621411
2034 nmdc:mga05p37_1214327_c1
2035 nmdc:mga05p37_127165_c1
2036 nmdc:mga05p37_156259_c1
2037 nmdc:mga05p37_176866_c1
2038 nmdc:mga05p37_193021_c1
2039 nmdc:mga05p37_2169_c1
2040 nmdc:mga05p37_30866_c1
2041 nmdc:mga05p37_35207_c1
2042 nmdc:mga05p37_376704_c1
2043 nmdc:mga05p37_411232_c2
2044 nmdc:mga05p37_53643_c2
2045 nmdc:mga05p37_6745_c1
2046 nmdc:mga05p37_74645_c1
2047 nmdc:mga05p37_74813_c1
2048 nmdc:mga05p37_75048_c1
2049 nmdc:mga05p37_760502_c1
2050 nmdc:mga09592_123314_c1
2051 nmdc:mga09592_142368_c1
2052 nmdc:mga09592_160271_c1
2053 nmdc:mga09592_397043_c1
2054 nmdc:mga09592_477817_c1
2055 nmdc:mga09592_4935_c1
2056 nmdc:mga09592_57742_c1
2057 nmdc:mga0qj67_116349_c1
2058 nmdc:mga0qj67_212178_c1
2059 nmdc:mga0qj67_256855_c1
2060 nmdc:mga0qj67_8816_c1
2061 nmdc:mga06r32_1105884_c1
2062 nmdc:mga06r32_1114373_c1
2063 nmdc:mga06r32_1232812_c1
2064 nmdc:mga06r32_185062_c1
2065 nmdc:mga06r32_55337_c1
2066 nmdc:mga06r32_58087_c1
2067 nmdc:mga08y16_1340_c1
2068 nmdc:mga08y16_1540_c1
2069 nmdc:mga08y16_159603_c1
2070 nmdc:mga08y16_2229_c1
2071 nmdc:mga08y16_244510_c1
2072 nmdc:mga08y16_2595_c1
2073 nmdc:mga08y16_45702_c1
2074 nmdc:mga08y16_55323_c1
2075 nmdc:mga08y16_7280_c1
2076 nmdc:mga08y16_75653_c1
2077 nmdc:mga0n895_108093_c1
2078 nmdc:mga0n895_14984_c1
2079 nmdc:mga0n895_1500_c1
2080 nmdc:mga0n895_18994_c1
2081 nmdc:mga0n895_223446_c1
2082 nmdc:mga0n895_291448_c1
2083 nmdc:mga0n895_308498_c1
2084 nmdc:mga0n895_378447_c1
2085 nmdc:mga0n895_408790_c1
2086 nmdc:mga0n895_702168_c1
2087 nmdc:mga0n895_95_c1
2088 nmdc:mga0rr50_102750_c1
2089 nmdc:mga0rr50_105623_c1
2090 nmdc:mga0rr50_13491_c1
2091 nmdc:mga0rr50_17771_c1
2092 nmdc:mga0rr50_193363_c1
2093 nmdc:mga0rr50_283931_c1
2094 nmdc:mga0rr50_28_c1
2095 nmdc:mga0rr50_4559_c1
2096 nmdc:mga0rr50_46608_c1
2097 nmdc:mga0rr50_788376_c1
2098 nmdc:mga0rr50_864788_c1
2099 nmdc:mga08x19_11377_c1
2100 nmdc:mga08x19_121_c1
2101 nmdc:mga08x19_28970_c1
2102 nmdc:mga08x19_55142_c1
2103 nmdc:mga08x19_58793_c1
2104 nmdc:mga08x19_62829_c1
2105 nmdc:mga08x19_91733_c1
2106 nmdc:mga0a205_1053_c2
2107 nmdc:mga0a205_33911_c1
2108 nmdc:mga0a205_35961_c1
2109 nmdc:mga0a205_384820_c1
2110 nmdc:mga0a205_431012_c1
2111 nmdc:mga0a205_476_c1
2112 nmdc:mga0a205_538846_c1
2113 nmdc:mga0a205_53893_c1
2114 nmdc:mga0a205_552440_c1
2115 nmdc:mga0a205_5677_c1
2116 nmdc:mga0a205_6503_c1
2117 nmdc:mga0a205_78431_c1
2118 Ga0495601_0009411
2119 Ga0495601_0147173
2120 Ga0495619_0487330
2121 Ga0500555_005302
2122 Ga0501084_0054920
2123 Ga0590075_004459
2124 Ga0501082_0069283
2125 Ga0501082_0381461
2126 Ga0501082_0471300
2127 Ga0501082_0644367
2128 Ga0501082_0703868
2129 Ga0530510_0066955
2130 Ga0530510_0288448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

47

139

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.806 2 202
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.8043 2 206
5tgs-assembly1.cif.gz_B crystal structure of quee from bacillus subtilis with methionine bound 0.7885 2 206
5th5-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound 0.787 2 213
5th5-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound 0.78 2 213
ID Description Score Start End Superfamily
af_Q59039_1_242_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8286 4 205 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8202 2 206 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.815 1 205 3.20.20.70
af_P75794_7_292_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7961 22 172 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7895 2 206 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A381SXU2-F1-model_v4 Radical SAM core domain-containing protein 0.9968 49 213 GO:0016829
GO:0051539
AF-A0A7W0LCA8-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9968 66 213 GO:0051539
AF-A0A2V6KKF6-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9955 44 213 GO:0016829
GO:0051539
AF-A0A2V5MAR6-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9955 53 213 GO:0051539
AF-A0A7Y1SHN7-F1-model_v4 deleted 0.9948 70 153

Map