F489406

General Info

Members Datasets Scaffolds Average Seq Length
1066 473 2132 210

Family's Representative Sequence

Representative Sequence 3300033527|Ga0316586_1000008|Ga0316586_100000820
Length 239
Sequence MKGILGKKLGMTQVFTEDGVQIPVTVVEVTPNVVTQIKTEDKDGYNAVQVAVSDKRVKNTSKSLQGHFDKANTAPKRFVKEFRDFEGADELSVGQELPNIFEVGEIIDVQGISKGKGFQGAIKRHNQRRGPMSHGSRFHRAPGAMGNVQDRRVRKGKLLPGHMGDALTTIQNSQIVAFDAEKSLVLVKGNVPGSNNTFVTLKKSVKTPGKIQEIKVLNFNDAALVGSKNESAEEAGNEE

Samples

Sample ID Description Type Environment
1 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
25 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
129 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
136 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
145 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
227 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
236 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
237 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
244 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
266 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
267 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
277 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
278 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
279 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
280 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
281 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
282 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
283 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
284 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
300 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
307 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
308 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
309 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
310 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
311 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
319 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
320 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
321 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
326 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
327 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
328 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
375 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
376 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
412 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
413 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
414 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
415 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
416 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
417 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
418 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
419 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
420 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
421 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
422 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
423 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
426 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
427 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
428 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
429 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
430 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
431 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
432 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
433 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
434 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
435 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
436 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
437 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
438 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
439 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
440 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
441 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
442 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
451 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
452 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
453 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
454 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
455 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
456 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
457 2739367700 Dyella sp. YR388 Isolate Unclassified
458 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
459 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
460 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
461 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
462 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
463 2884411467 Dyella sp. AD56 Isolate Rhizosphere
464 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
465 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
466 2928963466 Dyella japonica 1073 Isolate Unclassified
467 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
468 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
469 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
470 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
471 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
472 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
473 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.65
Metatranscriptomes 9.19
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.66
Nodule 0.09
Rhizoplane 2.25
Rhizosphere 83.77
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316586_1000008 3300033527 Bacteria 10390
2 JGI24736J21556_1002754 3300001904 Bacteria 3079
3 JGI24736J21556_1003768 3300001904 Bacteria 2612
4 JGI24736J21556_1023445 3300001904 Bacteria 964
5 JGI24741J21665_1004451 3300001915 Bacteria 3103
6 JGI24741J21665_1004493 3300001915 Bacteria 3078
7 JGI24741J21665_1004799 3300001915 Bacteria 2933
8 JGI24741J21665_1008247 3300001915 Bacteria 1973
9 JGI24741J21665_1018685 3300001915 Bacteria 1106
10 JGI24740J21852_10003737 3300001979 Bacteria 6625
11 JGI24740J21852_10006264 3300001979 Bacteria 4944
12 JGI24740J21852_10012232 3300001979 Bacteria 3240
13 JGI25156J39149_1002085 3300002705 Bacteria 7577
14 JGI25156J39149_1003296 3300002705 Bacteria 5346
15 JGI25162J39368_1003895 3300002737 Bacteria 3875
16 JGI25162J39368_1007773 3300002737 Bacteria 1620
17 JGI25157J39369_1001153 3300002741 Bacteria 11428
18 JGI25157J39369_1001750 3300002741 Bacteria 7146
19 JGI25157J39369_1002044 3300002741 Bacteria 5780
20 JGI25151J46595_10007643 3300003187 Bacteria 5275
21 JGI25151J46595_10013580 3300003187 Bacteria 3661
22 Ga0055538_1000196 3300003751 Bacteria 36369
23 Ga0055533_1002319 3300003756 Bacteria 4392
24 Ga0055525_1000111 3300003759 Bacteria 127836
25 Ga0055527_1001334 3300003760 Bacteria 5331
26 Ga0055527_1004862 3300003760 Bacteria 1803
27 Ga0055535_1004862 3300003761 Bacteria 3121
28 Ga0055542_1003848 3300003762 Bacteria 3875
29 Ga0055542_1004903 3300003762 Bacteria 3121
30 Ga0055529_1003204 3300003763 Bacteria 2799
31 Ga0055526_1008536 3300003771 Bacteria 5088
32 Ga0055526_1008987 3300003771 Bacteria 4886
33 Ga0055537_1001096 3300003773 Bacteria 11761
34 Ga0055524_1013602 3300003775 Bacteria 3064
35 Ga0055524_1015666 3300003775 Bacteria 2753
36 Ga0055536_1024081 3300003781 Bacteria 1773
37 Ga0055534_1003331 3300003784 Bacteria 5088
38 Ga0055534_1006907 3300003784 Bacteria 2790
39 Ga0055528_1013611 3300003790 Bacteria 3070
40 Ga0055528_1016393 3300003790 Bacteria 2622
41 Ga0055530_10004966 3300003791 Bacteria 6579
42 Ga0055531_10017875 3300003794 Bacteria 2963
43 Ga0058859_11760642 3300004798 Bacteria 1466
44 Ga0058863_10021952 3300004799 Bacteria 1762
45 Ga0058863_10051910 3300004799 Bacteria 920
46 Ga0058861_10029892 3300004800 Bacteria 2654
47 Ga0058860_10137024 3300004801 Bacteria 3744
48 Ga0058862_10121056 3300004803 Bacteria 1383
49 Ga0065165_1033037 3300005262 Bacteria 1615
50 Ga0065707_10183525 3300005295 Bacteria 1394
51 Ga0070658_10062591 3300005327 Bacteria 3032
52 Ga0070658_10253456 3300005327 Bacteria 1493
53 Ga0070658_10424499 3300005327 Bacteria 1144
54 Ga0070676_10011569 3300005328 Bacteria 4799
55 Ga0070683_100091777 3300005329 Bacteria 2852
56 Ga0070683_100337298 3300005329 Bacteria 1435
57 Ga0070690_100108195 3300005330 Bacteria 1851
58 Ga0070670_100213118 3300005331 Bacteria 1679
59 Ga0070666_10062032 3300005335 Bacteria 2531
60 Ga0070666_10267214 3300005335 Bacteria 1213
61 Ga0070680_100024646 3300005336 Bacteria 4808
62 Ga0070680_100126748 3300005336 Bacteria 2133
63 Ga0070680_100131473 3300005336 Bacteria 2094
64 Ga0070680_100135391 3300005336 Bacteria 2063
65 Ga0070680_100450980 3300005336 Bacteria 1099
66 Ga0070682_100031926 3300005337 Bacteria 3189
67 Ga0070682_100040504 3300005337 Bacteria 2867
68 Ga0070682_100141710 3300005337 Bacteria 1639
69 Ga0070682_100155304 3300005337 Bacteria 1574
70 Ga0070682_100374660 3300005337 Bacteria 1068
71 Ga0070660_100123626 3300005339 Bacteria 2066
72 Ga0070660_100244093 3300005339 Bacteria 1463
73 Ga0070660_100398730 3300005339 Bacteria 1137
74 Ga0070660_100541817 3300005339 Bacteria 970
75 Ga0070689_100041431 3300005340 Bacteria 3535
76 Ga0070691_10019986 3300005341 Bacteria 3091
77 Ga0070691_10048275 3300005341 Bacteria 2025
78 Ga0070661_100015281 3300005344 Bacteria 5418
79 Ga0070661_100042481 3300005344 Bacteria 3318
80 Ga0070661_100097541 3300005344 Bacteria 2182
81 Ga0070661_100138082 3300005344 Bacteria 1835
82 Ga0070661_100169084 3300005344 Bacteria 1659
83 Ga0070661_100187257 3300005344 Bacteria 1577
84 Ga0070661_100369076 3300005344 Bacteria 1129
85 Ga0070661_100699554 3300005344 Bacteria 826
86 Ga0070661_100749257 3300005344 Bacteria 798
87 Ga0070692_10007700 3300005345 Bacteria 4763
88 Ga0070692_10056065 3300005345 Bacteria 2062
89 Ga0070692_10087946 3300005345 Bacteria 1684
90 Ga0070692_10124727 3300005345 Bacteria 1440
91 Ga0070668_100014103 3300005347 Bacteria 5973
92 Ga0070668_100348368 3300005347 Bacteria 1253
93 Ga0070669_100006246 3300005353 Bacteria 8599
94 Ga0070669_100222301 3300005353 Bacteria 1493
95 Ga0070669_100564161 3300005353 Bacteria 950
96 Ga0070675_100638971 3300005354 Bacteria 967
97 Ga0070671_100288936 3300005355 Bacteria 1395
98 Ga0070671_100322516 3300005355 Bacteria 1316
99 Ga0070674_100279417 3300005356 Bacteria 1323
100 Ga0070674_100287754 3300005356 Bacteria 1305
101 Ga0070673_100109100 3300005364 Bacteria 2292
102 Ga0070688_100171238 3300005365 Bacteria 1499
103 Ga0070659_100138001 3300005366 Bacteria 1984
104 Ga0070659_100160932 3300005366 Bacteria 1835
105 Ga0070659_100173711 3300005366 Bacteria 1766
106 Ga0070659_100191871 3300005366 Bacteria 1679
107 Ga0070659_100219319 3300005366 Bacteria 1569
108 Ga0070659_100750336 3300005366 Bacteria 846
109 Ga0070667_100074637 3300005367 Bacteria 2893
110 Ga0070667_100124452 3300005367 Bacteria 2246
111 Ga0070667_100577578 3300005367 Bacteria 1034
112 Ga0070709_10000076 3300005434 Bacteria 74077
113 Ga0070709_10034187 3300005434 Bacteria 3080
114 Ga0070709_10160955 3300005434 Bacteria 1561
115 Ga0070713_100008401 3300005436 Bacteria 7319
116 Ga0070713_100020295 3300005436 Bacteria 5092
117 Ga0070713_100037982 3300005436 Bacteria 3897
118 Ga0070713_100103997 3300005436 Bacteria 2465
119 Ga0070710_10040859 3300005437 Bacteria 2558
120 Ga0070710_10071767 3300005437 Bacteria 1998
121 Ga0070710_10268926 3300005437 Bacteria 1102
122 Ga0070711_100001449 3300005439 Bacteria 13051
123 Ga0070711_100007565 3300005439 Bacteria 6611
124 Ga0070711_100225282 3300005439 Bacteria 1459
125 Ga0070711_100397777 3300005439 Bacteria 1118
126 Ga0070705_100127227 3300005440 Bacteria 1656
127 Ga0070694_100058419 3300005444 Bacteria 2624
128 Ga0070708_100035523 3300005445 Bacteria 4342
129 Ga0070708_100311587 3300005445 Bacteria 1482
130 Ga0070708_100318751 3300005445 Bacteria 1464
131 Ga0070663_100036599 3300005455 Bacteria 3410
132 Ga0070663_100112513 3300005455 Bacteria 2047
133 Ga0070663_100155767 3300005455 Bacteria 1755
134 Ga0070663_100199061 3300005455 Bacteria 1562
135 Ga0070663_100220345 3300005455 Bacteria 1489
136 Ga0070678_100007039 3300005456 Bacteria 6648
137 Ga0070662_100045686 3300005457 Bacteria 3144
138 Ga0070662_100109776 3300005457 Bacteria 2100
139 Ga0070662_100390820 3300005457 Bacteria 1146
140 Ga0070681_10038165 3300005458 Bacteria 4817
141 Ga0070681_10072551 3300005458 Bacteria 3405
142 Ga0070681_10107230 3300005458 Bacteria 2734
143 Ga0070681_10150874 3300005458 Bacteria 2250
144 Ga0070681_10164806 3300005458 Bacteria 2139
145 Ga0068867_100135873 3300005459 Bacteria 1916
146 Ga0068867_100200101 3300005459 Bacteria 1599
147 Ga0070706_100119495 3300005467 Bacteria 2456
148 Ga0070707_100192686 3300005468 Bacteria 1987
149 Ga0070698_100361005 3300005471 Bacteria 1384
150 Ga0070698_100363463 3300005471 Bacteria 1379
151 Ga0070699_100023687 3300005518 Bacteria 5289
152 Ga0070679_100019420 3300005530 Bacteria 6608
153 Ga0070679_100040938 3300005530 Bacteria 4611
154 Ga0070679_100178793 3300005530 Bacteria 2094
155 Ga0070679_100184276 3300005530 Bacteria 2059
156 Ga0070679_100881218 3300005530 Bacteria 838
157 Ga0070684_100050987 3300005535 Bacteria 3595
158 Ga0070684_100083757 3300005535 Bacteria 2826
159 Ga0070684_100088026 3300005535 Bacteria 2758
160 Ga0070697_100006091 3300005536 Bacteria 9330
161 Ga0070697_100049282 3300005536 Bacteria 3418
162 Ga0068853_100029334 3300005539 Bacteria 4636
163 Ga0068853_100035785 3300005539 Bacteria 4219
164 Ga0068853_100146241 3300005539 Bacteria 2124
165 Ga0068853_100155319 3300005539 Bacteria 2061
166 Ga0068853_100167153 3300005539 Bacteria 1988
167 Ga0070695_100005390 3300005545 Bacteria 7529
168 Ga0070695_100077726 3300005545 Bacteria 2187
169 Ga0070696_100004505 3300005546 Bacteria 9299
170 Ga0070696_100124730 3300005546 Bacteria 1867
171 Ga0070696_100128219 3300005546 Bacteria 1843
172 Ga0070696_100141842 3300005546 Bacteria 1757
173 Ga0070696_100153761 3300005546 Bacteria 1690
174 Ga0070693_100000494 3300005547 Bacteria 17601
175 Ga0070693_100091903 3300005547 Bacteria 1831
176 Ga0070665_100000175 3300005548 Bacteria 113874
177 Ga0070665_100000700 3300005548 Bacteria 44692
178 Ga0070665_100105834 3300005548 Bacteria 2815
179 Ga0070704_100013476 3300005549 Bacteria 5075
180 Ga0068855_100231949 3300005563 Bacteria 2066
181 Ga0068855_100258994 3300005563 Bacteria 1938
182 Ga0068855_101050573 3300005563 Bacteria 854
183 Ga0070664_100100832 3300005564 Bacteria 2510
184 Ga0070664_100443888 3300005564 Bacteria 1190
185 Ga0068857_100003667 3300005577 Bacteria 12865
186 Ga0068857_100087151 3300005577 Bacteria 2792
187 Ga0068857_100175464 3300005577 Bacteria 1950
188 Ga0068854_100054151 3300005578 Bacteria 2884
189 Ga0068854_100099085 3300005578 Bacteria 2182
190 Ga0068854_100104882 3300005578 Bacteria 2124
191 Ga0068854_100161998 3300005578 Bacteria 1733
192 Ga0068854_100221682 3300005578 Bacteria 1496
193 Ga0068854_100265326 3300005578 Bacteria 1376
194 Ga0068854_100415343 3300005578 Bacteria 1116
195 Ga0068856_100004797 3300005614 Bacteria 13405
196 Ga0068856_100184419 3300005614 Bacteria 2100
197 Ga0068856_100192491 3300005614 Bacteria 2053
198 Ga0068856_100211399 3300005614 Bacteria 1955
199 Ga0068856_100354244 3300005614 Bacteria 1486
200 Ga0068856_100459289 3300005614 Bacteria 1294
201 Ga0070702_100051791 3300005615 Bacteria 2352
202 Ga0068852_100031217 3300005616 Bacteria 4393
203 Ga0068852_100134375 3300005616 Bacteria 2282
204 Ga0068852_100151291 3300005616 Bacteria 2158
205 Ga0068852_100156348 3300005616 Bacteria 2124
206 Ga0068852_100370010 3300005616 Bacteria 1404
207 Ga0068852_100991777 3300005616 Bacteria 859
208 Ga0068859_100122263 3300005617 Bacteria 2670
209 Ga0068859_100678814 3300005617 Bacteria 1121
210 Ga0068864_100168714 3300005618 Bacteria 1994
211 Ga0068864_100479567 3300005618 Bacteria 1194
212 Ga0068861_100050727 3300005719 Bacteria 3147
213 Ga0068861_100503022 3300005719 Bacteria 1096
214 Ga0068851_10014017 3300005834 Bacteria 3800
215 Ga0068851_10118794 3300005834 Bacteria 1419
216 Ga0068851_10129468 3300005834 Bacteria 1364
217 Ga0068863_100012596 3300005841 Bacteria 8156
218 Ga0068863_100100973 3300005841 Bacteria 2742
219 Ga0068858_100068753 3300005842 Bacteria 3282
220 Ga0068858_100075141 3300005842 Bacteria 3138
221 Ga0068860_100426956 3300005843 Bacteria 1314
222 Ga0068862_100164162 3300005844 Bacteria 1984
223 Ga0081540_1000720 3300005983 Bacteria 30494
224 Ga0070717_10659450 3300006028 Bacteria 950
225 Ga0070716_100092179 3300006173 Bacteria 1836
226 Ga0070716_100198374 3300006173 Bacteria 1332
227 Ga0070716_100380441 3300006173 Bacteria 1009
228 Ga0070712_100055854 3300006175 Bacteria 2767
229 Ga0070712_100057688 3300006175 Bacteria 2729
230 Ga0068871_100100892 3300006358 Bacteria 2418
231 Ga0068871_100436173 3300006358 Bacteria 1172
232 Ga0075434_100195641 3300006871 Bacteria 2042
233 Ga0075434_100278025 3300006871 Bacteria 1694
234 Ga0068865_100440219 3300006881 Bacteria 1075
235 Ga0075436_100051741 3300006914 Bacteria 2834
236 Ga0075436_100125917 3300006914 Bacteria 1795
237 Ga0097620_100122253 3300006931 Bacteria 2670
238 Ga0097620_100678845 3300006931 Bacteria 1121
239 Ga0075435_100021456 3300007076 Bacteria 4968
240 Ga0075435_100176685 3300007076 Bacteria 1803
241 Ga0099794_10033018 3300007265 Bacteria 2432
242 Ga0099794_10132618 3300007265 Bacteria 1259
243 Ga0099794_10216173 3300007265 Bacteria 984
244 Ga0099794_10222807 3300007265 Unclassified 969
245 Ga0099794_10227996 3300007265 Bacteria 958
246 Ga0099795_10030595 3300007788 Bacteria 1849
247 Ga0105240_10054178 3300009093 Bacteria 5028
248 Ga0105240_10113841 3300009093 Bacteria 3269
249 Ga0105240_10261623 3300009093 Bacteria 1996
250 Ga0105240_10270922 3300009093 Bacteria 1955
251 Ga0105240_10274138 3300009093 Bacteria 1941
252 Ga0105240_10282025 3300009093 Bacteria 1908
253 Ga0111539_10344664 3300009094 Bacteria 1734
254 Ga0105247_10014280 3300009101 Bacteria 4767
255 Ga0105242_10341696 3300009176 Bacteria 1380
256 Ga0105248_10241422 3300009177 Bacteria 2034
257 Ga0105248_10280233 3300009177 Bacteria 1877
258 Ga0105248_10886345 3300009177 Bacteria 1007
259 Ga0105237_10051347 3300009545 Bacteria 4141
260 Ga0105237_10073900 3300009545 Bacteria 3401
261 Ga0105237_10161032 3300009545 Unclassified 2242
262 Ga0105237_10167989 3300009545 Bacteria 2193
263 Ga0105237_10239616 3300009545 Bacteria 1815
264 Ga0105238_10022011 3300009551 Bacteria 6496
265 Ga0105238_10067600 3300009551 Bacteria 3574
266 Ga0105238_10145294 3300009551 Bacteria 2348
267 Ga0105238_10214402 3300009551 Bacteria 1902
268 Ga0105238_10361347 3300009551 Bacteria 1441
269 Ga0105238_10494909 3300009551 Bacteria 1223
270 Ga0099796_10027098 3300010159 Bacteria 1827
271 Ga0105239_10006660 3300010375 Bacteria 13359
272 Ga0105239_10053763 3300010375 Bacteria 4416
273 Ga0105239_10141288 3300010375 Bacteria 2683
274 Ga0105239_10244795 3300010375 Bacteria 2013
275 Ga0105239_10280538 3300010375 Bacteria 1875
276 Ga0105246_10140293 3300011119 Bacteria 1816
277 Ga0157323_1003136 3300012495 Bacteria 976
278 Ga0157373_10037570 3300013100 Bacteria 3471
279 Ga0157373_10087027 3300013100 Bacteria 2202
280 Ga0157373_10133595 3300013100 Bacteria 1744
281 Ga0157373_10244996 3300013100 Bacteria 1267
282 Ga0157371_10042032 3300013102 Bacteria 3259
283 Ga0157371_10045126 3300013102 Bacteria 3137
284 Ga0157371_10118940 3300013102 Bacteria 1878
285 Ga0157371_10146760 3300013102 Bacteria 1681
286 Ga0157371_10153337 3300013102 Bacteria 1644
287 Ga0157371_10500069 3300013102 Bacteria 898
288 Ga0157370_10069149 3300013104 Bacteria 3335
289 Ga0157370_10073111 3300013104 Bacteria 3235
290 Ga0157370_10163772 3300013104 Bacteria 2069
291 Ga0157370_10320909 3300013104 Bacteria 1429
292 Ga0157370_10450952 3300013104 Bacteria 1183
293 Ga0157369_10036937 3300013105 Bacteria 5351
294 Ga0157369_10107916 3300013105 Bacteria 2961
295 Ga0157369_10179013 3300013105 Bacteria 2231
296 Ga0157369_10185505 3300013105 Bacteria 2188
297 Ga0157369_10269476 3300013105 Bacteria 1775
298 Ga0157369_10506063 3300013105 Bacteria 1249
299 Ga0157378_10765208 3300013297 Bacteria 989
300 Ga0163162_10070045 3300013306 Bacteria 3559
301 Ga0163162_10574042 3300013306 Bacteria 1255
302 Ga0157372_10045136 3300013307 Bacteria 4887
303 Ga0157372_10082823 3300013307 Bacteria 3633
304 Ga0157372_10157288 3300013307 Bacteria 2625
305 Ga0157372_10257410 3300013307 Bacteria 2026
306 Ga0157372_10310831 3300013307 Bacteria 1834
307 Ga0157372_10411246 3300013307 Bacteria 1576
308 Ga0157372_10484226 3300013307 Bacteria 1442
309 Ga0157372_11119375 3300013307 Bacteria 911
310 Ga0157372_11559379 3300013307 Bacteria 761
311 Ga0163163_10643802 3300014325 Bacteria 1123
312 Ga0182008_10077601 3300014497 Bacteria 1634
313 Ga0182008_10185021 3300014497 Bacteria 1055
314 Ga0157379_10168013 3300014968 Bacteria 1980
315 Ga0157376_10000077 3300014969 Bacteria 74189
316 Ga0157376_10001519 3300014969 Bacteria 15329
317 Ga0157376_10219585 3300014969 Bacteria 1760
318 Ga0157376_10254964 3300014969 Bacteria 1640
319 Ga0182007_10134052 3300015262 Bacteria 835
320 Ga0183368_1002 3300015687 Bacteria 1865598
321 Ga0183360_10001 3300015689 Bacteria 3943671
322 Ga0163161_10539761 3300017792 Bacteria 954
323 Ga0184592_126085 3300019177 Bacteria 1464
324 Ga0197907_10574318 3300020069 Bacteria 1433
325 Ga0197907_10947378 3300020069 Bacteria 3159
326 Ga0197907_11264123 3300020069 Bacteria 778
327 Ga0206356_10069576 3300020070 Bacteria 3317
328 Ga0206356_10171056 3300020070 Bacteria 2333
329 Ga0206356_10966620 3300020070 Bacteria 4089
330 Ga0206356_11482326 3300020070 Bacteria 1521
331 Ga0206349_1346577 3300020075 Bacteria 1686
332 Ga0206355_1347985 3300020076 Bacteria 4206
333 Ga0206355_1657004 3300020076 Bacteria 2465
334 Ga0206351_10247550 3300020077 Bacteria 8297
335 Ga0206352_11092907 3300020078 Bacteria 7966
336 Ga0206352_11356790 3300020078 Bacteria 2706
337 Ga0206350_10601137 3300020080 Bacteria 3515
338 Ga0206354_10337548 3300020081 Bacteria 1915
339 Ga0206354_10771806 3300020081 Bacteria 1286
340 Ga0206354_10919723 3300020081 Bacteria 3008
341 Ga0206353_10129542 3300020082 Bacteria 10452
342 Ga0206353_10294942 3300020082 Bacteria 4933
343 Ga0206353_11029087 3300020082 Bacteria 1412
344 Ga0154015_1010654 3300020610 Bacteria 5497
345 Ga0154015_1416341 3300020610 Bacteria 1104
346 Ga0213876_10017049 3300021384 Bacteria 3837
347 Ga0224712_10013385 3300022467 Bacteria 2610
348 Ga0224712_10021892 3300022467 Bacteria 2195
349 Ga0224712_10027027 3300022467 Bacteria 2037
350 Ga0209435_101200 3300025206 Bacteria 3488
351 Ga0209435_106506 3300025206 Bacteria 1299
352 Ga0209784_100310 3300025224 Bacteria 25654
353 Ga0209674_100043 3300025226 Bacteria 369728
354 Ga0209674_102881 3300025226 Bacteria 3418
355 Ga0209672_100004 3300025228 Bacteria 1467504
356 Ga0209672_102109 3300025228 Bacteria 5311
357 Ga0209563_100103 3300025230 Bacteria 151835
358 Ga0207427_100209 3300025231 Bacteria 53322
359 Ga0207427_104741 3300025231 Bacteria 2153
360 Ga0209437_100020 3300025233 Bacteria 656374
361 Ga0209437_100193 3300025233 Bacteria 122027
362 Ga0209258_100003 3300025242 Bacteria 1467504
363 Ga0209258_104604 3300025242 Bacteria 2564
364 Ga0207425_1039535 3300025245 Bacteria 903
365 Ga0209026_1000060 3300025250 Bacteria 220052
366 Ga0209026_1000274 3300025250 Bacteria 61312
367 Ga0209026_1001271 3300025250 Bacteria 11502
368 Ga0209026_1006743 3300025250 Bacteria 2739
369 Ga0209148_1000002 3300025254 Bacteria 2399500
370 Ga0209148_1000025 3300025254 Bacteria 663262
371 Ga0209759_1001919 3300025256 Bacteria 10178
372 Ga0209759_1010126 3300025256 Bacteria 2786
373 Ga0209759_1016259 3300025256 Bacteria 1887
374 Ga0209233_1000020 3300025261 Bacteria 798224
375 Ga0209233_1000920 3300025261 Bacteria 12852
376 Ga0209233_1033207 3300025261 Bacteria 1186
377 Ga0209565_1000001 3300025263 Bacteria 2950419
378 Ga0209565_1037789 3300025263 Bacteria 912
379 Ga0209455_1000004 3300025272 Bacteria 1467504
380 Ga0209455_1000095 3300025272 Bacteria 217487
381 Ga0209673_1000001 3300025273 Bacteria 3176258
382 Ga0209673_1002116 3300025273 Bacteria 14881
383 Ga0209675_1000001 3300025291 Bacteria 2950293
384 Ga0209675_1006904 3300025291 Bacteria 4460
385 Ga0209676_1001608 3300025292 Bacteria 20029
386 Ga0209676_1004892 3300025292 Bacteria 7229
387 Ga0209025_1044140 3300025294 Bacteria 1868
388 Ga0209025_1122127 3300025294 Bacteria 775
389 Ga0209564_1000001 3300025295 Bacteria 3176258
390 Ga0209564_1007141 3300025295 Bacteria 5828
391 Ga0209050_1001128 3300025298 Bacteria 32216
392 Ga0209256_1000002 3300025299 Bacteria 1906740
393 Ga0209256_1003821 3300025299 Bacteria 10090
394 Ga0209051_1037982 3300025303 Bacteria 1758
395 Ga0209257_1006382 3300025304 Bacteria 7632
396 Ga0207697_10042053 3300025315 Bacteria 1877
397 Ga0207656_10098242 3300025321 Bacteria 1339
398 Ga0207656_10105805 3300025321 Bacteria 1295
399 Ga0207692_10016367 3300025898 Bacteria 3283
400 Ga0207692_10056387 3300025898 Bacteria 2015
401 Ga0207692_10230442 3300025898 Bacteria 1102
402 Ga0207710_10034664 3300025900 Bacteria 2219
403 Ga0207647_10011795 3300025904 Bacteria 6108
404 Ga0207647_10012806 3300025904 Bacteria 5826
405 Ga0207647_10013393 3300025904 Bacteria 5686
406 Ga0207647_10041903 3300025904 Bacteria 2875
407 Ga0207647_10047348 3300025904 Bacteria 2675
408 Ga0207647_10071130 3300025904 Bacteria 2099
409 Ga0207647_10094179 3300025904 Bacteria 1784
410 Ga0207685_10031330 3300025905 Bacteria 1903
411 Ga0207699_10018682 3300025906 Bacteria 3679
412 Ga0207699_10170900 3300025906 Bacteria 1454
413 Ga0207699_10191605 3300025906 Bacteria 1380
414 Ga0207699_10208563 3300025906 Bacteria 1328
415 Ga0207699_10228437 3300025906 Bacteria 1274
416 Ga0207645_10006593 3300025907 Bacteria 8303
417 Ga0207705_10004273 3300025909 Bacteria 10819
418 Ga0207705_10008046 3300025909 Bacteria 7728
419 Ga0207705_10031780 3300025909 Bacteria 3770
420 Ga0207705_10034450 3300025909 Bacteria 3620
421 Ga0207705_10118746 3300025909 Bacteria 1960
422 Ga0207705_10173090 3300025909 Bacteria 1626
423 Ga0207705_10189107 3300025909 Bacteria 1556
424 Ga0207684_10230671 3300025910 Bacteria 1597
425 Ga0207684_10244280 3300025910 Bacteria 1549
426 Ga0207684_10251617 3300025910 Bacteria 1524
427 Ga0207684_10332351 3300025910 Bacteria 1309
428 Ga0207684_10383432 3300025910 Bacteria 1209
429 Ga0207654_10061667 3300025911 Bacteria 2195
430 Ga0207654_10144552 3300025911 Bacteria 1521
431 Ga0207707_10000210 3300025912 Bacteria 62292
432 Ga0207707_10001339 3300025912 Bacteria 22957
433 Ga0207707_10018111 3300025912 Bacteria 6137
434 Ga0207707_10025201 3300025912 Bacteria 5202
435 Ga0207707_10051492 3300025912 Bacteria 3585
436 Ga0207707_10052498 3300025912 Bacteria 3549
437 Ga0207707_10152834 3300025912 Bacteria 2018
438 Ga0207707_10237996 3300025912 Bacteria 1583
439 Ga0207695_10000818 3300025913 Bacteria 57675
440 Ga0207695_10006299 3300025913 Bacteria 15447
441 Ga0207695_10008130 3300025913 Bacteria 13192
442 Ga0207695_10068969 3300025913 Bacteria 3621
443 Ga0207695_10073537 3300025913 Bacteria 3483
444 Ga0207695_10148552 3300025913 Bacteria 2285
445 Ga0207695_10217754 3300025913 Bacteria 1818
446 Ga0207695_10312640 3300025913 Bacteria 1461
447 Ga0207671_10028839 3300025914 Bacteria 4146
448 Ga0207671_10054495 3300025914 Bacteria 2963
449 Ga0207671_10085943 3300025914 Bacteria 2364
450 Ga0207671_10269984 3300025914 Bacteria 1340
451 Ga0207693_10038470 3300025915 Bacteria 3768
452 Ga0207693_10096232 3300025915 Bacteria 2321
453 Ga0207693_10134099 3300025915 Bacteria 1947
454 Ga0207693_10277593 3300025915 Bacteria 1313
455 Ga0207693_10280409 3300025915 Bacteria 1306
456 Ga0207663_10004162 3300025916 Bacteria 7164
457 Ga0207663_10017954 3300025916 Bacteria 3951
458 Ga0207663_10275735 3300025916 Bacteria 1247
459 Ga0207660_10014060 3300025917 Bacteria 5253
460 Ga0207660_10034597 3300025917 Bacteria 3503
461 Ga0207660_10036194 3300025917 Bacteria 3431
462 Ga0207660_10105351 3300025917 Bacteria 2113
463 Ga0207660_10119378 3300025917 Bacteria 1995
464 Ga0207660_10368253 3300025917 Bacteria 1154
465 Ga0207657_10055348 3300025919 Bacteria 3427
466 Ga0207657_10070713 3300025919 Bacteria 2956
467 Ga0207657_10122412 3300025919 Bacteria 2140
468 Ga0207657_10124909 3300025919 Bacteria 2114
469 Ga0207657_10128163 3300025919 Bacteria 2082
470 Ga0207657_10200956 3300025919 Bacteria 1603
471 Ga0207649_10002213 3300025920 Bacteria 10987
472 Ga0207649_10014504 3300025920 Bacteria 4414
473 Ga0207649_10015259 3300025920 Bacteria 4316
474 Ga0207649_10024587 3300025920 Bacteria 3503
475 Ga0207649_10047910 3300025920 Bacteria 2633
476 Ga0207649_10065071 3300025920 Bacteria 2307
477 Ga0207652_10033428 3300025921 Bacteria 4330
478 Ga0207652_10048121 3300025921 Bacteria 3644
479 Ga0207652_10053020 3300025921 Bacteria 3483
480 Ga0207652_10147343 3300025921 Bacteria 2107
481 Ga0207652_10156736 3300025921 Bacteria 2040
482 Ga0207652_10669003 3300025921 Bacteria 928
483 Ga0207646_10000754 3300025922 Bacteria 42028
484 Ga0207646_10303931 3300025922 Bacteria 1441
485 Ga0207646_10356904 3300025922 Bacteria 1321
486 Ga0207646_10730209 3300025922 Bacteria 885
487 Ga0207681_10105252 3300025923 Bacteria 2042
488 Ga0207694_10028197 3300025924 Bacteria 4280
489 Ga0207694_10088183 3300025924 Bacteria 2445
490 Ga0207694_10119803 3300025924 Bacteria 2100
491 Ga0207694_10160368 3300025924 Bacteria 1816
492 Ga0207694_10714487 3300025924 Bacteria 845
493 Ga0207650_10286074 3300025925 Bacteria 1343
494 Ga0207687_10234006 3300025927 Bacteria 1452
495 Ga0207687_10481145 3300025927 Bacteria 1034
496 Ga0207700_10116306 3300025928 Bacteria 2161
497 Ga0207700_10180340 3300025928 Bacteria 1768
498 Ga0207700_10285416 3300025928 Bacteria 1421
499 Ga0207700_10737458 3300025928 Bacteria 880
500 Ga0207664_10001884 3300025929 Bacteria 13792
501 Ga0207644_10089389 3300025931 Bacteria 2292
502 Ga0207644_10090873 3300025931 Bacteria 2275
503 Ga0207690_10000291 3300025932 Bacteria 35587
504 Ga0207690_10003289 3300025932 Bacteria 9676
505 Ga0207690_10034320 3300025932 Bacteria 3268
506 Ga0207690_10222034 3300025932 Bacteria 1446
507 Ga0207690_10227720 3300025932 Bacteria 1429
508 Ga0207690_10670980 3300025932 Bacteria 851
509 Ga0207690_10809951 3300025932 Bacteria 774
510 Ga0207706_10015708 3300025933 Bacteria 6844
511 Ga0207706_10100114 3300025933 Bacteria 2550
512 Ga0207706_10107956 3300025933 Bacteria 2449
513 Ga0207706_10319011 3300025933 Bacteria 1352
514 Ga0207686_10023003 3300025934 Bacteria 3595
515 Ga0207686_10333629 3300025934 Bacteria 1137
516 Ga0207704_10216261 3300025938 Bacteria 1414
517 Ga0207665_10000959 3300025939 Bacteria 19542
518 Ga0207665_10006155 3300025939 Bacteria 7969
519 Ga0207665_10006268 3300025939 Bacteria 7894
520 Ga0207665_10010543 3300025939 Bacteria 6070
521 Ga0207665_10035786 3300025939 Bacteria 3297
522 Ga0207665_10052220 3300025939 Bacteria 2754
523 Ga0207665_10101234 3300025939 Bacteria 2011
524 Ga0207665_10215796 3300025939 Bacteria 1404
525 Ga0207665_10409253 3300025939 Bacteria 1034
526 Ga0207689_10020406 3300025942 Bacteria 5577
527 Ga0207689_10136777 3300025942 Bacteria 2018
528 Ga0207661_10004252 3300025944 Bacteria 10024
529 Ga0207661_10058973 3300025944 Bacteria 3091
530 Ga0207661_10273592 3300025944 Bacteria 1507
531 Ga0207661_10648918 3300025944 Bacteria 970
532 Ga0207679_10025524 3300025945 Bacteria 4065
533 Ga0207679_10425174 3300025945 Bacteria 1173
534 Ga0207667_10008758 3300025949 Bacteria 11990
535 Ga0207667_10009904 3300025949 Bacteria 11181
536 Ga0207667_10010803 3300025949 Bacteria 10649
537 Ga0207667_10053962 3300025949 Bacteria 4228
538 Ga0207667_10072769 3300025949 Bacteria 3572
539 Ga0207667_10095216 3300025949 Bacteria 3074
540 Ga0207667_10119954 3300025949 Bacteria 2710
541 Ga0207667_10193768 3300025949 Bacteria 2085
542 Ga0207667_10259410 3300025949 Bacteria 1777
543 Ga0207651_10066649 3300025960 Bacteria 2531
544 Ga0207668_10075782 3300025972 Bacteria 2419
545 Ga0207668_10187878 3300025972 Bacteria 1635
546 Ga0207668_10423728 3300025972 Bacteria 1130
547 Ga0207640_10002025 3300025981 Bacteria 10946
548 Ga0207640_10003058 3300025981 Bacteria 9010
549 Ga0207640_10025408 3300025981 Bacteria 3585
550 Ga0207640_10026008 3300025981 Bacteria 3549
551 Ga0207640_10059031 3300025981 Bacteria 2530
552 Ga0207640_10513033 3300025981 Bacteria 1000
553 Ga0207640_10559495 3300025981 Bacteria 962
554 Ga0207658_10028034 3300025986 Bacteria 3963
555 Ga0207658_10106388 3300025986 Bacteria 2208
556 Ga0207677_10157745 3300026023 Bacteria 1759
557 Ga0207677_10345942 3300026023 Bacteria 1244
558 Ga0207703_10163415 3300026035 Bacteria 1952
559 Ga0207703_10205239 3300026035 Bacteria 1753
560 Ga0207639_10000231 3300026041 Bacteria 41634
561 Ga0207639_10016511 3300026041 Bacteria 5226
562 Ga0207639_10029641 3300026041 Bacteria 4008
563 Ga0207639_10047428 3300026041 Bacteria 3247
564 Ga0207639_10125486 3300026041 Bacteria 2116
565 Ga0207639_10452119 3300026041 Bacteria 1166
566 Ga0207678_10016758 3300026067 Bacteria 6435
567 Ga0207678_10049236 3300026067 Bacteria 3642
568 Ga0207678_10055028 3300026067 Bacteria 3427
569 Ga0207678_10130950 3300026067 Bacteria 2140
570 Ga0207678_10137839 3300026067 Bacteria 2082
571 Ga0207678_10220963 3300026067 Bacteria 1621
572 Ga0207678_10271783 3300026067 Bacteria 1453
573 Ga0207678_10729632 3300026067 Bacteria 873
574 Ga0207678_10924653 3300026067 Bacteria 771
575 Ga0207708_10509884 3300026075 Bacteria 1009
576 Ga0207702_10000852 3300026078 Bacteria 31897
577 Ga0207702_10011901 3300026078 Bacteria 7239
578 Ga0207702_10012283 3300026078 Bacteria 7129
579 Ga0207702_10074823 3300026078 Bacteria 2924
580 Ga0207702_10091382 3300026078 Bacteria 2665
581 Ga0207702_10161689 3300026078 Bacteria 2045
582 Ga0207702_10375412 3300026078 Bacteria 1366
583 Ga0207702_10744510 3300026078 Bacteria 967
584 Ga0207641_10183031 3300026088 Bacteria 1920
585 Ga0207641_10546239 3300026088 Bacteria 1129
586 Ga0207648_10168415 3300026089 Bacteria 1936
587 Ga0207648_10310721 3300026089 Bacteria 1415
588 Ga0207676_10162686 3300026095 Bacteria 1935
589 Ga0207676_10285849 3300026095 Bacteria 1499
590 Ga0207674_10001554 3300026116 Bacteria 29587
591 Ga0207674_10017287 3300026116 Bacteria 7869
592 Ga0207674_10059241 3300026116 Bacteria 3875
593 Ga0207674_10111246 3300026116 Bacteria 2713
594 Ga0207674_10142271 3300026116 Bacteria 2358
595 Ga0207675_100106837 3300026118 Bacteria 2639
596 Ga0207675_100774282 3300026118 Bacteria 972
597 Ga0207675_101176735 3300026118 Bacteria 787
598 Ga0207683_10023634 3300026121 Bacteria 5287
599 Ga0207698_10004871 3300026142 Bacteria 8228
600 Ga0207698_10007267 3300026142 Bacteria 6940
601 Ga0207698_10038635 3300026142 Bacteria 3528
602 Ga0207698_10052641 3300026142 Bacteria 3120
603 Ga0207698_10301744 3300026142 Bacteria 1491
604 Ga0207698_10705601 3300026142 Bacteria 1004
605 Ga0209588_1051560 3300027671 Bacteria 1331
606 Ga0209588_1081586 3300027671 Bacteria 1044
607 Ga0268266_10000001 3300028379 Bacteria 4040580
608 Ga0268266_10000259 3300028379 Bacteria 88660
609 Ga0268266_10100303 3300028379 Bacteria 2550
610 Ga0268265_10115242 3300028380 Bacteria 2202
611 Ga0268264_10023204 3300028381 Bacteria 5063
612 Ga0268264_10121193 3300028381 Bacteria 2305
613 Ga0268264_10515755 3300028381 Bacteria 1168
614 Ga0307517_10241588 3300028786 Bacteria 1071
615 Ga0265766_1002482 3300030863 Bacteria 1024
616 Ga0265770_1020074 3300030878 Bacteria 1053
617 Ga0265764_100381 3300030882 Bacteria 1637
618 Ga0265774_100076 3300031011 Bacteria 2339
619 Ga0265760_10004278 3300031090 Bacteria 4102
620 Ga0265760_10074156 3300031090 Bacteria 1047
621 Ga0265760_10114369 3300031090 Unclassified 862
622 Ga0265325_10048727 3300031241 Bacteria 2188
623 Ga0265339_10265934 3300031249 Bacteria 826
624 Ga0307408_100110780 3300031548 Bacteria 2108
625 Ga0316575_10141054 3300031665 Bacteria 992
626 Ga0316576_10006052 3300031727 Bacteria 7481
627 Ga0316576_10187240 3300031727 Bacteria 1561
628 Ga0316578_10032616 3300031728 Bacteria 2978
629 Ga0307413_10146858 3300031824 Bacteria 1638
630 Ga0307413_10837432 3300031824 Bacteria 776
631 Ga0307406_10093487 3300031901 Bacteria 2030
632 Ga0307406_10105057 3300031901 Bacteria 1932
633 Ga0307412_10028293 3300031911 Bacteria 3505
634 Ga0307409_100474526 3300031995 Bacteria 1212
635 Ga0307416_100079046 3300032002 Bacteria 2770
636 Ga0307507_10270077 3300033179 Bacteria 1075
637 Ga0316588_1000021 3300033528 Bacteria 11292
638 Ga0316596_1000103 3300033541 Bacteria 10744
639 Ga0373959_0043986 3300034820 Bacteria 946
640 Ga0373926_0002726 3300035083 Bacteria 5632
641 Ga0373934_0001004 3300035086 Bacteria 10198
642 Ga0373934_0114056 3300035086 Bacteria 1097
643 Ga0373923_0001256 3300035111 Bacteria 7130
644 Ga0373945_0098404 3300035116 Bacteria 1142
645 Ga0373945_0240426 3300035116 Bacteria 762
646 Ga0373953_0066494 3300035117 Bacteria 1481
647 Ga0373954_0005540 3300035118 Bacteria 5466
648 Ga0373954_0015764 3300035118 Bacteria 3380
649 Ga0373954_0042676 3300035118 Bacteria 2115
650 Ga0373956_0019487 3300035119 Bacteria 2877
651 Ga0373957_0000289 3300035120 Bacteria 12644
652 Ga0373957_0034419 3300035120 Bacteria 1876
653 Ga0373943_0117096 3300035170 Bacteria 1412
654 Ga0373946_0023454 3300035171 Bacteria 2411
655 Ga0373955_0161703 3300035172 Bacteria 1322
656 Ga0316574_0051750 3300035398 Bacteria 2560
657 Ga0373931_0021266 3300035691 Bacteria 3254
658 Ga0373935_0010652 3300035692 Bacteria 5520
659 Ga0373927_0000934 3300035695 Bacteria 22198
660 Ga0373927_0004438 3300035695 Bacteria 9831
661 Ga0373933_0000551 3300035724 Bacteria 23376
662 Ga0373933_0002799 3300035724 Bacteria 9741
663 Ga0373933_0188487 3300035724 Bacteria 1317
664 Ga0373947_0000905 3300035725 Bacteria 17957
665 Ga0373947_0008831 3300035725 Bacteria 5795
666 Ga0373937_0000238 3300036401 Bacteria 53880
667 Ga0373937_0005026 3300036401 Bacteria 11254
668 Ga0373937_0016547 3300036401 Bacteria 6549
669 Ga0373937_0049055 3300036401 Bacteria 3866
670 Ga0373937_0377618 3300036401 Bacteria 1344
671 Ga0310112_000276 3300036458 Bacteria 4093
672 Ga0310109_011090 3300036534 Bacteria 1215
673 Ga0310110_004759 3300036535 Bacteria 1922
674 Ga0373925_0001788 3300037068 Bacteria 17923
675 Ga0373925_0009068 3300037068 Bacteria 7241
676 Ga0395899_0001959 3300037312 Bacteria 16927
677 Ga0395899_0042216 3300037312 Bacteria 3405
678 Ga0395899_0432225 3300037312 Bacteria 865
679 Ga0395900_0125348 3300037418 Bacteria 2634
680 Ga0395900_0135347 3300037418 Bacteria 2524
681 Ga0395900_0172278 3300037418 Bacteria 2202
682 Ga0395898_0000558 3300037466 Bacteria 69802
683 Ga0395898_0135016 3300037466 Bacteria 2362
684 Ga0395898_0138563 3300037466 Bacteria 2329
685 Ga0395901_0002939 3300038443 Bacteria 17197
686 Ga0395901_0218962 3300038443 Bacteria 1990
687 Ga0400483_047654 3300039062 Bacteria 9246
688 Ga0400483_168849 3300039062 Bacteria 24271
689 Ga0436365_1034683 3300039437 Bacteria 2594
690 Ga0436361_1002022 3300039447 Bacteria 749
691 Ga0451787_149821 3300041441 Bacteria 2666
692 Ga0451794_28977 3300041446 Bacteria 1588
693 Ga0451793_0393032 3300041452 Bacteria 3643
694 Ga0451805_117344 3300041461 Bacteria 748
695 Ga0451837_0589056 3300041494 Bacteria 1792
696 Ga0451853_1157729 3300041512 Bacteria 894
697 Ga0439437_001431 3300042000 Bacteria 2515
698 Ga0439455_0060019 3300042012 Bacteria 1007
699 Ga0439459_0002369 3300042438 Bacteria 2898
700 Ga0451577_0127243 3300042876 Bacteria 2283
701 Ga0466969_0001060 3300044656 Bacteria 14842
702 Ga0466969_0008941 3300044656 Bacteria 5311
703 Ga0466972_0000416 3300044658 Bacteria 22317
704 Ga0466965_0049044 3300044683 Bacteria 2093
705 Ga0466966_0002549 3300044684 Bacteria 11933
706 Ga0466961_0025162 3300044693 Bacteria 3830
707 Ga0466961_0085616 3300044693 Bacteria 1992
708 Ga0466971_0033841 3300044719 Bacteria 2290
709 Ga0466968_0016253 3300044735 Bacteria 2961
710 Ga0466968_0222672 3300044735 Bacteria 889
711 Ga0466970_0000139 3300044765 Bacteria 33601
712 Ga0466970_0088960 3300044765 Bacteria 1674
713 Ga0466959_0003175 3300045049 Bacteria 10666
714 Ga0466959_0072597 3300045049 Bacteria 2490
715 Ga0466958_0045436 3300045836 Bacteria 2649
716 Ga0466967_0729083 3300045976 Bacteria 982
717 Ga0466967_0743177 3300045976 Bacteria 973
718 Ga0495592_0116471 3300046454 Bacteria 1885
719 Ga0495592_0129288 3300046454 Bacteria 1768
720 Ga0495603_0065572 3300046455 Bacteria 2140
721 Ga0495629_0065391 3300046459 Bacteria 2538
722 Ga0495638_0000007 3300046460 Bacteria 602783
723 Ga0495651_0003059 3300046462 Bacteria 12909
724 Ga0495651_0012754 3300046462 Bacteria 6488
725 Ga0495651_0144083 3300046462 Bacteria 1724
726 Ga0495651_0369488 3300046462 Bacteria 943
727 Ga0495653_0004713 3300046463 Bacteria 11039
728 Ga0495653_0005252 3300046463 Bacteria 10534
729 Ga0495653_0188001 3300046463 Bacteria 1411
730 Ga0495653_0430957 3300046463 Unclassified 833
731 Ga0495653_0668187 3300046463 Bacteria 633
732 Ga0495650_0000202 3300046471 Bacteria 129910
733 Ga0495580_0002827 3300046472 Bacteria 14922
734 Ga0495580_0016376 3300046472 Bacteria 5564
735 Ga0495580_0071634 3300046472 Bacteria 2421
736 Ga0495580_0132657 3300046472 Bacteria 1727
737 Ga0495582_0004462 3300046473 Bacteria 7870
738 Ga0495582_0130173 3300046473 Unclassified 1421
739 Ga0495662_0014892 3300046476 Bacteria 3779
740 Ga0495664_0000007 3300046477 Bacteria 386710
741 Ga0495664_0158325 3300046477 Bacteria 1374
742 Ga0495594_0077145 3300046499 Bacteria 1858
743 Ga0495606_0001329 3300046507 Bacteria 33751
744 Ga0495608_0004716 3300046511 Bacteria 9758
745 Ga0495608_0014220 3300046511 Bacteria 5523
746 Ga0495608_0024720 3300046511 Bacteria 4105
747 Ga0495608_0083762 3300046511 Bacteria 2070
748 Ga0495618_0000035 3300046514 Bacteria 102739
749 Ga0495618_0102156 3300046514 Bacteria 1835
750 Ga0495628_0011006 3300046516 Bacteria 7660
751 Ga0495628_0017722 3300046516 Bacteria 5917
752 Ga0495630_0000610 3300046517 Bacteria 25880
753 Ga0495630_0015980 3300046517 Bacteria 5484
754 Ga0495630_0088337 3300046517 Bacteria 2341
755 Ga0495630_0145341 3300046517 Bacteria 1803
756 Ga0495630_0221500 3300046517 Unclassified 1444
757 Ga0495666_0029996 3300046526 Bacteria 2672
758 Ga0495666_0107669 3300046526 Bacteria 1310
759 Ga0495652_0023062 3300046529 Bacteria 5519
760 Ga0495652_0026177 3300046529 Bacteria 5155
761 Ga0495665_0017344 3300046531 Bacteria 3873
762 Ga0495665_0159246 3300046531 Bacteria 1177
763 Ga0495640_0031243 3300046533 Bacteria 3802
764 Ga0495586_0001676 3300046535 Bacteria 12153
765 Ga0495587_0000383 3300046536 Bacteria 31535
766 Ga0495587_0023543 3300046536 Bacteria 3784
767 Ga0495587_0024675 3300046536 Bacteria 3682
768 Ga0495645_0000033 3300046543 Bacteria 105930
769 Ga0495645_0076839 3300046543 Bacteria 2401
770 Ga0495622_0040458 3300046557 Bacteria 2169
771 Ga0495667_0071691 3300046559 Bacteria 2259
772 Ga0495625_0016676 3300046660 Bacteria 5771
773 Ga0495635_0011568 3300046663 Bacteria 6186
774 Ga0495657_0000027 3300046675 Bacteria 131421
775 Ga0495657_0049456 3300046675 Bacteria 2831
776 Ga0495657_0058966 3300046675 Bacteria 2547
777 Ga0495657_0201940 3300046675 Unclassified 1211
778 Ga0495599_0044494 3300046678 Bacteria 2784
779 Ga0495623_0001135 3300046679 Bacteria 18014
780 Ga0495646_0013837 3300046680 Bacteria 5129
781 Ga0495646_0118500 3300046680 Bacteria 1500
782 Ga0495646_0249493 3300046680 Bacteria 951
783 Ga0495613_0062134 3300046689 Bacteria 2734
784 Ga0495613_0214634 3300046689 Unclassified 1352
785 Ga0495624_0026801 3300046690 Bacteria 3776
786 Ga0495624_0038887 3300046690 Bacteria 3053
787 Ga0495670_0056198 3300046691 Bacteria 1974
788 Ga0495649_0000383 3300046694 Bacteria 38398
789 Ga0495600_0041791 3300046809 Bacteria 2988
790 Ga0495600_0200930 3300046809 Bacteria 1280
791 Ga0495581_0011173 3300047315 Bacteria 5190
792 Ga0495604_0000785 3300047317 Bacteria 26749
793 Ga0495604_0017471 3300047317 Bacteria 5742
794 Ga0495604_0209128 3300047317 Bacteria 1349
795 Ga0495604_0541963 3300047317 Bacteria 751
796 Ga0495674_0022169 3300047319 Bacteria 5859
797 Ga0495674_0184395 3300047319 Bacteria 1736
798 Ga0495674_0245455 3300047319 Bacteria 1474
799 Ga0495680_0081547 3300047322 Bacteria 2442
800 Ga0495680_0223650 3300047322 Unclassified 1342
801 Ga0495675_0002324 3300047444 Bacteria 11363
802 Ga0495684_0006019 3300047471 Bacteria 9428
803 Ga0495684_0010523 3300047471 Bacteria 7154
804 Ga0495684_0093585 3300047471 Bacteria 2276
805 Ga0495684_0208428 3300047471 Bacteria 1438
806 Ga0495593_0000774 3300047673 Bacteria 18607
807 Ga0495593_0083344 3300047673 Bacteria 1652
808 Ga0495602_0000595 3300048088 Bacteria 33887
809 Ga0495602_0019524 3300048088 Bacteria 6723
810 Ga0495602_0111755 3300048088 Bacteria 2218
811 Ga0495614_0038783 3300048089 Bacteria 2044
812 Ga0495614_0081326 3300048089 Unclassified 1403
813 Ga0496100_0473313 3300048903 Bacteria 963
814 Ga0496101_0243688 3300048904 Bacteria 1399
815 Ga0496102_0000002 3300048905 Bacteria 814588
816 Ga0496103_0000017 3300048906 Bacteria 244768
817 Ga0496104_0159892 3300048907 Bacteria 2161
818 Ga0496105_0041905 3300048908 Bacteria 3773
819 Ga0496107_0074215 3300048910 Bacteria 2475
820 Ga0496108_0647932 3300048911 Bacteria 918
821 Ga0496109_0004801 3300048912 Bacteria 11284
822 Ga0496110_0517704 3300048913 Bacteria 1085
823 Ga0496113_0237825 3300048916 Bacteria 1453
824 Ga0496114_0001141 3300048917 Bacteria 20073
825 Ga0496114_0055393 3300048917 Bacteria 3307
826 Ga0496114_0146312 3300048917 Bacteria 2048
827 Ga0496115_0002269 3300048918 Bacteria 13760
828 Ga0496115_0002867 3300048918 Bacteria 12421
829 Ga0496115_0082599 3300048918 Bacteria 2618
830 Ga0496115_0137021 3300048918 Bacteria 2018
831 Ga0496115_0145132 3300048918 Bacteria 1958
832 Ga0496115_0316099 3300048918 Bacteria 1278
833 Ga0496116_0021441 3300048919 Bacteria 4874
834 Ga0496116_0076103 3300048919 Bacteria 2103
835 Ga0496117_0000124 3300048920 Bacteria 169701
836 Ga0496117_0032904 3300048920 Bacteria 3931
837 Ga0496117_0063248 3300048920 Bacteria 2530
838 Ga0496118_0001647 3300048921 Bacteria 32855
839 Ga0496118_0012321 3300048921 Bacteria 8227
840 Ga0496118_0092393 3300048921 Bacteria 2077
841 Ga0496119_0000020 3300048922 Bacteria 285602
842 Ga0496119_0016519 3300048922 Bacteria 5611
843 Ga0496119_0089994 3300048922 Bacteria 1747
844 Ga0496120_0000006 3300048923 Bacteria 445068
845 Ga0496120_0002172 3300048923 Bacteria 20837
846 Ga0496120_0035080 3300048923 Bacteria 2999
847 Ga0496121_0002121 3300048924 Bacteria 31165
848 Ga0496121_0005001 3300048924 Bacteria 17352
849 Ga0496121_0016314 3300048924 Bacteria 7676
850 Ga0496121_0060216 3300048924 Bacteria 3124
851 Ga0496122_0000040 3300048925 Bacteria 285095
852 Ga0496122_0000140 3300048925 Bacteria 169037
853 Ga0496122_0000802 3300048925 Bacteria 60277
854 Ga0496122_0007916 3300048925 Bacteria 11642
855 Ga0496122_0043480 3300048925 Bacteria 3519
856 Ga0496122_0124335 3300048925 Bacteria 1655
857 Ga0496123_0000572 3300048926 Bacteria 62779
858 Ga0496123_0004284 3300048926 Bacteria 15176
859 Ga0496123_0022627 3300048926 Bacteria 4838
860 Ga0496124_0010706 3300048927 Bacteria 9252
861 Ga0496124_0101554 3300048927 Bacteria 2330
862 Ga0496125_0000010 3300048928 Bacteria 671167
863 Ga0496126_0000060 3300048929 Bacteria 264944
864 Ga0496126_0002082 3300048929 Bacteria 28029
865 Ga0496126_0028743 3300048929 Bacteria 5292
866 Ga0496126_0119779 3300048929 Bacteria 2284
867 Ga0496126_0225492 3300048929 Bacteria 1572
868 Ga0501306_009115 3300049127 Bacteria 1225
869 Ga0501308_013235 3300049128 Bacteria 951
870 Ga0501309_016200 3300049129 Bacteria 1014
871 Ga0501341_05108 3300049131 Bacteria 780
872 Ga0501343_003268 3300049132 Bacteria 1186
873 Ga0501305_000306 3300049161 Bacteria 3821
874 Ga0501305_007127 3300049161 Bacteria 1409
875 Ga0501305_013396 3300049161 Bacteria 1134
876 Ga0501307_004411 3300049162 Bacteria 1434
877 Ga0501307_008447 3300049162 Bacteria 1157
878 Ga0501307_015629 3300049162 Bacteria 939
879 Ga0501307_030725 3300049162 Bacteria 743
880 Ga0495678_016742 3300049459 Bacteria 3341
881 Ga0495682_0095818 3300049460 Bacteria 1065
882 Ga0501311_000061 3300049527 Bacteria 4751
883 Ga0501311_000124 3300049527 Bacteria 3927
884 Ga0501312_000051 3300049528 Bacteria 7173
885 Ga0501312_000171 3300049528 Bacteria 4337
886 Ga0501313_000884 3300049529 Bacteria 2334
887 Ga0501314_001682 3300049530 Bacteria 1634
888 Ga0501315_000777 3300049531 Bacteria 2403
889 Ga0501315_032343 3300049531 Bacteria 759
890 Ga0501316_032252 3300049532 Bacteria 705
891 Ga0501317_000397 3300049533 Bacteria 2969
892 Ga0501318_017451 3300049534 Bacteria 877
893 Ga0501319_003952 3300049535 Bacteria 1014
894 Ga0501320_000012 3300049536 Bacteria 8841
895 Ga0501320_001616 3300049536 Bacteria 1689
896 Ga0501321_004655 3300049537 Bacteria 1321
897 Ga0501321_005495 3300049537 Bacteria 1256
898 Ga0501321_006267 3300049537 Bacteria 1204
899 Ga0501323_000549 3300049539 Bacteria 2838
900 Ga0501323_000727 3300049539 Bacteria 2601
901 Ga0501324_016790 3300049540 Bacteria 721
902 Ga0501326_00100 3300049542 Bacteria 2712
903 Ga0501327_01403 3300049543 Bacteria 1150
904 Ga0501328_00508 3300049544 Bacteria 1328
905 Ga0501331_05830 3300049547 Bacteria 711
906 Ga0501332_03127 3300049548 Bacteria 948
907 Ga0501332_03708 3300049548 Bacteria 891
908 Ga0501334_01717 3300049550 Bacteria 1243
909 Ga0501335_004678 3300049551 Bacteria 1204
910 Ga0501335_009713 3300049551 Bacteria 920
911 Ga0501336_001466 3300049552 Bacteria 1408
912 Ga0501338_01561 3300049554 Bacteria 1241
913 Ga0501031_0011709 3300049568 Bacteria 5721
914 Ga0501031_0249142 3300049568 Bacteria 1154
915 Ga0501031_0388182 3300049568 Bacteria 903
916 Ga0501032_0002355 3300049569 Bacteria 14808
917 Ga0501032_0020602 3300049569 Bacteria 4590
918 Ga0501032_0025237 3300049569 Bacteria 4098
919 Ga0501032_0253464 3300049569 Bacteria 1142
920 Ga0501032_0294043 3300049569 Bacteria 1050
921 Ga0501033_0003263 3300049570 Bacteria 13428
922 Ga0501033_0012162 3300049570 Bacteria 6569
923 Ga0501034_0005654 3300049571 Bacteria 13601
924 Ga0501034_0025504 3300049571 Bacteria 6019
925 Ga0501034_0056333 3300049571 Bacteria 3955
926 Ga0501034_0214299 3300049571 Bacteria 1880
927 Ga0501034_0396200 3300049571 Unclassified 1304
928 Ga0501034_0826266 3300049571 Bacteria 818
929 Ga0501036_0332906 3300049572 Bacteria 1268
930 Ga0501036_0603738 3300049572 Bacteria 910
931 Ga0501037_0001372 3300049573 Bacteria 17876
932 Ga0501037_0127086 3300049573 Bacteria 1829
933 Ga0501038_0000314 3300049574 Bacteria 41462
934 Ga0501038_0013134 3300049574 Bacteria 7553
935 Ga0501038_0059410 3300049574 Bacteria 3275
936 Ga0501038_0199794 3300049574 Bacteria 1605
937 Ga0501039_0020620 3300049575 Bacteria 5050
938 Ga0501039_0036074 3300049575 Bacteria 3814
939 Ga0501042_0056670 3300049578 Bacteria 2796
940 Ga0501042_0144574 3300049578 Bacteria 1715
941 Ga0501042_0343336 3300049578 Bacteria 1079
942 Ga0501043_0001324 3300049579 Bacteria 21677
943 Ga0501043_0030616 3300049579 Bacteria 4230
944 Ga0501043_0269409 3300049579 Bacteria 1307
945 Ga0501046_0001012 3300049580 Bacteria 27395
946 Ga0501046_0034206 3300049580 Bacteria 4102
947 Ga0501046_0100330 3300049580 Bacteria 2221
948 Ga0501046_0113833 3300049580 Bacteria 2064
949 Ga0501046_0334541 3300049580 Bacteria 1101
950 Ga0501047_0000250 3300049581 Bacteria 63699
951 Ga0501047_0004195 3300049581 Bacteria 13568
952 Ga0501047_0103652 3300049581 Bacteria 2725
953 Ga0501047_0103968 3300049581 Bacteria 2720
954 Ga0501047_0188557 3300049581 Bacteria 1926
955 Ga0501047_0232735 3300049581 Bacteria 1695
956 Ga0501048_0017992 3300049582 Bacteria 5200
957 Ga0501048_0021518 3300049582 Bacteria 4723
958 Ga0501048_0029557 3300049582 Bacteria 3972
959 Ga0501067_0015294 3300049583 Bacteria 4246
960 Ga0501068_0246210 3300049584 Bacteria 1138
961 Ga0501069_0060151 3300049585 Bacteria 2120
962 Ga0501069_0089872 3300049585 Bacteria 1736
963 Ga0501069_0109992 3300049585 Bacteria 1568
964 Ga0501069_0522550 3300049585 Bacteria 709
965 Ga0501070_0006574 3300049586 Bacteria 9894
966 Ga0501070_0033585 3300049586 Bacteria 4293
967 Ga0501070_0036917 3300049586 Bacteria 4080
968 Ga0501070_0063643 3300049586 Bacteria 3055
969 Ga0501070_0138119 3300049586 Bacteria 2012
970 Ga0501070_0144521 3300049586 Bacteria 1963
971 Ga0501070_0162900 3300049586 Bacteria 1838
972 Ga0501070_0247835 3300049586 Bacteria 1457
973 Ga0501071_0015438 3300049587 Bacteria 5243
974 Ga0501071_0088182 3300049587 Bacteria 2276
975 Ga0501073_0001831 3300049589 Bacteria 15830
976 Ga0501073_0059390 3300049589 Bacteria 2671
977 Ga0501073_0077593 3300049589 Bacteria 2311
978 Ga0501073_0588853 3300049589 Bacteria 768
979 Ga0501074_0000980 3300049590 Bacteria 18498
980 Ga0501074_0060097 3300049590 Bacteria 2737
981 Ga0501074_0069493 3300049590 Bacteria 2532
982 Ga0501074_0148950 3300049590 Bacteria 1673
983 Ga0501074_0154724 3300049590 Bacteria 1638
984 Ga0501076_0515508 3300049592 Bacteria 986
985 Ga0501079_0213512 3300049741 Bacteria 1507
986 Ga0501079_0285027 3300049741 Bacteria 1291
987 Ga0501079_0374970 3300049741 Bacteria 1115
988 Ga0501080_0002282 3300049742 Bacteria 16696
989 Ga0501080_0021405 3300049742 Bacteria 5985
990 Ga0501080_0049719 3300049742 Bacteria 3902
991 Ga0501080_0062331 3300049742 Bacteria 3470
992 Ga0501080_0089179 3300049742 Bacteria 2865
993 Ga0501080_0107130 3300049742 Bacteria 2590
994 Ga0501081_0073960 3300049743 Bacteria 2377
995 Ga0501083_0057300 3300049744 Bacteria 2608
996 Ga0501083_0154216 3300049744 Bacteria 1504
997 Ga0501035_0000666 3300049822 Bacteria 37861
998 Ga0501035_0043368 3300049822 Bacteria 4053
999 Ga0501035_0069939 3300049822 Bacteria 3110
1000 Ga0501035_0307897 3300049822 Bacteria 1333
1001 Ga0501035_0508787 3300049822 Bacteria 991
1002 Ga0501035_0742204 3300049822 Bacteria 788
1003 Ga0501035_0769091 3300049822 Bacteria 771
1004 Ga0501044_0004802 3300049823 Bacteria 15112
1005 Ga0501044_0017351 3300049823 Bacteria 7721
1006 Ga0501044_0154438 3300049823 Bacteria 2275
1007 Ga0501044_0199878 3300049823 Bacteria 1957
1008 Ga0501044_0406799 3300049823 Bacteria 1272
1009 Ga0501044_0590676 3300049823 Bacteria 1004
1010 Ga0501045_0273922 3300049824 Bacteria 1256
1011 nmdc:mga0n895_277153_c1 3300050512 Bacteria 1701
1012 nmdc:mga0rr50_215952_c1 3300050513 Bacteria 1582
1013 nmdc:mga0rr50_437874_c1 3300050513 Bacteria 1107
1014 nmdc:mga0rr50_517934_c1 3300050513 Unclassified 1015
1015 nmdc:mga0rr50_73583_c1 3300050513 Bacteria 2613
1016 nmdc:mga08x19_365_c1 3300050514 Bacteria 32003
1017 nmdc:mga08x19_57597_c1 3300050514 Bacteria 2512
1018 nmdc:mga0a205_903698_c1 3300050515 Bacteria 730
1019 Ga0495601_0003409 3300053077 Bacteria 9110
1020 Ga0495601_0015194 3300053077 Bacteria 4651
1021 Ga0495612_0000369 3300053078 Bacteria 18070
1022 Ga0495612_0000772 3300053078 Bacteria 13040
1023 Ga0495619_0130096 3300053085 Bacteria 1729
1024 Ga0500647_0000104 3300053091 Bacteria 16366
1025 Ga0500648_000010 3300053097 Bacteria 53408
1026 Ga0500556_0000303 3300053104 Bacteria 37613
1027 Ga0500585_099340 3300053144 Bacteria 1049
1028 Ga0500586_095330 3300053145 Bacteria 1044
1029 Ga0500620_109363 3300053155 Bacteria 968
1030 Ga0500633_0015716 3300053160 Bacteria 2178
1031 Ga0500599_000007 3300053736 Bacteria 77262
1032 Ga0501084_0245529 3300054114 Bacteria 1511
1033 Ga0501084_0576817 3300054114 Bacteria 950
1034 Ga0587073_0001891 3300059492 Bacteria 2575
1035 Ga0587088_001539 3300059508 Bacteria 2415
1036 Ga0587106_000089 3300059605 Bacteria 4305
1037 Ga0587101_006283 3300059623 Bacteria 1356
1038 Ga0587075_006913 3300059644 Bacteria 1408
1039 Ga0587076_017558 3300059645 Bacteria 1142
1040 Ga0587079_003247 3300059647 Bacteria 2100
1041 Ga0587111_0101286 3300060346 Bacteria 718
1042 Ga0501082_0146414 3300060353 Bacteria 2050
1043 Ga0501082_0507194 3300060353 Bacteria 1054
1044 2512635739 2512564013 Bacteria 6286191
1045 2538834132 2537561836 Bacteria 3910579
1046 2643829524 2643221562 Bacteria 4048635
1047 2643895221 2643221577 Bacteria 3710843
1048 2644477380 2643221685 Bacteria 3673288
1049 2687584041 2687453130 Bacteria 4227172
1050 2739732124 2739367700 Bacteria 4747630
1051 2857472351 2857465823 Bacteria 6772595
1052 2857597784 2857591370 Bacteria 6569758
1053 2857608873 2857604169 Bacteria 5111450
1054 2857613416 2857609550 Bacteria 3753890
1055 2881649638 2881644220 Bacteria 5302661
1056 2884413728 2884411467 Bacteria 5246714
1057 2895397474 2895395659 Bacteria 3983269
1058 2915598703 2915597211 Bacteria 6475886
1059 2928964822 2928963466 Bacteria 5165703
1060 2929183849 2929183550 Bacteria 6377511
1061 2939612733 2939611941 Bacteria 3892017
1062 2941490077 2941489479 Bacteria 6313767
1063 2995950363 2995948881 Bacteria 6358104
1064 8003015003 8003014200 Bacteria 4059994
1065 8007374602 8007371054 Bacteria 4849201
1066 8055533618 8055531788 Bacteria 5249694
1067 Ga0316586_1000008
1068 JGI24736J21556_1002754
1069 JGI24736J21556_1003768
1070 JGI24736J21556_1023445
1071 JGI24741J21665_1004451
1072 JGI24741J21665_1004493
1073 JGI24741J21665_1004799
1074 JGI24741J21665_1008247
1075 JGI24741J21665_1018685
1076 JGI24740J21852_10003737
1077 JGI24740J21852_10006264
1078 JGI24740J21852_10012232
1079 JGI25156J39149_1002085
1080 JGI25156J39149_1003296
1081 JGI25162J39368_1003895
1082 JGI25162J39368_1007773
1083 JGI25157J39369_1001153
1084 JGI25157J39369_1001750
1085 JGI25157J39369_1002044
1086 JGI25151J46595_10007643
1087 JGI25151J46595_10013580
1088 Ga0055538_1000196
1089 Ga0055533_1002319
1090 Ga0055525_1000111
1091 Ga0055527_1001334
1092 Ga0055527_1004862
1093 Ga0055535_1004862
1094 Ga0055542_1003848
1095 Ga0055542_1004903
1096 Ga0055529_1003204
1097 Ga0055526_1008536
1098 Ga0055526_1008987
1099 Ga0055537_1001096
1100 Ga0055524_1013602
1101 Ga0055524_1015666
1102 Ga0055536_1024081
1103 Ga0055534_1003331
1104 Ga0055534_1006907
1105 Ga0055528_1013611
1106 Ga0055528_1016393
1107 Ga0055530_10004966
1108 Ga0055531_10017875
1109 Ga0058859_11760642
1110 Ga0058863_10021952
1111 Ga0058863_10051910
1112 Ga0058861_10029892
1113 Ga0058860_10137024
1114 Ga0058862_10121056
1115 Ga0065165_1033037
1116 Ga0065707_10183525
1117 Ga0070658_10062591
1118 Ga0070658_10253456
1119 Ga0070658_10424499
1120 Ga0070676_10011569
1121 Ga0070683_100091777
1122 Ga0070683_100337298
1123 Ga0070690_100108195
1124 Ga0070670_100213118
1125 Ga0070666_10062032
1126 Ga0070666_10267214
1127 Ga0070680_100024646
1128 Ga0070680_100126748
1129 Ga0070680_100131473
1130 Ga0070680_100135391
1131 Ga0070680_100450980
1132 Ga0070682_100031926
1133 Ga0070682_100040504
1134 Ga0070682_100141710
1135 Ga0070682_100155304
1136 Ga0070682_100374660
1137 Ga0070660_100123626
1138 Ga0070660_100244093
1139 Ga0070660_100398730
1140 Ga0070660_100541817
1141 Ga0070689_100041431
1142 Ga0070691_10019986
1143 Ga0070691_10048275
1144 Ga0070661_100015281
1145 Ga0070661_100042481
1146 Ga0070661_100097541
1147 Ga0070661_100138082
1148 Ga0070661_100169084
1149 Ga0070661_100187257
1150 Ga0070661_100369076
1151 Ga0070661_100699554
1152 Ga0070661_100749257
1153 Ga0070692_10007700
1154 Ga0070692_10056065
1155 Ga0070692_10087946
1156 Ga0070692_10124727
1157 Ga0070668_100014103
1158 Ga0070668_100348368
1159 Ga0070669_100006246
1160 Ga0070669_100222301
1161 Ga0070669_100564161
1162 Ga0070675_100638971
1163 Ga0070671_100288936
1164 Ga0070671_100322516
1165 Ga0070674_100279417
1166 Ga0070674_100287754
1167 Ga0070673_100109100
1168 Ga0070688_100171238
1169 Ga0070659_100138001
1170 Ga0070659_100160932
1171 Ga0070659_100173711
1172 Ga0070659_100191871
1173 Ga0070659_100219319
1174 Ga0070659_100750336
1175 Ga0070667_100074637
1176 Ga0070667_100124452
1177 Ga0070667_100577578
1178 Ga0070709_10000076
1179 Ga0070709_10034187
1180 Ga0070709_10160955
1181 Ga0070713_100008401
1182 Ga0070713_100020295
1183 Ga0070713_100037982
1184 Ga0070713_100103997
1185 Ga0070710_10040859
1186 Ga0070710_10071767
1187 Ga0070710_10268926
1188 Ga0070711_100001449
1189 Ga0070711_100007565
1190 Ga0070711_100225282
1191 Ga0070711_100397777
1192 Ga0070705_100127227
1193 Ga0070694_100058419
1194 Ga0070708_100035523
1195 Ga0070708_100311587
1196 Ga0070708_100318751
1197 Ga0070663_100036599
1198 Ga0070663_100112513
1199 Ga0070663_100155767
1200 Ga0070663_100199061
1201 Ga0070663_100220345
1202 Ga0070678_100007039
1203 Ga0070662_100045686
1204 Ga0070662_100109776
1205 Ga0070662_100390820
1206 Ga0070681_10038165
1207 Ga0070681_10072551
1208 Ga0070681_10107230
1209 Ga0070681_10150874
1210 Ga0070681_10164806
1211 Ga0068867_100135873
1212 Ga0068867_100200101
1213 Ga0070706_100119495
1214 Ga0070707_100192686
1215 Ga0070698_100361005
1216 Ga0070698_100363463
1217 Ga0070699_100023687
1218 Ga0070679_100019420
1219 Ga0070679_100040938
1220 Ga0070679_100178793
1221 Ga0070679_100184276
1222 Ga0070679_100881218
1223 Ga0070684_100050987
1224 Ga0070684_100083757
1225 Ga0070684_100088026
1226 Ga0070697_100006091
1227 Ga0070697_100049282
1228 Ga0068853_100029334
1229 Ga0068853_100035785
1230 Ga0068853_100146241
1231 Ga0068853_100155319
1232 Ga0068853_100167153
1233 Ga0070695_100005390
1234 Ga0070695_100077726
1235 Ga0070696_100004505
1236 Ga0070696_100124730
1237 Ga0070696_100128219
1238 Ga0070696_100141842
1239 Ga0070696_100153761
1240 Ga0070693_100000494
1241 Ga0070693_100091903
1242 Ga0070665_100000175
1243 Ga0070665_100000700
1244 Ga0070665_100105834
1245 Ga0070704_100013476
1246 Ga0068855_100231949
1247 Ga0068855_100258994
1248 Ga0068855_101050573
1249 Ga0070664_100100832
1250 Ga0070664_100443888
1251 Ga0068857_100003667
1252 Ga0068857_100087151
1253 Ga0068857_100175464
1254 Ga0068854_100054151
1255 Ga0068854_100099085
1256 Ga0068854_100104882
1257 Ga0068854_100161998
1258 Ga0068854_100221682
1259 Ga0068854_100265326
1260 Ga0068854_100415343
1261 Ga0068856_100004797
1262 Ga0068856_100184419
1263 Ga0068856_100192491
1264 Ga0068856_100211399
1265 Ga0068856_100354244
1266 Ga0068856_100459289
1267 Ga0070702_100051791
1268 Ga0068852_100031217
1269 Ga0068852_100134375
1270 Ga0068852_100151291
1271 Ga0068852_100156348
1272 Ga0068852_100370010
1273 Ga0068852_100991777
1274 Ga0068859_100122263
1275 Ga0068859_100678814
1276 Ga0068864_100168714
1277 Ga0068864_100479567
1278 Ga0068861_100050727
1279 Ga0068861_100503022
1280 Ga0068851_10014017
1281 Ga0068851_10118794
1282 Ga0068851_10129468
1283 Ga0068863_100012596
1284 Ga0068863_100100973
1285 Ga0068858_100068753
1286 Ga0068858_100075141
1287 Ga0068860_100426956
1288 Ga0068862_100164162
1289 Ga0081540_1000720
1290 Ga0070717_10659450
1291 Ga0070716_100092179
1292 Ga0070716_100198374
1293 Ga0070716_100380441
1294 Ga0070712_100055854
1295 Ga0070712_100057688
1296 Ga0068871_100100892
1297 Ga0068871_100436173
1298 Ga0075434_100195641
1299 Ga0075434_100278025
1300 Ga0068865_100440219
1301 Ga0075436_100051741
1302 Ga0075436_100125917
1303 Ga0097620_100122253
1304 Ga0097620_100678845
1305 Ga0075435_100021456
1306 Ga0075435_100176685
1307 Ga0099794_10033018
1308 Ga0099794_10132618
1309 Ga0099794_10216173
1310 Ga0099794_10222807
1311 Ga0099794_10227996
1312 Ga0099795_10030595
1313 Ga0105240_10054178
1314 Ga0105240_10113841
1315 Ga0105240_10261623
1316 Ga0105240_10270922
1317 Ga0105240_10274138
1318 Ga0105240_10282025
1319 Ga0111539_10344664
1320 Ga0105247_10014280
1321 Ga0105242_10341696
1322 Ga0105248_10241422
1323 Ga0105248_10280233
1324 Ga0105248_10886345
1325 Ga0105237_10051347
1326 Ga0105237_10073900
1327 Ga0105237_10161032
1328 Ga0105237_10167989
1329 Ga0105237_10239616
1330 Ga0105238_10022011
1331 Ga0105238_10067600
1332 Ga0105238_10145294
1333 Ga0105238_10214402
1334 Ga0105238_10361347
1335 Ga0105238_10494909
1336 Ga0099796_10027098
1337 Ga0105239_10006660
1338 Ga0105239_10053763
1339 Ga0105239_10141288
1340 Ga0105239_10244795
1341 Ga0105239_10280538
1342 Ga0105246_10140293
1343 Ga0157323_1003136
1344 Ga0157373_10037570
1345 Ga0157373_10087027
1346 Ga0157373_10133595
1347 Ga0157373_10244996
1348 Ga0157371_10042032
1349 Ga0157371_10045126
1350 Ga0157371_10118940
1351 Ga0157371_10146760
1352 Ga0157371_10153337
1353 Ga0157371_10500069
1354 Ga0157370_10069149
1355 Ga0157370_10073111
1356 Ga0157370_10163772
1357 Ga0157370_10320909
1358 Ga0157370_10450952
1359 Ga0157369_10036937
1360 Ga0157369_10107916
1361 Ga0157369_10179013
1362 Ga0157369_10185505
1363 Ga0157369_10269476
1364 Ga0157369_10506063
1365 Ga0157378_10765208
1366 Ga0163162_10070045
1367 Ga0163162_10574042
1368 Ga0157372_10045136
1369 Ga0157372_10082823
1370 Ga0157372_10157288
1371 Ga0157372_10257410
1372 Ga0157372_10310831
1373 Ga0157372_10411246
1374 Ga0157372_10484226
1375 Ga0157372_11119375
1376 Ga0157372_11559379
1377 Ga0163163_10643802
1378 Ga0182008_10077601
1379 Ga0182008_10185021
1380 Ga0157379_10168013
1381 Ga0157376_10000077
1382 Ga0157376_10001519
1383 Ga0157376_10219585
1384 Ga0157376_10254964
1385 Ga0182007_10134052
1386 Ga0183368_1002
1387 Ga0183360_10001
1388 Ga0163161_10539761
1389 Ga0184592_126085
1390 Ga0197907_10574318
1391 Ga0197907_10947378
1392 Ga0197907_11264123
1393 Ga0206356_10069576
1394 Ga0206356_10171056
1395 Ga0206356_10966620
1396 Ga0206356_11482326
1397 Ga0206349_1346577
1398 Ga0206355_1347985
1399 Ga0206355_1657004
1400 Ga0206351_10247550
1401 Ga0206352_11092907
1402 Ga0206352_11356790
1403 Ga0206350_10601137
1404 Ga0206354_10337548
1405 Ga0206354_10771806
1406 Ga0206354_10919723
1407 Ga0206353_10129542
1408 Ga0206353_10294942
1409 Ga0206353_11029087
1410 Ga0154015_1010654
1411 Ga0154015_1416341
1412 Ga0213876_10017049
1413 Ga0224712_10013385
1414 Ga0224712_10021892
1415 Ga0224712_10027027
1416 Ga0209435_101200
1417 Ga0209435_106506
1418 Ga0209784_100310
1419 Ga0209674_100043
1420 Ga0209674_102881
1421 Ga0209672_100004
1422 Ga0209672_102109
1423 Ga0209563_100103
1424 Ga0207427_100209
1425 Ga0207427_104741
1426 Ga0209437_100020
1427 Ga0209437_100193
1428 Ga0209258_100003
1429 Ga0209258_104604
1430 Ga0207425_1039535
1431 Ga0209026_1000060
1432 Ga0209026_1000274
1433 Ga0209026_1001271
1434 Ga0209026_1006743
1435 Ga0209148_1000002
1436 Ga0209148_1000025
1437 Ga0209759_1001919
1438 Ga0209759_1010126
1439 Ga0209759_1016259
1440 Ga0209233_1000020
1441 Ga0209233_1000920
1442 Ga0209233_1033207
1443 Ga0209565_1000001
1444 Ga0209565_1037789
1445 Ga0209455_1000004
1446 Ga0209455_1000095
1447 Ga0209673_1000001
1448 Ga0209673_1002116
1449 Ga0209675_1000001
1450 Ga0209675_1006904
1451 Ga0209676_1001608
1452 Ga0209676_1004892
1453 Ga0209025_1044140
1454 Ga0209025_1122127
1455 Ga0209564_1000001
1456 Ga0209564_1007141
1457 Ga0209050_1001128
1458 Ga0209256_1000002
1459 Ga0209256_1003821
1460 Ga0209051_1037982
1461 Ga0209257_1006382
1462 Ga0207697_10042053
1463 Ga0207656_10098242
1464 Ga0207656_10105805
1465 Ga0207692_10016367
1466 Ga0207692_10056387
1467 Ga0207692_10230442
1468 Ga0207710_10034664
1469 Ga0207647_10011795
1470 Ga0207647_10012806
1471 Ga0207647_10013393
1472 Ga0207647_10041903
1473 Ga0207647_10047348
1474 Ga0207647_10071130
1475 Ga0207647_10094179
1476 Ga0207685_10031330
1477 Ga0207699_10018682
1478 Ga0207699_10170900
1479 Ga0207699_10191605
1480 Ga0207699_10208563
1481 Ga0207699_10228437
1482 Ga0207645_10006593
1483 Ga0207705_10004273
1484 Ga0207705_10008046
1485 Ga0207705_10031780
1486 Ga0207705_10034450
1487 Ga0207705_10118746
1488 Ga0207705_10173090
1489 Ga0207705_10189107
1490 Ga0207684_10230671
1491 Ga0207684_10244280
1492 Ga0207684_10251617
1493 Ga0207684_10332351
1494 Ga0207684_10383432
1495 Ga0207654_10061667
1496 Ga0207654_10144552
1497 Ga0207707_10000210
1498 Ga0207707_10001339
1499 Ga0207707_10018111
1500 Ga0207707_10025201
1501 Ga0207707_10051492
1502 Ga0207707_10052498
1503 Ga0207707_10152834
1504 Ga0207707_10237996
1505 Ga0207695_10000818
1506 Ga0207695_10006299
1507 Ga0207695_10008130
1508 Ga0207695_10068969
1509 Ga0207695_10073537
1510 Ga0207695_10148552
1511 Ga0207695_10217754
1512 Ga0207695_10312640
1513 Ga0207671_10028839
1514 Ga0207671_10054495
1515 Ga0207671_10085943
1516 Ga0207671_10269984
1517 Ga0207693_10038470
1518 Ga0207693_10096232
1519 Ga0207693_10134099
1520 Ga0207693_10277593
1521 Ga0207693_10280409
1522 Ga0207663_10004162
1523 Ga0207663_10017954
1524 Ga0207663_10275735
1525 Ga0207660_10014060
1526 Ga0207660_10034597
1527 Ga0207660_10036194
1528 Ga0207660_10105351
1529 Ga0207660_10119378
1530 Ga0207660_10368253
1531 Ga0207657_10055348
1532 Ga0207657_10070713
1533 Ga0207657_10122412
1534 Ga0207657_10124909
1535 Ga0207657_10128163
1536 Ga0207657_10200956
1537 Ga0207649_10002213
1538 Ga0207649_10014504
1539 Ga0207649_10015259
1540 Ga0207649_10024587
1541 Ga0207649_10047910
1542 Ga0207649_10065071
1543 Ga0207652_10033428
1544 Ga0207652_10048121
1545 Ga0207652_10053020
1546 Ga0207652_10147343
1547 Ga0207652_10156736
1548 Ga0207652_10669003
1549 Ga0207646_10000754
1550 Ga0207646_10303931
1551 Ga0207646_10356904
1552 Ga0207646_10730209
1553 Ga0207681_10105252
1554 Ga0207694_10028197
1555 Ga0207694_10088183
1556 Ga0207694_10119803
1557 Ga0207694_10160368
1558 Ga0207694_10714487
1559 Ga0207650_10286074
1560 Ga0207687_10234006
1561 Ga0207687_10481145
1562 Ga0207700_10116306
1563 Ga0207700_10180340
1564 Ga0207700_10285416
1565 Ga0207700_10737458
1566 Ga0207664_10001884
1567 Ga0207644_10089389
1568 Ga0207644_10090873
1569 Ga0207690_10000291
1570 Ga0207690_10003289
1571 Ga0207690_10034320
1572 Ga0207690_10222034
1573 Ga0207690_10227720
1574 Ga0207690_10670980
1575 Ga0207690_10809951
1576 Ga0207706_10015708
1577 Ga0207706_10100114
1578 Ga0207706_10107956
1579 Ga0207706_10319011
1580 Ga0207686_10023003
1581 Ga0207686_10333629
1582 Ga0207704_10216261
1583 Ga0207665_10000959
1584 Ga0207665_10006155
1585 Ga0207665_10006268
1586 Ga0207665_10010543
1587 Ga0207665_10035786
1588 Ga0207665_10052220
1589 Ga0207665_10101234
1590 Ga0207665_10215796
1591 Ga0207665_10409253
1592 Ga0207689_10020406
1593 Ga0207689_10136777
1594 Ga0207661_10004252
1595 Ga0207661_10058973
1596 Ga0207661_10273592
1597 Ga0207661_10648918
1598 Ga0207679_10025524
1599 Ga0207679_10425174
1600 Ga0207667_10008758
1601 Ga0207667_10009904
1602 Ga0207667_10010803
1603 Ga0207667_10053962
1604 Ga0207667_10072769
1605 Ga0207667_10095216
1606 Ga0207667_10119954
1607 Ga0207667_10193768
1608 Ga0207667_10259410
1609 Ga0207651_10066649
1610 Ga0207668_10075782
1611 Ga0207668_10187878
1612 Ga0207668_10423728
1613 Ga0207640_10002025
1614 Ga0207640_10003058
1615 Ga0207640_10025408
1616 Ga0207640_10026008
1617 Ga0207640_10059031
1618 Ga0207640_10513033
1619 Ga0207640_10559495
1620 Ga0207658_10028034
1621 Ga0207658_10106388
1622 Ga0207677_10157745
1623 Ga0207677_10345942
1624 Ga0207703_10163415
1625 Ga0207703_10205239
1626 Ga0207639_10000231
1627 Ga0207639_10016511
1628 Ga0207639_10029641
1629 Ga0207639_10047428
1630 Ga0207639_10125486
1631 Ga0207639_10452119
1632 Ga0207678_10016758
1633 Ga0207678_10049236
1634 Ga0207678_10055028
1635 Ga0207678_10130950
1636 Ga0207678_10137839
1637 Ga0207678_10220963
1638 Ga0207678_10271783
1639 Ga0207678_10729632
1640 Ga0207678_10924653
1641 Ga0207708_10509884
1642 Ga0207702_10000852
1643 Ga0207702_10011901
1644 Ga0207702_10012283
1645 Ga0207702_10074823
1646 Ga0207702_10091382
1647 Ga0207702_10161689
1648 Ga0207702_10375412
1649 Ga0207702_10744510
1650 Ga0207641_10183031
1651 Ga0207641_10546239
1652 Ga0207648_10168415
1653 Ga0207648_10310721
1654 Ga0207676_10162686
1655 Ga0207676_10285849
1656 Ga0207674_10001554
1657 Ga0207674_10017287
1658 Ga0207674_10059241
1659 Ga0207674_10111246
1660 Ga0207674_10142271
1661 Ga0207675_100106837
1662 Ga0207675_100774282
1663 Ga0207675_101176735
1664 Ga0207683_10023634
1665 Ga0207698_10004871
1666 Ga0207698_10007267
1667 Ga0207698_10038635
1668 Ga0207698_10052641
1669 Ga0207698_10301744
1670 Ga0207698_10705601
1671 Ga0209588_1051560
1672 Ga0209588_1081586
1673 Ga0268266_10000001
1674 Ga0268266_10000259
1675 Ga0268266_10100303
1676 Ga0268265_10115242
1677 Ga0268264_10023204
1678 Ga0268264_10121193
1679 Ga0268264_10515755
1680 Ga0307517_10241588
1681 Ga0265766_1002482
1682 Ga0265770_1020074
1683 Ga0265764_100381
1684 Ga0265774_100076
1685 Ga0265760_10004278
1686 Ga0265760_10074156
1687 Ga0265760_10114369
1688 Ga0265325_10048727
1689 Ga0265339_10265934
1690 Ga0307408_100110780
1691 Ga0316575_10141054
1692 Ga0316576_10006052
1693 Ga0316576_10187240
1694 Ga0316578_10032616
1695 Ga0307413_10146858
1696 Ga0307413_10837432
1697 Ga0307406_10093487
1698 Ga0307406_10105057
1699 Ga0307412_10028293
1700 Ga0307409_100474526
1701 Ga0307416_100079046
1702 Ga0307507_10270077
1703 Ga0316588_1000021
1704 Ga0316596_1000103
1705 Ga0373959_0043986
1706 Ga0373926_0002726
1707 Ga0373934_0001004
1708 Ga0373934_0114056
1709 Ga0373923_0001256
1710 Ga0373945_0098404
1711 Ga0373945_0240426
1712 Ga0373953_0066494
1713 Ga0373954_0005540
1714 Ga0373954_0015764
1715 Ga0373954_0042676
1716 Ga0373956_0019487
1717 Ga0373957_0000289
1718 Ga0373957_0034419
1719 Ga0373943_0117096
1720 Ga0373946_0023454
1721 Ga0373955_0161703
1722 Ga0316574_0051750
1723 Ga0373931_0021266
1724 Ga0373935_0010652
1725 Ga0373927_0000934
1726 Ga0373927_0004438
1727 Ga0373933_0000551
1728 Ga0373933_0002799
1729 Ga0373933_0188487
1730 Ga0373947_0000905
1731 Ga0373947_0008831
1732 Ga0373937_0000238
1733 Ga0373937_0005026
1734 Ga0373937_0016547
1735 Ga0373937_0049055
1736 Ga0373937_0377618
1737 Ga0310112_000276
1738 Ga0310109_011090
1739 Ga0310110_004759
1740 Ga0373925_0001788
1741 Ga0373925_0009068
1742 Ga0395899_0001959
1743 Ga0395899_0042216
1744 Ga0395899_0432225
1745 Ga0395900_0125348
1746 Ga0395900_0135347
1747 Ga0395900_0172278
1748 Ga0395898_0000558
1749 Ga0395898_0135016
1750 Ga0395898_0138563
1751 Ga0395901_0002939
1752 Ga0395901_0218962
1753 Ga0400483_047654
1754 Ga0400483_168849
1755 Ga0436365_1034683
1756 Ga0436361_1002022
1757 Ga0451787_149821
1758 Ga0451794_28977
1759 Ga0451793_0393032
1760 Ga0451805_117344
1761 Ga0451837_0589056
1762 Ga0451853_1157729
1763 Ga0439437_001431
1764 Ga0439455_0060019
1765 Ga0439459_0002369
1766 Ga0451577_0127243
1767 Ga0466969_0001060
1768 Ga0466969_0008941
1769 Ga0466972_0000416
1770 Ga0466965_0049044
1771 Ga0466966_0002549
1772 Ga0466961_0025162
1773 Ga0466961_0085616
1774 Ga0466971_0033841
1775 Ga0466968_0016253
1776 Ga0466968_0222672
1777 Ga0466970_0000139
1778 Ga0466970_0088960
1779 Ga0466959_0003175
1780 Ga0466959_0072597
1781 Ga0466958_0045436
1782 Ga0466967_0729083
1783 Ga0466967_0743177
1784 Ga0495592_0116471
1785 Ga0495592_0129288
1786 Ga0495603_0065572
1787 Ga0495629_0065391
1788 Ga0495638_0000007
1789 Ga0495651_0003059
1790 Ga0495651_0012754
1791 Ga0495651_0144083
1792 Ga0495651_0369488
1793 Ga0495653_0004713
1794 Ga0495653_0005252
1795 Ga0495653_0188001
1796 Ga0495653_0430957
1797 Ga0495653_0668187
1798 Ga0495650_0000202
1799 Ga0495580_0002827
1800 Ga0495580_0016376
1801 Ga0495580_0071634
1802 Ga0495580_0132657
1803 Ga0495582_0004462
1804 Ga0495582_0130173
1805 Ga0495662_0014892
1806 Ga0495664_0000007
1807 Ga0495664_0158325
1808 Ga0495594_0077145
1809 Ga0495606_0001329
1810 Ga0495608_0004716
1811 Ga0495608_0014220
1812 Ga0495608_0024720
1813 Ga0495608_0083762
1814 Ga0495618_0000035
1815 Ga0495618_0102156
1816 Ga0495628_0011006
1817 Ga0495628_0017722
1818 Ga0495630_0000610
1819 Ga0495630_0015980
1820 Ga0495630_0088337
1821 Ga0495630_0145341
1822 Ga0495630_0221500
1823 Ga0495666_0029996
1824 Ga0495666_0107669
1825 Ga0495652_0023062
1826 Ga0495652_0026177
1827 Ga0495665_0017344
1828 Ga0495665_0159246
1829 Ga0495640_0031243
1830 Ga0495586_0001676
1831 Ga0495587_0000383
1832 Ga0495587_0023543
1833 Ga0495587_0024675
1834 Ga0495645_0000033
1835 Ga0495645_0076839
1836 Ga0495622_0040458
1837 Ga0495667_0071691
1838 Ga0495625_0016676
1839 Ga0495635_0011568
1840 Ga0495657_0000027
1841 Ga0495657_0049456
1842 Ga0495657_0058966
1843 Ga0495657_0201940
1844 Ga0495599_0044494
1845 Ga0495623_0001135
1846 Ga0495646_0013837
1847 Ga0495646_0118500
1848 Ga0495646_0249493
1849 Ga0495613_0062134
1850 Ga0495613_0214634
1851 Ga0495624_0026801
1852 Ga0495624_0038887
1853 Ga0495670_0056198
1854 Ga0495649_0000383
1855 Ga0495600_0041791
1856 Ga0495600_0200930
1857 Ga0495581_0011173
1858 Ga0495604_0000785
1859 Ga0495604_0017471
1860 Ga0495604_0209128
1861 Ga0495604_0541963
1862 Ga0495674_0022169
1863 Ga0495674_0184395
1864 Ga0495674_0245455
1865 Ga0495680_0081547
1866 Ga0495680_0223650
1867 Ga0495675_0002324
1868 Ga0495684_0006019
1869 Ga0495684_0010523
1870 Ga0495684_0093585
1871 Ga0495684_0208428
1872 Ga0495593_0000774
1873 Ga0495593_0083344
1874 Ga0495602_0000595
1875 Ga0495602_0019524
1876 Ga0495602_0111755
1877 Ga0495614_0038783
1878 Ga0495614_0081326
1879 Ga0496100_0473313
1880 Ga0496101_0243688
1881 Ga0496102_0000002
1882 Ga0496103_0000017
1883 Ga0496104_0159892
1884 Ga0496105_0041905
1885 Ga0496107_0074215
1886 Ga0496108_0647932
1887 Ga0496109_0004801
1888 Ga0496110_0517704
1889 Ga0496113_0237825
1890 Ga0496114_0001141
1891 Ga0496114_0055393
1892 Ga0496114_0146312
1893 Ga0496115_0002269
1894 Ga0496115_0002867
1895 Ga0496115_0082599
1896 Ga0496115_0137021
1897 Ga0496115_0145132
1898 Ga0496115_0316099
1899 Ga0496116_0021441
1900 Ga0496116_0076103
1901 Ga0496117_0000124
1902 Ga0496117_0032904
1903 Ga0496117_0063248
1904 Ga0496118_0001647
1905 Ga0496118_0012321
1906 Ga0496118_0092393
1907 Ga0496119_0000020
1908 Ga0496119_0016519
1909 Ga0496119_0089994
1910 Ga0496120_0000006
1911 Ga0496120_0002172
1912 Ga0496120_0035080
1913 Ga0496121_0002121
1914 Ga0496121_0005001
1915 Ga0496121_0016314
1916 Ga0496121_0060216
1917 Ga0496122_0000040
1918 Ga0496122_0000140
1919 Ga0496122_0000802
1920 Ga0496122_0007916
1921 Ga0496122_0043480
1922 Ga0496122_0124335
1923 Ga0496123_0000572
1924 Ga0496123_0004284
1925 Ga0496123_0022627
1926 Ga0496124_0010706
1927 Ga0496124_0101554
1928 Ga0496125_0000010
1929 Ga0496126_0000060
1930 Ga0496126_0002082
1931 Ga0496126_0028743
1932 Ga0496126_0119779
1933 Ga0496126_0225492
1934 Ga0501306_009115
1935 Ga0501308_013235
1936 Ga0501309_016200
1937 Ga0501341_05108
1938 Ga0501343_003268
1939 Ga0501305_000306
1940 Ga0501305_007127
1941 Ga0501305_013396
1942 Ga0501307_004411
1943 Ga0501307_008447
1944 Ga0501307_015629
1945 Ga0501307_030725
1946 Ga0495678_016742
1947 Ga0495682_0095818
1948 Ga0501311_000061
1949 Ga0501311_000124
1950 Ga0501312_000051
1951 Ga0501312_000171
1952 Ga0501313_000884
1953 Ga0501314_001682
1954 Ga0501315_000777
1955 Ga0501315_032343
1956 Ga0501316_032252
1957 Ga0501317_000397
1958 Ga0501318_017451
1959 Ga0501319_003952
1960 Ga0501320_000012
1961 Ga0501320_001616
1962 Ga0501321_004655
1963 Ga0501321_005495
1964 Ga0501321_006267
1965 Ga0501323_000549
1966 Ga0501323_000727
1967 Ga0501324_016790
1968 Ga0501326_00100
1969 Ga0501327_01403
1970 Ga0501328_00508
1971 Ga0501331_05830
1972 Ga0501332_03127
1973 Ga0501332_03708
1974 Ga0501334_01717
1975 Ga0501335_004678
1976 Ga0501335_009713
1977 Ga0501336_001466
1978 Ga0501338_01561
1979 Ga0501031_0011709
1980 Ga0501031_0249142
1981 Ga0501031_0388182
1982 Ga0501032_0002355
1983 Ga0501032_0020602
1984 Ga0501032_0025237
1985 Ga0501032_0253464
1986 Ga0501032_0294043
1987 Ga0501033_0003263
1988 Ga0501033_0012162
1989 Ga0501034_0005654
1990 Ga0501034_0025504
1991 Ga0501034_0056333
1992 Ga0501034_0214299
1993 Ga0501034_0396200
1994 Ga0501034_0826266
1995 Ga0501036_0332906
1996 Ga0501036_0603738
1997 Ga0501037_0001372
1998 Ga0501037_0127086
1999 Ga0501038_0000314
2000 Ga0501038_0013134
2001 Ga0501038_0059410
2002 Ga0501038_0199794
2003 Ga0501039_0020620
2004 Ga0501039_0036074
2005 Ga0501042_0056670
2006 Ga0501042_0144574
2007 Ga0501042_0343336
2008 Ga0501043_0001324
2009 Ga0501043_0030616
2010 Ga0501043_0269409
2011 Ga0501046_0001012
2012 Ga0501046_0034206
2013 Ga0501046_0100330
2014 Ga0501046_0113833
2015 Ga0501046_0334541
2016 Ga0501047_0000250
2017 Ga0501047_0004195
2018 Ga0501047_0103652
2019 Ga0501047_0103968
2020 Ga0501047_0188557
2021 Ga0501047_0232735
2022 Ga0501048_0017992
2023 Ga0501048_0021518
2024 Ga0501048_0029557
2025 Ga0501067_0015294
2026 Ga0501068_0246210
2027 Ga0501069_0060151
2028 Ga0501069_0089872
2029 Ga0501069_0109992
2030 Ga0501069_0522550
2031 Ga0501070_0006574
2032 Ga0501070_0033585
2033 Ga0501070_0036917
2034 Ga0501070_0063643
2035 Ga0501070_0138119
2036 Ga0501070_0144521
2037 Ga0501070_0162900
2038 Ga0501070_0247835
2039 Ga0501071_0015438
2040 Ga0501071_0088182
2041 Ga0501073_0001831
2042 Ga0501073_0059390
2043 Ga0501073_0077593
2044 Ga0501073_0588853
2045 Ga0501074_0000980
2046 Ga0501074_0060097
2047 Ga0501074_0069493
2048 Ga0501074_0148950
2049 Ga0501074_0154724
2050 Ga0501076_0515508
2051 Ga0501079_0213512
2052 Ga0501079_0285027
2053 Ga0501079_0374970
2054 Ga0501080_0002282
2055 Ga0501080_0021405
2056 Ga0501080_0049719
2057 Ga0501080_0062331
2058 Ga0501080_0089179
2059 Ga0501080_0107130
2060 Ga0501081_0073960
2061 Ga0501083_0057300
2062 Ga0501083_0154216
2063 Ga0501035_0000666
2064 Ga0501035_0043368
2065 Ga0501035_0069939
2066 Ga0501035_0307897
2067 Ga0501035_0508787
2068 Ga0501035_0742204
2069 Ga0501035_0769091
2070 Ga0501044_0004802
2071 Ga0501044_0017351
2072 Ga0501044_0154438
2073 Ga0501044_0199878
2074 Ga0501044_0406799
2075 Ga0501044_0590676
2076 Ga0501045_0273922
2077 nmdc:mga0n895_277153_c1
2078 nmdc:mga0rr50_215952_c1
2079 nmdc:mga0rr50_437874_c1
2080 nmdc:mga0rr50_517934_c1
2081 nmdc:mga0rr50_73583_c1
2082 nmdc:mga08x19_365_c1
2083 nmdc:mga08x19_57597_c1
2084 nmdc:mga0a205_903698_c1
2085 Ga0495601_0003409
2086 Ga0495601_0015194
2087 Ga0495612_0000369
2088 Ga0495612_0000772
2089 Ga0495619_0130096
2090 Ga0500647_0000104
2091 Ga0500648_000010
2092 Ga0500556_0000303
2093 Ga0500585_099340
2094 Ga0500586_095330
2095 Ga0500620_109363
2096 Ga0500633_0015716
2097 Ga0500599_000007
2098 Ga0501084_0245529
2099 Ga0501084_0576817
2100 Ga0587073_0001891
2101 Ga0587088_001539
2102 Ga0587106_000089
2103 Ga0587101_006283
2104 Ga0587075_006913
2105 Ga0587076_017558
2106 Ga0587079_003247
2107 Ga0587111_0101286
2108 Ga0501082_0146414
2109 Ga0501082_0507194
2110 2512635739
2111 2538834132
2112 2643829524
2113 2643895221
2114 2644477380
2115 2687584041
2116 2739732124
2117 2857472351
2118 2857597784
2119 2857608873
2120 2857613416
2121 2881649638
2122 2884413728
2123 2895397474
2124 2915598703
2125 2928964822
2126 2929183849
2127 2939612733
2128 2941490077
2129 2995950363
2130 8003015003
2131 8007374602
2132 8055533618

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

88

183

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9543 3 212
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9529 3 213
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.943 3 212
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9415 3 213
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.9317 3 212
ID Description Score Start End Superfamily
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9766 35 99 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.973 35 85 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9582 35 99 3.30.160.810
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9485 34 97 3.30.160.810
af_Q54I61_95_160_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9399 33 97 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A812F856-F1-model_v4 It binds directly near the 3'-end of the 23S rRNA 0.9711 3 86 GO:0003735
GO:0006412
GO:0022625
AF-A0A2V6DPT5-F1-model_v4 50S ribosomal protein L3 0.9675 1 86 GO:0003735
GO:0006412
GO:0022625
AF-A0A3B9LAN4-F1-model_v4 50S ribosomal protein L3 0.9623 4 124 GO:0003735
GO:0006412
GO:0022625
AF-A0A447N332-F1-model_v4 50S ribosomal protein L3 0.9597 3 86 GO:0003735
GO:0006412
GO:0022625
AF-A0A485AH68-F1-model_v4 50S ribosomal protein L3 0.9591 3 106 GO:0003735
GO:0006412
GO:0022625

Map