F489404

General Info

Members Datasets Scaffolds Average Seq Length
1066 378 2132 120

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100280122|Ga0307408_1002801221
Length 132
Sequence MAYVDGFLLPVPKKNLPRYRSIARRAGKVWMEHGALEYRESVADDLGKMSRGFGQGVRIKGGEVAMFSWIVYRSKRDRDRINRLVLKDPRILALMTPSNQIFDDKRMAYGGFRTIVDLAIKGTGHRAKAKKK

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
124 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
212 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
213 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
214 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
215 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
229 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
238 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
239 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
240 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
241 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
242 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
243 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
244 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
247 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
250 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
251 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
319 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
334 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
352 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
359 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
360 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
370 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
374 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
375 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.94
Nodule 0
Rhizoplane 4.13
Rhizosphere 89.87
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100280122 3300031548 Unclassified 1388
2 SwRhRL2b_contig_442106 2162886007 Bacteria 1269
3 SwRhRL2b_contig_844195 2162886007 Bacteria 2972
4 JGI24746J21847_1031565 3300001977 Bacteria 730
5 JGI24739J22299_10162950 3300001989 Bacteria 658
6 JGI24737J22298_10022369 3300001990 Bacteria 2010
7 JGI24743J22301_10000289 3300001991 Bacteria 5445
8 JGI24750J21931_1002677 3300002070 Bacteria 2137
9 JGI24748J21848_1044144 3300002074 Bacteria 572
10 JGI24738J21930_10156264 3300002075 Bacteria 509
11 JGI24744J21845_10001142 3300002077 Bacteria 5162
12 JGI24744J21845_10101059 3300002077 Unclassified 532
13 JGI24033J26618_1003370 3300002155 Bacteria 1683
14 JGI24742J22300_10043033 3300002244 Bacteria 807
15 JGI24742J22300_10085329 3300002244 Bacteria 600
16 JGI24751J29686_10003925 3300002459 Bacteria 3004
17 rootH2_10015358 3300003320 Bacteria 34751
18 rootH1_10157129 3300003323 Bacteria 5023
19 JGI25407J50210_10147166 3300003373 Bacteria 580
20 Ga0065715_10759263 3300005293 Bacteria 626
21 Ga0065707_10349446 3300005295 Bacteria 921
22 Ga0065707_10546411 3300005295 Bacteria 724
23 Ga0065707_10598815 3300005295 Bacteria 681
24 Ga0065707_10636514 3300005295 Bacteria 670
25 Ga0065707_10800179 3300005295 Bacteria 599
26 Ga0070676_10129134 3300005328 Bacteria 1596
27 Ga0070676_10397834 3300005328 Bacteria 958
28 Ga0070676_10575923 3300005328 Bacteria 809
29 Ga0070683_102086620 3300005329 Bacteria 544
30 Ga0070690_100009413 3300005330 Bacteria 5658
31 Ga0070690_100041690 3300005330 Bacteria 2906
32 Ga0070690_100612470 3300005330 Bacteria 828
33 Ga0070690_100716923 3300005330 Bacteria 769
34 Ga0070670_100173351 3300005331 Bacteria 1871
35 Ga0070670_100812416 3300005331 Bacteria 845
36 Ga0070677_10016023 3300005333 Bacteria 2663
37 Ga0070677_10042171 3300005333 Bacteria 1805
38 Ga0070677_10179249 3300005333 Bacteria 1008
39 Ga0070677_10211260 3300005333 Bacteria 942
40 Ga0068869_100039936 3300005334 Bacteria 3353
41 Ga0068869_100104321 3300005334 Bacteria 2149
42 Ga0068869_100703600 3300005334 Bacteria 862
43 Ga0068869_101000833 3300005334 Unclassified 728
44 Ga0068869_101492468 3300005334 Bacteria 600
45 Ga0068869_101741194 3300005334 Bacteria 557
46 Ga0070666_10411434 3300005335 Bacteria 973
47 Ga0070680_100339665 3300005336 Bacteria 1276
48 Ga0068868_100058792 3300005338 Bacteria 3039
49 Ga0070660_100112452 3300005339 Bacteria 2168
50 Ga0070689_100027085 3300005340 Bacteria 4319
51 Ga0070689_100276349 3300005340 Bacteria 1392
52 Ga0070689_100403657 3300005340 Bacteria 1156
53 Ga0070689_100587071 3300005340 Bacteria 964
54 Ga0070689_100587204 3300005340 Bacteria 964
55 Ga0070691_10062475 3300005341 Bacteria 1794
56 Ga0070691_10382175 3300005341 Bacteria 789
57 Ga0070691_10556161 3300005341 Bacteria 671
58 Ga0070687_100013616 3300005343 Bacteria 3629
59 Ga0070687_100332283 3300005343 Bacteria 975
60 Ga0070687_100879638 3300005343 Bacteria 641
61 Ga0070661_100974151 3300005344 Bacteria 703
62 Ga0070692_10055110 3300005345 Bacteria 2078
63 Ga0070692_10274115 3300005345 Bacteria 1020
64 Ga0070692_10340976 3300005345 Bacteria 928
65 Ga0070668_100071393 3300005347 Bacteria 2704
66 Ga0070668_100163900 3300005347 Bacteria 1805
67 Ga0070668_100165081 3300005347 Bacteria 1799
68 Ga0070668_100421980 3300005347 Bacteria 1142
69 Ga0070668_100499828 3300005347 Bacteria 1052
70 Ga0070668_100781846 3300005347 Bacteria 847
71 Ga0070668_101021219 3300005347 Bacteria 744
72 Ga0070669_100024281 3300005353 Bacteria 4347
73 Ga0070669_100032969 3300005353 Bacteria 3744
74 Ga0070669_100076141 3300005353 Bacteria 2490
75 Ga0070669_101767839 3300005353 Bacteria 539
76 Ga0070675_100021110 3300005354 Bacteria 5201
77 Ga0070675_100195145 3300005354 Bacteria 1756
78 Ga0070675_100474882 3300005354 Bacteria 1124
79 Ga0070675_100490600 3300005354 Bacteria 1106
80 Ga0070674_100008010 3300005356 Bacteria 6262
81 Ga0070674_100013939 3300005356 Bacteria 4984
82 Ga0070674_100019263 3300005356 Bacteria 4333
83 Ga0070674_100039433 3300005356 Bacteria 3189
84 Ga0070674_100308610 3300005356 Bacteria 1264
85 Ga0070674_100793274 3300005356 Bacteria 817
86 Ga0070673_100034287 3300005364 Bacteria 3839
87 Ga0070673_100051856 3300005364 Bacteria 3216
88 Ga0070673_100290422 3300005364 Bacteria 1437
89 Ga0070673_100578887 3300005364 Bacteria 1022
90 Ga0070673_100607969 3300005364 Bacteria 998
91 Ga0070673_100855410 3300005364 Bacteria 842
92 Ga0070673_101019821 3300005364 Bacteria 771
93 Ga0070673_101234034 3300005364 Bacteria 701
94 Ga0070673_101347997 3300005364 Bacteria 671
95 Ga0070688_100006679 3300005365 Bacteria 6182
96 Ga0070688_100030550 3300005365 Bacteria 3235
97 Ga0070688_100066185 3300005365 Bacteria 2299
98 Ga0070688_100093546 3300005365 Bacteria 1969
99 Ga0070688_100176158 3300005365 Bacteria 1480
100 Ga0070688_100221112 3300005365 Bacteria 1334
101 Ga0070659_100006061 3300005366 Bacteria 8721
102 Ga0070659_100151620 3300005366 Bacteria 1891
103 Ga0070659_101051100 3300005366 Bacteria 716
104 Ga0070667_100042351 3300005367 Bacteria 3821
105 Ga0070667_100353143 3300005367 Bacteria 1331
106 Ga0070667_100429111 3300005367 Bacteria 1206
107 Ga0070667_101581259 3300005367 Bacteria 616
108 Ga0070703_10070998 3300005406 Bacteria 1163
109 Ga0070701_10011428 3300005438 Bacteria 3969
110 Ga0070701_10108626 3300005438 Bacteria 1547
111 Ga0070701_10147202 3300005438 Bacteria 1353
112 Ga0070701_10612076 3300005438 Bacteria 723
113 Ga0070701_10815755 3300005438 Bacteria 638
114 Ga0070711_101013505 3300005439 Bacteria 713
115 Ga0070705_100013904 3300005440 Bacteria 4128
116 Ga0070705_100081424 3300005440 Bacteria 1989
117 Ga0070705_100115279 3300005440 Bacteria 1725
118 Ga0070705_100123176 3300005440 Bacteria 1678
119 Ga0070705_100891852 3300005440 Bacteria 714
120 Ga0070700_100001831 3300005441 Bacteria 10735
121 Ga0070700_100024645 3300005441 Bacteria 3535
122 Ga0070700_100213204 3300005441 Bacteria 1364
123 Ga0070700_100272249 3300005441 Bacteria 1224
124 Ga0070700_100354636 3300005441 Bacteria 1089
125 Ga0070700_100425144 3300005441 Bacteria 1005
126 Ga0070700_100570968 3300005441 Bacteria 882
127 Ga0070694_100067189 3300005444 Bacteria 2461
128 Ga0070694_100120415 3300005444 Bacteria 1882
129 Ga0070694_100227034 3300005444 Bacteria 1403
130 Ga0070694_100276844 3300005444 Unclassified 1278
131 Ga0070694_100506881 3300005444 Bacteria 961
132 Ga0070694_100898372 3300005444 Bacteria 731
133 Ga0070694_100934547 3300005444 Bacteria 717
134 Ga0070663_100034544 3300005455 Bacteria 3502
135 Ga0070663_100042205 3300005455 Bacteria 3204
136 Ga0070663_100192677 3300005455 Bacteria 1587
137 Ga0070678_100051594 3300005456 Bacteria 2982
138 Ga0070678_100147121 3300005456 Bacteria 1893
139 Ga0070678_100285946 3300005456 Bacteria 1396
140 Ga0070678_100536330 3300005456 Bacteria 1037
141 Ga0070678_100611740 3300005456 Bacteria 974
142 Ga0070662_100039586 3300005457 Bacteria 3352
143 Ga0070662_100181707 3300005457 Bacteria 1658
144 Ga0070662_100639693 3300005457 Bacteria 897
145 Ga0070662_100779514 3300005457 Bacteria 812
146 Ga0070662_100795103 3300005457 Bacteria 804
147 Ga0070662_101620786 3300005457 Bacteria 559
148 Ga0070681_10066648 3300005458 Bacteria 3569
149 Ga0070681_11166494 3300005458 Bacteria 692
150 Ga0068867_100026934 3300005459 Bacteria 4131
151 Ga0068867_100062864 3300005459 Bacteria 2759
152 Ga0068867_100185720 3300005459 Bacteria 1656
153 Ga0068867_100437315 3300005459 Bacteria 1112
154 Ga0068867_100483201 3300005459 Bacteria 1062
155 Ga0070685_10002826 3300005466 Bacteria 8871
156 Ga0070685_10152406 3300005466 Bacteria 1466
157 Ga0070685_10524535 3300005466 Bacteria 842
158 Ga0070707_100282148 3300005468 Unclassified 1614
159 Ga0070707_101845867 3300005468 Unclassified 572
160 Ga0070698_100020375 3300005471 Bacteria 6950
161 Ga0070698_101671845 3300005471 Unclassified 589
162 Ga0070699_100000012 3300005518 Bacteria 246521
163 Ga0070699_100246708 3300005518 Bacteria 1595
164 Ga0070699_100451974 3300005518 Bacteria 1165
165 Ga0070679_100053571 3300005530 Bacteria 4016
166 Ga0070684_100153697 3300005535 Bacteria 2086
167 Ga0070697_100323693 3300005536 Unclassified 1328
168 Ga0070697_100803916 3300005536 Bacteria 832
169 Ga0070697_101005284 3300005536 Unclassified 741
170 Ga0070697_101961306 3300005536 Unclassified 524
171 Ga0068853_100197108 3300005539 Bacteria 1832
172 Ga0068853_100545824 3300005539 Bacteria 1098
173 Ga0070672_100011114 3300005543 Bacteria 6270
174 Ga0070672_100093329 3300005543 Bacteria 2431
175 Ga0070672_100369918 3300005543 Bacteria 1224
176 Ga0070672_100654130 3300005543 Bacteria 918
177 Ga0070672_101071472 3300005543 Bacteria 716
178 Ga0070686_100009432 3300005544 Bacteria 5487
179 Ga0070686_100037119 3300005544 Bacteria 3021
180 Ga0070686_100948792 3300005544 Unclassified 703
181 Ga0070695_100011470 3300005545 Bacteria 5300
182 Ga0070695_100103183 3300005545 Bacteria 1924
183 Ga0070695_100300607 3300005545 Bacteria 1186
184 Ga0070695_101528312 3300005545 Bacteria 556
185 Ga0070696_100009053 3300005546 Bacteria 6667
186 Ga0070696_100166438 3300005546 Bacteria 1627
187 Ga0070693_100006310 3300005547 Bacteria 5747
188 Ga0070693_100658952 3300005547 Bacteria 762
189 Ga0070665_100048285 3300005548 Bacteria 4274
190 Ga0070665_100095945 3300005548 Bacteria 2970
191 Ga0070665_100258146 3300005548 Bacteria 1744
192 Ga0070665_100496069 3300005548 Bacteria 1232
193 Ga0070665_101185842 3300005548 Bacteria 774
194 Ga0070704_100054091 3300005549 Bacteria 2840
195 Ga0070704_100179392 3300005549 Bacteria 1692
196 Ga0070704_100374703 3300005549 Bacteria 1208
197 Ga0070664_100258165 3300005564 Bacteria 1567
198 Ga0070664_100336652 3300005564 Bacteria 1370
199 Ga0070664_101889046 3300005564 Unclassified 566
200 Ga0068857_100024296 3300005577 Bacteria 5333
201 Ga0068857_100249292 3300005577 Bacteria 1627
202 Ga0068857_100501143 3300005577 Bacteria 1140
203 Ga0068857_100523862 3300005577 Bacteria 1114
204 Ga0068854_100088893 3300005578 Bacteria 2295
205 Ga0068854_100758180 3300005578 Bacteria 842
206 Ga0068854_100832597 3300005578 Bacteria 806
207 Ga0068854_101260940 3300005578 Bacteria 664
208 Ga0068854_101853022 3300005578 Bacteria 554
209 Ga0070702_100011472 3300005615 Bacteria 4408
210 Ga0070702_100020816 3300005615 Bacteria 3442
211 Ga0070702_100276643 3300005615 Bacteria 1151
212 Ga0070702_100386439 3300005615 Bacteria 997
213 Ga0068852_100162491 3300005616 Bacteria 2086
214 Ga0068852_102268943 3300005616 Bacteria 564
215 Ga0068859_100139957 3300005617 Bacteria 2494
216 Ga0068859_100392249 3300005617 Bacteria 1484
217 Ga0068859_100503115 3300005617 Bacteria 1307
218 Ga0068859_100620354 3300005617 Bacteria 1174
219 Ga0068859_100691468 3300005617 Bacteria 1111
220 Ga0068859_100896314 3300005617 Bacteria 972
221 Ga0068859_100905409 3300005617 Bacteria 967
222 Ga0068859_102107141 3300005617 Bacteria 623
223 Ga0068864_100019800 3300005618 Bacteria 5626
224 Ga0068864_100053857 3300005618 Bacteria 3472
225 Ga0068864_100228708 3300005618 Bacteria 1719
226 Ga0068864_101373641 3300005618 Bacteria 708
227 Ga0068866_10036038 3300005718 Bacteria 2421
228 Ga0068866_10110477 3300005718 Bacteria 1533
229 Ga0068866_10675756 3300005718 Bacteria 706
230 Ga0068866_10726436 3300005718 Bacteria 684
231 Ga0068861_100009091 3300005719 Bacteria 6850
232 Ga0068861_100033722 3300005719 Bacteria 3780
233 Ga0068861_100034292 3300005719 Bacteria 3752
234 Ga0068861_100133863 3300005719 Bacteria 2015
235 Ga0068861_100140301 3300005719 Bacteria 1972
236 Ga0068861_100173354 3300005719 Bacteria 1789
237 Ga0068861_100296339 3300005719 Bacteria 1399
238 Ga0068861_100424974 3300005719 Bacteria 1185
239 Ga0068861_100693384 3300005719 Bacteria 945
240 Ga0068870_10002310 3300005840 Bacteria 7924
241 Ga0068870_10044675 3300005840 Bacteria 2316
242 Ga0068870_10053710 3300005840 Bacteria 2140
243 Ga0068870_10462106 3300005840 Bacteria 839
244 Ga0068870_10477476 3300005840 Bacteria 827
245 Ga0068863_100113905 3300005841 Bacteria 2576
246 Ga0068863_100292468 3300005841 Bacteria 1579
247 Ga0068863_100964527 3300005841 Bacteria 854
248 Ga0068863_101106419 3300005841 Bacteria 797
249 Ga0068863_101143695 3300005841 Unclassified 783
250 Ga0068863_101946318 3300005841 Bacteria 598
251 Ga0068863_102642931 3300005841 Bacteria 511
252 Ga0068858_100005836 3300005842 Bacteria 12027
253 Ga0068858_100023261 3300005842 Bacteria 5775
254 Ga0068858_100201330 3300005842 Bacteria 1883
255 Ga0068858_100231770 3300005842 Bacteria 1751
256 Ga0068860_100029497 3300005843 Bacteria 5278
257 Ga0068860_100046638 3300005843 Bacteria 4132
258 Ga0068860_100418461 3300005843 Bacteria 1328
259 Ga0068860_100543002 3300005843 Bacteria 1164
260 Ga0068860_100713908 3300005843 Bacteria 1013
261 Ga0068860_100874969 3300005843 Bacteria 914
262 Ga0068860_100904726 3300005843 Bacteria 899
263 Ga0068862_100128197 3300005844 Bacteria 2242
264 Ga0068862_100193183 3300005844 Bacteria 1833
265 Ga0068862_100246388 3300005844 Bacteria 1627
266 Ga0068862_100342701 3300005844 Bacteria 1385
267 Ga0068862_100372681 3300005844 Bacteria 1329
268 Ga0068862_100719449 3300005844 Bacteria 969
269 Ga0068862_101436801 3300005844 Bacteria 694
270 Ga0081455_10004385 3300005937 Bacteria 15894
271 Ga0081455_10006450 3300005937 Bacteria 12569
272 Ga0081538_10015699 3300005981 Bacteria 5848
273 Ga0081538_10036943 3300005981 Bacteria 3178
274 Ga0070717_11119478 3300006028 Bacteria 717
275 Ga0075365_10011977 3300006038 Bacteria 5125
276 Ga0075365_10050444 3300006038 Bacteria 2745
277 Ga0075365_10775439 3300006038 Bacteria 677
278 Ga0075363_100006440 3300006048 Bacteria 5333
279 Ga0075363_100330740 3300006048 Bacteria 887
280 Ga0075364_10173269 3300006051 Bacteria 1459
281 Ga0075432_10552234 3300006058 Bacteria 520
282 Ga0070715_10017981 3300006163 Bacteria 2686
283 Ga0070712_100183080 3300006175 Bacteria 1634
284 Ga0075362_10058135 3300006177 Bacteria 1744
285 Ga0075362_10086876 3300006177 Bacteria 1448
286 Ga0075362_10137611 3300006177 Bacteria 1166
287 Ga0075367_10006406 3300006178 Bacteria 5945
288 Ga0075367_10256038 3300006178 Bacteria 1098
289 Ga0075367_10482339 3300006178 Bacteria 786
290 Ga0075367_10848917 3300006178 Bacteria 582
291 Ga0075369_10096470 3300006186 Bacteria 1324
292 Ga0075369_10480281 3300006186 Bacteria 590
293 Ga0075366_10481327 3300006195 Bacteria 767
294 Ga0097621_100014001 3300006237 Bacteria 5992
295 Ga0097621_100197699 3300006237 Bacteria 1744
296 Ga0097621_100205331 3300006237 Bacteria 1712
297 Ga0097621_100912438 3300006237 Bacteria 819
298 Ga0097621_100966918 3300006237 Unclassified 795
299 Ga0075370_10069593 3300006353 Bacteria 2011
300 Ga0075370_10773796 3300006353 Bacteria 585
301 Ga0068871_100030159 3300006358 Bacteria 4268
302 Ga0068871_100274062 3300006358 Bacteria 1474
303 Ga0068871_100562601 3300006358 Bacteria 1034
304 Ga0068871_100974999 3300006358 Bacteria 788
305 Ga0068871_101588998 3300006358 Bacteria 619
306 Ga0068871_102080032 3300006358 Bacteria 541
307 Ga0075428_100088621 3300006844 Bacteria 3375
308 Ga0075428_100111490 3300006844 Bacteria 2980
309 Ga0075428_100165771 3300006844 Bacteria 2397
310 Ga0075428_100375310 3300006844 Bacteria 1525
311 Ga0075428_100674699 3300006844 Bacteria 1102
312 Ga0075430_100021899 3300006846 Bacteria 5431
313 Ga0075430_100161849 3300006846 Bacteria 1863
314 Ga0075430_100221187 3300006846 Bacteria 1571
315 Ga0075430_100324024 3300006846 Bacteria 1273
316 Ga0075430_101421549 3300006846 Bacteria 570
317 Ga0075431_100020076 3300006847 Bacteria 6823
318 Ga0075431_100024922 3300006847 Bacteria 6132
319 Ga0075431_100063780 3300006847 Bacteria 3803
320 Ga0075431_100102562 3300006847 Bacteria 2953
321 Ga0075431_100366567 3300006847 Bacteria 1446
322 Ga0075433_10072810 3300006852 Bacteria 3022
323 Ga0075434_100112818 3300006871 Bacteria 2730
324 Ga0075434_100278673 3300006871 Bacteria 1692
325 Ga0075434_100629395 3300006871 Bacteria 1092
326 Ga0075434_101053870 3300006871 Bacteria 827
327 Ga0075434_101521405 3300006871 Bacteria 678
328 Ga0075429_100000516 3300006880 Bacteria 29275
329 Ga0075429_100061796 3300006880 Bacteria 3263
330 Ga0075429_101426640 3300006880 Bacteria 603
331 Ga0068865_100101247 3300006881 Bacteria 2109
332 Ga0068865_100344279 3300006881 Bacteria 1206
333 Ga0097620_100139956 3300006931 Bacteria 2494
334 Ga0097620_100392299 3300006931 Bacteria 1484
335 Ga0097620_100503145 3300006931 Bacteria 1307
336 Ga0097620_100620283 3300006931 Bacteria 1174
337 Ga0097620_100691483 3300006931 Bacteria 1111
338 Ga0097620_100896301 3300006931 Bacteria 972
339 Ga0097620_100905368 3300006931 Bacteria 967
340 Ga0097620_102107088 3300006931 Bacteria 623
341 Ga0075435_100095165 3300007076 Bacteria 2463
342 Ga0099795_10000022 3300007788 Bacteria 52585
343 Ga0105250_10035451 3300009092 Bacteria 2001
344 Ga0111539_10025568 3300009094 Bacteria 7237
345 Ga0111539_10091488 3300009094 Bacteria 3574
346 Ga0111539_10470432 3300009094 Bacteria 1464
347 Ga0111539_10613229 3300009094 Bacteria 1267
348 Ga0111539_10717690 3300009094 Bacteria 1164
349 Ga0111539_10766076 3300009094 Bacteria 1123
350 Ga0111539_11158669 3300009094 Bacteria 898
351 Ga0111539_11981300 3300009094 Bacteria 675
352 Ga0105245_10138958 3300009098 Bacteria 2286
353 Ga0105247_10002316 3300009101 Bacteria 13011
354 Ga0105247_10017387 3300009101 Bacteria 4318
355 Ga0114129_10006246 3300009147 Bacteria 16890
356 Ga0114129_10040767 3300009147 Bacteria 6545
357 Ga0114129_10206847 3300009147 Bacteria 2655
358 Ga0114129_10373351 3300009147 Bacteria 1885
359 Ga0114129_10452513 3300009147 Bacteria 1684
360 Ga0114129_10779165 3300009147 Bacteria 1222
361 Ga0114129_11124000 3300009147 Bacteria 982
362 Ga0114129_11149003 3300009147 Bacteria 970
363 Ga0114129_11712671 3300009147 Bacteria 767
364 Ga0105243_10046925 3300009148 Bacteria 3400
365 Ga0105243_10300094 3300009148 Bacteria 1455
366 Ga0105243_10390765 3300009148 Bacteria 1289
367 Ga0105243_10762726 3300009148 Bacteria 950
368 Ga0105243_10834875 3300009148 Bacteria 911
369 Ga0105241_10411180 3300009174 Bacteria 1189
370 Ga0105241_10712673 3300009174 Bacteria 917
371 Ga0105242_10015964 3300009176 Bacteria 5836
372 Ga0105242_10261036 3300009176 Bacteria 1565
373 Ga0105242_13157271 3300009176 Bacteria 511
374 Ga0105248_10013593 3300009177 Bacteria 8961
375 Ga0105248_10031395 3300009177 Bacteria 5938
376 Ga0105248_10310970 3300009177 Bacteria 1774
377 Ga0105248_10373142 3300009177 Bacteria 1606
378 Ga0105248_10849747 3300009177 Bacteria 1030
379 Ga0105237_10157318 3300009545 Bacteria 2270
380 Ga0105237_11227353 3300009545 Bacteria 756
381 Ga0105238_10216685 3300009551 Bacteria 1890
382 Ga0105238_10315895 3300009551 Bacteria 1548
383 Ga0105238_10516766 3300009551 Bacteria 1196
384 Ga0105238_11734471 3300009551 Unclassified 656
385 Ga0105249_10046617 3300009553 Bacteria 3945
386 Ga0105249_10058640 3300009553 Bacteria 3529
387 Ga0105249_10572772 3300009553 Bacteria 1182
388 Ga0105249_10597082 3300009553 Bacteria 1158
389 Ga0105249_10773384 3300009553 Bacteria 1023
390 Ga0099796_10000153 3300010159 Bacteria 10219
391 Ga0105239_10926368 3300010375 Bacteria 1000
392 Ga0105246_10012857 3300011119 Bacteria 5234
393 Ga0105246_10147417 3300011119 Bacteria 1777
394 Ga0157341_1003637 3300012494 Bacteria 1085
395 Ga0157326_1010374 3300012513 Bacteria 1038
396 Ga0157326_1034287 3300012513 Bacteria 686
397 Ga0157373_10028056 3300013100 Bacteria 4062
398 Ga0157371_10448916 3300013102 Bacteria 948
399 Ga0157371_10716731 3300013102 Bacteria 750
400 Ga0157371_11025873 3300013102 Unclassified 630
401 Ga0157374_10484621 3300013296 Bacteria 1240
402 Ga0157374_12731598 3300013296 Bacteria 521
403 Ga0157378_10016082 3300013297 Bacteria 6553
404 Ga0157378_10242931 3300013297 Bacteria 1721
405 Ga0157378_11397435 3300013297 Bacteria 743
406 Ga0157378_12078554 3300013297 Bacteria 618
407 Ga0163162_10044564 3300013306 Bacteria 4443
408 Ga0163162_10057411 3300013306 Bacteria 3920
409 Ga0163162_11160413 3300013306 Bacteria 876
410 Ga0163162_11379610 3300013306 Bacteria 802
411 Ga0163162_11828480 3300013306 Bacteria 695
412 Ga0163162_11866294 3300013306 Bacteria 688
413 Ga0157372_10007051 3300013307 Bacteria 11969
414 Ga0157372_10888523 3300013307 Bacteria 1034
415 Ga0157375_10102597 3300013308 Bacteria 2946
416 Ga0157375_10972892 3300013308 Unclassified 989
417 Ga0157375_11274581 3300013308 Bacteria 863
418 Ga0157375_13115047 3300013308 Bacteria 553
419 Ga0163163_10267597 3300014325 Bacteria 1760
420 Ga0163163_10271568 3300014325 Bacteria 1747
421 Ga0163163_10891707 3300014325 Bacteria 953
422 Ga0157380_10053038 3300014326 Bacteria 3213
423 Ga0157380_10099751 3300014326 Bacteria 2416
424 Ga0157380_10121023 3300014326 Bacteria 2217
425 Ga0157380_10171516 3300014326 Bacteria 1896
426 Ga0157380_10343883 3300014326 Bacteria 1393
427 Ga0157380_10422125 3300014326 Bacteria 1272
428 Ga0157380_10510970 3300014326 Bacteria 1169
429 Ga0157380_10863907 3300014326 Bacteria 928
430 Ga0157380_10869019 3300014326 Bacteria 925
431 Ga0157380_11203236 3300014326 Bacteria 801
432 Ga0157380_11254780 3300014326 Bacteria 787
433 Ga0157380_11878385 3300014326 Bacteria 659
434 Ga0182008_10088724 3300014497 Bacteria 1524
435 Ga0182008_10192751 3300014497 Bacteria 1035
436 Ga0157377_10060707 3300014745 Bacteria 2159
437 Ga0157377_10078011 3300014745 Bacteria 1930
438 Ga0157379_10013529 3300014968 Bacteria 7151
439 Ga0157379_10053782 3300014968 Unclassified 3597
440 Ga0157379_10347170 3300014968 Bacteria 1358
441 Ga0157379_10561869 3300014968 Unclassified 1062
442 Ga0157379_10643133 3300014968 Bacteria 992
443 Ga0157379_10666387 3300014968 Bacteria 975
444 Ga0157379_11296301 3300014968 Unclassified 703
445 Ga0157379_12498597 3300014968 Bacteria 516
446 Ga0157376_10028966 3300014969 Bacteria 4408
447 Ga0157376_10045197 3300014969 Bacteria 3624
448 Ga0157376_10460957 3300014969 Bacteria 1242
449 Ga0157376_10507449 3300014969 Unclassified 1186
450 Ga0157376_11985290 3300014969 Unclassified 619
451 Ga0182006_1071938 3300015261 Bacteria 1280
452 Ga0182007_10045579 3300015262 Bacteria 1453
453 Ga0182007_10047438 3300015262 Bacteria 1421
454 Ga0182007_10151356 3300015262 Bacteria 789
455 Ga0163161_10035357 3300017792 Bacteria 3576
456 Ga0163161_10089587 3300017792 Bacteria 2276
457 Ga0163161_10261797 3300017792 Bacteria 1351
458 Ga0163161_10767451 3300017792 Unclassified 808
459 Ga0207638_1003840 3300025227 Bacteria 610
460 Ga0209758_1018310 3300025297 Bacteria 3441
461 Ga0207697_10548945 3300025315 Bacteria 508
462 Ga0207682_10003239 3300025893 Bacteria 7121
463 Ga0207682_10023027 3300025893 Bacteria 2458
464 Ga0207642_10036811 3300025899 Bacteria 2103
465 Ga0207642_10216771 3300025899 Bacteria 1067
466 Ga0207642_10325115 3300025899 Bacteria 899
467 Ga0207642_10494725 3300025899 Bacteria 748
468 Ga0207710_10074811 3300025900 Bacteria 1560
469 Ga0207688_10000283 3300025901 Bacteria 23210
470 Ga0207688_10133948 3300025901 Bacteria 1454
471 Ga0207680_10088104 3300025903 Bacteria 1967
472 Ga0207680_10312532 3300025903 Bacteria 1097
473 Ga0207647_10008609 3300025904 Bacteria 7303
474 Ga0207647_10288886 3300025904 Bacteria 935
475 Ga0207685_10011195 3300025905 Bacteria 2685
476 Ga0207645_10004284 3300025907 Bacteria 10588
477 Ga0207645_10075319 3300025907 Bacteria 2160
478 Ga0207645_10149060 3300025907 Bacteria 1526
479 Ga0207645_10374439 3300025907 Bacteria 955
480 Ga0207645_10858230 3300025907 Bacteria 617
481 Ga0207643_10000615 3300025908 Bacteria 22480
482 Ga0207643_10038281 3300025908 Bacteria 2693
483 Ga0207643_10089816 3300025908 Bacteria 1790
484 Ga0207643_10110027 3300025908 Bacteria 1623
485 Ga0207643_10713642 3300025908 Bacteria 648
486 Ga0207707_10099173 3300025912 Bacteria 2546
487 Ga0207671_10481807 3300025914 Bacteria 989
488 Ga0207671_10731091 3300025914 Bacteria 786
489 Ga0207663_10197530 3300025916 Bacteria 1449
490 Ga0207662_10002182 3300025918 Bacteria 9762
491 Ga0207662_10019443 3300025918 Bacteria 3865
492 Ga0207662_10157989 3300025918 Bacteria 1447
493 Ga0207662_10267689 3300025918 Unclassified 1127
494 Ga0207657_10111144 3300025919 Bacteria 2263
495 Ga0207657_10816507 3300025919 Bacteria 720
496 Ga0207649_10974225 3300025920 Bacteria 667
497 Ga0207649_11129601 3300025920 Bacteria 618
498 Ga0207652_10089380 3300025921 Bacteria 2705
499 Ga0207652_11197203 3300025921 Bacteria 661
500 Ga0207646_10935093 3300025922 Unclassified 768
501 Ga0207681_10019540 3300025923 Bacteria 4282
502 Ga0207681_10032108 3300025923 Bacteria 3436
503 Ga0207681_10103416 3300025923 Bacteria 2058
504 Ga0207681_10339484 3300025923 Bacteria 1199
505 Ga0207681_10691224 3300025923 Bacteria 848
506 Ga0207681_10701050 3300025923 Bacteria 842
507 Ga0207694_10557457 3300025924 Bacteria 962
508 Ga0207694_10613141 3300025924 Bacteria 915
509 Ga0207694_10954270 3300025924 Bacteria 725
510 Ga0207694_11052464 3300025924 Bacteria 689
511 Ga0207650_10043430 3300025925 Bacteria 3299
512 Ga0207650_10144074 3300025925 Bacteria 1875
513 Ga0207650_10163106 3300025925 Bacteria 1767
514 Ga0207659_10160130 3300025926 Bacteria 1766
515 Ga0207659_10509646 3300025926 Bacteria 1019
516 Ga0207659_11630553 3300025926 Bacteria 550
517 Ga0207659_11729908 3300025926 Unclassified 532
518 Ga0207690_10015285 3300025932 Bacteria 4647
519 Ga0207690_10024268 3300025932 Bacteria 3796
520 Ga0207690_10313276 3300025932 Bacteria 1231
521 Ga0207690_10409627 3300025932 Bacteria 1083
522 Ga0207706_10011257 3300025933 Bacteria 8155
523 Ga0207706_10025823 3300025933 Bacteria 5261
524 Ga0207706_10083579 3300025933 Bacteria 2807
525 Ga0207706_10097236 3300025933 Bacteria 2589
526 Ga0207706_10192645 3300025933 Bacteria 1789
527 Ga0207706_10232699 3300025933 Bacteria 1612
528 Ga0207706_10371654 3300025933 Bacteria 1241
529 Ga0207706_10489218 3300025933 Bacteria 1062
530 Ga0207706_10939280 3300025933 Bacteria 729
531 Ga0207706_11690729 3300025933 Unclassified 510
532 Ga0207686_10025970 3300025934 Bacteria 3414
533 Ga0207686_10802782 3300025934 Bacteria 754
534 Ga0207709_10039886 3300025935 Bacteria 2808
535 Ga0207709_10258863 3300025935 Bacteria 1275
536 Ga0207709_10259269 3300025935 Bacteria 1274
537 Ga0207709_11378050 3300025935 Bacteria 584
538 Ga0207670_10040465 3300025936 Bacteria 3059
539 Ga0207670_10091205 3300025936 Bacteria 2154
540 Ga0207670_10136471 3300025936 Bacteria 1804
541 Ga0207670_10203833 3300025936 Bacteria 1504
542 Ga0207669_10008898 3300025937 Bacteria 4743
543 Ga0207669_10033296 3300025937 Bacteria 2906
544 Ga0207669_10124508 3300025937 Bacteria 1758
545 Ga0207669_10818753 3300025937 Bacteria 773
546 Ga0207669_11571520 3300025937 Bacteria 561
547 Ga0207704_10009089 3300025938 Bacteria 4778
548 Ga0207704_10071029 3300025938 Bacteria 2207
549 Ga0207704_10156445 3300025938 Bacteria 1616
550 Ga0207704_10362465 3300025938 Bacteria 1132
551 Ga0207704_10417450 3300025938 Bacteria 1063
552 Ga0207704_10480390 3300025938 Bacteria 997
553 Ga0207704_10935495 3300025938 Unclassified 730
554 Ga0207665_10123760 3300025939 Bacteria 1829
555 Ga0207691_10001340 3300025940 Bacteria 24566
556 Ga0207691_10005505 3300025940 Bacteria 12237
557 Ga0207691_10008332 3300025940 Bacteria 9956
558 Ga0207691_10009993 3300025940 Bacteria 9113
559 Ga0207691_10072598 3300025940 Bacteria 3104
560 Ga0207691_10170907 3300025940 Bacteria 1903
561 Ga0207691_10367487 3300025940 Bacteria 1229
562 Ga0207691_10440963 3300025940 Bacteria 1109
563 Ga0207691_10444171 3300025940 Bacteria 1104
564 Ga0207711_10046436 3300025941 Bacteria 3711
565 Ga0207711_10053060 3300025941 Bacteria 3477
566 Ga0207711_10132630 3300025941 Bacteria 2235
567 Ga0207711_10289652 3300025941 Bacteria 1509
568 Ga0207711_10577632 3300025941 Bacteria 1048
569 Ga0207711_10981813 3300025941 Bacteria 784
570 Ga0207689_10009385 3300025942 Bacteria 8452
571 Ga0207689_10087974 3300025942 Bacteria 2552
572 Ga0207689_11537481 3300025942 Unclassified 555
573 Ga0207689_11744840 3300025942 Unclassified 515
574 Ga0207679_10959545 3300025945 Bacteria 783
575 Ga0207679_11140419 3300025945 Bacteria 715
576 Ga0207651_10008440 3300025960 Bacteria 5565
577 Ga0207651_10168645 3300025960 Bacteria 1724
578 Ga0207651_10224327 3300025960 Bacteria 1521
579 Ga0207651_10572169 3300025960 Bacteria 985
580 Ga0207651_10661013 3300025960 Bacteria 918
581 Ga0207651_10919728 3300025960 Bacteria 779
582 Ga0207712_10060130 3300025961 Bacteria 2692
583 Ga0207712_10112492 3300025961 Bacteria 2044
584 Ga0207712_10121386 3300025961 Bacteria 1978
585 Ga0207712_11519808 3300025961 Bacteria 600
586 Ga0207668_10009499 3300025972 Bacteria 5835
587 Ga0207668_10070567 3300025972 Bacteria 2492
588 Ga0207668_10235326 3300025972 Bacteria 1479
589 Ga0207668_10648104 3300025972 Bacteria 924
590 Ga0207668_10871932 3300025972 Bacteria 800
591 Ga0207668_11036018 3300025972 Bacteria 734
592 Ga0207668_11165618 3300025972 Bacteria 692
593 Ga0207640_10085407 3300025981 Bacteria 2170
594 Ga0207640_10101516 3300025981 Bacteria 2019
595 Ga0207640_10327720 3300025981 Bacteria 1222
596 Ga0207640_10734150 3300025981 Bacteria 850
597 Ga0207640_10761161 3300025981 Bacteria 836
598 Ga0207640_10954915 3300025981 Bacteria 752
599 Ga0207658_10000197 3300025986 Bacteria 63743
600 Ga0207658_10734154 3300025986 Bacteria 894
601 Ga0207677_10154074 3300026023 Bacteria 1777
602 Ga0207677_10704384 3300026023 Bacteria 896
603 Ga0207677_12016001 3300026023 Unclassified 536
604 Ga0207703_10096065 3300026035 Bacteria 2501
605 Ga0207703_10167161 3300026035 Bacteria 1931
606 Ga0207703_10422123 3300026035 Bacteria 1241
607 Ga0207703_11054795 3300026035 Bacteria 780
608 Ga0207703_11380736 3300026035 Bacteria 678
609 Ga0207678_10246095 3300026067 Bacteria 1531
610 Ga0207678_10512222 3300026067 Bacteria 1047
611 Ga0207708_10003436 3300026075 Bacteria 11669
612 Ga0207708_10029898 3300026075 Bacteria 4131
613 Ga0207708_10091093 3300026075 Bacteria 2351
614 Ga0207708_10132218 3300026075 Bacteria 1952
615 Ga0207708_10180197 3300026075 Bacteria 1677
616 Ga0207702_10189450 3300026078 Bacteria 1899
617 Ga0207641_10017045 3300026088 Bacteria 5945
618 Ga0207641_10183121 3300026088 Bacteria 1920
619 Ga0207641_10254176 3300026088 Bacteria 1642
620 Ga0207641_10859732 3300026088 Bacteria 899
621 Ga0207641_11307783 3300026088 Bacteria 725
622 Ga0207648_10006798 3300026089 Bacteria 11340
623 Ga0207648_10010221 3300026089 Bacteria 8921
624 Ga0207648_10022150 3300026089 Bacteria 5708
625 Ga0207648_10065638 3300026089 Bacteria 3164
626 Ga0207648_10125085 3300026089 Bacteria 2261
627 Ga0207648_10208303 3300026089 Bacteria 1735
628 Ga0207648_10641701 3300026089 Bacteria 981
629 Ga0207676_10023885 3300026095 Bacteria 4518
630 Ga0207676_10298808 3300026095 Bacteria 1469
631 Ga0207676_10365983 3300026095 Bacteria 1338
632 Ga0207674_10063658 3300026116 Bacteria 3723
633 Ga0207674_10094187 3300026116 Bacteria 2982
634 Ga0207674_10923396 3300026116 Bacteria 841
635 Ga0207675_100006775 3300026118 Bacteria 10836
636 Ga0207675_100018555 3300026118 Bacteria 6490
637 Ga0207675_100028532 3300026118 Bacteria 5197
638 Ga0207675_100055390 3300026118 Bacteria 3699
639 Ga0207675_100070045 3300026118 Bacteria 3278
640 Ga0207675_100096188 3300026118 Bacteria 2788
641 Ga0207675_100187573 3300026118 Bacteria 1982
642 Ga0207675_100494449 3300026118 Bacteria 1217
643 Ga0207675_102019977 3300026118 Bacteria 594
644 Ga0207683_10028583 3300026121 Bacteria 4823
645 Ga0207683_10059345 3300026121 Bacteria 3361
646 Ga0207683_10206023 3300026121 Bacteria 1789
647 Ga0207683_10214207 3300026121 Bacteria 1754
648 Ga0207683_10394443 3300026121 Bacteria 1273
649 Ga0207683_10524950 3300026121 Bacteria 1094
650 Ga0207683_11035767 3300026121 Bacteria 762
651 Ga0207683_11589114 3300026121 Bacteria 603
652 Ga0207698_10513602 3300026142 Bacteria 1168
653 Ga0207698_11103328 3300026142 Bacteria 806
654 Ga0207698_12312798 3300026142 Bacteria 549
655 Ga0210000_1016949 3300027462 Bacteria 1102
656 Ga0209968_1054170 3300027526 Bacteria 700
657 Ga0209970_1007302 3300027614 Bacteria 1811
658 Ga0210002_1018709 3300027617 Bacteria 1109
659 Ga0209971_1008263 3300027682 Bacteria 2467
660 Ga0209971_1072879 3300027682 Bacteria 834
661 Ga0209966_1015446 3300027695 Bacteria 1434
662 Ga0209966_1064389 3300027695 Bacteria 796
663 Ga0209998_10007799 3300027717 Bacteria 2222
664 Ga0209974_10042439 3300027876 Bacteria 1514
665 Ga0209974_10128081 3300027876 Bacteria 904
666 Ga0207428_10156321 3300027907 Bacteria 1734
667 Ga0207428_10221566 3300027907 Bacteria 1418
668 Ga0207428_10326338 3300027907 Bacteria 1133
669 Ga0268266_10080203 3300028379 Bacteria 2843
670 Ga0268266_10237482 3300028379 Bacteria 1681
671 Ga0268266_10472430 3300028379 Bacteria 1194
672 Ga0268266_11790717 3300028379 Bacteria 589
673 Ga0268265_10073416 3300028380 Bacteria 2672
674 Ga0268265_10087869 3300028380 Bacteria 2475
675 Ga0268265_10485084 3300028380 Bacteria 1162
676 Ga0268265_10498585 3300028380 Bacteria 1147
677 Ga0268265_10531940 3300028380 Bacteria 1113
678 Ga0268265_10717636 3300028380 Bacteria 967
679 Ga0268265_12095664 3300028380 Bacteria 573
680 Ga0268264_10019390 3300028381 Bacteria 5559
681 Ga0268264_10084470 3300028381 Bacteria 2722
682 Ga0268264_10133590 3300028381 Bacteria 2204
683 Ga0265336_10076650 3300028666 Bacteria 999
684 Ga0307517_10228870 3300028786 Bacteria 1119
685 Ga0307515_10000358 3300028794 Bacteria 112133
686 Ga0307515_10293201 3300028794 Bacteria 1320
687 Ga0307511_10344090 3300030521 Bacteria 645
688 Ga0307513_10031619 3300031456 Bacteria 5991
689 Ga0307513_10076534 3300031456 Bacteria 3470
690 Ga0307408_100041613 3300031548 Bacteria 3258
691 Ga0307408_100050815 3300031548 Bacteria 2983
692 Ga0307408_101174283 3300031548 Bacteria 715
693 Ga0316575_10054229 3300031665 Bacteria 1597
694 Ga0316579_10046748 3300031691 Bacteria 2020
695 Ga0316576_10167592 3300031727 Bacteria 1657
696 Ga0316578_10072822 3300031728 Bacteria 2035
697 Ga0307516_10824918 3300031730 Bacteria 590
698 Ga0307405_10112123 3300031731 Bacteria 1850
699 Ga0307405_10112223 3300031731 Bacteria 1849
700 Ga0307405_10314844 3300031731 Bacteria 1193
701 Ga0307405_11443449 3300031731 Bacteria 603
702 Ga0316577_10016044 3300031733 Bacteria 4123
703 Ga0307413_10009445 3300031824 Bacteria 4670
704 Ga0307413_10147138 3300031824 Bacteria 1636
705 Ga0307410_10027077 3300031852 Bacteria 3619
706 Ga0307410_11196331 3300031852 Unclassified 662
707 Ga0307406_10011667 3300031901 Bacteria 4988
708 Ga0307406_10310814 3300031901 Unclassified 1215
709 Ga0307406_12021221 3300031901 Bacteria 515
710 Ga0307407_10012375 3300031903 Bacteria 4098
711 Ga0307407_10205972 3300031903 Bacteria 1321
712 Ga0307407_10338632 3300031903 Unclassified 1061
713 Ga0307412_10109505 3300031911 Bacteria 1969
714 Ga0307412_10343604 3300031911 Unclassified 1195
715 Ga0307412_11011721 3300031911 Bacteria 735
716 Ga0307412_11738684 3300031911 Bacteria 572
717 Ga0307409_100030472 3300031995 Bacteria 3876
718 Ga0307409_100072272 3300031995 Bacteria 2746
719 Ga0307409_100094227 3300031995 Bacteria 2463
720 Ga0307416_100007315 3300032002 Bacteria 7006
721 Ga0307416_100094520 3300032002 Unclassified 2578
722 Ga0307416_100446731 3300032002 Bacteria 1344
723 Ga0307414_10497157 3300032004 Bacteria 1078
724 Ga0307414_10906003 3300032004 Unclassified 809
725 Ga0307411_10009093 3300032005 Bacteria 5199
726 Ga0307411_10081837 3300032005 Bacteria 2225
727 Ga0307411_10314037 3300032005 Bacteria 1262
728 Ga0307411_10385597 3300032005 Bacteria 1154
729 Ga0307411_10742234 3300032005 Bacteria 859
730 Ga0307415_100025640 3300032126 Bacteria 3704
731 Ga0307415_100748194 3300032126 Bacteria 887
732 Ga0307415_101938870 3300032126 Bacteria 572
733 Ga0316585_10010265 3300032137 Bacteria 2746
734 Ga0316580_10049611 3300032139 Bacteria 1293
735 Ga0373958_0191400 3300034819 Bacteria 532
736 Ga0373928_0150689 3300035084 Bacteria 644
737 Ga0373961_0182157 3300035241 Bacteria 732
738 Ga0316574_0079917 3300035398 Bacteria 2074
739 Ga0373931_0357414 3300035691 Bacteria 916
740 Ga0373931_0452931 3300035691 Bacteria 821
741 Ga0316584_0229151 3300036712 Bacteria 1362
742 Ga0373925_0463292 3300037068 Bacteria 1039
743 Ga0439465_0281421 3300041413 Bacteria 620
744 Ga0451791_0408146 3300041451 Bacteria 2761
745 Ga0451791_1109250 3300041451 Bacteria 1818
746 Ga0451793_1139976 3300041452 Unclassified 573
747 Ga0451793_1266290 3300041452 Bacteria 964
748 Ga0451797_1322930 3300041453 Bacteria 2125
749 Ga0451800_0205198 3300041459 Bacteria 1169
750 Ga0451802_0332107 3300041460 Bacteria 1238
751 Ga0451807_0568058 3300041486 Bacteria 2713
752 Ga0451807_2422974 3300041486 Bacteria 929
753 Ga0451807_2604943 3300041486 Bacteria 1053
754 Ga0451837_1029966 3300041494 Bacteria 3320
755 Ga0451853_2805711 3300041512 Unclassified 543
756 Ga0451853_3090388 3300041512 Bacteria 597
757 Ga0451853_3458144 3300041512 Bacteria 1738
758 Ga0451853_3968423 3300041512 Bacteria 1138
759 Ga0439441_002708 3300042001 Bacteria 2524
760 Ga0439445_0057312 3300042004 Unclassified 1060
761 Ga0439434_0122921 3300042435 Bacteria 847
762 Ga0439444_0086875 3300042437 Bacteria 692
763 Ga0439459_0195351 3300042438 Bacteria 550
764 Ga0439460_0087242 3300042461 Bacteria 987
765 Ga0451577_0120548 3300042876 Bacteria 2349
766 Ga0451577_0141480 3300042876 Unclassified 2162
767 Ga0453684_0121922 3300044712 Bacteria 3146
768 Ga0453684_1138063 3300044712 Unclassified 823
769 Ga0453684_2369017 3300044712 Bacteria 526
770 Ga0451576_0732517 3300045051 Bacteria 1039
771 Ga0451576_1684726 3300045051 Bacteria 657
772 Ga0495627_215332 3300046453 Bacteria 528
773 Ga0495592_0567717 3300046454 Bacteria 696
774 Ga0495590_0005899 3300046457 Bacteria 4806
775 Ga0495638_0031603 3300046460 Bacteria 3401
776 Ga0495641_0296405 3300046461 Bacteria 729
777 Ga0495650_0087027 3300046471 Bacteria 1195
778 Ga0495580_0398656 3300046472 Bacteria 928
779 Ga0495639_0047934 3300046475 Bacteria 1937
780 Ga0495584_0711558 3300046491 Bacteria 512
781 Ga0495585_0080608 3300046492 Bacteria 1764
782 Ga0495585_0105295 3300046492 Bacteria 1505
783 Ga0495585_0360636 3300046492 Bacteria 705
784 Ga0495616_0156341 3300046513 Bacteria 1028
785 Ga0495618_0118886 3300046514 Bacteria 1693
786 Ga0495620_0129520 3300046515 Bacteria 991
787 Ga0495628_0229858 3300046516 Bacteria 1391
788 Ga0495632_0088149 3300046519 Bacteria 1474
789 Ga0495632_0273994 3300046519 Bacteria 752
790 Ga0495637_0017363 3300046520 Bacteria 3355
791 Ga0495644_0345835 3300046523 Bacteria 585
792 Ga0495663_0037513 3300046525 Bacteria 1462
793 Ga0495652_0186082 3300046529 Bacteria 1589
794 Ga0495640_0574015 3300046533 Bacteria 683
795 Ga0495587_0169715 3300046536 Bacteria 1240
796 Ga0495587_0394923 3300046536 Bacteria 769
797 Ga0495621_0002870 3300046539 Bacteria 4694
798 Ga0495621_0153108 3300046539 Bacteria 908
799 Ga0495621_0275249 3300046539 Bacteria 693
800 Ga0495667_0155994 3300046559 Bacteria 1469
801 Ga0495656_0075175 3300046615 Bacteria 1511
802 Ga0495656_0087629 3300046615 Bacteria 1418
803 Ga0495668_0374095 3300046616 Bacteria 782
804 Ga0495611_0338941 3300046648 Bacteria 691
805 Ga0495625_0060202 3300046660 Bacteria 2691
806 Ga0495625_0077317 3300046660 Bacteria 2326
807 Ga0495625_0081023 3300046660 Bacteria 2260
808 Ga0495635_0362707 3300046663 Bacteria 966
809 Ga0495659_0107385 3300046664 Bacteria 1087
810 Ga0495661_0214993 3300046665 Bacteria 999
811 Ga0495599_0237946 3300046678 Bacteria 1111
812 Ga0495599_0420483 3300046678 Bacteria 794
813 Ga0495670_0435474 3300046691 Bacteria 710
814 Ga0495649_0506525 3300046694 Bacteria 600
815 Ga0495649_0537546 3300046694 Bacteria 579
816 Ga0495581_0820107 3300047315 Bacteria 533
817 Ga0495604_0119888 3300047317 Bacteria 1906
818 Ga0495604_0771887 3300047317 Bacteria 607
819 Ga0495685_019324 3300047447 Bacteria 2341
820 Ga0495684_0817617 3300047471 Bacteria 607
821 Ga0495602_0368870 3300048088 Bacteria 1031
822 Ga0495615_0047193 3300048090 Bacteria 1097
823 Ga0495626_0116094 3300048091 Bacteria 1155
824 Ga0496100_0004400 3300048903 Bacteria 7463
825 Ga0496100_0182201 3300048903 Bacteria 1519
826 Ga0496102_0095979 3300048905 Bacteria 2748
827 Ga0496102_1275242 3300048905 Bacteria 654
828 Ga0496103_0026288 3300048906 Bacteria 3523
829 Ga0496103_0991334 3300048906 Bacteria 523
830 Ga0496104_0004927 3300048907 Bacteria 11647
831 Ga0496104_0090195 3300048907 Bacteria 2929
832 Ga0496104_0294739 3300048907 Bacteria 1535
833 Ga0496105_0010453 3300048908 Bacteria 7296
834 Ga0496105_0219291 3300048908 Bacteria 1549
835 Ga0496105_0721191 3300048908 Bacteria 764
836 Ga0496106_0018018 3300048909 Bacteria 5221
837 Ga0496106_0073320 3300048909 Bacteria 2619
838 Ga0496107_0001216 3300048910 Bacteria 15691
839 Ga0496107_0122677 3300048910 Bacteria 1914
840 Ga0496108_0001982 3300048911 Bacteria 16387
841 Ga0496109_0000633 3300048912 Bacteria 29328
842 Ga0496109_0111219 3300048912 Bacteria 2547
843 Ga0496109_0923270 3300048912 Bacteria 811
844 Ga0496110_0007585 3300048913 Bacteria 8669
845 Ga0496110_0682383 3300048913 Bacteria 928
846 Ga0496111_0006790 3300048914 Bacteria 7459
847 Ga0496111_0097382 3300048914 Bacteria 2159
848 Ga0496112_0000400 3300048915 Bacteria 28343
849 Ga0496112_0612154 3300048915 Bacteria 1020
850 Ga0496112_1148832 3300048915 Bacteria 694
851 Ga0496113_0005600 3300048916 Bacteria 7856
852 Ga0496113_0051586 3300048916 Bacteria 3070
853 Ga0496114_0204233 3300048917 Bacteria 1731
854 Ga0496114_0272876 3300048917 Bacteria 1490
855 Ga0496114_0274173 3300048917 Bacteria 1487
856 Ga0496114_0874533 3300048917 Bacteria 779
857 Ga0496115_0022318 3300048918 Bacteria 4902
858 Ga0496116_0152320 3300048919 Bacteria 1282
859 Ga0496117_0316061 3300048920 Bacteria 820
860 Ga0496118_0018464 3300048921 Bacteria 6293
861 Ga0496121_0105333 3300048924 Bacteria 2165
862 Ga0496122_0096002 3300048925 Bacteria 2001
863 Ga0496123_0100612 3300048926 Bacteria 1683
864 Ga0496124_0151279 3300048927 Bacteria 1820
865 Ga0496125_0000164 3300048928 Bacteria 147789
866 Ga0495678_163843 3300049459 Bacteria 709
867 Ga0501297_075804 3300049520 Unclassified 538
868 Ga0501031_0274551 3300049568 Bacteria 1094
869 Ga0501032_0014842 3300049569 Bacteria 5513
870 Ga0501032_0978080 3300049569 Bacteria 532
871 Ga0501033_0021211 3300049570 Bacteria 4901
872 Ga0501033_0179021 3300049570 Bacteria 1520
873 Ga0501033_0848342 3300049570 Bacteria 616
874 Ga0501036_0015220 3300049572 Bacteria 6423
875 Ga0501036_0041878 3300049572 Bacteria 3876
876 Ga0501036_0504276 3300049572 Bacteria 1007
877 Ga0501036_0521226 3300049572 Bacteria 988
878 Ga0501036_0922313 3300049572 Bacteria 716
879 Ga0501036_1068057 3300049572 Bacteria 660
880 Ga0501036_1086425 3300049572 Bacteria 654
881 Ga0501036_1267287 3300049572 Bacteria 600
882 Ga0501037_0796547 3300049573 Bacteria 624
883 Ga0501038_0020300 3300049574 Bacteria 5976
884 Ga0501038_0169293 3300049574 Bacteria 1770
885 Ga0501038_1221805 3300049574 Bacteria 545
886 Ga0501039_0058792 3300049575 Bacteria 2978
887 Ga0501039_0120483 3300049575 Bacteria 2056
888 Ga0501039_0527053 3300049575 Bacteria 927
889 Ga0501039_1028680 3300049575 Bacteria 639
890 Ga0501039_1317651 3300049575 Bacteria 557
891 Ga0501040_0010290 3300049576 Bacteria 6117
892 Ga0501040_0070046 3300049576 Bacteria 2420
893 Ga0501040_1041791 3300049576 Bacteria 593
894 Ga0501040_1347065 3300049576 Bacteria 518
895 Ga0501041_0033240 3300049577 Bacteria 3120
896 Ga0501041_0033891 3300049577 Bacteria 3090
897 Ga0501041_0429632 3300049577 Bacteria 838
898 Ga0501041_0447645 3300049577 Bacteria 820
899 Ga0501042_0035033 3300049578 Bacteria 3561
900 Ga0501042_0051674 3300049578 Bacteria 2932
901 Ga0501042_0519598 3300049578 Bacteria 865
902 Ga0501042_0600514 3300049578 Bacteria 800
903 Ga0501042_0601326 3300049578 Bacteria 800
904 Ga0501042_0606226 3300049578 Bacteria 796
905 Ga0501042_1055765 3300049578 Bacteria 592
906 Ga0501043_0259897 3300049579 Bacteria 1336
907 Ga0501043_0753301 3300049579 Bacteria 708
908 Ga0501046_0154988 3300049580 Bacteria 1726
909 Ga0501046_0166832 3300049580 Bacteria 1654
910 Ga0501046_0257553 3300049580 Bacteria 1283
911 Ga0501048_0058949 3300049582 Bacteria 2720
912 Ga0501048_0227922 3300049582 Bacteria 1322
913 Ga0501067_0173646 3300049583 Bacteria 1200
914 Ga0501068_0025220 3300049584 Bacteria 3497
915 Ga0501068_0046874 3300049584 Bacteria 2606
916 Ga0501068_0253447 3300049584 Bacteria 1122
917 Ga0501068_0668236 3300049584 Bacteria 679
918 Ga0501069_0017872 3300049585 Bacteria 3824
919 Ga0501069_0130668 3300049585 Bacteria 1438
920 Ga0501070_0084140 3300049586 Bacteria 2634
921 Ga0501070_0314163 3300049586 Bacteria 1275
922 Ga0501071_0038731 3300049587 Bacteria 3407
923 Ga0501071_0085395 3300049587 Bacteria 2314
924 Ga0501071_0392564 3300049587 Bacteria 1059
925 Ga0501072_0003174 3300049588 Bacteria 12358
926 Ga0501072_0197503 3300049588 Bacteria 1604
927 Ga0501072_0244921 3300049588 Bacteria 1428
928 Ga0501072_0300167 3300049588 Bacteria 1277
929 Ga0501072_0301214 3300049588 Bacteria 1274
930 Ga0501073_0062627 3300049589 Bacteria 2594
931 Ga0501073_0162868 3300049589 Bacteria 1545
932 Ga0501073_0408892 3300049589 Bacteria 938
933 Ga0501074_0055255 3300049590 Bacteria 2862
934 Ga0501074_0119587 3300049590 Bacteria 1884
935 Ga0501074_0285423 3300049590 Bacteria 1173
936 Ga0501074_0379355 3300049590 Bacteria 1003
937 Ga0501074_0543277 3300049590 Bacteria 823
938 Ga0501074_1141699 3300049590 Bacteria 547
939 Ga0501075_0008080 3300049591 Bacteria 7317
940 Ga0501075_0102482 3300049591 Bacteria 2174
941 Ga0501075_0129719 3300049591 Bacteria 1921
942 Ga0501075_0150567 3300049591 Bacteria 1774
943 Ga0501075_0279702 3300049591 Bacteria 1272
944 Ga0501075_0310909 3300049591 Bacteria 1201
945 Ga0501075_0498458 3300049591 Bacteria 929
946 Ga0501075_0661431 3300049591 Bacteria 796
947 Ga0501075_1122258 3300049591 Bacteria 597
948 Ga0501075_1311480 3300049591 Bacteria 549
949 Ga0501076_0037327 3300049592 Bacteria 3809
950 Ga0501076_0045487 3300049592 Bacteria 3466
951 Ga0501076_0057885 3300049592 Bacteria 3079
952 Ga0501076_0247013 3300049592 Bacteria 1460
953 Ga0501076_0362875 3300049592 Bacteria 1190
954 Ga0501076_0483046 3300049592 Bacteria 1021
955 Ga0501076_0543079 3300049592 Bacteria 958
956 Ga0501076_0959496 3300049592 Bacteria 705
957 Ga0501076_0990532 3300049592 Bacteria 692
958 Ga0501077_0009972 3300049593 Bacteria 5912
959 Ga0501077_0061225 3300049593 Bacteria 2388
960 Ga0501077_0226965 3300049593 Bacteria 1187
961 Ga0501077_0280574 3300049593 Bacteria 1060
962 Ga0501077_0305632 3300049593 Bacteria 1013
963 Ga0501077_0386524 3300049593 Bacteria 894
964 Ga0501077_0452288 3300049593 Bacteria 822
965 Ga0501079_0106401 3300049741 Bacteria 2177
966 Ga0501079_0252495 3300049741 Bacteria 1378
967 Ga0501079_0317593 3300049741 Bacteria 1219
968 Ga0501079_0462419 3300049741 Bacteria 996
969 Ga0501079_0468376 3300049741 Bacteria 990
970 Ga0501079_0567044 3300049741 Bacteria 893
971 Ga0501079_1041991 3300049741 Bacteria 644
972 Ga0501080_0192894 3300049742 Bacteria 1872
973 Ga0501080_0442922 3300049742 Bacteria 1165
974 Ga0501080_1323437 3300049742 Bacteria 616
975 Ga0501081_0088873 3300049743 Bacteria 2171
976 Ga0501081_0294962 3300049743 Bacteria 1189
977 Ga0501081_0324108 3300049743 Bacteria 1133
978 Ga0501081_1000567 3300049743 Bacteria 632
979 Ga0501081_1077780 3300049743 Bacteria 608
980 Ga0501081_1295789 3300049743 Bacteria 552
981 Ga0501083_0130949 3300049744 Bacteria 1644
982 Ga0501035_0156134 3300049822 Bacteria 1978
983 Ga0501035_0191060 3300049822 Bacteria 1760
984 Ga0501044_1171247 3300049823 Bacteria 637
985 Ga0501044_1236664 3300049823 Bacteria 614
986 Ga0501045_0054894 3300049824 Bacteria 2913
987 Ga0501045_0056579 3300049824 Bacteria 2869
988 Ga0501045_0177568 3300049824 Bacteria 1586
989 nmdc:mga03683_39084_c1 3300050489 Bacteria 1941
990 nmdc:mga03683_61999_c1 3300050489 Bacteria 1583
991 nmdc:mga03683_78013_c1 3300050489 Bacteria 858
992 nmdc:mga03n38_1178_c1 3300050490 Bacteria 7287
993 nmdc:mga03n38_194356_c1 3300050490 Bacteria 1047
994 nmdc:mga03n38_961607_c1 3300050490 Bacteria 504
995 nmdc:mga00v17_397260_c1 3300050491 Bacteria 896
996 nmdc:mga0yw44_10029_c1 3300050492 Bacteria 4819
997 nmdc:mga0yw44_212548_c1 3300050492 Bacteria 1280
998 nmdc:mga0yw44_29263_c2 3300050492 Bacteria 1024
999 nmdc:mga0yw44_832033_c1 3300050492 Bacteria 627
1000 nmdc:mga06z11_136192_c1 3300050494 Bacteria 1384
1001 nmdc:mga06z11_206027_c1 3300050494 Bacteria 1144
1002 nmdc:mga06z11_224408_c1 3300050494 Bacteria 1099
1003 nmdc:mga06z11_3732_c1 3300050494 Bacteria 5919
1004 nmdc:mga06z11_459846_c1 3300050494 Bacteria 769
1005 nmdc:mga07m45_134146_c1 3300050496 Bacteria 1433
1006 nmdc:mga07m45_1587_c1 3300050496 Bacteria 10470
1007 nmdc:mga05p37_102920_c1 3300050507 Bacteria 3516
1008 nmdc:mga05p37_1501614_c1 3300050507 Bacteria 671
1009 nmdc:mga05p37_1689629_c1 3300050507 Bacteria 618
1010 nmdc:mga05p37_176990_c1 3300050507 Bacteria 2598
1011 nmdc:mga05p37_2192820_c1 3300050507 Bacteria 513
1012 nmdc:mga05p37_348_c1 3300050507 Bacteria 49472
1013 nmdc:mga05p37_448926_c1 3300050507 Bacteria 1493
1014 nmdc:mga05p37_468372_c1 3300050507 Bacteria 1454
1015 nmdc:mga09592_1260904_c1 3300050508 Bacteria 609
1016 nmdc:mga09592_151652_c1 3300050508 Bacteria 2000
1017 nmdc:mga09592_5_c1 3300050508 Bacteria 130353
1018 nmdc:mga0qj67_1273265_c1 3300050509 Bacteria 570
1019 nmdc:mga0qj67_45509_c1 3300050509 Bacteria 3463
1020 nmdc:mga06r32_102295_c1 3300050510 Bacteria 2812
1021 nmdc:mga06r32_11679_c1 3300050510 Bacteria 7904
1022 nmdc:mga06r32_191709_c1 3300050510 Bacteria 2031
1023 nmdc:mga06r32_314673_c1 3300050510 Bacteria 1551
1024 nmdc:mga06r32_950258_c1 3300050510 Bacteria 814
1025 nmdc:mga06r32_96986_c1 3300050510 Bacteria 941
1026 nmdc:mga08y16_221905_c1 3300050511 Bacteria 1956
1027 nmdc:mga08y16_230263_c1 3300050511 Bacteria 1916
1028 nmdc:mga08y16_2349_c1 3300050511 Bacteria 19391
1029 nmdc:mga08y16_30230_c1 3300050511 Bacteria 5702
1030 nmdc:mga08y16_399159_c1 3300050511 Bacteria 1408
1031 nmdc:mga08y16_405778_c1 3300050511 Bacteria 1394
1032 nmdc:mga08y16_50531_c1 3300050511 Bacteria 4351
1033 nmdc:mga08y16_955334_c1 3300050511 Bacteria 840
1034 nmdc:mga0n895_409720_c1 3300050512 Bacteria 1371
1035 nmdc:mga0n895_413112_c1 3300050512 Bacteria 1364
1036 nmdc:mga0n895_42972_c1 3300050512 Bacteria 4401
1037 nmdc:mga0n895_473758_c1 3300050512 Bacteria 1263
1038 nmdc:mga0rr50_1077155_c1 3300050513 Bacteria 684
1039 nmdc:mga08x19_153055_c1 3300050514 Bacteria 1563
1040 nmdc:mga0a205_29717_c2 3300050515 Bacteria 3178
1041 nmdc:mga0a205_506359_c1 3300050515 Bacteria 1064
1042 nmdc:mga0a205_779377_c1 3300050515 Bacteria 804
1043 nmdc:mga0sz30_62707_c1 3300050516 Bacteria 1590
1044 Ga0495601_0013981 3300053077 Bacteria 4833
1045 Ga0495612_0094096 3300053078 Bacteria 1272
1046 Ga0500635_0102332 3300053080 Bacteria 1055
1047 Ga0495655_0000628 3300053083 Bacteria 5741
1048 Ga0495595_0155983 3300053084 Bacteria 1125
1049 Ga0495619_0380483 3300053085 Bacteria 975
1050 Ga0500607_259147 3300053121 Bacteria 683
1051 Ga0500618_005777 3300053125 Bacteria 3720
1052 Ga0500567_043907 3300053723 Bacteria 2073
1053 Ga0501084_0033695 3300054114 Bacteria 4284
1054 Ga0501084_0073208 3300054114 Bacteria 2869
1055 Ga0501084_0073995 3300054114 Bacteria 2853
1056 Ga0501084_0147187 3300054114 Bacteria 1984
1057 Ga0501084_1618901 3300054114 Bacteria 541
1058 Ga0501082_0006177 3300060353 Bacteria 10398
1059 Ga0501082_0180677 3300060353 Bacteria 1835
1060 Ga0501082_0182537 3300060353 Bacteria 1825
1061 Ga0501082_0251458 3300060353 Bacteria 1538
1062 Ga0501082_0294415 3300060353 Bacteria 1413
1063 Ga0501082_1646562 3300060353 Bacteria 560
1064 Ga0530510_0008431 3300061734 Bacteria 7184
1065 Ga0530510_0040315 3300061734 Bacteria 3370
1066 Ga0530510_0363112 3300061734 Bacteria 1089
1067 Ga0307408_100280122
1068 SwRhRL2b_contig_442106
1069 SwRhRL2b_contig_844195
1070 JGI24746J21847_1031565
1071 JGI24739J22299_10162950
1072 JGI24737J22298_10022369
1073 JGI24743J22301_10000289
1074 JGI24750J21931_1002677
1075 JGI24748J21848_1044144
1076 JGI24738J21930_10156264
1077 JGI24744J21845_10001142
1078 JGI24744J21845_10101059
1079 JGI24033J26618_1003370
1080 JGI24742J22300_10043033
1081 JGI24742J22300_10085329
1082 JGI24751J29686_10003925
1083 rootH2_10015358
1084 rootH1_10157129
1085 JGI25407J50210_10147166
1086 Ga0065715_10759263
1087 Ga0065707_10349446
1088 Ga0065707_10546411
1089 Ga0065707_10598815
1090 Ga0065707_10636514
1091 Ga0065707_10800179
1092 Ga0070676_10129134
1093 Ga0070676_10397834
1094 Ga0070676_10575923
1095 Ga0070683_102086620
1096 Ga0070690_100009413
1097 Ga0070690_100041690
1098 Ga0070690_100612470
1099 Ga0070690_100716923
1100 Ga0070670_100173351
1101 Ga0070670_100812416
1102 Ga0070677_10016023
1103 Ga0070677_10042171
1104 Ga0070677_10179249
1105 Ga0070677_10211260
1106 Ga0068869_100039936
1107 Ga0068869_100104321
1108 Ga0068869_100703600
1109 Ga0068869_101000833
1110 Ga0068869_101492468
1111 Ga0068869_101741194
1112 Ga0070666_10411434
1113 Ga0070680_100339665
1114 Ga0068868_100058792
1115 Ga0070660_100112452
1116 Ga0070689_100027085
1117 Ga0070689_100276349
1118 Ga0070689_100403657
1119 Ga0070689_100587071
1120 Ga0070689_100587204
1121 Ga0070691_10062475
1122 Ga0070691_10382175
1123 Ga0070691_10556161
1124 Ga0070687_100013616
1125 Ga0070687_100332283
1126 Ga0070687_100879638
1127 Ga0070661_100974151
1128 Ga0070692_10055110
1129 Ga0070692_10274115
1130 Ga0070692_10340976
1131 Ga0070668_100071393
1132 Ga0070668_100163900
1133 Ga0070668_100165081
1134 Ga0070668_100421980
1135 Ga0070668_100499828
1136 Ga0070668_100781846
1137 Ga0070668_101021219
1138 Ga0070669_100024281
1139 Ga0070669_100032969
1140 Ga0070669_100076141
1141 Ga0070669_101767839
1142 Ga0070675_100021110
1143 Ga0070675_100195145
1144 Ga0070675_100474882
1145 Ga0070675_100490600
1146 Ga0070674_100008010
1147 Ga0070674_100013939
1148 Ga0070674_100019263
1149 Ga0070674_100039433
1150 Ga0070674_100308610
1151 Ga0070674_100793274
1152 Ga0070673_100034287
1153 Ga0070673_100051856
1154 Ga0070673_100290422
1155 Ga0070673_100578887
1156 Ga0070673_100607969
1157 Ga0070673_100855410
1158 Ga0070673_101019821
1159 Ga0070673_101234034
1160 Ga0070673_101347997
1161 Ga0070688_100006679
1162 Ga0070688_100030550
1163 Ga0070688_100066185
1164 Ga0070688_100093546
1165 Ga0070688_100176158
1166 Ga0070688_100221112
1167 Ga0070659_100006061
1168 Ga0070659_100151620
1169 Ga0070659_101051100
1170 Ga0070667_100042351
1171 Ga0070667_100353143
1172 Ga0070667_100429111
1173 Ga0070667_101581259
1174 Ga0070703_10070998
1175 Ga0070701_10011428
1176 Ga0070701_10108626
1177 Ga0070701_10147202
1178 Ga0070701_10612076
1179 Ga0070701_10815755
1180 Ga0070711_101013505
1181 Ga0070705_100013904
1182 Ga0070705_100081424
1183 Ga0070705_100115279
1184 Ga0070705_100123176
1185 Ga0070705_100891852
1186 Ga0070700_100001831
1187 Ga0070700_100024645
1188 Ga0070700_100213204
1189 Ga0070700_100272249
1190 Ga0070700_100354636
1191 Ga0070700_100425144
1192 Ga0070700_100570968
1193 Ga0070694_100067189
1194 Ga0070694_100120415
1195 Ga0070694_100227034
1196 Ga0070694_100276844
1197 Ga0070694_100506881
1198 Ga0070694_100898372
1199 Ga0070694_100934547
1200 Ga0070663_100034544
1201 Ga0070663_100042205
1202 Ga0070663_100192677
1203 Ga0070678_100051594
1204 Ga0070678_100147121
1205 Ga0070678_100285946
1206 Ga0070678_100536330
1207 Ga0070678_100611740
1208 Ga0070662_100039586
1209 Ga0070662_100181707
1210 Ga0070662_100639693
1211 Ga0070662_100779514
1212 Ga0070662_100795103
1213 Ga0070662_101620786
1214 Ga0070681_10066648
1215 Ga0070681_11166494
1216 Ga0068867_100026934
1217 Ga0068867_100062864
1218 Ga0068867_100185720
1219 Ga0068867_100437315
1220 Ga0068867_100483201
1221 Ga0070685_10002826
1222 Ga0070685_10152406
1223 Ga0070685_10524535
1224 Ga0070707_100282148
1225 Ga0070707_101845867
1226 Ga0070698_100020375
1227 Ga0070698_101671845
1228 Ga0070699_100000012
1229 Ga0070699_100246708
1230 Ga0070699_100451974
1231 Ga0070679_100053571
1232 Ga0070684_100153697
1233 Ga0070697_100323693
1234 Ga0070697_100803916
1235 Ga0070697_101005284
1236 Ga0070697_101961306
1237 Ga0068853_100197108
1238 Ga0068853_100545824
1239 Ga0070672_100011114
1240 Ga0070672_100093329
1241 Ga0070672_100369918
1242 Ga0070672_100654130
1243 Ga0070672_101071472
1244 Ga0070686_100009432
1245 Ga0070686_100037119
1246 Ga0070686_100948792
1247 Ga0070695_100011470
1248 Ga0070695_100103183
1249 Ga0070695_100300607
1250 Ga0070695_101528312
1251 Ga0070696_100009053
1252 Ga0070696_100166438
1253 Ga0070693_100006310
1254 Ga0070693_100658952
1255 Ga0070665_100048285
1256 Ga0070665_100095945
1257 Ga0070665_100258146
1258 Ga0070665_100496069
1259 Ga0070665_101185842
1260 Ga0070704_100054091
1261 Ga0070704_100179392
1262 Ga0070704_100374703
1263 Ga0070664_100258165
1264 Ga0070664_100336652
1265 Ga0070664_101889046
1266 Ga0068857_100024296
1267 Ga0068857_100249292
1268 Ga0068857_100501143
1269 Ga0068857_100523862
1270 Ga0068854_100088893
1271 Ga0068854_100758180
1272 Ga0068854_100832597
1273 Ga0068854_101260940
1274 Ga0068854_101853022
1275 Ga0070702_100011472
1276 Ga0070702_100020816
1277 Ga0070702_100276643
1278 Ga0070702_100386439
1279 Ga0068852_100162491
1280 Ga0068852_102268943
1281 Ga0068859_100139957
1282 Ga0068859_100392249
1283 Ga0068859_100503115
1284 Ga0068859_100620354
1285 Ga0068859_100691468
1286 Ga0068859_100896314
1287 Ga0068859_100905409
1288 Ga0068859_102107141
1289 Ga0068864_100019800
1290 Ga0068864_100053857
1291 Ga0068864_100228708
1292 Ga0068864_101373641
1293 Ga0068866_10036038
1294 Ga0068866_10110477
1295 Ga0068866_10675756
1296 Ga0068866_10726436
1297 Ga0068861_100009091
1298 Ga0068861_100033722
1299 Ga0068861_100034292
1300 Ga0068861_100133863
1301 Ga0068861_100140301
1302 Ga0068861_100173354
1303 Ga0068861_100296339
1304 Ga0068861_100424974
1305 Ga0068861_100693384
1306 Ga0068870_10002310
1307 Ga0068870_10044675
1308 Ga0068870_10053710
1309 Ga0068870_10462106
1310 Ga0068870_10477476
1311 Ga0068863_100113905
1312 Ga0068863_100292468
1313 Ga0068863_100964527
1314 Ga0068863_101106419
1315 Ga0068863_101143695
1316 Ga0068863_101946318
1317 Ga0068863_102642931
1318 Ga0068858_100005836
1319 Ga0068858_100023261
1320 Ga0068858_100201330
1321 Ga0068858_100231770
1322 Ga0068860_100029497
1323 Ga0068860_100046638
1324 Ga0068860_100418461
1325 Ga0068860_100543002
1326 Ga0068860_100713908
1327 Ga0068860_100874969
1328 Ga0068860_100904726
1329 Ga0068862_100128197
1330 Ga0068862_100193183
1331 Ga0068862_100246388
1332 Ga0068862_100342701
1333 Ga0068862_100372681
1334 Ga0068862_100719449
1335 Ga0068862_101436801
1336 Ga0081455_10004385
1337 Ga0081455_10006450
1338 Ga0081538_10015699
1339 Ga0081538_10036943
1340 Ga0070717_11119478
1341 Ga0075365_10011977
1342 Ga0075365_10050444
1343 Ga0075365_10775439
1344 Ga0075363_100006440
1345 Ga0075363_100330740
1346 Ga0075364_10173269
1347 Ga0075432_10552234
1348 Ga0070715_10017981
1349 Ga0070712_100183080
1350 Ga0075362_10058135
1351 Ga0075362_10086876
1352 Ga0075362_10137611
1353 Ga0075367_10006406
1354 Ga0075367_10256038
1355 Ga0075367_10482339
1356 Ga0075367_10848917
1357 Ga0075369_10096470
1358 Ga0075369_10480281
1359 Ga0075366_10481327
1360 Ga0097621_100014001
1361 Ga0097621_100197699
1362 Ga0097621_100205331
1363 Ga0097621_100912438
1364 Ga0097621_100966918
1365 Ga0075370_10069593
1366 Ga0075370_10773796
1367 Ga0068871_100030159
1368 Ga0068871_100274062
1369 Ga0068871_100562601
1370 Ga0068871_100974999
1371 Ga0068871_101588998
1372 Ga0068871_102080032
1373 Ga0075428_100088621
1374 Ga0075428_100111490
1375 Ga0075428_100165771
1376 Ga0075428_100375310
1377 Ga0075428_100674699
1378 Ga0075430_100021899
1379 Ga0075430_100161849
1380 Ga0075430_100221187
1381 Ga0075430_100324024
1382 Ga0075430_101421549
1383 Ga0075431_100020076
1384 Ga0075431_100024922
1385 Ga0075431_100063780
1386 Ga0075431_100102562
1387 Ga0075431_100366567
1388 Ga0075433_10072810
1389 Ga0075434_100112818
1390 Ga0075434_100278673
1391 Ga0075434_100629395
1392 Ga0075434_101053870
1393 Ga0075434_101521405
1394 Ga0075429_100000516
1395 Ga0075429_100061796
1396 Ga0075429_101426640
1397 Ga0068865_100101247
1398 Ga0068865_100344279
1399 Ga0097620_100139956
1400 Ga0097620_100392299
1401 Ga0097620_100503145
1402 Ga0097620_100620283
1403 Ga0097620_100691483
1404 Ga0097620_100896301
1405 Ga0097620_100905368
1406 Ga0097620_102107088
1407 Ga0075435_100095165
1408 Ga0099795_10000022
1409 Ga0105250_10035451
1410 Ga0111539_10025568
1411 Ga0111539_10091488
1412 Ga0111539_10470432
1413 Ga0111539_10613229
1414 Ga0111539_10717690
1415 Ga0111539_10766076
1416 Ga0111539_11158669
1417 Ga0111539_11981300
1418 Ga0105245_10138958
1419 Ga0105247_10002316
1420 Ga0105247_10017387
1421 Ga0114129_10006246
1422 Ga0114129_10040767
1423 Ga0114129_10206847
1424 Ga0114129_10373351
1425 Ga0114129_10452513
1426 Ga0114129_10779165
1427 Ga0114129_11124000
1428 Ga0114129_11149003
1429 Ga0114129_11712671
1430 Ga0105243_10046925
1431 Ga0105243_10300094
1432 Ga0105243_10390765
1433 Ga0105243_10762726
1434 Ga0105243_10834875
1435 Ga0105241_10411180
1436 Ga0105241_10712673
1437 Ga0105242_10015964
1438 Ga0105242_10261036
1439 Ga0105242_13157271
1440 Ga0105248_10013593
1441 Ga0105248_10031395
1442 Ga0105248_10310970
1443 Ga0105248_10373142
1444 Ga0105248_10849747
1445 Ga0105237_10157318
1446 Ga0105237_11227353
1447 Ga0105238_10216685
1448 Ga0105238_10315895
1449 Ga0105238_10516766
1450 Ga0105238_11734471
1451 Ga0105249_10046617
1452 Ga0105249_10058640
1453 Ga0105249_10572772
1454 Ga0105249_10597082
1455 Ga0105249_10773384
1456 Ga0099796_10000153
1457 Ga0105239_10926368
1458 Ga0105246_10012857
1459 Ga0105246_10147417
1460 Ga0157341_1003637
1461 Ga0157326_1010374
1462 Ga0157326_1034287
1463 Ga0157373_10028056
1464 Ga0157371_10448916
1465 Ga0157371_10716731
1466 Ga0157371_11025873
1467 Ga0157374_10484621
1468 Ga0157374_12731598
1469 Ga0157378_10016082
1470 Ga0157378_10242931
1471 Ga0157378_11397435
1472 Ga0157378_12078554
1473 Ga0163162_10044564
1474 Ga0163162_10057411
1475 Ga0163162_11160413
1476 Ga0163162_11379610
1477 Ga0163162_11828480
1478 Ga0163162_11866294
1479 Ga0157372_10007051
1480 Ga0157372_10888523
1481 Ga0157375_10102597
1482 Ga0157375_10972892
1483 Ga0157375_11274581
1484 Ga0157375_13115047
1485 Ga0163163_10267597
1486 Ga0163163_10271568
1487 Ga0163163_10891707
1488 Ga0157380_10053038
1489 Ga0157380_10099751
1490 Ga0157380_10121023
1491 Ga0157380_10171516
1492 Ga0157380_10343883
1493 Ga0157380_10422125
1494 Ga0157380_10510970
1495 Ga0157380_10863907
1496 Ga0157380_10869019
1497 Ga0157380_11203236
1498 Ga0157380_11254780
1499 Ga0157380_11878385
1500 Ga0182008_10088724
1501 Ga0182008_10192751
1502 Ga0157377_10060707
1503 Ga0157377_10078011
1504 Ga0157379_10013529
1505 Ga0157379_10053782
1506 Ga0157379_10347170
1507 Ga0157379_10561869
1508 Ga0157379_10643133
1509 Ga0157379_10666387
1510 Ga0157379_11296301
1511 Ga0157379_12498597
1512 Ga0157376_10028966
1513 Ga0157376_10045197
1514 Ga0157376_10460957
1515 Ga0157376_10507449
1516 Ga0157376_11985290
1517 Ga0182006_1071938
1518 Ga0182007_10045579
1519 Ga0182007_10047438
1520 Ga0182007_10151356
1521 Ga0163161_10035357
1522 Ga0163161_10089587
1523 Ga0163161_10261797
1524 Ga0163161_10767451
1525 Ga0207638_1003840
1526 Ga0209758_1018310
1527 Ga0207697_10548945
1528 Ga0207682_10003239
1529 Ga0207682_10023027
1530 Ga0207642_10036811
1531 Ga0207642_10216771
1532 Ga0207642_10325115
1533 Ga0207642_10494725
1534 Ga0207710_10074811
1535 Ga0207688_10000283
1536 Ga0207688_10133948
1537 Ga0207680_10088104
1538 Ga0207680_10312532
1539 Ga0207647_10008609
1540 Ga0207647_10288886
1541 Ga0207685_10011195
1542 Ga0207645_10004284
1543 Ga0207645_10075319
1544 Ga0207645_10149060
1545 Ga0207645_10374439
1546 Ga0207645_10858230
1547 Ga0207643_10000615
1548 Ga0207643_10038281
1549 Ga0207643_10089816
1550 Ga0207643_10110027
1551 Ga0207643_10713642
1552 Ga0207707_10099173
1553 Ga0207671_10481807
1554 Ga0207671_10731091
1555 Ga0207663_10197530
1556 Ga0207662_10002182
1557 Ga0207662_10019443
1558 Ga0207662_10157989
1559 Ga0207662_10267689
1560 Ga0207657_10111144
1561 Ga0207657_10816507
1562 Ga0207649_10974225
1563 Ga0207649_11129601
1564 Ga0207652_10089380
1565 Ga0207652_11197203
1566 Ga0207646_10935093
1567 Ga0207681_10019540
1568 Ga0207681_10032108
1569 Ga0207681_10103416
1570 Ga0207681_10339484
1571 Ga0207681_10691224
1572 Ga0207681_10701050
1573 Ga0207694_10557457
1574 Ga0207694_10613141
1575 Ga0207694_10954270
1576 Ga0207694_11052464
1577 Ga0207650_10043430
1578 Ga0207650_10144074
1579 Ga0207650_10163106
1580 Ga0207659_10160130
1581 Ga0207659_10509646
1582 Ga0207659_11630553
1583 Ga0207659_11729908
1584 Ga0207690_10015285
1585 Ga0207690_10024268
1586 Ga0207690_10313276
1587 Ga0207690_10409627
1588 Ga0207706_10011257
1589 Ga0207706_10025823
1590 Ga0207706_10083579
1591 Ga0207706_10097236
1592 Ga0207706_10192645
1593 Ga0207706_10232699
1594 Ga0207706_10371654
1595 Ga0207706_10489218
1596 Ga0207706_10939280
1597 Ga0207706_11690729
1598 Ga0207686_10025970
1599 Ga0207686_10802782
1600 Ga0207709_10039886
1601 Ga0207709_10258863
1602 Ga0207709_10259269
1603 Ga0207709_11378050
1604 Ga0207670_10040465
1605 Ga0207670_10091205
1606 Ga0207670_10136471
1607 Ga0207670_10203833
1608 Ga0207669_10008898
1609 Ga0207669_10033296
1610 Ga0207669_10124508
1611 Ga0207669_10818753
1612 Ga0207669_11571520
1613 Ga0207704_10009089
1614 Ga0207704_10071029
1615 Ga0207704_10156445
1616 Ga0207704_10362465
1617 Ga0207704_10417450
1618 Ga0207704_10480390
1619 Ga0207704_10935495
1620 Ga0207665_10123760
1621 Ga0207691_10001340
1622 Ga0207691_10005505
1623 Ga0207691_10008332
1624 Ga0207691_10009993
1625 Ga0207691_10072598
1626 Ga0207691_10170907
1627 Ga0207691_10367487
1628 Ga0207691_10440963
1629 Ga0207691_10444171
1630 Ga0207711_10046436
1631 Ga0207711_10053060
1632 Ga0207711_10132630
1633 Ga0207711_10289652
1634 Ga0207711_10577632
1635 Ga0207711_10981813
1636 Ga0207689_10009385
1637 Ga0207689_10087974
1638 Ga0207689_11537481
1639 Ga0207689_11744840
1640 Ga0207679_10959545
1641 Ga0207679_11140419
1642 Ga0207651_10008440
1643 Ga0207651_10168645
1644 Ga0207651_10224327
1645 Ga0207651_10572169
1646 Ga0207651_10661013
1647 Ga0207651_10919728
1648 Ga0207712_10060130
1649 Ga0207712_10112492
1650 Ga0207712_10121386
1651 Ga0207712_11519808
1652 Ga0207668_10009499
1653 Ga0207668_10070567
1654 Ga0207668_10235326
1655 Ga0207668_10648104
1656 Ga0207668_10871932
1657 Ga0207668_11036018
1658 Ga0207668_11165618
1659 Ga0207640_10085407
1660 Ga0207640_10101516
1661 Ga0207640_10327720
1662 Ga0207640_10734150
1663 Ga0207640_10761161
1664 Ga0207640_10954915
1665 Ga0207658_10000197
1666 Ga0207658_10734154
1667 Ga0207677_10154074
1668 Ga0207677_10704384
1669 Ga0207677_12016001
1670 Ga0207703_10096065
1671 Ga0207703_10167161
1672 Ga0207703_10422123
1673 Ga0207703_11054795
1674 Ga0207703_11380736
1675 Ga0207678_10246095
1676 Ga0207678_10512222
1677 Ga0207708_10003436
1678 Ga0207708_10029898
1679 Ga0207708_10091093
1680 Ga0207708_10132218
1681 Ga0207708_10180197
1682 Ga0207702_10189450
1683 Ga0207641_10017045
1684 Ga0207641_10183121
1685 Ga0207641_10254176
1686 Ga0207641_10859732
1687 Ga0207641_11307783
1688 Ga0207648_10006798
1689 Ga0207648_10010221
1690 Ga0207648_10022150
1691 Ga0207648_10065638
1692 Ga0207648_10125085
1693 Ga0207648_10208303
1694 Ga0207648_10641701
1695 Ga0207676_10023885
1696 Ga0207676_10298808
1697 Ga0207676_10365983
1698 Ga0207674_10063658
1699 Ga0207674_10094187
1700 Ga0207674_10923396
1701 Ga0207675_100006775
1702 Ga0207675_100018555
1703 Ga0207675_100028532
1704 Ga0207675_100055390
1705 Ga0207675_100070045
1706 Ga0207675_100096188
1707 Ga0207675_100187573
1708 Ga0207675_100494449
1709 Ga0207675_102019977
1710 Ga0207683_10028583
1711 Ga0207683_10059345
1712 Ga0207683_10206023
1713 Ga0207683_10214207
1714 Ga0207683_10394443
1715 Ga0207683_10524950
1716 Ga0207683_11035767
1717 Ga0207683_11589114
1718 Ga0207698_10513602
1719 Ga0207698_11103328
1720 Ga0207698_12312798
1721 Ga0210000_1016949
1722 Ga0209968_1054170
1723 Ga0209970_1007302
1724 Ga0210002_1018709
1725 Ga0209971_1008263
1726 Ga0209971_1072879
1727 Ga0209966_1015446
1728 Ga0209966_1064389
1729 Ga0209998_10007799
1730 Ga0209974_10042439
1731 Ga0209974_10128081
1732 Ga0207428_10156321
1733 Ga0207428_10221566
1734 Ga0207428_10326338
1735 Ga0268266_10080203
1736 Ga0268266_10237482
1737 Ga0268266_10472430
1738 Ga0268266_11790717
1739 Ga0268265_10073416
1740 Ga0268265_10087869
1741 Ga0268265_10485084
1742 Ga0268265_10498585
1743 Ga0268265_10531940
1744 Ga0268265_10717636
1745 Ga0268265_12095664
1746 Ga0268264_10019390
1747 Ga0268264_10084470
1748 Ga0268264_10133590
1749 Ga0265336_10076650
1750 Ga0307517_10228870
1751 Ga0307515_10000358
1752 Ga0307515_10293201
1753 Ga0307511_10344090
1754 Ga0307513_10031619
1755 Ga0307513_10076534
1756 Ga0307408_100041613
1757 Ga0307408_100050815
1758 Ga0307408_101174283
1759 Ga0316575_10054229
1760 Ga0316579_10046748
1761 Ga0316576_10167592
1762 Ga0316578_10072822
1763 Ga0307516_10824918
1764 Ga0307405_10112123
1765 Ga0307405_10112223
1766 Ga0307405_10314844
1767 Ga0307405_11443449
1768 Ga0316577_10016044
1769 Ga0307413_10009445
1770 Ga0307413_10147138
1771 Ga0307410_10027077
1772 Ga0307410_11196331
1773 Ga0307406_10011667
1774 Ga0307406_10310814
1775 Ga0307406_12021221
1776 Ga0307407_10012375
1777 Ga0307407_10205972
1778 Ga0307407_10338632
1779 Ga0307412_10109505
1780 Ga0307412_10343604
1781 Ga0307412_11011721
1782 Ga0307412_11738684
1783 Ga0307409_100030472
1784 Ga0307409_100072272
1785 Ga0307409_100094227
1786 Ga0307416_100007315
1787 Ga0307416_100094520
1788 Ga0307416_100446731
1789 Ga0307414_10497157
1790 Ga0307414_10906003
1791 Ga0307411_10009093
1792 Ga0307411_10081837
1793 Ga0307411_10314037
1794 Ga0307411_10385597
1795 Ga0307411_10742234
1796 Ga0307415_100025640
1797 Ga0307415_100748194
1798 Ga0307415_101938870
1799 Ga0316585_10010265
1800 Ga0316580_10049611
1801 Ga0373958_0191400
1802 Ga0373928_0150689
1803 Ga0373961_0182157
1804 Ga0316574_0079917
1805 Ga0373931_0357414
1806 Ga0373931_0452931
1807 Ga0316584_0229151
1808 Ga0373925_0463292
1809 Ga0439465_0281421
1810 Ga0451791_0408146
1811 Ga0451791_1109250
1812 Ga0451793_1139976
1813 Ga0451793_1266290
1814 Ga0451797_1322930
1815 Ga0451800_0205198
1816 Ga0451802_0332107
1817 Ga0451807_0568058
1818 Ga0451807_2422974
1819 Ga0451807_2604943
1820 Ga0451837_1029966
1821 Ga0451853_2805711
1822 Ga0451853_3090388
1823 Ga0451853_3458144
1824 Ga0451853_3968423
1825 Ga0439441_002708
1826 Ga0439445_0057312
1827 Ga0439434_0122921
1828 Ga0439444_0086875
1829 Ga0439459_0195351
1830 Ga0439460_0087242
1831 Ga0451577_0120548
1832 Ga0451577_0141480
1833 Ga0453684_0121922
1834 Ga0453684_1138063
1835 Ga0453684_2369017
1836 Ga0451576_0732517
1837 Ga0451576_1684726
1838 Ga0495627_215332
1839 Ga0495592_0567717
1840 Ga0495590_0005899
1841 Ga0495638_0031603
1842 Ga0495641_0296405
1843 Ga0495650_0087027
1844 Ga0495580_0398656
1845 Ga0495639_0047934
1846 Ga0495584_0711558
1847 Ga0495585_0080608
1848 Ga0495585_0105295
1849 Ga0495585_0360636
1850 Ga0495616_0156341
1851 Ga0495618_0118886
1852 Ga0495620_0129520
1853 Ga0495628_0229858
1854 Ga0495632_0088149
1855 Ga0495632_0273994
1856 Ga0495637_0017363
1857 Ga0495644_0345835
1858 Ga0495663_0037513
1859 Ga0495652_0186082
1860 Ga0495640_0574015
1861 Ga0495587_0169715
1862 Ga0495587_0394923
1863 Ga0495621_0002870
1864 Ga0495621_0153108
1865 Ga0495621_0275249
1866 Ga0495667_0155994
1867 Ga0495656_0075175
1868 Ga0495656_0087629
1869 Ga0495668_0374095
1870 Ga0495611_0338941
1871 Ga0495625_0060202
1872 Ga0495625_0077317
1873 Ga0495625_0081023
1874 Ga0495635_0362707
1875 Ga0495659_0107385
1876 Ga0495661_0214993
1877 Ga0495599_0237946
1878 Ga0495599_0420483
1879 Ga0495670_0435474
1880 Ga0495649_0506525
1881 Ga0495649_0537546
1882 Ga0495581_0820107
1883 Ga0495604_0119888
1884 Ga0495604_0771887
1885 Ga0495685_019324
1886 Ga0495684_0817617
1887 Ga0495602_0368870
1888 Ga0495615_0047193
1889 Ga0495626_0116094
1890 Ga0496100_0004400
1891 Ga0496100_0182201
1892 Ga0496102_0095979
1893 Ga0496102_1275242
1894 Ga0496103_0026288
1895 Ga0496103_0991334
1896 Ga0496104_0004927
1897 Ga0496104_0090195
1898 Ga0496104_0294739
1899 Ga0496105_0010453
1900 Ga0496105_0219291
1901 Ga0496105_0721191
1902 Ga0496106_0018018
1903 Ga0496106_0073320
1904 Ga0496107_0001216
1905 Ga0496107_0122677
1906 Ga0496108_0001982
1907 Ga0496109_0000633
1908 Ga0496109_0111219
1909 Ga0496109_0923270
1910 Ga0496110_0007585
1911 Ga0496110_0682383
1912 Ga0496111_0006790
1913 Ga0496111_0097382
1914 Ga0496112_0000400
1915 Ga0496112_0612154
1916 Ga0496112_1148832
1917 Ga0496113_0005600
1918 Ga0496113_0051586
1919 Ga0496114_0204233
1920 Ga0496114_0272876
1921 Ga0496114_0274173
1922 Ga0496114_0874533
1923 Ga0496115_0022318
1924 Ga0496116_0152320
1925 Ga0496117_0316061
1926 Ga0496118_0018464
1927 Ga0496121_0105333
1928 Ga0496122_0096002
1929 Ga0496123_0100612
1930 Ga0496124_0151279
1931 Ga0496125_0000164
1932 Ga0495678_163843
1933 Ga0501297_075804
1934 Ga0501031_0274551
1935 Ga0501032_0014842
1936 Ga0501032_0978080
1937 Ga0501033_0021211
1938 Ga0501033_0179021
1939 Ga0501033_0848342
1940 Ga0501036_0015220
1941 Ga0501036_0041878
1942 Ga0501036_0504276
1943 Ga0501036_0521226
1944 Ga0501036_0922313
1945 Ga0501036_1068057
1946 Ga0501036_1086425
1947 Ga0501036_1267287
1948 Ga0501037_0796547
1949 Ga0501038_0020300
1950 Ga0501038_0169293
1951 Ga0501038_1221805
1952 Ga0501039_0058792
1953 Ga0501039_0120483
1954 Ga0501039_0527053
1955 Ga0501039_1028680
1956 Ga0501039_1317651
1957 Ga0501040_0010290
1958 Ga0501040_0070046
1959 Ga0501040_1041791
1960 Ga0501040_1347065
1961 Ga0501041_0033240
1962 Ga0501041_0033891
1963 Ga0501041_0429632
1964 Ga0501041_0447645
1965 Ga0501042_0035033
1966 Ga0501042_0051674
1967 Ga0501042_0519598
1968 Ga0501042_0600514
1969 Ga0501042_0601326
1970 Ga0501042_0606226
1971 Ga0501042_1055765
1972 Ga0501043_0259897
1973 Ga0501043_0753301
1974 Ga0501046_0154988
1975 Ga0501046_0166832
1976 Ga0501046_0257553
1977 Ga0501048_0058949
1978 Ga0501048_0227922
1979 Ga0501067_0173646
1980 Ga0501068_0025220
1981 Ga0501068_0046874
1982 Ga0501068_0253447
1983 Ga0501068_0668236
1984 Ga0501069_0017872
1985 Ga0501069_0130668
1986 Ga0501070_0084140
1987 Ga0501070_0314163
1988 Ga0501071_0038731
1989 Ga0501071_0085395
1990 Ga0501071_0392564
1991 Ga0501072_0003174
1992 Ga0501072_0197503
1993 Ga0501072_0244921
1994 Ga0501072_0300167
1995 Ga0501072_0301214
1996 Ga0501073_0062627
1997 Ga0501073_0162868
1998 Ga0501073_0408892
1999 Ga0501074_0055255
2000 Ga0501074_0119587
2001 Ga0501074_0285423
2002 Ga0501074_0379355
2003 Ga0501074_0543277
2004 Ga0501074_1141699
2005 Ga0501075_0008080
2006 Ga0501075_0102482
2007 Ga0501075_0129719
2008 Ga0501075_0150567
2009 Ga0501075_0279702
2010 Ga0501075_0310909
2011 Ga0501075_0498458
2012 Ga0501075_0661431
2013 Ga0501075_1122258
2014 Ga0501075_1311480
2015 Ga0501076_0037327
2016 Ga0501076_0045487
2017 Ga0501076_0057885
2018 Ga0501076_0247013
2019 Ga0501076_0362875
2020 Ga0501076_0483046
2021 Ga0501076_0543079
2022 Ga0501076_0959496
2023 Ga0501076_0990532
2024 Ga0501077_0009972
2025 Ga0501077_0061225
2026 Ga0501077_0226965
2027 Ga0501077_0280574
2028 Ga0501077_0305632
2029 Ga0501077_0386524
2030 Ga0501077_0452288
2031 Ga0501079_0106401
2032 Ga0501079_0252495
2033 Ga0501079_0317593
2034 Ga0501079_0462419
2035 Ga0501079_0468376
2036 Ga0501079_0567044
2037 Ga0501079_1041991
2038 Ga0501080_0192894
2039 Ga0501080_0442922
2040 Ga0501080_1323437
2041 Ga0501081_0088873
2042 Ga0501081_0294962
2043 Ga0501081_0324108
2044 Ga0501081_1000567
2045 Ga0501081_1077780
2046 Ga0501081_1295789
2047 Ga0501083_0130949
2048 Ga0501035_0156134
2049 Ga0501035_0191060
2050 Ga0501044_1171247
2051 Ga0501044_1236664
2052 Ga0501045_0054894
2053 Ga0501045_0056579
2054 Ga0501045_0177568
2055 nmdc:mga03683_39084_c1
2056 nmdc:mga03683_61999_c1
2057 nmdc:mga03683_78013_c1
2058 nmdc:mga03n38_1178_c1
2059 nmdc:mga03n38_194356_c1
2060 nmdc:mga03n38_961607_c1
2061 nmdc:mga00v17_397260_c1
2062 nmdc:mga0yw44_10029_c1
2063 nmdc:mga0yw44_212548_c1
2064 nmdc:mga0yw44_29263_c2
2065 nmdc:mga0yw44_832033_c1
2066 nmdc:mga06z11_136192_c1
2067 nmdc:mga06z11_206027_c1
2068 nmdc:mga06z11_224408_c1
2069 nmdc:mga06z11_3732_c1
2070 nmdc:mga06z11_459846_c1
2071 nmdc:mga07m45_134146_c1
2072 nmdc:mga07m45_1587_c1
2073 nmdc:mga05p37_102920_c1
2074 nmdc:mga05p37_1501614_c1
2075 nmdc:mga05p37_1689629_c1
2076 nmdc:mga05p37_176990_c1
2077 nmdc:mga05p37_2192820_c1
2078 nmdc:mga05p37_348_c1
2079 nmdc:mga05p37_448926_c1
2080 nmdc:mga05p37_468372_c1
2081 nmdc:mga09592_1260904_c1
2082 nmdc:mga09592_151652_c1
2083 nmdc:mga09592_5_c1
2084 nmdc:mga0qj67_1273265_c1
2085 nmdc:mga0qj67_45509_c1
2086 nmdc:mga06r32_102295_c1
2087 nmdc:mga06r32_11679_c1
2088 nmdc:mga06r32_191709_c1
2089 nmdc:mga06r32_314673_c1
2090 nmdc:mga06r32_950258_c1
2091 nmdc:mga06r32_96986_c1
2092 nmdc:mga08y16_221905_c1
2093 nmdc:mga08y16_230263_c1
2094 nmdc:mga08y16_2349_c1
2095 nmdc:mga08y16_30230_c1
2096 nmdc:mga08y16_399159_c1
2097 nmdc:mga08y16_405778_c1
2098 nmdc:mga08y16_50531_c1
2099 nmdc:mga08y16_955334_c1
2100 nmdc:mga0n895_409720_c1
2101 nmdc:mga0n895_413112_c1
2102 nmdc:mga0n895_42972_c1
2103 nmdc:mga0n895_473758_c1
2104 nmdc:mga0rr50_1077155_c1
2105 nmdc:mga08x19_153055_c1
2106 nmdc:mga0a205_29717_c2
2107 nmdc:mga0a205_506359_c1
2108 nmdc:mga0a205_779377_c1
2109 nmdc:mga0sz30_62707_c1
2110 Ga0495601_0013981
2111 Ga0495612_0094096
2112 Ga0500635_0102332
2113 Ga0495655_0000628
2114 Ga0495595_0155983
2115 Ga0495619_0380483
2116 Ga0500607_259147
2117 Ga0500618_005777
2118 Ga0500567_043907
2119 Ga0501084_0033695
2120 Ga0501084_0073208
2121 Ga0501084_0073995
2122 Ga0501084_0147187
2123 Ga0501084_1618901
2124 Ga0501082_0006177
2125 Ga0501082_0180677
2126 Ga0501082_0182537
2127 Ga0501082_0251458
2128 Ga0501082_0294415
2129 Ga0501082_1646562
2130 Ga0530510_0008431
2131 Ga0530510_0040315
2132 Ga0530510_0363112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

2

105

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9287 2 118
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9251 2 120
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8845 2 118
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8504 2 120
8avi-assembly1.cif.gz_B crystal structure of isdg from bacillus cereus in complex with heme 0.7765 4 120
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9346 3 120 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9194 3 120 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7711 1 119 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7483 2 117 3.30.70.100
4dpoB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7472 3 116 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4R2I8P8-F1-model_v4 Uncharacterized protein YbaA (DUF1428 family) 0.9604 3 120
AF-A0A2W7C8D6-F1-model_v4 RNA signal recognition particle 0.9591 3 120
AF-A0A6J4S241-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9583 2 120
AF-A0A442F9M7-F1-model_v4 DUF1428 family protein 0.958 3 120
AF-A0A2P9AJ88-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9576 3 120

Map