F489405
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1066 | 526 | 2132 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300031852|Ga0307410_10851425|Ga0307410_108514252 |
| Length | 172 |
| Sequence | MSTATTEGREIPRLKTKYREEIVAAMQSEFSYPNVMQVPGLTKIVVNMGVGEAARDSKLIEGAVKDLTAITGQKPQVTKARKSIAQFKLREGMPIGAHVTLRGDRMWEFLDRLLDGRGNYTFGLTEQVMFHEIDQDRVDRSRGMDITVVTTATNDDEGRALLKQLGFPFKEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 109 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 110 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 111 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 112 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 202 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 203 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 204 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 205 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 211 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 212 | 3300031635 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 213 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 214 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 229 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 230 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 231 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 239 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 242 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 243 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 245 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 263 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 270 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 271 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300038634 | Barley rhizosphere microbial communities from Potsdam, Germany - 563_E | Metagenome | Rhizosphere |
| 280 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 281 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 282 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 283 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 284 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 287 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 288 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 289 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 290 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 291 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 292 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 293 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 294 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 295 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 296 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 297 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 298 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 299 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 300 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 301 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 302 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 303 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 304 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 305 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 306 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 307 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 308 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 311 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 312 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 366 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 367 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 368 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 369 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 370 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 371 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 374 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 375 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 376 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 377 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 378 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 379 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 380 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 381 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 382 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 383 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 384 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 385 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 451 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 452 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 453 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 454 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 455 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 466 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 467 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 468 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 469 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 492 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 493 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 494 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 495 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 496 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 497 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 498 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 499 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 500 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 501 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 502 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 503 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 504 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 505 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 506 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 507 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 508 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 509 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 510 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 511 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 512 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 513 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 514 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 515 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 516 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 517 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 518 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 519 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 520 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 521 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 522 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 523 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 524 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 525 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 526 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.18 |
| Metatranscriptomes | 11.63 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 3.1 |
| Nodule | 0.38 |
| Rhizoplane | 7.41 |
| Rhizosphere | 83.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307410_10851425 | 3300031852 | Bacteria | 778 |
| 2 | LJQas_1002544 | 3300000549 | Bacteria | 2524 |
| 3 | LJQas_1003371 | 3300000549 | Bacteria | 2146 |
| 4 | JGI24740J21852_10024400 | 3300001979 | Bacteria | 2052 |
| 5 | JGI24740J21852_10043774 | 3300001979 | Bacteria | 1333 |
| 6 | JGI24739J22299_10020519 | 3300001989 | Bacteria | 2360 |
| 7 | JGI24739J22299_10145953 | 3300001989 | Bacteria | 700 |
| 8 | JGI24737J22298_10008409 | 3300001990 | Bacteria | 3455 |
| 9 | JGI24737J22298_10012287 | 3300001990 | Bacteria | 2791 |
| 10 | JGI24737J22298_10027583 | 3300001990 | Bacteria | 1790 |
| 11 | JGI24737J22298_10078923 | 3300001990 | Bacteria | 980 |
| 12 | JGI24735J21928_10006549 | 3300002067 | Bacteria | 3829 |
| 13 | JGI24749J21850_1019914 | 3300002076 | Bacteria | 947 |
| 14 | JGI25160J50197_1027253 | 3300003354 | Bacteria | 1559 |
| 15 | JGI25404J52841_10002323 | 3300003659 | Bacteria | 3580 |
| 16 | JGI25404J52841_10009368 | 3300003659 | Bacteria | 2093 |
| 17 | Ga0058859_10041476 | 3300004798 | Bacteria | 1440 |
| 18 | Ga0058863_10065621 | 3300004799 | Bacteria | 1672 |
| 19 | Ga0058862_10100651 | 3300004803 | Bacteria | 2010 |
| 20 | Ga0070658_10026607 | 3300005327 | Bacteria | 4642 |
| 21 | Ga0070658_10278035 | 3300005327 | Bacteria | 1424 |
| 22 | Ga0070658_10561934 | 3300005327 | Bacteria | 987 |
| 23 | Ga0070658_10568438 | 3300005327 | Bacteria | 982 |
| 24 | Ga0070658_11287459 | 3300005327 | Bacteria | 635 |
| 25 | Ga0070683_100145362 | 3300005329 | Bacteria | 2247 |
| 26 | Ga0070683_100163005 | 3300005329 | Bacteria | 2115 |
| 27 | Ga0070683_100511921 | 3300005329 | Bacteria | 1147 |
| 28 | Ga0070690_100027098 | 3300005330 | Bacteria | 3540 |
| 29 | Ga0070690_100374204 | 3300005330 | Bacteria | 1040 |
| 30 | Ga0070690_100663378 | 3300005330 | Bacteria | 798 |
| 31 | Ga0070670_100566077 | 3300005331 | Bacteria | 1015 |
| 32 | Ga0070670_100910279 | 3300005331 | Bacteria | 798 |
| 33 | Ga0070677_10063664 | 3300005333 | Bacteria | 1530 |
| 34 | Ga0068869_100059598 | 3300005334 | Bacteria | 2795 |
| 35 | Ga0070666_10030704 | 3300005335 | Bacteria | 3542 |
| 36 | Ga0070680_100030852 | 3300005336 | Bacteria | 4306 |
| 37 | Ga0070680_100826248 | 3300005336 | Bacteria | 799 |
| 38 | Ga0068868_100150264 | 3300005338 | Bacteria | 1918 |
| 39 | Ga0068868_100258856 | 3300005338 | Bacteria | 1467 |
| 40 | Ga0070660_100043146 | 3300005339 | Bacteria | 3445 |
| 41 | Ga0070689_100898436 | 3300005340 | Bacteria | 784 |
| 42 | Ga0070687_100012021 | 3300005343 | Bacteria | 3807 |
| 43 | Ga0070661_100016545 | 3300005344 | Bacteria | 5216 |
| 44 | Ga0070661_100303814 | 3300005344 | Bacteria | 1243 |
| 45 | Ga0070661_100513270 | 3300005344 | Bacteria | 961 |
| 46 | Ga0070692_10062248 | 3300005345 | Bacteria | 1969 |
| 47 | Ga0070668_100003483 | 3300005347 | Bacteria | 11605 |
| 48 | Ga0070668_100036770 | 3300005347 | Bacteria | 3737 |
| 49 | Ga0070668_100620495 | 3300005347 | Bacteria | 948 |
| 50 | Ga0070668_100674885 | 3300005347 | Bacteria | 910 |
| 51 | Ga0070675_100008243 | 3300005354 | Bacteria | 8083 |
| 52 | Ga0070671_100323271 | 3300005355 | Bacteria | 1315 |
| 53 | Ga0070674_100112101 | 3300005356 | Bacteria | 2004 |
| 54 | Ga0070673_100008022 | 3300005364 | Bacteria | 6993 |
| 55 | Ga0070688_100306368 | 3300005365 | Bacteria | 1150 |
| 56 | Ga0070659_100049958 | 3300005366 | Bacteria | 3289 |
| 57 | Ga0070659_100054657 | 3300005366 | Bacteria | 3145 |
| 58 | Ga0070659_100348162 | 3300005366 | Bacteria | 1242 |
| 59 | Ga0070659_100505443 | 3300005366 | Bacteria | 1031 |
| 60 | Ga0070659_100965815 | 3300005366 | Bacteria | 747 |
| 61 | Ga0070667_100196469 | 3300005367 | Bacteria | 1788 |
| 62 | Ga0070667_100560330 | 3300005367 | Bacteria | 1051 |
| 63 | Ga0070703_10001744 | 3300005406 | Bacteria | 6448 |
| 64 | Ga0070709_10334812 | 3300005434 | Bacteria | 1114 |
| 65 | Ga0070714_100548556 | 3300005435 | Bacteria | 1106 |
| 66 | Ga0070713_100685787 | 3300005436 | Bacteria | 977 |
| 67 | Ga0070710_10102132 | 3300005437 | Bacteria | 1709 |
| 68 | Ga0070701_10260060 | 3300005438 | Bacteria | 1052 |
| 69 | Ga0070711_100011818 | 3300005439 | Bacteria | 5432 |
| 70 | Ga0070705_100025564 | 3300005440 | Bacteria | 3202 |
| 71 | Ga0070700_100040117 | 3300005441 | Bacteria | 2864 |
| 72 | Ga0070694_100458641 | 3300005444 | Bacteria | 1007 |
| 73 | Ga0070663_100003713 | 3300005455 | Bacteria | 8850 |
| 74 | Ga0070663_100018814 | 3300005455 | Bacteria | 4538 |
| 75 | Ga0070678_100025778 | 3300005456 | Bacteria | 3963 |
| 76 | Ga0070662_100036864 | 3300005457 | Bacteria | 3463 |
| 77 | Ga0070662_100978871 | 3300005457 | Bacteria | 724 |
| 78 | Ga0070681_10156766 | 3300005458 | Bacteria | 2201 |
| 79 | Ga0068867_100413408 | 3300005459 | Bacteria | 1141 |
| 80 | Ga0070685_10471050 | 3300005466 | Bacteria | 884 |
| 81 | Ga0070698_100915888 | 3300005471 | Bacteria | 822 |
| 82 | Ga0070699_100294482 | 3300005518 | Bacteria | 1455 |
| 83 | Ga0070679_100040577 | 3300005530 | Bacteria | 4630 |
| 84 | Ga0070679_100047460 | 3300005530 | Bacteria | 4280 |
| 85 | Ga0070679_100667022 | 3300005530 | Bacteria | 983 |
| 86 | Ga0070684_100025884 | 3300005535 | Bacteria | 4936 |
| 87 | Ga0070684_100386288 | 3300005535 | Bacteria | 1290 |
| 88 | Ga0070684_100988699 | 3300005535 | Bacteria | 790 |
| 89 | Ga0068853_100054955 | 3300005539 | Bacteria | 3431 |
| 90 | Ga0070672_100049439 | 3300005543 | Bacteria | 3271 |
| 91 | Ga0070672_100098954 | 3300005543 | Bacteria | 2363 |
| 92 | Ga0070672_100399673 | 3300005543 | Bacteria | 1178 |
| 93 | Ga0070686_100016815 | 3300005544 | Bacteria | 4260 |
| 94 | Ga0070686_100312558 | 3300005544 | Bacteria | 1169 |
| 95 | Ga0070695_100711354 | 3300005545 | Bacteria | 798 |
| 96 | Ga0070696_100022624 | 3300005546 | Bacteria | 4272 |
| 97 | Ga0070693_100015406 | 3300005547 | Bacteria | 3935 |
| 98 | Ga0070693_100141358 | 3300005547 | Bacteria | 1516 |
| 99 | Ga0068855_100204576 | 3300005563 | Bacteria | 2221 |
| 100 | Ga0070664_100084984 | 3300005564 | Bacteria | 2732 |
| 101 | Ga0070664_100235174 | 3300005564 | Bacteria | 1643 |
| 102 | Ga0070664_100425536 | 3300005564 | Bacteria | 1217 |
| 103 | Ga0068857_100051503 | 3300005577 | Bacteria | 3653 |
| 104 | Ga0068857_100067096 | 3300005577 | Bacteria | 3193 |
| 105 | Ga0068857_100276565 | 3300005577 | Bacteria | 1544 |
| 106 | Ga0068854_100124477 | 3300005578 | Bacteria | 1961 |
| 107 | Ga0068856_100321310 | 3300005614 | Bacteria | 1565 |
| 108 | Ga0068852_100030950 | 3300005616 | Bacteria | 4410 |
| 109 | Ga0068852_100650456 | 3300005616 | Bacteria | 1061 |
| 110 | Ga0068852_101368767 | 3300005616 | Bacteria | 730 |
| 111 | Ga0068859_100590108 | 3300005617 | Bacteria | 1204 |
| 112 | Ga0068859_101116260 | 3300005617 | Bacteria | 867 |
| 113 | Ga0068864_100042979 | 3300005618 | Bacteria | 3868 |
| 114 | Ga0068866_10007484 | 3300005718 | Bacteria | 4572 |
| 115 | Ga0068866_10300969 | 3300005718 | Bacteria | 1002 |
| 116 | Ga0068861_100050932 | 3300005719 | Bacteria | 3142 |
| 117 | Ga0068851_10099517 | 3300005834 | Bacteria | 1541 |
| 118 | Ga0068870_10020461 | 3300005840 | Bacteria | 3224 |
| 119 | Ga0068863_100101788 | 3300005841 | Bacteria | 2731 |
| 120 | Ga0068858_100088600 | 3300005842 | Bacteria | 2879 |
| 121 | Ga0068860_100031232 | 3300005843 | Bacteria | 5121 |
| 122 | Ga0068860_100279397 | 3300005843 | Bacteria | 1631 |
| 123 | Ga0081455_10193839 | 3300005937 | Bacteria | 1528 |
| 124 | Ga0081540_1000341 | 3300005983 | Bacteria | 47794 |
| 125 | Ga0081539_10041214 | 3300005985 | Bacteria | 2701 |
| 126 | Ga0075365_10005427 | 3300006038 | Bacteria | 6870 |
| 127 | Ga0075365_10010269 | 3300006038 | Bacteria | 5441 |
| 128 | Ga0075365_10047138 | 3300006038 | Bacteria | 2832 |
| 129 | Ga0075363_100060635 | 3300006048 | Bacteria | 2037 |
| 130 | Ga0075363_100217110 | 3300006048 | Bacteria | 1095 |
| 131 | Ga0075364_10002085 | 3300006051 | Bacteria | 11167 |
| 132 | Ga0075364_10086362 | 3300006051 | Bacteria | 2078 |
| 133 | Ga0075364_10199713 | 3300006051 | Bacteria | 1355 |
| 134 | Ga0075364_10314438 | 3300006051 | Bacteria | 1066 |
| 135 | Ga0070715_10068395 | 3300006163 | Bacteria | 1579 |
| 136 | Ga0070715_10399429 | 3300006163 | Bacteria | 764 |
| 137 | Ga0070716_100079914 | 3300006173 | Bacteria | 1948 |
| 138 | Ga0075367_10030754 | 3300006178 | Bacteria | 3080 |
| 139 | Ga0075367_10091226 | 3300006178 | Bacteria | 1853 |
| 140 | Ga0075369_10164990 | 3300006186 | Bacteria | 1016 |
| 141 | Ga0075366_10046356 | 3300006195 | Bacteria | 2575 |
| 142 | Ga0097621_100125114 | 3300006237 | Bacteria | 2183 |
| 143 | Ga0097621_100477483 | 3300006237 | Bacteria | 1127 |
| 144 | Ga0075370_10063757 | 3300006353 | Bacteria | 2101 |
| 145 | Ga0075370_10096038 | 3300006353 | Bacteria | 1712 |
| 146 | Ga0075431_100111938 | 3300006847 | Bacteria | 2817 |
| 147 | Ga0075433_10154476 | 3300006852 | Bacteria | 2042 |
| 148 | Ga0068865_100012035 | 3300006881 | Bacteria | 5437 |
| 149 | Ga0068865_100432253 | 3300006881 | Bacteria | 1085 |
| 150 | Ga0075436_100676551 | 3300006914 | Bacteria | 763 |
| 151 | Ga0097620_100590154 | 3300006931 | Bacteria | 1204 |
| 152 | Ga0097620_101116279 | 3300006931 | Bacteria | 867 |
| 153 | Ga0075435_100187776 | 3300007076 | Bacteria | 1748 |
| 154 | Ga0099795_10005676 | 3300007788 | Bacteria | 3343 |
| 155 | Ga0105251_10017151 | 3300009011 | Bacteria | 3890 |
| 156 | Ga0105240_10604346 | 3300009093 | Bacteria | 1207 |
| 157 | Ga0114129_10128932 | 3300009147 | Bacteria | 3476 |
| 158 | Ga0105243_10155585 | 3300009148 | Bacteria | 1965 |
| 159 | Ga0105243_10313600 | 3300009148 | Bacteria | 1426 |
| 160 | Ga0105241_10327878 | 3300009174 | Bacteria | 1322 |
| 161 | Ga0105241_10733029 | 3300009174 | Bacteria | 905 |
| 162 | Ga0105242_10048204 | 3300009176 | Bacteria | 3462 |
| 163 | Ga0105248_10028082 | 3300009177 | Bacteria | 6267 |
| 164 | Ga0105248_11537813 | 3300009177 | Bacteria | 753 |
| 165 | Ga0105237_10205919 | 3300009545 | Bacteria | 1968 |
| 166 | Ga0105238_10024399 | 3300009551 | Bacteria | 6164 |
| 167 | Ga0105238_10154465 | 3300009551 | Bacteria | 2270 |
| 168 | Ga0105238_10275283 | 3300009551 | Bacteria | 1664 |
| 169 | Ga0105249_10687159 | 3300009553 | Bacteria | 1083 |
| 170 | Ga0105028_101589 | 3300009993 | Bacteria | 2385 |
| 171 | Ga0105246_10022573 | 3300011119 | Bacteria | 4061 |
| 172 | Ga0157314_1004247 | 3300012500 | Bacteria | 1047 |
| 173 | Ga0157347_1034320 | 3300012502 | Bacteria | 648 |
| 174 | Ga0157339_1001307 | 3300012505 | Bacteria | 1496 |
| 175 | Ga0157342_1004268 | 3300012507 | Bacteria | 1261 |
| 176 | Ga0157326_1004953 | 3300012513 | Bacteria | 1401 |
| 177 | Ga0157373_10020075 | 3300013100 | Bacteria | 4861 |
| 178 | Ga0157371_10011243 | 3300013102 | Bacteria | 6914 |
| 179 | Ga0157370_10036228 | 3300013104 | Bacteria | 4789 |
| 180 | Ga0157370_10380334 | 3300013104 | Bacteria | 1300 |
| 181 | Ga0157369_10434604 | 3300013105 | Bacteria | 1360 |
| 182 | Ga0157369_10729565 | 3300013105 | Bacteria | 1020 |
| 183 | Ga0157374_10465779 | 3300013296 | Bacteria | 1266 |
| 184 | Ga0163162_10197944 | 3300013306 | Bacteria | 2138 |
| 185 | Ga0157372_10064774 | 3300013307 | Bacteria | 4101 |
| 186 | Ga0157372_10345496 | 3300013307 | Bacteria | 1733 |
| 187 | Ga0157372_10560791 | 3300013307 | Bacteria | 1331 |
| 188 | Ga0157375_10058681 | 3300013308 | Bacteria | 3808 |
| 189 | Ga0157375_10432688 | 3300013308 | Bacteria | 1482 |
| 190 | Ga0157375_10624674 | 3300013308 | Bacteria | 1235 |
| 191 | Ga0163163_10243613 | 3300014325 | Bacteria | 1848 |
| 192 | Ga0163163_10921933 | 3300014325 | Bacteria | 937 |
| 193 | Ga0157380_10126489 | 3300014326 | Bacteria | 2173 |
| 194 | Ga0182008_10198439 | 3300014497 | Bacteria | 1020 |
| 195 | Ga0157377_10004084 | 3300014745 | Bacteria | 6666 |
| 196 | Ga0157377_10321177 | 3300014745 | Bacteria | 1029 |
| 197 | Ga0157377_10351388 | 3300014745 | Bacteria | 989 |
| 198 | Ga0157379_11183780 | 3300014968 | Bacteria | 735 |
| 199 | Ga0157376_10060699 | 3300014969 | Bacteria | 3176 |
| 200 | Ga0157376_11007103 | 3300014969 | Bacteria | 856 |
| 201 | Ga0163161_10011752 | 3300017792 | Bacteria | 6071 |
| 202 | Ga0163161_10054055 | 3300017792 | Bacteria | 2914 |
| 203 | Ga0163161_10076665 | 3300017792 | Bacteria | 2454 |
| 204 | Ga0163161_10483293 | 3300017792 | Bacteria | 1006 |
| 205 | Ga0184603_142129 | 3300019192 | Bacteria | 1682 |
| 206 | Ga0197907_10112628 | 3300020069 | Bacteria | 1119 |
| 207 | Ga0197907_10949401 | 3300020069 | Bacteria | 1784 |
| 208 | Ga0206354_10111251 | 3300020081 | Bacteria | 3100 |
| 209 | Ga0206354_10596362 | 3300020081 | Bacteria | 1432 |
| 210 | Ga0206354_11019960 | 3300020081 | Bacteria | 1653 |
| 211 | Ga0206353_10575488 | 3300020082 | Bacteria | 1151 |
| 212 | Ga0206353_10722515 | 3300020082 | Bacteria | 2024 |
| 213 | Ga0206353_11113762 | 3300020082 | Bacteria | 3043 |
| 214 | Ga0154015_1389080 | 3300020610 | Bacteria | 846 |
| 215 | Ga0154015_1394262 | 3300020610 | Bacteria | 1791 |
| 216 | Ga0213876_10023891 | 3300021384 | Bacteria | 3227 |
| 217 | Ga0224712_10000978 | 3300022467 | Bacteria | 6216 |
| 218 | Ga0224712_10003998 | 3300022467 | Bacteria | 3918 |
| 219 | Ga0224712_10010159 | 3300022467 | Bacteria | 2867 |
| 220 | Ga0207426_1003235 | 3300025302 | Bacteria | 9137 |
| 221 | Ga0207656_10079341 | 3300025321 | Bacteria | 1473 |
| 222 | Ga0207656_10108734 | 3300025321 | Bacteria | 1279 |
| 223 | Ga0207713_1046389 | 3300025735 | Bacteria | 1767 |
| 224 | Ga0207653_10015068 | 3300025885 | Bacteria | 2426 |
| 225 | Ga0207692_10007166 | 3300025898 | Bacteria | 4556 |
| 226 | Ga0207692_10012926 | 3300025898 | Bacteria | 3603 |
| 227 | Ga0207710_10008561 | 3300025900 | Bacteria | 4313 |
| 228 | Ga0207688_10001159 | 3300025901 | Bacteria | 13577 |
| 229 | Ga0207688_10005072 | 3300025901 | Bacteria | 7162 |
| 230 | Ga0207688_10036973 | 3300025901 | Bacteria | 2707 |
| 231 | Ga0207680_10120601 | 3300025903 | Bacteria | 1714 |
| 232 | Ga0207647_10010255 | 3300025904 | Bacteria | 6620 |
| 233 | Ga0207647_10039949 | 3300025904 | Bacteria | 2957 |
| 234 | Ga0207685_10150146 | 3300025905 | Bacteria | 1054 |
| 235 | Ga0207685_10435218 | 3300025905 | Bacteria | 679 |
| 236 | Ga0207699_10001668 | 3300025906 | Bacteria | 10536 |
| 237 | Ga0207699_10001977 | 3300025906 | Bacteria | 9676 |
| 238 | Ga0207699_10269142 | 3300025906 | Bacteria | 1180 |
| 239 | Ga0207645_10046028 | 3300025907 | Bacteria | 2787 |
| 240 | Ga0207643_10013524 | 3300025908 | Bacteria | 4422 |
| 241 | Ga0207705_10003438 | 3300025909 | Bacteria | 12045 |
| 242 | Ga0207705_10115376 | 3300025909 | Bacteria | 1987 |
| 243 | Ga0207654_10048558 | 3300025911 | Bacteria | 2430 |
| 244 | Ga0207707_10015978 | 3300025912 | Bacteria | 6545 |
| 245 | Ga0207707_10371731 | 3300025912 | Bacteria | 1230 |
| 246 | Ga0207707_10871401 | 3300025912 | Bacteria | 746 |
| 247 | Ga0207695_10106290 | 3300025913 | Bacteria | 2793 |
| 248 | Ga0207695_10332121 | 3300025913 | Bacteria | 1409 |
| 249 | Ga0207695_10514063 | 3300025913 | Bacteria | 1079 |
| 250 | Ga0207671_10029560 | 3300025914 | Bacteria | 4092 |
| 251 | Ga0207671_10094035 | 3300025914 | Bacteria | 2262 |
| 252 | Ga0207693_10292026 | 3300025915 | Bacteria | 1278 |
| 253 | Ga0207663_10011872 | 3300025916 | Bacteria | 4691 |
| 254 | Ga0207663_10018057 | 3300025916 | Bacteria | 3942 |
| 255 | Ga0207663_10081057 | 3300025916 | Bacteria | 2124 |
| 256 | Ga0207660_10191125 | 3300025917 | Bacteria | 1594 |
| 257 | Ga0207662_10002882 | 3300025918 | Bacteria | 8712 |
| 258 | Ga0207662_10025569 | 3300025918 | Bacteria | 3401 |
| 259 | Ga0207657_10001387 | 3300025919 | Bacteria | 25846 |
| 260 | Ga0207649_10066532 | 3300025920 | Bacteria | 2285 |
| 261 | Ga0207652_10259169 | 3300025921 | Bacteria | 1568 |
| 262 | Ga0207652_10387656 | 3300025921 | Bacteria | 1261 |
| 263 | Ga0207652_10801747 | 3300025921 | Bacteria | 836 |
| 264 | Ga0207681_10305203 | 3300025923 | Bacteria | 1261 |
| 265 | Ga0207694_10165665 | 3300025924 | Bacteria | 1787 |
| 266 | Ga0207694_10258966 | 3300025924 | Bacteria | 1425 |
| 267 | Ga0207650_10149015 | 3300025925 | Bacteria | 1845 |
| 268 | Ga0207650_10397855 | 3300025925 | Bacteria | 1140 |
| 269 | Ga0207659_10069212 | 3300025926 | Bacteria | 2569 |
| 270 | Ga0207687_10005166 | 3300025927 | Bacteria | 8656 |
| 271 | Ga0207700_10006412 | 3300025928 | Bacteria | 7101 |
| 272 | Ga0207700_10084912 | 3300025928 | Bacteria | 2483 |
| 273 | Ga0207700_10104512 | 3300025928 | Bacteria | 2266 |
| 274 | Ga0207664_10003003 | 3300025929 | Bacteria | 11208 |
| 275 | Ga0207664_10006898 | 3300025929 | Bacteria | 7853 |
| 276 | Ga0207664_10093952 | 3300025929 | Bacteria | 2464 |
| 277 | Ga0207644_10024762 | 3300025931 | Bacteria | 4122 |
| 278 | Ga0207644_10179212 | 3300025931 | Bacteria | 1659 |
| 279 | Ga0207690_10048134 | 3300025932 | Bacteria | 2833 |
| 280 | Ga0207690_10254656 | 3300025932 | Bacteria | 1358 |
| 281 | Ga0207690_10364051 | 3300025932 | Bacteria | 1146 |
| 282 | Ga0207690_10377652 | 3300025932 | Bacteria | 1126 |
| 283 | Ga0207690_10464866 | 3300025932 | Bacteria | 1019 |
| 284 | Ga0207690_10791107 | 3300025932 | Bacteria | 783 |
| 285 | Ga0207706_10016603 | 3300025933 | Bacteria | 6645 |
| 286 | Ga0207686_10030825 | 3300025934 | Bacteria | 3180 |
| 287 | Ga0207686_10480251 | 3300025934 | Bacteria | 961 |
| 288 | Ga0207669_10761424 | 3300025937 | Bacteria | 800 |
| 289 | Ga0207704_10089458 | 3300025938 | Bacteria | 2017 |
| 290 | Ga0207665_10239179 | 3300025939 | Bacteria | 1337 |
| 291 | Ga0207691_10030436 | 3300025940 | Bacteria | 5044 |
| 292 | Ga0207691_10040006 | 3300025940 | Bacteria | 4335 |
| 293 | Ga0207691_10255048 | 3300025940 | Bacteria | 1513 |
| 294 | Ga0207711_10026932 | 3300025941 | Bacteria | 4826 |
| 295 | Ga0207689_10002936 | 3300025942 | Bacteria | 15743 |
| 296 | Ga0207661_10052310 | 3300025944 | Bacteria | 3262 |
| 297 | Ga0207661_10418113 | 3300025944 | Bacteria | 1217 |
| 298 | Ga0207661_10463321 | 3300025944 | Bacteria | 1155 |
| 299 | Ga0207661_10478766 | 3300025944 | Bacteria | 1136 |
| 300 | Ga0207679_10209425 | 3300025945 | Bacteria | 1634 |
| 301 | Ga0207679_10217458 | 3300025945 | Bacteria | 1606 |
| 302 | Ga0207667_10186338 | 3300025949 | Bacteria | 2130 |
| 303 | Ga0207667_10488905 | 3300025949 | Bacteria | 1249 |
| 304 | Ga0207651_10594109 | 3300025960 | Bacteria | 967 |
| 305 | Ga0207668_10001244 | 3300025972 | Bacteria | 15180 |
| 306 | Ga0207668_10024969 | 3300025972 | Bacteria | 3863 |
| 307 | Ga0207668_10147889 | 3300025972 | Bacteria | 1815 |
| 308 | Ga0207668_10217745 | 3300025972 | Bacteria | 1531 |
| 309 | Ga0207640_10028988 | 3300025981 | Bacteria | 3391 |
| 310 | Ga0207658_10002262 | 3300025986 | Bacteria | 14246 |
| 311 | Ga0207658_10023394 | 3300025986 | Bacteria | 4312 |
| 312 | Ga0207658_10100622 | 3300025986 | Bacteria | 2263 |
| 313 | Ga0207658_10354061 | 3300025986 | Bacteria | 1279 |
| 314 | Ga0207658_10560070 | 3300025986 | Bacteria | 1023 |
| 315 | Ga0207677_10015884 | 3300026023 | Bacteria | 4443 |
| 316 | Ga0207677_10347824 | 3300026023 | Bacteria | 1241 |
| 317 | Ga0207677_10379289 | 3300026023 | Bacteria | 1193 |
| 318 | Ga0207677_10795855 | 3300026023 | Bacteria | 846 |
| 319 | Ga0207639_10050243 | 3300026041 | Bacteria | 3166 |
| 320 | Ga0207678_10000929 | 3300026067 | Bacteria | 26706 |
| 321 | Ga0207678_10002587 | 3300026067 | Bacteria | 16500 |
| 322 | Ga0207678_10078838 | 3300026067 | Bacteria | 2821 |
| 323 | Ga0207678_10324077 | 3300026067 | Bacteria | 1326 |
| 324 | Ga0207678_10584415 | 3300026067 | Bacteria | 978 |
| 325 | Ga0207708_10025444 | 3300026075 | Bacteria | 4477 |
| 326 | Ga0207708_10033142 | 3300026075 | Bacteria | 3923 |
| 327 | Ga0207708_10466344 | 3300026075 | Bacteria | 1054 |
| 328 | Ga0207702_10003344 | 3300026078 | Bacteria | 14708 |
| 329 | Ga0207702_10043789 | 3300026078 | Bacteria | 3760 |
| 330 | Ga0207702_10282130 | 3300026078 | Bacteria | 1571 |
| 331 | Ga0207702_10477739 | 3300026078 | Bacteria | 1212 |
| 332 | Ga0207641_10012413 | 3300026088 | Bacteria | 6984 |
| 333 | Ga0207641_10029616 | 3300026088 | Bacteria | 4528 |
| 334 | Ga0207641_10151858 | 3300026088 | Bacteria | 2098 |
| 335 | Ga0207676_10170521 | 3300026095 | Bacteria | 1895 |
| 336 | Ga0207674_10006508 | 3300026116 | Bacteria | 13736 |
| 337 | Ga0207674_10026320 | 3300026116 | Bacteria | 6181 |
| 338 | Ga0207674_10120238 | 3300026116 | Bacteria | 2595 |
| 339 | Ga0207674_10341828 | 3300026116 | Bacteria | 1447 |
| 340 | Ga0207675_100010883 | 3300026118 | Bacteria | 8521 |
| 341 | Ga0207675_100039815 | 3300026118 | Bacteria | 4386 |
| 342 | Ga0207675_100227704 | 3300026118 | Bacteria | 1798 |
| 343 | Ga0207683_10002849 | 3300026121 | Bacteria | 15092 |
| 344 | Ga0207683_10003476 | 3300026121 | Bacteria | 13744 |
| 345 | Ga0207683_10046199 | 3300026121 | Bacteria | 3810 |
| 346 | Ga0207683_10611383 | 3300026121 | Bacteria | 1009 |
| 347 | Ga0207683_10720382 | 3300026121 | Bacteria | 925 |
| 348 | Ga0207698_10399334 | 3300026142 | Bacteria | 1313 |
| 349 | Ga0209981_1023067 | 3300027378 | Bacteria | 894 |
| 350 | Ga0209813_10001880 | 3300027866 | Bacteria | 4739 |
| 351 | Ga0268266_10109275 | 3300028379 | Bacteria | 2448 |
| 352 | Ga0268266_10121702 | 3300028379 | Bacteria | 2323 |
| 353 | Ga0268264_10000792 | 3300028381 | Bacteria | 34282 |
| 354 | Ga0307515_10095406 | 3300028794 | Bacteria | 3661 |
| 355 | Ga0265338_10014758 | 3300028800 | Bacteria | 8652 |
| 356 | Ga0265338_10061662 | 3300028800 | Bacteria | 3285 |
| 357 | Ga0311001_1013709 | 3300029277 | Bacteria | 919 |
| 358 | Ga0307512_10156912 | 3300030522 | Bacteria | 1344 |
| 359 | Ga0316181_1005005 | 3300030744 | Bacteria | 1586 |
| 360 | Ga0316182_1232924 | 3300030745 | Bacteria | 892 |
| 361 | Ga0265763_1021048 | 3300030763 | Bacteria | 686 |
| 362 | Ga0265767_100127 | 3300030836 | Bacteria | 2620 |
| 363 | Ga0265770_1007774 | 3300030878 | Bacteria | 1515 |
| 364 | Ga0307513_10011746 | 3300031456 | Bacteria | 10859 |
| 365 | Ga0307509_10012707 | 3300031507 | Bacteria | 10038 |
| 366 | Ga0307509_10084425 | 3300031507 | Bacteria | 3271 |
| 367 | Ga0310116_103289 | 3300031591 | Bacteria | 1658 |
| 368 | Ga0310117_103919 | 3300031592 | Bacteria | 1591 |
| 369 | Ga0310115_106822 | 3300031635 | Bacteria | 1368 |
| 370 | Ga0316575_10011120 | 3300031665 | Bacteria | 3324 |
| 371 | Ga0316579_10003148 | 3300031691 | Bacteria | 6378 |
| 372 | Ga0316579_10005517 | 3300031691 | Bacteria | 5115 |
| 373 | Ga0316576_10009973 | 3300031727 | Bacteria | 6151 |
| 374 | Ga0316576_10011042 | 3300031727 | Bacteria | 5896 |
| 375 | Ga0316576_10015825 | 3300031727 | Bacteria | 5074 |
| 376 | Ga0316576_10049104 | 3300031727 | Bacteria | 3063 |
| 377 | Ga0316578_10016785 | 3300031728 | Bacteria | 3971 |
| 378 | Ga0316578_10017124 | 3300031728 | Bacteria | 3939 |
| 379 | Ga0316578_10090169 | 3300031728 | Bacteria | 1830 |
| 380 | Ga0307405_10246931 | 3300031731 | Bacteria | 1325 |
| 381 | Ga0307405_10349811 | 3300031731 | Bacteria | 1139 |
| 382 | Ga0307405_10465057 | 3300031731 | Bacteria | 1006 |
| 383 | Ga0316577_10035601 | 3300031733 | Bacteria | 2782 |
| 384 | Ga0316577_10449185 | 3300031733 | Bacteria | 732 |
| 385 | Ga0307413_10741649 | 3300031824 | Bacteria | 820 |
| 386 | Ga0307410_10076652 | 3300031852 | Bacteria | 2334 |
| 387 | Ga0307410_10165932 | 3300031852 | Bacteria | 1659 |
| 388 | Ga0307406_10150201 | 3300031901 | Bacteria | 1661 |
| 389 | Ga0307407_10083148 | 3300031903 | Bacteria | 1942 |
| 390 | Ga0307407_10114589 | 3300031903 | Bacteria | 1698 |
| 391 | Ga0307412_10255387 | 3300031911 | Bacteria | 1363 |
| 392 | Ga0307412_10894250 | 3300031911 | Bacteria | 778 |
| 393 | Ga0307409_100091276 | 3300031995 | Bacteria | 2496 |
| 394 | Ga0307409_100621614 | 3300031995 | Bacteria | 1070 |
| 395 | Ga0307409_100778054 | 3300031995 | Bacteria | 963 |
| 396 | Ga0307409_101261888 | 3300031995 | Bacteria | 763 |
| 397 | Ga0307416_100431629 | 3300032002 | Bacteria | 1365 |
| 398 | Ga0307416_101152117 | 3300032002 | Bacteria | 880 |
| 399 | Ga0307414_10070859 | 3300032004 | Bacteria | 2512 |
| 400 | Ga0307414_10397529 | 3300032004 | Bacteria | 1196 |
| 401 | Ga0307414_10410258 | 3300032004 | Bacteria | 1179 |
| 402 | Ga0307414_10474407 | 3300032004 | Bacteria | 1102 |
| 403 | Ga0307411_10418557 | 3300032005 | Bacteria | 1112 |
| 404 | Ga0307415_100313078 | 3300032126 | Bacteria | 1305 |
| 405 | Ga0307415_100556002 | 3300032126 | Bacteria | 1013 |
| 406 | Ga0316583_10012326 | 3300032133 | Bacteria | 3084 |
| 407 | Ga0316583_10018078 | 3300032133 | Bacteria | 2532 |
| 408 | Ga0316583_10195409 | 3300032133 | Bacteria | 702 |
| 409 | Ga0316585_10005598 | 3300032137 | Bacteria | 3552 |
| 410 | Ga0316585_10007990 | 3300032137 | Bacteria | 3060 |
| 411 | Ga0316580_10001591 | 3300032139 | Bacteria | 5993 |
| 412 | Ga0316593_10038217 | 3300032168 | Bacteria | 1589 |
| 413 | Ga0307507_10078944 | 3300033179 | Bacteria | 2913 |
| 414 | Ga0307510_10036115 | 3300033180 | Bacteria | 5504 |
| 415 | Ga0307510_10448380 | 3300033180 | Bacteria | 731 |
| 416 | Ga0316592_1006178 | 3300033524 | Bacteria | 2297 |
| 417 | Ga0316592_1011540 | 3300033524 | Bacteria | 1798 |
| 418 | Ga0316586_1024288 | 3300033527 | Bacteria | 1016 |
| 419 | Ga0316588_1003297 | 3300033528 | Bacteria | 2925 |
| 420 | Ga0316596_1006516 | 3300033541 | Bacteria | 2719 |
| 421 | Ga0316596_1010689 | 3300033541 | Bacteria | 2228 |
| 422 | Ga0316214_1000853 | 3300033545 | Bacteria | 3335 |
| 423 | Ga0373930_0060483 | 3300034816 | Bacteria | 844 |
| 424 | Ga0373950_0018484 | 3300034818 | Bacteria | 1210 |
| 425 | Ga0373958_0011974 | 3300034819 | Bacteria | 1477 |
| 426 | Ga0373959_0022162 | 3300034820 | Bacteria | 1226 |
| 427 | Ga0373938_0006655 | 3300034957 | Bacteria | 2006 |
| 428 | Ga0373926_0001795 | 3300035083 | Bacteria | 6662 |
| 429 | Ga0373926_0081669 | 3300035083 | Bacteria | 1196 |
| 430 | Ga0373929_0010821 | 3300035085 | Bacteria | 1711 |
| 431 | Ga0373929_0095959 | 3300035085 | Bacteria | 742 |
| 432 | Ga0373934_0065509 | 3300035086 | Bacteria | 1450 |
| 433 | Ga0373934_0128298 | 3300035086 | Bacteria | 1033 |
| 434 | Ga0373940_0038980 | 3300035088 | Bacteria | 1299 |
| 435 | Ga0373949_0006803 | 3300035090 | Bacteria | 2511 |
| 436 | Ga0373949_0136066 | 3300035090 | Bacteria | 701 |
| 437 | Ga0373951_0040515 | 3300035091 | Bacteria | 1122 |
| 438 | Ga0373952_0002133 | 3300035092 | Bacteria | 3556 |
| 439 | Ga0373923_0029180 | 3300035111 | Bacteria | 2210 |
| 440 | Ga0373936_0075154 | 3300035113 | Bacteria | 1398 |
| 441 | Ga0373936_0158249 | 3300035113 | Bacteria | 985 |
| 442 | Ga0373939_0078649 | 3300035114 | Bacteria | 1090 |
| 443 | Ga0373941_0027282 | 3300035115 | Bacteria | 1665 |
| 444 | Ga0373953_0010766 | 3300035117 | Bacteria | 3192 |
| 445 | Ga0373954_0021194 | 3300035118 | Bacteria | 2941 |
| 446 | Ga0373954_0080638 | 3300035118 | Bacteria | 1554 |
| 447 | Ga0373956_0099854 | 3300035119 | Bacteria | 1345 |
| 448 | Ga0373943_0011419 | 3300035170 | Bacteria | 3996 |
| 449 | Ga0373955_0028721 | 3300035172 | Bacteria | 2886 |
| 450 | Ga0373942_0003606 | 3300035207 | Bacteria | 3629 |
| 451 | Ga0373961_0006256 | 3300035241 | Bacteria | 2861 |
| 452 | Ga0373962_0129064 | 3300035242 | Bacteria | 812 |
| 453 | Ga0316574_0003558 | 3300035398 | Bacteria | 8051 |
| 454 | Ga0316574_0004026 | 3300035398 | Bacteria | 7661 |
| 455 | Ga0316574_0023256 | 3300035398 | Bacteria | 3699 |
| 456 | Ga0316574_0032259 | 3300035398 | Bacteria | 3182 |
| 457 | Ga0316574_0049174 | 3300035398 | Bacteria | 2621 |
| 458 | Ga0373924_0064246 | 3300035410 | Bacteria | 1540 |
| 459 | Ga0373931_0207866 | 3300035691 | Bacteria | 1172 |
| 460 | Ga0373927_0052651 | 3300035695 | Bacteria | 2632 |
| 461 | Ga0373933_0040792 | 3300035724 | Bacteria | 2736 |
| 462 | Ga0373937_0560290 | 3300036401 | Bacteria | 1085 |
| 463 | Ga0372808_000924 | 3300036459 | Bacteria | 2755 |
| 464 | Ga0316582_0001841 | 3300036647 | Bacteria | 9599 |
| 465 | Ga0316582_0031807 | 3300036647 | Bacteria | 3228 |
| 466 | Ga0316582_0114084 | 3300036647 | Bacteria | 1802 |
| 467 | Ga0316584_0003484 | 3300036712 | Bacteria | 10242 |
| 468 | Ga0316584_0005394 | 3300036712 | Bacteria | 8579 |
| 469 | Ga0373925_0000004 | 3300037068 | Bacteria | 361597 |
| 470 | Ga0373925_0708978 | 3300037068 | Bacteria | 829 |
| 471 | Ga0373925_1152266 | 3300037068 | Bacteria | 637 |
| 472 | Ga0395899_0006378 | 3300037312 | Bacteria | 9136 |
| 473 | Ga0395900_0055781 | 3300037418 | Bacteria | 4068 |
| 474 | Ga0395900_0068181 | 3300037418 | Bacteria | 3655 |
| 475 | Ga0395900_0350113 | 3300037418 | Bacteria | 1451 |
| 476 | Ga0395900_0527639 | 3300037418 | Bacteria | 1128 |
| 477 | Ga0395898_0052729 | 3300037466 | Bacteria | 3973 |
| 478 | Ga0395898_0109702 | 3300037466 | Bacteria | 2645 |
| 479 | Ga0395905_0034499 | 3300037471 | Bacteria | 4751 |
| 480 | Ga0395905_0112855 | 3300037471 | Bacteria | 2553 |
| 481 | Ga0436364_0624941 | 3300037853 | Bacteria | 1997 |
| 482 | Ga0436364_1561235 | 3300037853 | Bacteria | 3036 |
| 483 | Ga0395901_0002011 | 3300038443 | Bacteria | 20930 |
| 484 | Ga0395901_0018326 | 3300038443 | Bacteria | 7147 |
| 485 | Ga0395901_0024756 | 3300038443 | Bacteria | 6163 |
| 486 | Ga0395901_0128864 | 3300038443 | Bacteria | 2659 |
| 487 | Ga0395901_0711862 | 3300038443 | Bacteria | 1001 |
| 488 | Ga0395901_1384348 | 3300038443 | Bacteria | 662 |
| 489 | Ga0246641_00856 | 3300038634 | Bacteria | 705 |
| 490 | Ga0436365_1093008 | 3300039437 | Bacteria | 961 |
| 491 | Ga0436365_1742710 | 3300039437 | Bacteria | 15179 |
| 492 | Ga0436363_0951008 | 3300039450 | Bacteria | 856 |
| 493 | Ga0436363_1346257 | 3300039450 | Bacteria | 712 |
| 494 | Ga0439436_0057590 | 3300041404 | Bacteria | 1090 |
| 495 | Ga0439438_082877 | 3300041405 | Bacteria | 786 |
| 496 | Ga0451797_0953582 | 3300041453 | Bacteria | 992 |
| 497 | Ga0451807_2663483 | 3300041486 | Bacteria | 873 |
| 498 | Ga0451833_0940272 | 3300041491 | Bacteria | 5554 |
| 499 | Ga0451837_1096605 | 3300041494 | Bacteria | 3790 |
| 500 | Ga0451837_1738307 | 3300041494 | Bacteria | 712 |
| 501 | Ga0451843_0656929 | 3300041509 | Bacteria | 1118 |
| 502 | Ga0451853_0724050 | 3300041512 | Bacteria | 646 |
| 503 | Ga0451853_1129289 | 3300041512 | Bacteria | 1692 |
| 504 | Ga0451853_2987354 | 3300041512 | Bacteria | 1514 |
| 505 | Ga0439442_044996 | 3300042002 | Bacteria | 930 |
| 506 | Ga0439445_0107616 | 3300042004 | Bacteria | 794 |
| 507 | Ga0439454_004739 | 3300042011 | Bacteria | 1586 |
| 508 | Ga0439462_0024189 | 3300042015 | Bacteria | 1594 |
| 509 | Ga0450906_050823 | 3300042145 | Bacteria | 732 |
| 510 | Ga0450907_012360 | 3300042146 | Bacteria | 1420 |
| 511 | Ga0439464_0003677 | 3300042439 | Bacteria | 3889 |
| 512 | Ga0466969_0015659 | 3300044656 | Bacteria | 3973 |
| 513 | Ga0466972_0007797 | 3300044658 | Bacteria | 5372 |
| 514 | Ga0466972_0077032 | 3300044658 | Bacteria | 1588 |
| 515 | Ga0466972_0088997 | 3300044658 | Bacteria | 1465 |
| 516 | Ga0466965_0018349 | 3300044683 | Bacteria | 3353 |
| 517 | Ga0466965_0086225 | 3300044683 | Bacteria | 1592 |
| 518 | Ga0466965_0228850 | 3300044683 | Bacteria | 992 |
| 519 | Ga0466965_0300473 | 3300044683 | Bacteria | 871 |
| 520 | Ga0466965_0461516 | 3300044683 | Bacteria | 708 |
| 521 | Ga0466966_0047711 | 3300044684 | Bacteria | 2730 |
| 522 | Ga0466966_0059964 | 3300044684 | Bacteria | 2402 |
| 523 | Ga0466966_0091649 | 3300044684 | Bacteria | 1886 |
| 524 | Ga0466966_0246124 | 3300044684 | Bacteria | 1077 |
| 525 | Ga0466961_0005440 | 3300044693 | Bacteria | 8027 |
| 526 | Ga0466961_0009592 | 3300044693 | Bacteria | 6162 |
| 527 | Ga0466961_0026459 | 3300044693 | Bacteria | 3729 |
| 528 | Ga0466961_0041150 | 3300044693 | Bacteria | 2962 |
| 529 | Ga0466961_0347470 | 3300044693 | Bacteria | 903 |
| 530 | Ga0466963_0016148 | 3300044694 | Bacteria | 4639 |
| 531 | Ga0466963_0107473 | 3300044694 | Bacteria | 1913 |
| 532 | Ga0466963_0253797 | 3300044694 | Bacteria | 1234 |
| 533 | Ga0466963_0266010 | 3300044694 | Bacteria | 1204 |
| 534 | Ga0466963_0324304 | 3300044694 | Bacteria | 1084 |
| 535 | Ga0466964_0011253 | 3300044706 | Bacteria | 3379 |
| 536 | Ga0466964_0067997 | 3300044706 | Bacteria | 1499 |
| 537 | Ga0466964_0116543 | 3300044706 | Bacteria | 1198 |
| 538 | Ga0466971_0001406 | 3300044719 | Bacteria | 10109 |
| 539 | Ga0466971_0024327 | 3300044719 | Bacteria | 2702 |
| 540 | Ga0466968_0100059 | 3300044735 | Bacteria | 1293 |
| 541 | Ga0466970_0005678 | 3300044765 | Bacteria | 6196 |
| 542 | Ga0466970_0044578 | 3300044765 | Bacteria | 2361 |
| 543 | Ga0466970_0082051 | 3300044765 | Bacteria | 1743 |
| 544 | Ga0466970_0189322 | 3300044765 | Bacteria | 1143 |
| 545 | Ga0466970_0206926 | 3300044765 | Bacteria | 1092 |
| 546 | Ga0466970_0207482 | 3300044765 | Bacteria | 1091 |
| 547 | Ga0466970_0212592 | 3300044765 | Bacteria | 1078 |
| 548 | Ga0466970_0360675 | 3300044765 | Bacteria | 825 |
| 549 | Ga0466957_0001751 | 3300044842 | Bacteria | 11414 |
| 550 | Ga0466957_0003801 | 3300044842 | Bacteria | 8345 |
| 551 | Ga0466957_0041425 | 3300044842 | Bacteria | 2785 |
| 552 | Ga0466957_0154969 | 3300044842 | Bacteria | 1484 |
| 553 | Ga0466957_0403497 | 3300044842 | Bacteria | 935 |
| 554 | Ga0466960_0006772 | 3300044901 | Bacteria | 4616 |
| 555 | Ga0466960_0019073 | 3300044901 | Bacteria | 3016 |
| 556 | Ga0466960_0038077 | 3300044901 | Bacteria | 2259 |
| 557 | Ga0466959_0124349 | 3300045049 | Bacteria | 1831 |
| 558 | Ga0466959_0229616 | 3300045049 | Bacteria | 1285 |
| 559 | Ga0466959_0394619 | 3300045049 | Bacteria | 941 |
| 560 | Ga0466958_0012657 | 3300045836 | Bacteria | 4782 |
| 561 | Ga0466958_0022751 | 3300045836 | Bacteria | 3674 |
| 562 | Ga0466958_0125691 | 3300045836 | Bacteria | 1608 |
| 563 | Ga0466958_0221417 | 3300045836 | Bacteria | 1207 |
| 564 | Ga0466967_0008916 | 3300045976 | Bacteria | 7403 |
| 565 | Ga0466967_0011477 | 3300045976 | Bacteria | 6714 |
| 566 | Ga0466967_0012456 | 3300045976 | Bacteria | 6506 |
| 567 | Ga0466967_0019141 | 3300045976 | Bacteria | 5497 |
| 568 | Ga0466967_0045336 | 3300045976 | Bacteria | 3819 |
| 569 | Ga0466967_0086365 | 3300045976 | Bacteria | 2842 |
| 570 | Ga0466967_0376227 | 3300045976 | Bacteria | 1378 |
| 571 | Ga0466967_0746528 | 3300045976 | Bacteria | 970 |
| 572 | Ga0466967_0749490 | 3300045976 | Bacteria | 968 |
| 573 | Ga0495592_0142506 | 3300046454 | Bacteria | 1665 |
| 574 | Ga0495592_0203739 | 3300046454 | Bacteria | 1333 |
| 575 | Ga0495603_0012499 | 3300046455 | Bacteria | 5139 |
| 576 | Ga0495629_0019176 | 3300046459 | Bacteria | 4889 |
| 577 | Ga0495629_0392937 | 3300046459 | Bacteria | 943 |
| 578 | Ga0495638_0016739 | 3300046460 | Bacteria | 4902 |
| 579 | Ga0495641_0003583 | 3300046461 | Bacteria | 11516 |
| 580 | Ga0495641_0035689 | 3300046461 | Bacteria | 2341 |
| 581 | Ga0495651_0000169 | 3300046462 | Bacteria | 48128 |
| 582 | Ga0495651_0029794 | 3300046462 | Bacteria | 4255 |
| 583 | Ga0495651_0330819 | 3300046462 | Bacteria | 1012 |
| 584 | Ga0495653_0067856 | 3300046463 | Bacteria | 2676 |
| 585 | Ga0495653_0068012 | 3300046463 | Bacteria | 2673 |
| 586 | Ga0495653_0132483 | 3300046463 | Bacteria | 1762 |
| 587 | Ga0495653_0149658 | 3300046463 | Bacteria | 1632 |
| 588 | Ga0495580_0035177 | 3300046472 | Bacteria | 3602 |
| 589 | Ga0495582_0121270 | 3300046473 | Bacteria | 1473 |
| 590 | Ga0495639_0054995 | 3300046475 | Bacteria | 1815 |
| 591 | Ga0495662_0018856 | 3300046476 | Bacteria | 3338 |
| 592 | Ga0495664_0030772 | 3300046477 | Bacteria | 3144 |
| 593 | Ga0495664_0318835 | 3300046477 | Bacteria | 937 |
| 594 | Ga0495585_0167012 | 3300046492 | Bacteria | 1139 |
| 595 | Ga0495607_0159700 | 3300046501 | Bacteria | 1146 |
| 596 | Ga0495608_0040445 | 3300046511 | Bacteria | 3123 |
| 597 | Ga0495608_0111871 | 3300046511 | Bacteria | 1755 |
| 598 | Ga0495618_0095052 | 3300046514 | Bacteria | 1905 |
| 599 | Ga0495628_0004361 | 3300046516 | Bacteria | 12548 |
| 600 | Ga0495628_0221610 | 3300046516 | Bacteria | 1420 |
| 601 | Ga0495628_0266415 | 3300046516 | Bacteria | 1275 |
| 602 | Ga0495630_0068032 | 3300046517 | Bacteria | 2677 |
| 603 | Ga0495666_0018448 | 3300046526 | Bacteria | 3471 |
| 604 | Ga0495652_0011903 | 3300046529 | Bacteria | 7865 |
| 605 | Ga0495652_0071875 | 3300046529 | Bacteria | 2885 |
| 606 | Ga0495665_0003597 | 3300046531 | Bacteria | 8412 |
| 607 | Ga0495640_0035704 | 3300046533 | Bacteria | 3517 |
| 608 | Ga0495640_0045392 | 3300046533 | Bacteria | 3049 |
| 609 | Ga0495586_0028108 | 3300046535 | Bacteria | 3009 |
| 610 | Ga0495587_0120858 | 3300046536 | Bacteria | 1500 |
| 611 | Ga0495587_0126899 | 3300046536 | Bacteria | 1459 |
| 612 | Ga0495645_0026666 | 3300046543 | Bacteria | 4194 |
| 613 | Ga0495645_0066478 | 3300046543 | Bacteria | 2605 |
| 614 | Ga0495645_0262263 | 3300046543 | Bacteria | 1143 |
| 615 | Ga0495622_0059954 | 3300046557 | Bacteria | 1762 |
| 616 | Ga0495667_0012986 | 3300046559 | Bacteria | 5645 |
| 617 | Ga0495667_0070366 | 3300046559 | Bacteria | 2282 |
| 618 | Ga0495667_0502544 | 3300046559 | Bacteria | 759 |
| 619 | Ga0495656_0043112 | 3300046615 | Bacteria | 1893 |
| 620 | Ga0495634_0005879 | 3300046642 | Bacteria | 9375 |
| 621 | Ga0495635_0014023 | 3300046663 | Bacteria | 5608 |
| 622 | Ga0495635_0022472 | 3300046663 | Bacteria | 4392 |
| 623 | Ga0495635_0077571 | 3300046663 | Bacteria | 2275 |
| 624 | Ga0495635_0144740 | 3300046663 | Bacteria | 1618 |
| 625 | Ga0495657_0014898 | 3300046675 | Bacteria | 5703 |
| 626 | Ga0495657_0407829 | 3300046675 | Bacteria | 799 |
| 627 | Ga0495599_0047758 | 3300046678 | Bacteria | 2682 |
| 628 | Ga0495599_0236070 | 3300046678 | Bacteria | 1116 |
| 629 | Ga0495623_0003245 | 3300046679 | Bacteria | 10749 |
| 630 | Ga0495623_0341057 | 3300046679 | Bacteria | 818 |
| 631 | Ga0495646_0038695 | 3300046680 | Bacteria | 2943 |
| 632 | Ga0495646_0041433 | 3300046680 | Bacteria | 2829 |
| 633 | Ga0495647_0005262 | 3300046681 | Bacteria | 4235 |
| 634 | Ga0495658_0437185 | 3300046683 | Bacteria | 835 |
| 635 | Ga0495669_0019422 | 3300046684 | Bacteria | 2933 |
| 636 | Ga0495613_0017693 | 3300046689 | Bacteria | 5310 |
| 637 | Ga0495624_0222191 | 3300046690 | Bacteria | 1145 |
| 638 | Ga0495600_0136587 | 3300046809 | Bacteria | 1592 |
| 639 | Ga0495600_0140744 | 3300046809 | Bacteria | 1565 |
| 640 | Ga0495600_0197509 | 3300046809 | Bacteria | 1292 |
| 641 | Ga0495581_0004893 | 3300047315 | Bacteria | 7747 |
| 642 | Ga0495604_0064253 | 3300047317 | Bacteria | 2797 |
| 643 | Ga0495604_0198084 | 3300047317 | Bacteria | 1395 |
| 644 | Ga0495604_0505318 | 3300047317 | Bacteria | 784 |
| 645 | Ga0495674_0094452 | 3300047319 | Bacteria | 2550 |
| 646 | Ga0495674_0161291 | 3300047319 | Bacteria | 1876 |
| 647 | Ga0495674_0262553 | 3300047319 | Bacteria | 1418 |
| 648 | Ga0495674_0350397 | 3300047319 | Bacteria | 1199 |
| 649 | Ga0495674_0369979 | 3300047319 | Bacteria | 1161 |
| 650 | Ga0495676_0024236 | 3300047321 | Bacteria | 5256 |
| 651 | Ga0495676_0554607 | 3300047321 | Bacteria | 751 |
| 652 | Ga0495676_0821387 | 3300047321 | Bacteria | 598 |
| 653 | Ga0495680_0073670 | 3300047322 | Bacteria | 2594 |
| 654 | Ga0495680_0172293 | 3300047322 | Bacteria | 1566 |
| 655 | Ga0495680_0201799 | 3300047322 | Bacteria | 1426 |
| 656 | Ga0495680_0339216 | 3300047322 | Bacteria | 1048 |
| 657 | Ga0495683_0003613 | 3300047323 | Bacteria | 8973 |
| 658 | Ga0495675_0065651 | 3300047444 | Bacteria | 2294 |
| 659 | Ga0495684_0006411 | 3300047471 | Bacteria | 9130 |
| 660 | Ga0495593_0161336 | 3300047673 | Bacteria | 1131 |
| 661 | Ga0495602_0072071 | 3300048088 | Bacteria | 2947 |
| 662 | Ga0495602_0094996 | 3300048088 | Bacteria | 2462 |
| 663 | Ga0495602_0242532 | 3300048088 | Bacteria | 1347 |
| 664 | Ga0495614_0220217 | 3300048089 | Bacteria | 862 |
| 665 | Ga0496100_0001690 | 3300048903 | Bacteria | 10962 |
| 666 | Ga0496100_0038035 | 3300048903 | Bacteria | 3046 |
| 667 | Ga0496100_0062063 | 3300048903 | Bacteria | 2465 |
| 668 | Ga0496100_0279081 | 3300048903 | Bacteria | 1245 |
| 669 | Ga0496100_0410013 | 3300048903 | Bacteria | 1033 |
| 670 | Ga0496100_1059587 | 3300048903 | Bacteria | 638 |
| 671 | Ga0496101_0098005 | 3300048904 | Bacteria | 2190 |
| 672 | Ga0496101_0161957 | 3300048904 | Bacteria | 1716 |
| 673 | Ga0496101_0177173 | 3300048904 | Bacteria | 1640 |
| 674 | Ga0496102_0008709 | 3300048905 | Bacteria | 8707 |
| 675 | Ga0496102_0030623 | 3300048905 | Bacteria | 4816 |
| 676 | Ga0496102_0078954 | 3300048905 | Bacteria | 3030 |
| 677 | Ga0496102_0291705 | 3300048905 | Bacteria | 1537 |
| 678 | Ga0496102_0295427 | 3300048905 | Bacteria | 1527 |
| 679 | Ga0496103_0005052 | 3300048906 | Bacteria | 7958 |
| 680 | Ga0496103_0021213 | 3300048906 | Bacteria | 3908 |
| 681 | Ga0496103_0047442 | 3300048906 | Bacteria | 2654 |
| 682 | Ga0496103_0113581 | 3300048906 | Bacteria | 1721 |
| 683 | Ga0496103_0124836 | 3300048906 | Bacteria | 1641 |
| 684 | Ga0496104_0012662 | 3300048907 | Bacteria | 7595 |
| 685 | Ga0496104_0183433 | 3300048907 | Bacteria | 2003 |
| 686 | Ga0496104_0314662 | 3300048907 | Bacteria | 1478 |
| 687 | Ga0496104_0406627 | 3300048907 | Bacteria | 1273 |
| 688 | Ga0496105_0023753 | 3300048908 | Bacteria | 4976 |
| 689 | Ga0496105_0057129 | 3300048908 | Bacteria | 3222 |
| 690 | Ga0496105_0087327 | 3300048908 | Bacteria | 2576 |
| 691 | Ga0496105_0205624 | 3300048908 | Bacteria | 1606 |
| 692 | Ga0496105_0776933 | 3300048908 | Bacteria | 730 |
| 693 | Ga0496106_0211113 | 3300048909 | Bacteria | 1546 |
| 694 | Ga0496107_0010178 | 3300048910 | Bacteria | 6523 |
| 695 | Ga0496107_0190866 | 3300048910 | Bacteria | 1522 |
| 696 | Ga0496107_0200618 | 3300048910 | Bacteria | 1483 |
| 697 | Ga0496108_0022038 | 3300048911 | Bacteria | 5237 |
| 698 | Ga0496108_0035892 | 3300048911 | Bacteria | 4123 |
| 699 | Ga0496108_0054098 | 3300048911 | Bacteria | 3368 |
| 700 | Ga0496108_0058001 | 3300048911 | Bacteria | 3253 |
| 701 | Ga0496108_0123605 | 3300048911 | Bacteria | 2221 |
| 702 | Ga0496108_0200647 | 3300048911 | Bacteria | 1731 |
| 703 | Ga0496108_0209348 | 3300048911 | Bacteria | 1692 |
| 704 | Ga0496108_0739577 | 3300048911 | Bacteria | 851 |
| 705 | Ga0496109_0008096 | 3300048912 | Bacteria | 8910 |
| 706 | Ga0496109_0011868 | 3300048912 | Bacteria | 7501 |
| 707 | Ga0496109_0095042 | 3300048912 | Bacteria | 2759 |
| 708 | Ga0496109_0099512 | 3300048912 | Bacteria | 2697 |
| 709 | Ga0496109_0126497 | 3300048912 | Bacteria | 2383 |
| 710 | Ga0496109_0140882 | 3300048912 | Bacteria | 2254 |
| 711 | Ga0496109_0221191 | 3300048912 | Bacteria | 1780 |
| 712 | Ga0496109_0243342 | 3300048912 | Bacteria | 1693 |
| 713 | Ga0496109_0323736 | 3300048912 | Bacteria | 1455 |
| 714 | Ga0496110_0002685 | 3300048913 | Bacteria | 13433 |
| 715 | Ga0496110_0018772 | 3300048913 | Bacteria | 5804 |
| 716 | Ga0496110_0048688 | 3300048913 | Bacteria | 3715 |
| 717 | Ga0496110_0109101 | 3300048913 | Bacteria | 2485 |
| 718 | Ga0496110_0182540 | 3300048913 | Bacteria | 1905 |
| 719 | Ga0496110_0382112 | 3300048913 | Bacteria | 1283 |
| 720 | Ga0496110_0825917 | 3300048913 | Bacteria | 832 |
| 721 | Ga0496111_0011005 | 3300048914 | Bacteria | 6088 |
| 722 | Ga0496111_0014401 | 3300048914 | Bacteria | 5401 |
| 723 | Ga0496111_0023360 | 3300048914 | Bacteria | 4339 |
| 724 | Ga0496111_0026509 | 3300048914 | Bacteria | 4094 |
| 725 | Ga0496111_0224706 | 3300048914 | Bacteria | 1395 |
| 726 | Ga0496111_0407018 | 3300048914 | Bacteria | 1005 |
| 727 | Ga0496112_0057073 | 3300048915 | Bacteria | 3843 |
| 728 | Ga0496112_0130195 | 3300048915 | Bacteria | 2487 |
| 729 | Ga0496112_0198098 | 3300048915 | Bacteria | 1968 |
| 730 | Ga0496112_0580681 | 3300048915 | Bacteria | 1053 |
| 731 | Ga0496112_1114351 | 3300048915 | Bacteria | 707 |
| 732 | Ga0496113_0012988 | 3300048916 | Bacteria | 5619 |
| 733 | Ga0496113_0041589 | 3300048916 | Bacteria | 3392 |
| 734 | Ga0496113_0094930 | 3300048916 | Bacteria | 2304 |
| 735 | Ga0496113_0629115 | 3300048916 | Bacteria | 859 |
| 736 | Ga0496114_0175712 | 3300048917 | Bacteria | 1868 |
| 737 | Ga0496114_0207804 | 3300048917 | Bacteria | 1716 |
| 738 | Ga0496114_0247129 | 3300048917 | Bacteria | 1569 |
| 739 | Ga0496115_0059690 | 3300048918 | Bacteria | 3072 |
| 740 | Ga0496115_0076142 | 3300048918 | Bacteria | 2727 |
| 741 | Ga0496115_0137141 | 3300048918 | Bacteria | 2017 |
| 742 | Ga0496117_0196583 | 3300048920 | Bacteria | 1143 |
| 743 | Ga0496119_0024498 | 3300048922 | Bacteria | 4244 |
| 744 | Ga0496119_0176062 | 3300048922 | Bacteria | 1126 |
| 745 | Ga0496119_0234397 | 3300048922 | Bacteria | 932 |
| 746 | Ga0496122_0015469 | 3300048925 | Bacteria | 7294 |
| 747 | Ga0496122_0055803 | 3300048925 | Bacteria | 2952 |
| 748 | Ga0496123_0019835 | 3300048926 | Bacteria | 5279 |
| 749 | Ga0496123_0041554 | 3300048926 | Bacteria | 3185 |
| 750 | Ga0496124_0038275 | 3300048927 | Bacteria | 4166 |
| 751 | Ga0496124_0291985 | 3300048927 | Bacteria | 1183 |
| 752 | Ga0496126_0008800 | 3300048929 | Bacteria | 10829 |
| 753 | Ga0496126_0041790 | 3300048929 | Bacteria | 4240 |
| 754 | Ga0496126_0111838 | 3300048929 | Bacteria | 2378 |
| 755 | Ga0501306_004436 | 3300049127 | Bacteria | 1571 |
| 756 | Ga0501306_004912 | 3300049127 | Bacteria | 1514 |
| 757 | Ga0501306_015030 | 3300049127 | Bacteria | 1027 |
| 758 | Ga0501306_021234 | 3300049127 | Bacteria | 908 |
| 759 | Ga0501308_013172 | 3300049128 | Bacteria | 953 |
| 760 | Ga0501309_002625 | 3300049129 | Bacteria | 1959 |
| 761 | Ga0501310_001524 | 3300049130 | Bacteria | 2112 |
| 762 | Ga0501310_001576 | 3300049130 | Bacteria | 2081 |
| 763 | Ga0501310_001843 | 3300049130 | Bacteria | 1962 |
| 764 | Ga0501310_007780 | 3300049130 | Bacteria | 1151 |
| 765 | Ga0501310_010317 | 3300049130 | Bacteria | 1040 |
| 766 | Ga0501341_04032 | 3300049131 | Bacteria | 847 |
| 767 | Ga0501341_04391 | 3300049131 | Bacteria | 822 |
| 768 | Ga0501304_004891 | 3300049160 | Bacteria | 1032 |
| 769 | Ga0501304_006976 | 3300049160 | Bacteria | 922 |
| 770 | Ga0501305_000247 | 3300049161 | Bacteria | 4011 |
| 771 | Ga0501305_004689 | 3300049161 | Bacteria | 1619 |
| 772 | Ga0501305_013477 | 3300049161 | Bacteria | 1131 |
| 773 | Ga0501307_000425 | 3300049162 | Bacteria | 2824 |
| 774 | Ga0501307_002945 | 3300049162 | Bacteria | 1633 |
| 775 | Ga0501311_006900 | 3300049527 | Bacteria | 1294 |
| 776 | Ga0501312_001041 | 3300049528 | Bacteria | 2579 |
| 777 | Ga0501312_007888 | 3300049528 | Bacteria | 1368 |
| 778 | Ga0501312_040646 | 3300049528 | Bacteria | 760 |
| 779 | Ga0501313_001100 | 3300049529 | Bacteria | 2207 |
| 780 | Ga0501313_010211 | 3300049529 | Bacteria | 1066 |
| 781 | Ga0501313_017759 | 3300049529 | Bacteria | 861 |
| 782 | Ga0501314_001924 | 3300049530 | Bacteria | 1562 |
| 783 | Ga0501314_019924 | 3300049530 | Bacteria | 691 |
| 784 | Ga0501315_001948 | 3300049531 | Bacteria | 1869 |
| 785 | Ga0501316_001756 | 3300049532 | Bacteria | 1909 |
| 786 | Ga0501316_001871 | 3300049532 | Bacteria | 1872 |
| 787 | Ga0501316_006101 | 3300049532 | Bacteria | 1273 |
| 788 | Ga0501317_001407 | 3300049533 | Bacteria | 2069 |
| 789 | Ga0501318_000136 | 3300049534 | Bacteria | 3502 |
| 790 | Ga0501318_003546 | 3300049534 | Bacteria | 1437 |
| 791 | Ga0501318_005547 | 3300049534 | Bacteria | 1256 |
| 792 | Ga0501319_002482 | 3300049535 | Bacteria | 1170 |
| 793 | Ga0501320_000277 | 3300049536 | Bacteria | 2787 |
| 794 | Ga0501320_000989 | 3300049536 | Bacteria | 1913 |
| 795 | Ga0501320_002460 | 3300049536 | Bacteria | 1483 |
| 796 | Ga0501320_002714 | 3300049536 | Bacteria | 1440 |
| 797 | Ga0501320_002966 | 3300049536 | Bacteria | 1401 |
| 798 | Ga0501320_004127 | 3300049536 | Bacteria | 1265 |
| 799 | Ga0501321_000036 | 3300049537 | Bacteria | 6130 |
| 800 | Ga0501321_000260 | 3300049537 | Bacteria | 3107 |
| 801 | Ga0501321_006115 | 3300049537 | Bacteria | 1214 |
| 802 | Ga0501321_014755 | 3300049537 | Bacteria | 912 |
| 803 | Ga0501322_000885 | 3300049538 | Bacteria | 1550 |
| 804 | Ga0501322_003462 | 3300049538 | Bacteria | 1024 |
| 805 | Ga0501323_001980 | 3300049539 | Bacteria | 1921 |
| 806 | Ga0501323_002331 | 3300049539 | Bacteria | 1828 |
| 807 | Ga0501323_010328 | 3300049539 | Bacteria | 1111 |
| 808 | Ga0501324_003394 | 3300049540 | Bacteria | 1220 |
| 809 | Ga0501325_000156 | 3300049541 | Bacteria | 2583 |
| 810 | Ga0501325_000249 | 3300049541 | Bacteria | 2266 |
| 811 | Ga0501326_01209 | 3300049542 | Bacteria | 1168 |
| 812 | Ga0501329_00057 | 3300049545 | Bacteria | 2543 |
| 813 | Ga0501330_005306 | 3300049546 | Bacteria | 819 |
| 814 | Ga0501332_01635 | 3300049548 | Bacteria | 1193 |
| 815 | Ga0501333_001220 | 3300049549 | Bacteria | 1359 |
| 816 | Ga0501334_03218 | 3300049550 | Bacteria | 1004 |
| 817 | Ga0501336_000521 | 3300049552 | Bacteria | 1940 |
| 818 | Ga0501338_00927 | 3300049554 | Bacteria | 1470 |
| 819 | Ga0501340_003446 | 3300049556 | Bacteria | 960 |
| 820 | Ga0501031_0003261 | 3300049568 | Bacteria | 10426 |
| 821 | Ga0501031_0013728 | 3300049568 | Bacteria | 5280 |
| 822 | Ga0501031_0026809 | 3300049568 | Bacteria | 3756 |
| 823 | Ga0501031_0048743 | 3300049568 | Bacteria | 2760 |
| 824 | Ga0501031_0110643 | 3300049568 | Bacteria | 1794 |
| 825 | Ga0501031_0119959 | 3300049568 | Bacteria | 1718 |
| 826 | Ga0501031_0196883 | 3300049568 | Bacteria | 1315 |
| 827 | Ga0501032_0001347 | 3300049569 | Bacteria | 19514 |
| 828 | Ga0501032_0029669 | 3300049569 | Bacteria | 3752 |
| 829 | Ga0501032_0094053 | 3300049569 | Bacteria | 1987 |
| 830 | Ga0501032_0220509 | 3300049569 | Bacteria | 1234 |
| 831 | Ga0501033_0005545 | 3300049570 | Bacteria | 9978 |
| 832 | Ga0501033_0103656 | 3300049570 | Bacteria | 2074 |
| 833 | Ga0501033_0202791 | 3300049570 | Bacteria | 1416 |
| 834 | Ga0501033_0252841 | 3300049570 | Bacteria | 1248 |
| 835 | Ga0501034_0011756 | 3300049571 | Bacteria | 9058 |
| 836 | Ga0501034_0017192 | 3300049571 | Bacteria | 7420 |
| 837 | Ga0501034_0680938 | 3300049571 | Bacteria | 928 |
| 838 | Ga0501036_0003874 | 3300049572 | Bacteria | 12000 |
| 839 | Ga0501036_0015731 | 3300049572 | Bacteria | 6318 |
| 840 | Ga0501036_0053426 | 3300049572 | Bacteria | 3421 |
| 841 | Ga0501036_0081619 | 3300049572 | Bacteria | 2732 |
| 842 | Ga0501036_0287575 | 3300049572 | Bacteria | 1375 |
| 843 | Ga0501037_0004030 | 3300049573 | Bacteria | 10649 |
| 844 | Ga0501037_0138940 | 3300049573 | Bacteria | 1739 |
| 845 | Ga0501037_0371208 | 3300049573 | Bacteria | 984 |
| 846 | Ga0501038_0007465 | 3300049574 | Bacteria | 10087 |
| 847 | Ga0501038_0009388 | 3300049574 | Bacteria | 8975 |
| 848 | Ga0501038_0138305 | 3300049574 | Bacteria | 1994 |
| 849 | Ga0501038_0144848 | 3300049574 | Bacteria | 1941 |
| 850 | Ga0501038_0151350 | 3300049574 | Bacteria | 1891 |
| 851 | Ga0501038_0314909 | 3300049574 | Bacteria | 1225 |
| 852 | Ga0501039_0003016 | 3300049575 | Bacteria | 12590 |
| 853 | Ga0501039_0026196 | 3300049575 | Bacteria | 4481 |
| 854 | Ga0501039_0065871 | 3300049575 | Bacteria | 2811 |
| 855 | Ga0501039_0126555 | 3300049575 | Bacteria | 2004 |
| 856 | Ga0501039_0372700 | 3300049575 | Bacteria | 1121 |
| 857 | Ga0501040_0002706 | 3300049576 | Bacteria | 11426 |
| 858 | Ga0501040_0022758 | 3300049576 | Bacteria | 4198 |
| 859 | Ga0501040_0044216 | 3300049576 | Bacteria | 3036 |
| 860 | Ga0501040_0083061 | 3300049576 | Bacteria | 2221 |
| 861 | Ga0501040_0280634 | 3300049576 | Bacteria | 1190 |
| 862 | Ga0501040_0328943 | 3300049576 | Bacteria | 1093 |
| 863 | Ga0501041_0002671 | 3300049577 | Bacteria | 10179 |
| 864 | Ga0501041_0006740 | 3300049577 | Bacteria | 6731 |
| 865 | Ga0501041_0026655 | 3300049577 | Bacteria | 3477 |
| 866 | Ga0501041_0371149 | 3300049577 | Bacteria | 905 |
| 867 | Ga0501042_0024746 | 3300049578 | Bacteria | 4212 |
| 868 | Ga0501042_0034939 | 3300049578 | Bacteria | 3566 |
| 869 | Ga0501042_0354536 | 3300049578 | Bacteria | 1061 |
| 870 | Ga0501043_0024200 | 3300049579 | Bacteria | 4764 |
| 871 | Ga0501043_0029097 | 3300049579 | Bacteria | 4339 |
| 872 | Ga0501046_0002011 | 3300049580 | Bacteria | 19297 |
| 873 | Ga0501046_0050473 | 3300049580 | Bacteria | 3287 |
| 874 | Ga0501046_0050632 | 3300049580 | Bacteria | 3280 |
| 875 | Ga0501046_0331079 | 3300049580 | Bacteria | 1108 |
| 876 | Ga0501046_0391700 | 3300049580 | Bacteria | 1004 |
| 877 | Ga0501046_0498686 | 3300049580 | Bacteria | 872 |
| 878 | Ga0501047_0000278 | 3300049581 | Bacteria | 59271 |
| 879 | Ga0501047_0008040 | 3300049581 | Bacteria | 9951 |
| 880 | Ga0501047_0023199 | 3300049581 | Bacteria | 5958 |
| 881 | Ga0501047_0125201 | 3300049581 | Bacteria | 2451 |
| 882 | Ga0501048_0001026 | 3300049582 | Bacteria | 20878 |
| 883 | Ga0501048_0033481 | 3300049582 | Bacteria | 3712 |
| 884 | Ga0501048_0165013 | 3300049582 | Bacteria | 1568 |
| 885 | Ga0501048_0195212 | 3300049582 | Bacteria | 1435 |
| 886 | Ga0501067_0000592 | 3300049583 | Bacteria | 19503 |
| 887 | Ga0501067_0035438 | 3300049583 | Bacteria | 2771 |
| 888 | Ga0501068_0003271 | 3300049584 | Bacteria | 8684 |
| 889 | Ga0501068_0205550 | 3300049584 | Bacteria | 1249 |
| 890 | Ga0501068_0267407 | 3300049584 | Bacteria | 1091 |
| 891 | Ga0501069_0006049 | 3300049585 | Bacteria | 6318 |
| 892 | Ga0501069_0013692 | 3300049585 | Bacteria | 4329 |
| 893 | Ga0501069_0221171 | 3300049585 | Bacteria | 1100 |
| 894 | Ga0501069_0251237 | 3300049585 | Bacteria | 1031 |
| 895 | Ga0501069_0291128 | 3300049585 | Bacteria | 956 |
| 896 | Ga0501069_0340815 | 3300049585 | Bacteria | 883 |
| 897 | Ga0501069_0466764 | 3300049585 | Bacteria | 751 |
| 898 | Ga0501069_0590024 | 3300049585 | Bacteria | 666 |
| 899 | Ga0501070_0004123 | 3300049586 | Bacteria | 12503 |
| 900 | Ga0501070_0004983 | 3300049586 | Bacteria | 11332 |
| 901 | Ga0501070_0007652 | 3300049586 | Bacteria | 9170 |
| 902 | Ga0501070_0101284 | 3300049586 | Bacteria | 2382 |
| 903 | Ga0501070_0108719 | 3300049586 | Bacteria | 2291 |
| 904 | Ga0501070_0469519 | 3300049586 | Bacteria | 1013 |
| 905 | Ga0501070_0707538 | 3300049586 | Bacteria | 796 |
| 906 | Ga0501071_0005440 | 3300049587 | Bacteria | 8184 |
| 907 | Ga0501071_0005948 | 3300049587 | Bacteria | 7895 |
| 908 | Ga0501071_0067819 | 3300049587 | Bacteria | 2595 |
| 909 | Ga0501071_0119659 | 3300049587 | Bacteria | 1952 |
| 910 | Ga0501071_0497746 | 3300049587 | Bacteria | 935 |
| 911 | Ga0501072_0001152 | 3300049588 | Bacteria | 19660 |
| 912 | Ga0501072_0033624 | 3300049588 | Bacteria | 4018 |
| 913 | Ga0501072_0254096 | 3300049588 | Bacteria | 1399 |
| 914 | Ga0501072_0304805 | 3300049588 | Bacteria | 1266 |
| 915 | Ga0501073_0004460 | 3300049589 | Bacteria | 10515 |
| 916 | Ga0501073_0131495 | 3300049589 | Bacteria | 1735 |
| 917 | Ga0501074_0003766 | 3300049590 | Bacteria | 10779 |
| 918 | Ga0501074_0003829 | 3300049590 | Bacteria | 10704 |
| 919 | Ga0501074_0014346 | 3300049590 | Bacteria | 5765 |
| 920 | Ga0501075_0017703 | 3300049591 | Bacteria | 5146 |
| 921 | Ga0501075_0458315 | 3300049591 | Bacteria | 972 |
| 922 | Ga0501075_0632239 | 3300049591 | Bacteria | 816 |
| 923 | Ga0501075_0663171 | 3300049591 | Bacteria | 795 |
| 924 | Ga0501076_0007352 | 3300049592 | Bacteria | 8014 |
| 925 | Ga0501076_0062892 | 3300049592 | Bacteria | 2956 |
| 926 | Ga0501076_0082515 | 3300049592 | Bacteria | 2580 |
| 927 | Ga0501076_0101880 | 3300049592 | Bacteria | 2314 |
| 928 | Ga0501076_0339783 | 3300049592 | Bacteria | 1232 |
| 929 | Ga0501076_0454217 | 3300049592 | Bacteria | 1055 |
| 930 | Ga0501077_0003693 | 3300049593 | Bacteria | 9204 |
| 931 | Ga0501077_0012235 | 3300049593 | Bacteria | 5374 |
| 932 | Ga0501077_0015668 | 3300049593 | Bacteria | 4775 |
| 933 | Ga0501079_0050969 | 3300049741 | Bacteria | 3194 |
| 934 | Ga0501080_0004649 | 3300049742 | Bacteria | 12241 |
| 935 | Ga0501080_0022770 | 3300049742 | Bacteria | 5804 |
| 936 | Ga0501080_0063974 | 3300049742 | Bacteria | 3423 |
| 937 | Ga0501080_0107570 | 3300049742 | Bacteria | 2585 |
| 938 | Ga0501080_0432696 | 3300049742 | Bacteria | 1181 |
| 939 | Ga0501081_0008966 | 3300049743 | Bacteria | 6503 |
| 940 | Ga0501081_0107003 | 3300049743 | Bacteria | 1983 |
| 941 | Ga0501081_0335521 | 3300049743 | Bacteria | 1113 |
| 942 | Ga0501083_0004200 | 3300049744 | Bacteria | 10143 |
| 943 | Ga0501083_0143435 | 3300049744 | Bacteria | 1564 |
| 944 | Ga0501035_0015444 | 3300049822 | Bacteria | 7044 |
| 945 | Ga0501035_0017574 | 3300049822 | Bacteria | 6599 |
| 946 | Ga0501035_0019781 | 3300049822 | Bacteria | 6185 |
| 947 | Ga0501035_0069836 | 3300049822 | Bacteria | 3112 |
| 948 | Ga0501035_0204322 | 3300049822 | Bacteria | 1693 |
| 949 | Ga0501035_0601079 | 3300049822 | Bacteria | 896 |
| 950 | Ga0501035_0603300 | 3300049822 | Bacteria | 894 |
| 951 | Ga0501044_0010423 | 3300049823 | Bacteria | 10087 |
| 952 | Ga0501044_0044490 | 3300049823 | Bacteria | 4606 |
| 953 | Ga0501044_0088185 | 3300049823 | Bacteria | 3132 |
| 954 | Ga0501044_0314347 | 3300049823 | Bacteria | 1492 |
| 955 | Ga0501044_0421215 | 3300049823 | Bacteria | 1245 |
| 956 | Ga0501045_0005656 | 3300049824 | Bacteria | 8648 |
| 957 | Ga0501045_0006942 | 3300049824 | Bacteria | 7848 |
| 958 | Ga0501045_0009893 | 3300049824 | Bacteria | 6672 |
| 959 | Ga0501045_0025024 | 3300049824 | Bacteria | 4288 |
| 960 | Ga0501045_0217938 | 3300049824 | Bacteria | 1421 |
| 961 | Ga0501045_0341315 | 3300049824 | Bacteria | 1115 |
| 962 | nmdc:mga03n38_178117_c1 | 3300050490 | Bacteria | 1087 |
| 963 | nmdc:mga03n38_6768_c1 | 3300050490 | Bacteria | 4010 |
| 964 | nmdc:mga00v17_180307_c1 | 3300050491 | Bacteria | 1363 |
| 965 | nmdc:mga00v17_958_c1 | 3300050491 | Bacteria | 15464 |
| 966 | nmdc:mga0yw44_1197_c1 | 3300050492 | Bacteria | 10147 |
| 967 | nmdc:mga0yw44_2187_c1 | 3300050492 | Bacteria | 8221 |
| 968 | nmdc:mga06z11_1560_c1 | 3300050494 | Bacteria | 8521 |
| 969 | nmdc:mga06z11_53803_c1 | 3300050494 | Bacteria | 2072 |
| 970 | nmdc:mga04h51_28361_c1 | 3300050495 | Bacteria | 1746 |
| 971 | nmdc:mga07m45_413222_c1 | 3300050496 | Bacteria | 783 |
| 972 | nmdc:mga07m45_5853_c1 | 3300050496 | Bacteria | 6170 |
| 973 | nmdc:mga06r32_136_c2 | 3300050510 | Bacteria | 3241 |
| 974 | nmdc:mga0n895_574310_c1 | 3300050512 | Bacteria | 1132 |
| 975 | nmdc:mga0rr50_446787_c1 | 3300050513 | Bacteria | 1096 |
| 976 | nmdc:mga08x19_177064_c1 | 3300050514 | Bacteria | 1455 |
| 977 | Ga0495601_0008187 | 3300053077 | Bacteria | 6166 |
| 978 | Ga0495601_0009796 | 3300053077 | Bacteria | 5668 |
| 979 | Ga0495612_0016852 | 3300053078 | Bacteria | 2927 |
| 980 | Ga0495612_0018939 | 3300053078 | Bacteria | 2755 |
| 981 | Ga0495612_0082754 | 3300053078 | Bacteria | 1350 |
| 982 | Ga0495655_0112064 | 3300053083 | Bacteria | 821 |
| 983 | Ga0495595_0084971 | 3300053084 | Bacteria | 1512 |
| 984 | Ga0495619_0021438 | 3300053085 | Bacteria | 4125 |
| 985 | Ga0495619_0063850 | 3300053085 | Bacteria | 2454 |
| 986 | Ga0495619_0129781 | 3300053085 | Bacteria | 1731 |
| 987 | Ga0495619_0134926 | 3300053085 | Bacteria | 1697 |
| 988 | Ga0495619_0229240 | 3300053085 | Bacteria | 1287 |
| 989 | Ga0500641_0000363 | 3300053096 | Bacteria | 16791 |
| 990 | Ga0500616_0016827 | 3300053153 | Bacteria | 4155 |
| 991 | Ga0500639_244526 | 3300053163 | Bacteria | 725 |
| 992 | Ga0500611_132952 | 3300053727 | Bacteria | 672 |
| 993 | Ga0501084_0001550 | 3300054114 | Bacteria | 18271 |
| 994 | Ga0501084_0014112 | 3300054114 | Bacteria | 6617 |
| 995 | Ga0501084_0319807 | 3300054114 | Bacteria | 1311 |
| 996 | Ga0501084_0617328 | 3300054114 | Bacteria | 916 |
| 997 | Ga0587070_041752 | 3300059491 | Bacteria | 881 |
| 998 | Ga0587077_009339 | 3300059493 | Bacteria | 1486 |
| 999 | Ga0587080_003407 | 3300059503 | Bacteria | 1975 |
| 1000 | Ga0587080_004067 | 3300059503 | Bacteria | 1871 |
| 1001 | Ga0587083_0016332 | 3300059505 | Bacteria | 1312 |
| 1002 | Ga0587083_0018638 | 3300059505 | Bacteria | 1258 |
| 1003 | Ga0587083_0064238 | 3300059505 | Bacteria | 836 |
| 1004 | Ga0587088_070091 | 3300059508 | Bacteria | 729 |
| 1005 | Ga0587090_019187 | 3300059510 | Bacteria | 1052 |
| 1006 | Ga0587090_028243 | 3300059510 | Bacteria | 923 |
| 1007 | Ga0587090_030729 | 3300059510 | Bacteria | 897 |
| 1008 | Ga0587091_019318 | 3300059511 | Bacteria | 1170 |
| 1009 | Ga0587106_002255 | 3300059605 | Bacteria | 1864 |
| 1010 | Ga0587106_007182 | 3300059605 | Bacteria | 1344 |
| 1011 | Ga0587099_008078 | 3300059622 | Bacteria | 1008 |
| 1012 | Ga0587101_009312 | 3300059623 | Bacteria | 1210 |
| 1013 | Ga0587101_014944 | 3300059623 | Bacteria | 1044 |
| 1014 | Ga0587117_029071 | 3300059627 | Bacteria | 822 |
| 1015 | Ga0587128_007988 | 3300059630 | Bacteria | 1355 |
| 1016 | Ga0587067_016763 | 3300059640 | Bacteria | 1207 |
| 1017 | Ga0587068_001843 | 3300059641 | Bacteria | 2473 |
| 1018 | Ga0587075_007403 | 3300059644 | Bacteria | 1377 |
| 1019 | Ga0587076_006534 | 3300059645 | Bacteria | 1558 |
| 1020 | Ga0587079_015434 | 3300059647 | Bacteria | 1297 |
| 1021 | Ga0587104_003738 | 3300059650 | Bacteria | 946 |
| 1022 | Ga0587105_004336 | 3300059651 | Bacteria | 902 |
| 1023 | Ga0587107_032477 | 3300059652 | Bacteria | 803 |
| 1024 | Ga0501082_0046869 | 3300060353 | Bacteria | 3725 |
| 1025 | Ga0501082_0153707 | 3300060353 | Bacteria | 1999 |
| 1026 | Ga0466962_0001686 | 3300061719 | Bacteria | 10365 |
| 1027 | Ga0466962_0055564 | 3300061719 | Bacteria | 1892 |
| 1028 | Ga0466962_0064981 | 3300061719 | Bacteria | 1742 |
| 1029 | Ga0466962_0090674 | 3300061719 | Bacteria | 1464 |
| 1030 | Ga0530510_0007003 | 3300061734 | Bacteria | 7854 |
| 1031 | Ga0530510_0166551 | 3300061734 | Bacteria | 1631 |
| 1032 | Ga0530510_0241138 | 3300061734 | Bacteria | 1346 |
| 1033 | 2643824226 | 2643221561 | Bacteria | 4984412 |
| 1034 | 2643851174 | 2643221567 | Bacteria | 4163945 |
| 1035 | 2644229149 | 2643221641 | Bacteria | 4490190 |
| 1036 | 2644455943 | 2643221681 | Bacteria | 3707866 |
| 1037 | 2644533530 | 2643221696 | Bacteria | 5431823 |
| 1038 | 2644538511 | 2643221697 | Bacteria | 3575694 |
| 1039 | 2644607516 | 2643221711 | Bacteria | 4865335 |
| 1040 | 2645720815 | 2643221961 | Bacteria | 3919167 |
| 1041 | 2645723824 | 2643221962 | Bacteria | 3874254 |
| 1042 | 2671835732 | 2671180195 | Bacteria | 9757215 |
| 1043 | 2676494466 | 2675903060 | Bacteria | 10051191 |
| 1044 | 2734970104 | 2734482000 | Bacteria | 5525167 |
| 1045 | 2740168049 | 2739367898 | Bacteria | 4367674 |
| 1046 | 2774853888 | 2773857922 | Bacteria | 9757215 |
| 1047 | 2784471478 | 2784132109 | Bacteria | 3141763 |
| 1048 | 2819426333 | 2818991318 | Bacteria | 5266538 |
| 1049 | 2819665370 | 2818991458 | Bacteria | 4794049 |
| 1050 | 2837269025 | 2837268691 | Bacteria | 7850704 |
| 1051 | 2855389968 | 2855386786 | Bacteria | 4752232 |
| 1052 | 2862578166 | 2862574272 | Bacteria | 10567477 |
| 1053 | 2867481071 | 2867475112 | Bacteria | 6909112 |
| 1054 | 2919449331 | 2919446982 | Bacteria | 3994487 |
| 1055 | 2935395221 | 2935390628 | Bacteria | 7043367 |
| 1056 | 2974316207 | 2974315732 | Bacteria | 4602776 |
| 1057 | 2984524368 | 2984523437 | Bacteria | 4508481 |
| 1058 | 2984592295 | 2984592036 | Bacteria | 3670284 |
| 1059 | 2997458230 | 2997451912 | Bacteria | 8492419 |
| 1060 | 3001890600 | 3001889506 | Bacteria | 2975194 |
| 1061 | 8025486075 | 8025478263 | Bacteria | 8209203 |
| 1062 | 8054160801 | 8054160619 | Bacteria | 7783213 |
| 1063 | 8054613750 | 8054609563 | Bacteria | 5170090 |
| 1064 | 8055073787 | 8055066027 | Bacteria | 9479577 |
| 1065 | 8056447893 | 8056447290 | Bacteria | 7680491 |
| 1066 | 8056673126 | 8056667051 | Bacteria | 6953971 |
| 1067 | Ga0307410_10851425 | |||
| 1068 | LJQas_1002544 | |||
| 1069 | LJQas_1003371 | |||
| 1070 | JGI24740J21852_10024400 | |||
| 1071 | JGI24740J21852_10043774 | |||
| 1072 | JGI24739J22299_10020519 | |||
| 1073 | JGI24739J22299_10145953 | |||
| 1074 | JGI24737J22298_10008409 | |||
| 1075 | JGI24737J22298_10012287 | |||
| 1076 | JGI24737J22298_10027583 | |||
| 1077 | JGI24737J22298_10078923 | |||
| 1078 | JGI24735J21928_10006549 | |||
| 1079 | JGI24749J21850_1019914 | |||
| 1080 | JGI25160J50197_1027253 | |||
| 1081 | JGI25404J52841_10002323 | |||
| 1082 | JGI25404J52841_10009368 | |||
| 1083 | Ga0058859_10041476 | |||
| 1084 | Ga0058863_10065621 | |||
| 1085 | Ga0058862_10100651 | |||
| 1086 | Ga0070658_10026607 | |||
| 1087 | Ga0070658_10278035 | |||
| 1088 | Ga0070658_10561934 | |||
| 1089 | Ga0070658_10568438 | |||
| 1090 | Ga0070658_11287459 | |||
| 1091 | Ga0070683_100145362 | |||
| 1092 | Ga0070683_100163005 | |||
| 1093 | Ga0070683_100511921 | |||
| 1094 | Ga0070690_100027098 | |||
| 1095 | Ga0070690_100374204 | |||
| 1096 | Ga0070690_100663378 | |||
| 1097 | Ga0070670_100566077 | |||
| 1098 | Ga0070670_100910279 | |||
| 1099 | Ga0070677_10063664 | |||
| 1100 | Ga0068869_100059598 | |||
| 1101 | Ga0070666_10030704 | |||
| 1102 | Ga0070680_100030852 | |||
| 1103 | Ga0070680_100826248 | |||
| 1104 | Ga0068868_100150264 | |||
| 1105 | Ga0068868_100258856 | |||
| 1106 | Ga0070660_100043146 | |||
| 1107 | Ga0070689_100898436 | |||
| 1108 | Ga0070687_100012021 | |||
| 1109 | Ga0070661_100016545 | |||
| 1110 | Ga0070661_100303814 | |||
| 1111 | Ga0070661_100513270 | |||
| 1112 | Ga0070692_10062248 | |||
| 1113 | Ga0070668_100003483 | |||
| 1114 | Ga0070668_100036770 | |||
| 1115 | Ga0070668_100620495 | |||
| 1116 | Ga0070668_100674885 | |||
| 1117 | Ga0070675_100008243 | |||
| 1118 | Ga0070671_100323271 | |||
| 1119 | Ga0070674_100112101 | |||
| 1120 | Ga0070673_100008022 | |||
| 1121 | Ga0070688_100306368 | |||
| 1122 | Ga0070659_100049958 | |||
| 1123 | Ga0070659_100054657 | |||
| 1124 | Ga0070659_100348162 | |||
| 1125 | Ga0070659_100505443 | |||
| 1126 | Ga0070659_100965815 | |||
| 1127 | Ga0070667_100196469 | |||
| 1128 | Ga0070667_100560330 | |||
| 1129 | Ga0070703_10001744 | |||
| 1130 | Ga0070709_10334812 | |||
| 1131 | Ga0070714_100548556 | |||
| 1132 | Ga0070713_100685787 | |||
| 1133 | Ga0070710_10102132 | |||
| 1134 | Ga0070701_10260060 | |||
| 1135 | Ga0070711_100011818 | |||
| 1136 | Ga0070705_100025564 | |||
| 1137 | Ga0070700_100040117 | |||
| 1138 | Ga0070694_100458641 | |||
| 1139 | Ga0070663_100003713 | |||
| 1140 | Ga0070663_100018814 | |||
| 1141 | Ga0070678_100025778 | |||
| 1142 | Ga0070662_100036864 | |||
| 1143 | Ga0070662_100978871 | |||
| 1144 | Ga0070681_10156766 | |||
| 1145 | Ga0068867_100413408 | |||
| 1146 | Ga0070685_10471050 | |||
| 1147 | Ga0070698_100915888 | |||
| 1148 | Ga0070699_100294482 | |||
| 1149 | Ga0070679_100040577 | |||
| 1150 | Ga0070679_100047460 | |||
| 1151 | Ga0070679_100667022 | |||
| 1152 | Ga0070684_100025884 | |||
| 1153 | Ga0070684_100386288 | |||
| 1154 | Ga0070684_100988699 | |||
| 1155 | Ga0068853_100054955 | |||
| 1156 | Ga0070672_100049439 | |||
| 1157 | Ga0070672_100098954 | |||
| 1158 | Ga0070672_100399673 | |||
| 1159 | Ga0070686_100016815 | |||
| 1160 | Ga0070686_100312558 | |||
| 1161 | Ga0070695_100711354 | |||
| 1162 | Ga0070696_100022624 | |||
| 1163 | Ga0070693_100015406 | |||
| 1164 | Ga0070693_100141358 | |||
| 1165 | Ga0068855_100204576 | |||
| 1166 | Ga0070664_100084984 | |||
| 1167 | Ga0070664_100235174 | |||
| 1168 | Ga0070664_100425536 | |||
| 1169 | Ga0068857_100051503 | |||
| 1170 | Ga0068857_100067096 | |||
| 1171 | Ga0068857_100276565 | |||
| 1172 | Ga0068854_100124477 | |||
| 1173 | Ga0068856_100321310 | |||
| 1174 | Ga0068852_100030950 | |||
| 1175 | Ga0068852_100650456 | |||
| 1176 | Ga0068852_101368767 | |||
| 1177 | Ga0068859_100590108 | |||
| 1178 | Ga0068859_101116260 | |||
| 1179 | Ga0068864_100042979 | |||
| 1180 | Ga0068866_10007484 | |||
| 1181 | Ga0068866_10300969 | |||
| 1182 | Ga0068861_100050932 | |||
| 1183 | Ga0068851_10099517 | |||
| 1184 | Ga0068870_10020461 | |||
| 1185 | Ga0068863_100101788 | |||
| 1186 | Ga0068858_100088600 | |||
| 1187 | Ga0068860_100031232 | |||
| 1188 | Ga0068860_100279397 | |||
| 1189 | Ga0081455_10193839 | |||
| 1190 | Ga0081540_1000341 | |||
| 1191 | Ga0081539_10041214 | |||
| 1192 | Ga0075365_10005427 | |||
| 1193 | Ga0075365_10010269 | |||
| 1194 | Ga0075365_10047138 | |||
| 1195 | Ga0075363_100060635 | |||
| 1196 | Ga0075363_100217110 | |||
| 1197 | Ga0075364_10002085 | |||
| 1198 | Ga0075364_10086362 | |||
| 1199 | Ga0075364_10199713 | |||
| 1200 | Ga0075364_10314438 | |||
| 1201 | Ga0070715_10068395 | |||
| 1202 | Ga0070715_10399429 | |||
| 1203 | Ga0070716_100079914 | |||
| 1204 | Ga0075367_10030754 | |||
| 1205 | Ga0075367_10091226 | |||
| 1206 | Ga0075369_10164990 | |||
| 1207 | Ga0075366_10046356 | |||
| 1208 | Ga0097621_100125114 | |||
| 1209 | Ga0097621_100477483 | |||
| 1210 | Ga0075370_10063757 | |||
| 1211 | Ga0075370_10096038 | |||
| 1212 | Ga0075431_100111938 | |||
| 1213 | Ga0075433_10154476 | |||
| 1214 | Ga0068865_100012035 | |||
| 1215 | Ga0068865_100432253 | |||
| 1216 | Ga0075436_100676551 | |||
| 1217 | Ga0097620_100590154 | |||
| 1218 | Ga0097620_101116279 | |||
| 1219 | Ga0075435_100187776 | |||
| 1220 | Ga0099795_10005676 | |||
| 1221 | Ga0105251_10017151 | |||
| 1222 | Ga0105240_10604346 | |||
| 1223 | Ga0114129_10128932 | |||
| 1224 | Ga0105243_10155585 | |||
| 1225 | Ga0105243_10313600 | |||
| 1226 | Ga0105241_10327878 | |||
| 1227 | Ga0105241_10733029 | |||
| 1228 | Ga0105242_10048204 | |||
| 1229 | Ga0105248_10028082 | |||
| 1230 | Ga0105248_11537813 | |||
| 1231 | Ga0105237_10205919 | |||
| 1232 | Ga0105238_10024399 | |||
| 1233 | Ga0105238_10154465 | |||
| 1234 | Ga0105238_10275283 | |||
| 1235 | Ga0105249_10687159 | |||
| 1236 | Ga0105028_101589 | |||
| 1237 | Ga0105246_10022573 | |||
| 1238 | Ga0157314_1004247 | |||
| 1239 | Ga0157347_1034320 | |||
| 1240 | Ga0157339_1001307 | |||
| 1241 | Ga0157342_1004268 | |||
| 1242 | Ga0157326_1004953 | |||
| 1243 | Ga0157373_10020075 | |||
| 1244 | Ga0157371_10011243 | |||
| 1245 | Ga0157370_10036228 | |||
| 1246 | Ga0157370_10380334 | |||
| 1247 | Ga0157369_10434604 | |||
| 1248 | Ga0157369_10729565 | |||
| 1249 | Ga0157374_10465779 | |||
| 1250 | Ga0163162_10197944 | |||
| 1251 | Ga0157372_10064774 | |||
| 1252 | Ga0157372_10345496 | |||
| 1253 | Ga0157372_10560791 | |||
| 1254 | Ga0157375_10058681 | |||
| 1255 | Ga0157375_10432688 | |||
| 1256 | Ga0157375_10624674 | |||
| 1257 | Ga0163163_10243613 | |||
| 1258 | Ga0163163_10921933 | |||
| 1259 | Ga0157380_10126489 | |||
| 1260 | Ga0182008_10198439 | |||
| 1261 | Ga0157377_10004084 | |||
| 1262 | Ga0157377_10321177 | |||
| 1263 | Ga0157377_10351388 | |||
| 1264 | Ga0157379_11183780 | |||
| 1265 | Ga0157376_10060699 | |||
| 1266 | Ga0157376_11007103 | |||
| 1267 | Ga0163161_10011752 | |||
| 1268 | Ga0163161_10054055 | |||
| 1269 | Ga0163161_10076665 | |||
| 1270 | Ga0163161_10483293 | |||
| 1271 | Ga0184603_142129 | |||
| 1272 | Ga0197907_10112628 | |||
| 1273 | Ga0197907_10949401 | |||
| 1274 | Ga0206354_10111251 | |||
| 1275 | Ga0206354_10596362 | |||
| 1276 | Ga0206354_11019960 | |||
| 1277 | Ga0206353_10575488 | |||
| 1278 | Ga0206353_10722515 | |||
| 1279 | Ga0206353_11113762 | |||
| 1280 | Ga0154015_1389080 | |||
| 1281 | Ga0154015_1394262 | |||
| 1282 | Ga0213876_10023891 | |||
| 1283 | Ga0224712_10000978 | |||
| 1284 | Ga0224712_10003998 | |||
| 1285 | Ga0224712_10010159 | |||
| 1286 | Ga0207426_1003235 | |||
| 1287 | Ga0207656_10079341 | |||
| 1288 | Ga0207656_10108734 | |||
| 1289 | Ga0207713_1046389 | |||
| 1290 | Ga0207653_10015068 | |||
| 1291 | Ga0207692_10007166 | |||
| 1292 | Ga0207692_10012926 | |||
| 1293 | Ga0207710_10008561 | |||
| 1294 | Ga0207688_10001159 | |||
| 1295 | Ga0207688_10005072 | |||
| 1296 | Ga0207688_10036973 | |||
| 1297 | Ga0207680_10120601 | |||
| 1298 | Ga0207647_10010255 | |||
| 1299 | Ga0207647_10039949 | |||
| 1300 | Ga0207685_10150146 | |||
| 1301 | Ga0207685_10435218 | |||
| 1302 | Ga0207699_10001668 | |||
| 1303 | Ga0207699_10001977 | |||
| 1304 | Ga0207699_10269142 | |||
| 1305 | Ga0207645_10046028 | |||
| 1306 | Ga0207643_10013524 | |||
| 1307 | Ga0207705_10003438 | |||
| 1308 | Ga0207705_10115376 | |||
| 1309 | Ga0207654_10048558 | |||
| 1310 | Ga0207707_10015978 | |||
| 1311 | Ga0207707_10371731 | |||
| 1312 | Ga0207707_10871401 | |||
| 1313 | Ga0207695_10106290 | |||
| 1314 | Ga0207695_10332121 | |||
| 1315 | Ga0207695_10514063 | |||
| 1316 | Ga0207671_10029560 | |||
| 1317 | Ga0207671_10094035 | |||
| 1318 | Ga0207693_10292026 | |||
| 1319 | Ga0207663_10011872 | |||
| 1320 | Ga0207663_10018057 | |||
| 1321 | Ga0207663_10081057 | |||
| 1322 | Ga0207660_10191125 | |||
| 1323 | Ga0207662_10002882 | |||
| 1324 | Ga0207662_10025569 | |||
| 1325 | Ga0207657_10001387 | |||
| 1326 | Ga0207649_10066532 | |||
| 1327 | Ga0207652_10259169 | |||
| 1328 | Ga0207652_10387656 | |||
| 1329 | Ga0207652_10801747 | |||
| 1330 | Ga0207681_10305203 | |||
| 1331 | Ga0207694_10165665 | |||
| 1332 | Ga0207694_10258966 | |||
| 1333 | Ga0207650_10149015 | |||
| 1334 | Ga0207650_10397855 | |||
| 1335 | Ga0207659_10069212 | |||
| 1336 | Ga0207687_10005166 | |||
| 1337 | Ga0207700_10006412 | |||
| 1338 | Ga0207700_10084912 | |||
| 1339 | Ga0207700_10104512 | |||
| 1340 | Ga0207664_10003003 | |||
| 1341 | Ga0207664_10006898 | |||
| 1342 | Ga0207664_10093952 | |||
| 1343 | Ga0207644_10024762 | |||
| 1344 | Ga0207644_10179212 | |||
| 1345 | Ga0207690_10048134 | |||
| 1346 | Ga0207690_10254656 | |||
| 1347 | Ga0207690_10364051 | |||
| 1348 | Ga0207690_10377652 | |||
| 1349 | Ga0207690_10464866 | |||
| 1350 | Ga0207690_10791107 | |||
| 1351 | Ga0207706_10016603 | |||
| 1352 | Ga0207686_10030825 | |||
| 1353 | Ga0207686_10480251 | |||
| 1354 | Ga0207669_10761424 | |||
| 1355 | Ga0207704_10089458 | |||
| 1356 | Ga0207665_10239179 | |||
| 1357 | Ga0207691_10030436 | |||
| 1358 | Ga0207691_10040006 | |||
| 1359 | Ga0207691_10255048 | |||
| 1360 | Ga0207711_10026932 | |||
| 1361 | Ga0207689_10002936 | |||
| 1362 | Ga0207661_10052310 | |||
| 1363 | Ga0207661_10418113 | |||
| 1364 | Ga0207661_10463321 | |||
| 1365 | Ga0207661_10478766 | |||
| 1366 | Ga0207679_10209425 | |||
| 1367 | Ga0207679_10217458 | |||
| 1368 | Ga0207667_10186338 | |||
| 1369 | Ga0207667_10488905 | |||
| 1370 | Ga0207651_10594109 | |||
| 1371 | Ga0207668_10001244 | |||
| 1372 | Ga0207668_10024969 | |||
| 1373 | Ga0207668_10147889 | |||
| 1374 | Ga0207668_10217745 | |||
| 1375 | Ga0207640_10028988 | |||
| 1376 | Ga0207658_10002262 | |||
| 1377 | Ga0207658_10023394 | |||
| 1378 | Ga0207658_10100622 | |||
| 1379 | Ga0207658_10354061 | |||
| 1380 | Ga0207658_10560070 | |||
| 1381 | Ga0207677_10015884 | |||
| 1382 | Ga0207677_10347824 | |||
| 1383 | Ga0207677_10379289 | |||
| 1384 | Ga0207677_10795855 | |||
| 1385 | Ga0207639_10050243 | |||
| 1386 | Ga0207678_10000929 | |||
| 1387 | Ga0207678_10002587 | |||
| 1388 | Ga0207678_10078838 | |||
| 1389 | Ga0207678_10324077 | |||
| 1390 | Ga0207678_10584415 | |||
| 1391 | Ga0207708_10025444 | |||
| 1392 | Ga0207708_10033142 | |||
| 1393 | Ga0207708_10466344 | |||
| 1394 | Ga0207702_10003344 | |||
| 1395 | Ga0207702_10043789 | |||
| 1396 | Ga0207702_10282130 | |||
| 1397 | Ga0207702_10477739 | |||
| 1398 | Ga0207641_10012413 | |||
| 1399 | Ga0207641_10029616 | |||
| 1400 | Ga0207641_10151858 | |||
| 1401 | Ga0207676_10170521 | |||
| 1402 | Ga0207674_10006508 | |||
| 1403 | Ga0207674_10026320 | |||
| 1404 | Ga0207674_10120238 | |||
| 1405 | Ga0207674_10341828 | |||
| 1406 | Ga0207675_100010883 | |||
| 1407 | Ga0207675_100039815 | |||
| 1408 | Ga0207675_100227704 | |||
| 1409 | Ga0207683_10002849 | |||
| 1410 | Ga0207683_10003476 | |||
| 1411 | Ga0207683_10046199 | |||
| 1412 | Ga0207683_10611383 | |||
| 1413 | Ga0207683_10720382 | |||
| 1414 | Ga0207698_10399334 | |||
| 1415 | Ga0209981_1023067 | |||
| 1416 | Ga0209813_10001880 | |||
| 1417 | Ga0268266_10109275 | |||
| 1418 | Ga0268266_10121702 | |||
| 1419 | Ga0268264_10000792 | |||
| 1420 | Ga0307515_10095406 | |||
| 1421 | Ga0265338_10014758 | |||
| 1422 | Ga0265338_10061662 | |||
| 1423 | Ga0311001_1013709 | |||
| 1424 | Ga0307512_10156912 | |||
| 1425 | Ga0316181_1005005 | |||
| 1426 | Ga0316182_1232924 | |||
| 1427 | Ga0265763_1021048 | |||
| 1428 | Ga0265767_100127 | |||
| 1429 | Ga0265770_1007774 | |||
| 1430 | Ga0307513_10011746 | |||
| 1431 | Ga0307509_10012707 | |||
| 1432 | Ga0307509_10084425 | |||
| 1433 | Ga0310116_103289 | |||
| 1434 | Ga0310117_103919 | |||
| 1435 | Ga0310115_106822 | |||
| 1436 | Ga0316575_10011120 | |||
| 1437 | Ga0316579_10003148 | |||
| 1438 | Ga0316579_10005517 | |||
| 1439 | Ga0316576_10009973 | |||
| 1440 | Ga0316576_10011042 | |||
| 1441 | Ga0316576_10015825 | |||
| 1442 | Ga0316576_10049104 | |||
| 1443 | Ga0316578_10016785 | |||
| 1444 | Ga0316578_10017124 | |||
| 1445 | Ga0316578_10090169 | |||
| 1446 | Ga0307405_10246931 | |||
| 1447 | Ga0307405_10349811 | |||
| 1448 | Ga0307405_10465057 | |||
| 1449 | Ga0316577_10035601 | |||
| 1450 | Ga0316577_10449185 | |||
| 1451 | Ga0307413_10741649 | |||
| 1452 | Ga0307410_10076652 | |||
| 1453 | Ga0307410_10165932 | |||
| 1454 | Ga0307406_10150201 | |||
| 1455 | Ga0307407_10083148 | |||
| 1456 | Ga0307407_10114589 | |||
| 1457 | Ga0307412_10255387 | |||
| 1458 | Ga0307412_10894250 | |||
| 1459 | Ga0307409_100091276 | |||
| 1460 | Ga0307409_100621614 | |||
| 1461 | Ga0307409_100778054 | |||
| 1462 | Ga0307409_101261888 | |||
| 1463 | Ga0307416_100431629 | |||
| 1464 | Ga0307416_101152117 | |||
| 1465 | Ga0307414_10070859 | |||
| 1466 | Ga0307414_10397529 | |||
| 1467 | Ga0307414_10410258 | |||
| 1468 | Ga0307414_10474407 | |||
| 1469 | Ga0307411_10418557 | |||
| 1470 | Ga0307415_100313078 | |||
| 1471 | Ga0307415_100556002 | |||
| 1472 | Ga0316583_10012326 | |||
| 1473 | Ga0316583_10018078 | |||
| 1474 | Ga0316583_10195409 | |||
| 1475 | Ga0316585_10005598 | |||
| 1476 | Ga0316585_10007990 | |||
| 1477 | Ga0316580_10001591 | |||
| 1478 | Ga0316593_10038217 | |||
| 1479 | Ga0307507_10078944 | |||
| 1480 | Ga0307510_10036115 | |||
| 1481 | Ga0307510_10448380 | |||
| 1482 | Ga0316592_1006178 | |||
| 1483 | Ga0316592_1011540 | |||
| 1484 | Ga0316586_1024288 | |||
| 1485 | Ga0316588_1003297 | |||
| 1486 | Ga0316596_1006516 | |||
| 1487 | Ga0316596_1010689 | |||
| 1488 | Ga0316214_1000853 | |||
| 1489 | Ga0373930_0060483 | |||
| 1490 | Ga0373950_0018484 | |||
| 1491 | Ga0373958_0011974 | |||
| 1492 | Ga0373959_0022162 | |||
| 1493 | Ga0373938_0006655 | |||
| 1494 | Ga0373926_0001795 | |||
| 1495 | Ga0373926_0081669 | |||
| 1496 | Ga0373929_0010821 | |||
| 1497 | Ga0373929_0095959 | |||
| 1498 | Ga0373934_0065509 | |||
| 1499 | Ga0373934_0128298 | |||
| 1500 | Ga0373940_0038980 | |||
| 1501 | Ga0373949_0006803 | |||
| 1502 | Ga0373949_0136066 | |||
| 1503 | Ga0373951_0040515 | |||
| 1504 | Ga0373952_0002133 | |||
| 1505 | Ga0373923_0029180 | |||
| 1506 | Ga0373936_0075154 | |||
| 1507 | Ga0373936_0158249 | |||
| 1508 | Ga0373939_0078649 | |||
| 1509 | Ga0373941_0027282 | |||
| 1510 | Ga0373953_0010766 | |||
| 1511 | Ga0373954_0021194 | |||
| 1512 | Ga0373954_0080638 | |||
| 1513 | Ga0373956_0099854 | |||
| 1514 | Ga0373943_0011419 | |||
| 1515 | Ga0373955_0028721 | |||
| 1516 | Ga0373942_0003606 | |||
| 1517 | Ga0373961_0006256 | |||
| 1518 | Ga0373962_0129064 | |||
| 1519 | Ga0316574_0003558 | |||
| 1520 | Ga0316574_0004026 | |||
| 1521 | Ga0316574_0023256 | |||
| 1522 | Ga0316574_0032259 | |||
| 1523 | Ga0316574_0049174 | |||
| 1524 | Ga0373924_0064246 | |||
| 1525 | Ga0373931_0207866 | |||
| 1526 | Ga0373927_0052651 | |||
| 1527 | Ga0373933_0040792 | |||
| 1528 | Ga0373937_0560290 | |||
| 1529 | Ga0372808_000924 | |||
| 1530 | Ga0316582_0001841 | |||
| 1531 | Ga0316582_0031807 | |||
| 1532 | Ga0316582_0114084 | |||
| 1533 | Ga0316584_0003484 | |||
| 1534 | Ga0316584_0005394 | |||
| 1535 | Ga0373925_0000004 | |||
| 1536 | Ga0373925_0708978 | |||
| 1537 | Ga0373925_1152266 | |||
| 1538 | Ga0395899_0006378 | |||
| 1539 | Ga0395900_0055781 | |||
| 1540 | Ga0395900_0068181 | |||
| 1541 | Ga0395900_0350113 | |||
| 1542 | Ga0395900_0527639 | |||
| 1543 | Ga0395898_0052729 | |||
| 1544 | Ga0395898_0109702 | |||
| 1545 | Ga0395905_0034499 | |||
| 1546 | Ga0395905_0112855 | |||
| 1547 | Ga0436364_0624941 | |||
| 1548 | Ga0436364_1561235 | |||
| 1549 | Ga0395901_0002011 | |||
| 1550 | Ga0395901_0018326 | |||
| 1551 | Ga0395901_0024756 | |||
| 1552 | Ga0395901_0128864 | |||
| 1553 | Ga0395901_0711862 | |||
| 1554 | Ga0395901_1384348 | |||
| 1555 | Ga0246641_00856 | |||
| 1556 | Ga0436365_1093008 | |||
| 1557 | Ga0436365_1742710 | |||
| 1558 | Ga0436363_0951008 | |||
| 1559 | Ga0436363_1346257 | |||
| 1560 | Ga0439436_0057590 | |||
| 1561 | Ga0439438_082877 | |||
| 1562 | Ga0451797_0953582 | |||
| 1563 | Ga0451807_2663483 | |||
| 1564 | Ga0451833_0940272 | |||
| 1565 | Ga0451837_1096605 | |||
| 1566 | Ga0451837_1738307 | |||
| 1567 | Ga0451843_0656929 | |||
| 1568 | Ga0451853_0724050 | |||
| 1569 | Ga0451853_1129289 | |||
| 1570 | Ga0451853_2987354 | |||
| 1571 | Ga0439442_044996 | |||
| 1572 | Ga0439445_0107616 | |||
| 1573 | Ga0439454_004739 | |||
| 1574 | Ga0439462_0024189 | |||
| 1575 | Ga0450906_050823 | |||
| 1576 | Ga0450907_012360 | |||
| 1577 | Ga0439464_0003677 | |||
| 1578 | Ga0466969_0015659 | |||
| 1579 | Ga0466972_0007797 | |||
| 1580 | Ga0466972_0077032 | |||
| 1581 | Ga0466972_0088997 | |||
| 1582 | Ga0466965_0018349 | |||
| 1583 | Ga0466965_0086225 | |||
| 1584 | Ga0466965_0228850 | |||
| 1585 | Ga0466965_0300473 | |||
| 1586 | Ga0466965_0461516 | |||
| 1587 | Ga0466966_0047711 | |||
| 1588 | Ga0466966_0059964 | |||
| 1589 | Ga0466966_0091649 | |||
| 1590 | Ga0466966_0246124 | |||
| 1591 | Ga0466961_0005440 | |||
| 1592 | Ga0466961_0009592 | |||
| 1593 | Ga0466961_0026459 | |||
| 1594 | Ga0466961_0041150 | |||
| 1595 | Ga0466961_0347470 | |||
| 1596 | Ga0466963_0016148 | |||
| 1597 | Ga0466963_0107473 | |||
| 1598 | Ga0466963_0253797 | |||
| 1599 | Ga0466963_0266010 | |||
| 1600 | Ga0466963_0324304 | |||
| 1601 | Ga0466964_0011253 | |||
| 1602 | Ga0466964_0067997 | |||
| 1603 | Ga0466964_0116543 | |||
| 1604 | Ga0466971_0001406 | |||
| 1605 | Ga0466971_0024327 | |||
| 1606 | Ga0466968_0100059 | |||
| 1607 | Ga0466970_0005678 | |||
| 1608 | Ga0466970_0044578 | |||
| 1609 | Ga0466970_0082051 | |||
| 1610 | Ga0466970_0189322 | |||
| 1611 | Ga0466970_0206926 | |||
| 1612 | Ga0466970_0207482 | |||
| 1613 | Ga0466970_0212592 | |||
| 1614 | Ga0466970_0360675 | |||
| 1615 | Ga0466957_0001751 | |||
| 1616 | Ga0466957_0003801 | |||
| 1617 | Ga0466957_0041425 | |||
| 1618 | Ga0466957_0154969 | |||
| 1619 | Ga0466957_0403497 | |||
| 1620 | Ga0466960_0006772 | |||
| 1621 | Ga0466960_0019073 | |||
| 1622 | Ga0466960_0038077 | |||
| 1623 | Ga0466959_0124349 | |||
| 1624 | Ga0466959_0229616 | |||
| 1625 | Ga0466959_0394619 | |||
| 1626 | Ga0466958_0012657 | |||
| 1627 | Ga0466958_0022751 | |||
| 1628 | Ga0466958_0125691 | |||
| 1629 | Ga0466958_0221417 | |||
| 1630 | Ga0466967_0008916 | |||
| 1631 | Ga0466967_0011477 | |||
| 1632 | Ga0466967_0012456 | |||
| 1633 | Ga0466967_0019141 | |||
| 1634 | Ga0466967_0045336 | |||
| 1635 | Ga0466967_0086365 | |||
| 1636 | Ga0466967_0376227 | |||
| 1637 | Ga0466967_0746528 | |||
| 1638 | Ga0466967_0749490 | |||
| 1639 | Ga0495592_0142506 | |||
| 1640 | Ga0495592_0203739 | |||
| 1641 | Ga0495603_0012499 | |||
| 1642 | Ga0495629_0019176 | |||
| 1643 | Ga0495629_0392937 | |||
| 1644 | Ga0495638_0016739 | |||
| 1645 | Ga0495641_0003583 | |||
| 1646 | Ga0495641_0035689 | |||
| 1647 | Ga0495651_0000169 | |||
| 1648 | Ga0495651_0029794 | |||
| 1649 | Ga0495651_0330819 | |||
| 1650 | Ga0495653_0067856 | |||
| 1651 | Ga0495653_0068012 | |||
| 1652 | Ga0495653_0132483 | |||
| 1653 | Ga0495653_0149658 | |||
| 1654 | Ga0495580_0035177 | |||
| 1655 | Ga0495582_0121270 | |||
| 1656 | Ga0495639_0054995 | |||
| 1657 | Ga0495662_0018856 | |||
| 1658 | Ga0495664_0030772 | |||
| 1659 | Ga0495664_0318835 | |||
| 1660 | Ga0495585_0167012 | |||
| 1661 | Ga0495607_0159700 | |||
| 1662 | Ga0495608_0040445 | |||
| 1663 | Ga0495608_0111871 | |||
| 1664 | Ga0495618_0095052 | |||
| 1665 | Ga0495628_0004361 | |||
| 1666 | Ga0495628_0221610 | |||
| 1667 | Ga0495628_0266415 | |||
| 1668 | Ga0495630_0068032 | |||
| 1669 | Ga0495666_0018448 | |||
| 1670 | Ga0495652_0011903 | |||
| 1671 | Ga0495652_0071875 | |||
| 1672 | Ga0495665_0003597 | |||
| 1673 | Ga0495640_0035704 | |||
| 1674 | Ga0495640_0045392 | |||
| 1675 | Ga0495586_0028108 | |||
| 1676 | Ga0495587_0120858 | |||
| 1677 | Ga0495587_0126899 | |||
| 1678 | Ga0495645_0026666 | |||
| 1679 | Ga0495645_0066478 | |||
| 1680 | Ga0495645_0262263 | |||
| 1681 | Ga0495622_0059954 | |||
| 1682 | Ga0495667_0012986 | |||
| 1683 | Ga0495667_0070366 | |||
| 1684 | Ga0495667_0502544 | |||
| 1685 | Ga0495656_0043112 | |||
| 1686 | Ga0495634_0005879 | |||
| 1687 | Ga0495635_0014023 | |||
| 1688 | Ga0495635_0022472 | |||
| 1689 | Ga0495635_0077571 | |||
| 1690 | Ga0495635_0144740 | |||
| 1691 | Ga0495657_0014898 | |||
| 1692 | Ga0495657_0407829 | |||
| 1693 | Ga0495599_0047758 | |||
| 1694 | Ga0495599_0236070 | |||
| 1695 | Ga0495623_0003245 | |||
| 1696 | Ga0495623_0341057 | |||
| 1697 | Ga0495646_0038695 | |||
| 1698 | Ga0495646_0041433 | |||
| 1699 | Ga0495647_0005262 | |||
| 1700 | Ga0495658_0437185 | |||
| 1701 | Ga0495669_0019422 | |||
| 1702 | Ga0495613_0017693 | |||
| 1703 | Ga0495624_0222191 | |||
| 1704 | Ga0495600_0136587 | |||
| 1705 | Ga0495600_0140744 | |||
| 1706 | Ga0495600_0197509 | |||
| 1707 | Ga0495581_0004893 | |||
| 1708 | Ga0495604_0064253 | |||
| 1709 | Ga0495604_0198084 | |||
| 1710 | Ga0495604_0505318 | |||
| 1711 | Ga0495674_0094452 | |||
| 1712 | Ga0495674_0161291 | |||
| 1713 | Ga0495674_0262553 | |||
| 1714 | Ga0495674_0350397 | |||
| 1715 | Ga0495674_0369979 | |||
| 1716 | Ga0495676_0024236 | |||
| 1717 | Ga0495676_0554607 | |||
| 1718 | Ga0495676_0821387 | |||
| 1719 | Ga0495680_0073670 | |||
| 1720 | Ga0495680_0172293 | |||
| 1721 | Ga0495680_0201799 | |||
| 1722 | Ga0495680_0339216 | |||
| 1723 | Ga0495683_0003613 | |||
| 1724 | Ga0495675_0065651 | |||
| 1725 | Ga0495684_0006411 | |||
| 1726 | Ga0495593_0161336 | |||
| 1727 | Ga0495602_0072071 | |||
| 1728 | Ga0495602_0094996 | |||
| 1729 | Ga0495602_0242532 | |||
| 1730 | Ga0495614_0220217 | |||
| 1731 | Ga0496100_0001690 | |||
| 1732 | Ga0496100_0038035 | |||
| 1733 | Ga0496100_0062063 | |||
| 1734 | Ga0496100_0279081 | |||
| 1735 | Ga0496100_0410013 | |||
| 1736 | Ga0496100_1059587 | |||
| 1737 | Ga0496101_0098005 | |||
| 1738 | Ga0496101_0161957 | |||
| 1739 | Ga0496101_0177173 | |||
| 1740 | Ga0496102_0008709 | |||
| 1741 | Ga0496102_0030623 | |||
| 1742 | Ga0496102_0078954 | |||
| 1743 | Ga0496102_0291705 | |||
| 1744 | Ga0496102_0295427 | |||
| 1745 | Ga0496103_0005052 | |||
| 1746 | Ga0496103_0021213 | |||
| 1747 | Ga0496103_0047442 | |||
| 1748 | Ga0496103_0113581 | |||
| 1749 | Ga0496103_0124836 | |||
| 1750 | Ga0496104_0012662 | |||
| 1751 | Ga0496104_0183433 | |||
| 1752 | Ga0496104_0314662 | |||
| 1753 | Ga0496104_0406627 | |||
| 1754 | Ga0496105_0023753 | |||
| 1755 | Ga0496105_0057129 | |||
| 1756 | Ga0496105_0087327 | |||
| 1757 | Ga0496105_0205624 | |||
| 1758 | Ga0496105_0776933 | |||
| 1759 | Ga0496106_0211113 | |||
| 1760 | Ga0496107_0010178 | |||
| 1761 | Ga0496107_0190866 | |||
| 1762 | Ga0496107_0200618 | |||
| 1763 | Ga0496108_0022038 | |||
| 1764 | Ga0496108_0035892 | |||
| 1765 | Ga0496108_0054098 | |||
| 1766 | Ga0496108_0058001 | |||
| 1767 | Ga0496108_0123605 | |||
| 1768 | Ga0496108_0200647 | |||
| 1769 | Ga0496108_0209348 | |||
| 1770 | Ga0496108_0739577 | |||
| 1771 | Ga0496109_0008096 | |||
| 1772 | Ga0496109_0011868 | |||
| 1773 | Ga0496109_0095042 | |||
| 1774 | Ga0496109_0099512 | |||
| 1775 | Ga0496109_0126497 | |||
| 1776 | Ga0496109_0140882 | |||
| 1777 | Ga0496109_0221191 | |||
| 1778 | Ga0496109_0243342 | |||
| 1779 | Ga0496109_0323736 | |||
| 1780 | Ga0496110_0002685 | |||
| 1781 | Ga0496110_0018772 | |||
| 1782 | Ga0496110_0048688 | |||
| 1783 | Ga0496110_0109101 | |||
| 1784 | Ga0496110_0182540 | |||
| 1785 | Ga0496110_0382112 | |||
| 1786 | Ga0496110_0825917 | |||
| 1787 | Ga0496111_0011005 | |||
| 1788 | Ga0496111_0014401 | |||
| 1789 | Ga0496111_0023360 | |||
| 1790 | Ga0496111_0026509 | |||
| 1791 | Ga0496111_0224706 | |||
| 1792 | Ga0496111_0407018 | |||
| 1793 | Ga0496112_0057073 | |||
| 1794 | Ga0496112_0130195 | |||
| 1795 | Ga0496112_0198098 | |||
| 1796 | Ga0496112_0580681 | |||
| 1797 | Ga0496112_1114351 | |||
| 1798 | Ga0496113_0012988 | |||
| 1799 | Ga0496113_0041589 | |||
| 1800 | Ga0496113_0094930 | |||
| 1801 | Ga0496113_0629115 | |||
| 1802 | Ga0496114_0175712 | |||
| 1803 | Ga0496114_0207804 | |||
| 1804 | Ga0496114_0247129 | |||
| 1805 | Ga0496115_0059690 | |||
| 1806 | Ga0496115_0076142 | |||
| 1807 | Ga0496115_0137141 | |||
| 1808 | Ga0496117_0196583 | |||
| 1809 | Ga0496119_0024498 | |||
| 1810 | Ga0496119_0176062 | |||
| 1811 | Ga0496119_0234397 | |||
| 1812 | Ga0496122_0015469 | |||
| 1813 | Ga0496122_0055803 | |||
| 1814 | Ga0496123_0019835 | |||
| 1815 | Ga0496123_0041554 | |||
| 1816 | Ga0496124_0038275 | |||
| 1817 | Ga0496124_0291985 | |||
| 1818 | Ga0496126_0008800 | |||
| 1819 | Ga0496126_0041790 | |||
| 1820 | Ga0496126_0111838 | |||
| 1821 | Ga0501306_004436 | |||
| 1822 | Ga0501306_004912 | |||
| 1823 | Ga0501306_015030 | |||
| 1824 | Ga0501306_021234 | |||
| 1825 | Ga0501308_013172 | |||
| 1826 | Ga0501309_002625 | |||
| 1827 | Ga0501310_001524 | |||
| 1828 | Ga0501310_001576 | |||
| 1829 | Ga0501310_001843 | |||
| 1830 | Ga0501310_007780 | |||
| 1831 | Ga0501310_010317 | |||
| 1832 | Ga0501341_04032 | |||
| 1833 | Ga0501341_04391 | |||
| 1834 | Ga0501304_004891 | |||
| 1835 | Ga0501304_006976 | |||
| 1836 | Ga0501305_000247 | |||
| 1837 | Ga0501305_004689 | |||
| 1838 | Ga0501305_013477 | |||
| 1839 | Ga0501307_000425 | |||
| 1840 | Ga0501307_002945 | |||
| 1841 | Ga0501311_006900 | |||
| 1842 | Ga0501312_001041 | |||
| 1843 | Ga0501312_007888 | |||
| 1844 | Ga0501312_040646 | |||
| 1845 | Ga0501313_001100 | |||
| 1846 | Ga0501313_010211 | |||
| 1847 | Ga0501313_017759 | |||
| 1848 | Ga0501314_001924 | |||
| 1849 | Ga0501314_019924 | |||
| 1850 | Ga0501315_001948 | |||
| 1851 | Ga0501316_001756 | |||
| 1852 | Ga0501316_001871 | |||
| 1853 | Ga0501316_006101 | |||
| 1854 | Ga0501317_001407 | |||
| 1855 | Ga0501318_000136 | |||
| 1856 | Ga0501318_003546 | |||
| 1857 | Ga0501318_005547 | |||
| 1858 | Ga0501319_002482 | |||
| 1859 | Ga0501320_000277 | |||
| 1860 | Ga0501320_000989 | |||
| 1861 | Ga0501320_002460 | |||
| 1862 | Ga0501320_002714 | |||
| 1863 | Ga0501320_002966 | |||
| 1864 | Ga0501320_004127 | |||
| 1865 | Ga0501321_000036 | |||
| 1866 | Ga0501321_000260 | |||
| 1867 | Ga0501321_006115 | |||
| 1868 | Ga0501321_014755 | |||
| 1869 | Ga0501322_000885 | |||
| 1870 | Ga0501322_003462 | |||
| 1871 | Ga0501323_001980 | |||
| 1872 | Ga0501323_002331 | |||
| 1873 | Ga0501323_010328 | |||
| 1874 | Ga0501324_003394 | |||
| 1875 | Ga0501325_000156 | |||
| 1876 | Ga0501325_000249 | |||
| 1877 | Ga0501326_01209 | |||
| 1878 | Ga0501329_00057 | |||
| 1879 | Ga0501330_005306 | |||
| 1880 | Ga0501332_01635 | |||
| 1881 | Ga0501333_001220 | |||
| 1882 | Ga0501334_03218 | |||
| 1883 | Ga0501336_000521 | |||
| 1884 | Ga0501338_00927 | |||
| 1885 | Ga0501340_003446 | |||
| 1886 | Ga0501031_0003261 | |||
| 1887 | Ga0501031_0013728 | |||
| 1888 | Ga0501031_0026809 | |||
| 1889 | Ga0501031_0048743 | |||
| 1890 | Ga0501031_0110643 | |||
| 1891 | Ga0501031_0119959 | |||
| 1892 | Ga0501031_0196883 | |||
| 1893 | Ga0501032_0001347 | |||
| 1894 | Ga0501032_0029669 | |||
| 1895 | Ga0501032_0094053 | |||
| 1896 | Ga0501032_0220509 | |||
| 1897 | Ga0501033_0005545 | |||
| 1898 | Ga0501033_0103656 | |||
| 1899 | Ga0501033_0202791 | |||
| 1900 | Ga0501033_0252841 | |||
| 1901 | Ga0501034_0011756 | |||
| 1902 | Ga0501034_0017192 | |||
| 1903 | Ga0501034_0680938 | |||
| 1904 | Ga0501036_0003874 | |||
| 1905 | Ga0501036_0015731 | |||
| 1906 | Ga0501036_0053426 | |||
| 1907 | Ga0501036_0081619 | |||
| 1908 | Ga0501036_0287575 | |||
| 1909 | Ga0501037_0004030 | |||
| 1910 | Ga0501037_0138940 | |||
| 1911 | Ga0501037_0371208 | |||
| 1912 | Ga0501038_0007465 | |||
| 1913 | Ga0501038_0009388 | |||
| 1914 | Ga0501038_0138305 | |||
| 1915 | Ga0501038_0144848 | |||
| 1916 | Ga0501038_0151350 | |||
| 1917 | Ga0501038_0314909 | |||
| 1918 | Ga0501039_0003016 | |||
| 1919 | Ga0501039_0026196 | |||
| 1920 | Ga0501039_0065871 | |||
| 1921 | Ga0501039_0126555 | |||
| 1922 | Ga0501039_0372700 | |||
| 1923 | Ga0501040_0002706 | |||
| 1924 | Ga0501040_0022758 | |||
| 1925 | Ga0501040_0044216 | |||
| 1926 | Ga0501040_0083061 | |||
| 1927 | Ga0501040_0280634 | |||
| 1928 | Ga0501040_0328943 | |||
| 1929 | Ga0501041_0002671 | |||
| 1930 | Ga0501041_0006740 | |||
| 1931 | Ga0501041_0026655 | |||
| 1932 | Ga0501041_0371149 | |||
| 1933 | Ga0501042_0024746 | |||
| 1934 | Ga0501042_0034939 | |||
| 1935 | Ga0501042_0354536 | |||
| 1936 | Ga0501043_0024200 | |||
| 1937 | Ga0501043_0029097 | |||
| 1938 | Ga0501046_0002011 | |||
| 1939 | Ga0501046_0050473 | |||
| 1940 | Ga0501046_0050632 | |||
| 1941 | Ga0501046_0331079 | |||
| 1942 | Ga0501046_0391700 | |||
| 1943 | Ga0501046_0498686 | |||
| 1944 | Ga0501047_0000278 | |||
| 1945 | Ga0501047_0008040 | |||
| 1946 | Ga0501047_0023199 | |||
| 1947 | Ga0501047_0125201 | |||
| 1948 | Ga0501048_0001026 | |||
| 1949 | Ga0501048_0033481 | |||
| 1950 | Ga0501048_0165013 | |||
| 1951 | Ga0501048_0195212 | |||
| 1952 | Ga0501067_0000592 | |||
| 1953 | Ga0501067_0035438 | |||
| 1954 | Ga0501068_0003271 | |||
| 1955 | Ga0501068_0205550 | |||
| 1956 | Ga0501068_0267407 | |||
| 1957 | Ga0501069_0006049 | |||
| 1958 | Ga0501069_0013692 | |||
| 1959 | Ga0501069_0221171 | |||
| 1960 | Ga0501069_0251237 | |||
| 1961 | Ga0501069_0291128 | |||
| 1962 | Ga0501069_0340815 | |||
| 1963 | Ga0501069_0466764 | |||
| 1964 | Ga0501069_0590024 | |||
| 1965 | Ga0501070_0004123 | |||
| 1966 | Ga0501070_0004983 | |||
| 1967 | Ga0501070_0007652 | |||
| 1968 | Ga0501070_0101284 | |||
| 1969 | Ga0501070_0108719 | |||
| 1970 | Ga0501070_0469519 | |||
| 1971 | Ga0501070_0707538 | |||
| 1972 | Ga0501071_0005440 | |||
| 1973 | Ga0501071_0005948 | |||
| 1974 | Ga0501071_0067819 | |||
| 1975 | Ga0501071_0119659 | |||
| 1976 | Ga0501071_0497746 | |||
| 1977 | Ga0501072_0001152 | |||
| 1978 | Ga0501072_0033624 | |||
| 1979 | Ga0501072_0254096 | |||
| 1980 | Ga0501072_0304805 | |||
| 1981 | Ga0501073_0004460 | |||
| 1982 | Ga0501073_0131495 | |||
| 1983 | Ga0501074_0003766 | |||
| 1984 | Ga0501074_0003829 | |||
| 1985 | Ga0501074_0014346 | |||
| 1986 | Ga0501075_0017703 | |||
| 1987 | Ga0501075_0458315 | |||
| 1988 | Ga0501075_0632239 | |||
| 1989 | Ga0501075_0663171 | |||
| 1990 | Ga0501076_0007352 | |||
| 1991 | Ga0501076_0062892 | |||
| 1992 | Ga0501076_0082515 | |||
| 1993 | Ga0501076_0101880 | |||
| 1994 | Ga0501076_0339783 | |||
| 1995 | Ga0501076_0454217 | |||
| 1996 | Ga0501077_0003693 | |||
| 1997 | Ga0501077_0012235 | |||
| 1998 | Ga0501077_0015668 | |||
| 1999 | Ga0501079_0050969 | |||
| 2000 | Ga0501080_0004649 | |||
| 2001 | Ga0501080_0022770 | |||
| 2002 | Ga0501080_0063974 | |||
| 2003 | Ga0501080_0107570 | |||
| 2004 | Ga0501080_0432696 | |||
| 2005 | Ga0501081_0008966 | |||
| 2006 | Ga0501081_0107003 | |||
| 2007 | Ga0501081_0335521 | |||
| 2008 | Ga0501083_0004200 | |||
| 2009 | Ga0501083_0143435 | |||
| 2010 | Ga0501035_0015444 | |||
| 2011 | Ga0501035_0017574 | |||
| 2012 | Ga0501035_0019781 | |||
| 2013 | Ga0501035_0069836 | |||
| 2014 | Ga0501035_0204322 | |||
| 2015 | Ga0501035_0601079 | |||
| 2016 | Ga0501035_0603300 | |||
| 2017 | Ga0501044_0010423 | |||
| 2018 | Ga0501044_0044490 | |||
| 2019 | Ga0501044_0088185 | |||
| 2020 | Ga0501044_0314347 | |||
| 2021 | Ga0501044_0421215 | |||
| 2022 | Ga0501045_0005656 | |||
| 2023 | Ga0501045_0006942 | |||
| 2024 | Ga0501045_0009893 | |||
| 2025 | Ga0501045_0025024 | |||
| 2026 | Ga0501045_0217938 | |||
| 2027 | Ga0501045_0341315 | |||
| 2028 | nmdc:mga03n38_178117_c1 | |||
| 2029 | nmdc:mga03n38_6768_c1 | |||
| 2030 | nmdc:mga00v17_180307_c1 | |||
| 2031 | nmdc:mga00v17_958_c1 | |||
| 2032 | nmdc:mga0yw44_1197_c1 | |||
| 2033 | nmdc:mga0yw44_2187_c1 | |||
| 2034 | nmdc:mga06z11_1560_c1 | |||
| 2035 | nmdc:mga06z11_53803_c1 | |||
| 2036 | nmdc:mga04h51_28361_c1 | |||
| 2037 | nmdc:mga07m45_413222_c1 | |||
| 2038 | nmdc:mga07m45_5853_c1 | |||
| 2039 | nmdc:mga06r32_136_c2 | |||
| 2040 | nmdc:mga0n895_574310_c1 | |||
| 2041 | nmdc:mga0rr50_446787_c1 | |||
| 2042 | nmdc:mga08x19_177064_c1 | |||
| 2043 | Ga0495601_0008187 | |||
| 2044 | Ga0495601_0009796 | |||
| 2045 | Ga0495612_0016852 | |||
| 2046 | Ga0495612_0018939 | |||
| 2047 | Ga0495612_0082754 | |||
| 2048 | Ga0495655_0112064 | |||
| 2049 | Ga0495595_0084971 | |||
| 2050 | Ga0495619_0021438 | |||
| 2051 | Ga0495619_0063850 | |||
| 2052 | Ga0495619_0129781 | |||
| 2053 | Ga0495619_0134926 | |||
| 2054 | Ga0495619_0229240 | |||
| 2055 | Ga0500641_0000363 | |||
| 2056 | Ga0500616_0016827 | |||
| 2057 | Ga0500639_244526 | |||
| 2058 | Ga0500611_132952 | |||
| 2059 | Ga0501084_0001550 | |||
| 2060 | Ga0501084_0014112 | |||
| 2061 | Ga0501084_0319807 | |||
| 2062 | Ga0501084_0617328 | |||
| 2063 | Ga0587070_041752 | |||
| 2064 | Ga0587077_009339 | |||
| 2065 | Ga0587080_003407 | |||
| 2066 | Ga0587080_004067 | |||
| 2067 | Ga0587083_0016332 | |||
| 2068 | Ga0587083_0018638 | |||
| 2069 | Ga0587083_0064238 | |||
| 2070 | Ga0587088_070091 | |||
| 2071 | Ga0587090_019187 | |||
| 2072 | Ga0587090_028243 | |||
| 2073 | Ga0587090_030729 | |||
| 2074 | Ga0587091_019318 | |||
| 2075 | Ga0587106_002255 | |||
| 2076 | Ga0587106_007182 | |||
| 2077 | Ga0587099_008078 | |||
| 2078 | Ga0587101_009312 | |||
| 2079 | Ga0587101_014944 | |||
| 2080 | Ga0587117_029071 | |||
| 2081 | Ga0587128_007988 | |||
| 2082 | Ga0587067_016763 | |||
| 2083 | Ga0587068_001843 | |||
| 2084 | Ga0587075_007403 | |||
| 2085 | Ga0587076_006534 | |||
| 2086 | Ga0587079_015434 | |||
| 2087 | Ga0587104_003738 | |||
| 2088 | Ga0587105_004336 | |||
| 2089 | Ga0587107_032477 | |||
| 2090 | Ga0501082_0046869 | |||
| 2091 | Ga0501082_0153707 | |||
| 2092 | Ga0466962_0001686 | |||
| 2093 | Ga0466962_0055564 | |||
| 2094 | Ga0466962_0064981 | |||
| 2095 | Ga0466962_0090674 | |||
| 2096 | Ga0530510_0007003 | |||
| 2097 | Ga0530510_0166551 | |||
| 2098 | Ga0530510_0241138 | |||
| 2099 | 2643824226 | |||
| 2100 | 2643851174 | |||
| 2101 | 2644229149 | |||
| 2102 | 2644455943 | |||
| 2103 | 2644533530 | |||
| 2104 | 2644538511 | |||
| 2105 | 2644607516 | |||
| 2106 | 2645720815 | |||
| 2107 | 2645723824 | |||
| 2108 | 2671835732 | |||
| 2109 | 2676494466 | |||
| 2110 | 2734970104 | |||
| 2111 | 2740168049 | |||
| 2112 | 2774853888 | |||
| 2113 | 2784471478 | |||
| 2114 | 2819426333 | |||
| 2115 | 2819665370 | |||
| 2116 | 2837269025 | |||
| 2117 | 2855389968 | |||
| 2118 | 2862578166 | |||
| 2119 | 2867481071 | |||
| 2120 | 2919449331 | |||
| 2121 | 2935395221 | |||
| 2122 | 2974316207 | |||
| 2123 | 2984524368 | |||
| 2124 | 2984592295 | |||
| 2125 | 2997458230 | |||
| 2126 | 3001890600 | |||
| 2127 | 8025486075 | |||
| 2128 | 8054160801 | |||
| 2129 | 8054613750 | |||
| 2130 | 8055073787 | |||
| 2131 | 8056447893 | |||
| 2132 | 8056673126 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7azo-assembly1.cif.gz_L5A | 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 | 0.9764 | 22 | 197 |
| 6ore-assembly1.cif.gz_E | release complex 70s | 0.9724 | 22 | 195 |
| 8a63-assembly1.cif.gz_J | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.9708 | 21 | 194 |
| 8fn2-assembly1.cif.gz_G | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9704 | 20 | 197 |
| 8cvm-assembly1.cif.gz_f | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9692 | 20 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9715 | 21 | 195 | 3.30.1440.10 |
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9554 | 21 | 195 | 3.30.1440.10 |
| af_A0A1D8PHY2_119_286_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9506 | 40 | 197 | 3.30.1440.10 |
| af_P36519_120_288_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9411 | 40 | 195 | 3.30.1440.10 |
| af_O14337_108_278_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9303 | 40 | 191 | 3.30.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E4QSC5-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9882 | 47 | 199 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A6J7QSX0-F1-model_v4 | Unannotated protein | 0.9869 | 32 | 198 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7C6D7J7-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9866 | 21 | 197 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2H6JCL0-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9863 | 21 | 197 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A5P1UZC1-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9859 | 22 | 196 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |