F489407
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1066 | 389 | 2132 | 456 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0034608|Ga0373925_0034608_585_2138 |
| Length | 517 |
| Sequence | MYGSQSAGMGHDRQVRKAIIGTDCAIPASSAGAVALSSARPAPARSPRRTVRDGCIEEELMPLATPAAKAIAAVRNAPGTRVKVAVSDIDGILRGKYLHKDKFYSAAEGGFGFCDVVFGWDMMDVTYDNTSLTGWHKGFPDALAKIDLGTLRHVPWDDGVPFFLGEFVQQKNGKEVPLGICPRQVLKRVLKRAEKLGVMPMCGMEFEWFNFIETPQSWADKKGVGPTTLTPGMFGYSLLRANANRDFFAALMNEMAAFGVPIEGLHTETGPGVYEAAITFSEALEAADRAILFKTGAKEIGARFGIMPSFMAKWNAQLPGCSGHIHQSLSDGKKNVFHDPKGRHGMSRLFESYLAGQVAALMEMAPMYWPTINSYKRLVDGFWAPVKPTWGVDNRTASFRVLAASPKSTRLETRCPGADMNPYLAAAACLAAGLNGIERNMKLTAKPIHGTNQGAENVPRAPRTLIETTRIFRDSAVARDWFGDDFVDHFAATREWEWRQWQDAVTDWEMKRYFEII |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 138 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 227 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 228 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 241 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 242 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 244 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 245 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 246 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 247 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 249 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 250 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 251 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 252 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 253 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 254 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 268 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 269 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 270 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 271 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 272 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 273 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 274 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 275 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 276 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 277 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 278 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 279 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 334 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 337 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 338 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 346 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 347 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 353 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 366 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 367 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 369 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 371 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 377 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 378 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 380 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 381 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 382 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 383 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 384 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 385 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 386 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 387 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 388 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 389 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.06 |
| Metatranscriptomes | 0 |
| Isolates | 0.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.5 |
| Nodule | 0 |
| Rhizoplane | 1.88 |
| Rhizosphere | 86.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373925_0034608 | 3300037068 | Bacteria | 3724 |
| 2 | JGI24739J22299_10005527 | 3300001989 | Bacteria | 4794 |
| 3 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 4 | JGI24751J29686_10001458 | 3300002459 | Bacteria | 4947 |
| 5 | JGI25155J39150_1000184 | 3300002704 | Bacteria | 26887 |
| 6 | JGI25156J39149_1000100 | 3300002705 | Bacteria | 63565 |
| 7 | JGI25162J39368_1000017 | 3300002737 | Bacteria | 281385 |
| 8 | JGI25162J39368_1000774 | 3300002737 | Bacteria | 21551 |
| 9 | JGI25154J39366_1000121 | 3300002738 | Bacteria | 62887 |
| 10 | JGI25157J39369_1000130 | 3300002741 | Bacteria | 63360 |
| 11 | JGI25150J39212_1001463 | 3300002774 | Bacteria | 6579 |
| 12 | JGI25159J45721_1000190 | 3300002987 | Bacteria | 28606 |
| 13 | JGI25151J46595_10011468 | 3300003187 | Bacteria | 4072 |
| 14 | JGI25165J46597_1002106 | 3300003214 | Bacteria | 7255 |
| 15 | rootH1_10005314 | 3300003316 | Bacteria | 25578 |
| 16 | rootH2_10218036 | 3300003320 | Bacteria | 2763 |
| 17 | rootH1_10009528 | 3300003323 | Bacteria | 31356 |
| 18 | rootH1_10122910 | 3300003323 | Bacteria | 5030 |
| 19 | JGI25160J50197_1000345 | 3300003354 | Bacteria | 30950 |
| 20 | JGI25160J50197_1000460 | 3300003354 | Bacteria | 25318 |
| 21 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 22 | Ga0055537_1000183 | 3300003773 | Bacteria | 46516 |
| 23 | Ga0055537_1000254 | 3300003773 | Bacteria | 38945 |
| 24 | Ga0055537_1011407 | 3300003773 | Bacteria | 1805 |
| 25 | Ga0055524_1000101 | 3300003775 | Bacteria | 106527 |
| 26 | Ga0055524_1000471 | 3300003775 | Bacteria | 32322 |
| 27 | Ga0055536_1016321 | 3300003781 | Bacteria | 2489 |
| 28 | Ga0055536_1016335 | 3300003781 | Bacteria | 2487 |
| 29 | Ga0055534_1000846 | 3300003784 | Bacteria | 14087 |
| 30 | Ga0055528_1001026 | 3300003790 | Bacteria | 18496 |
| 31 | Ga0055530_10003916 | 3300003791 | Bacteria | 8084 |
| 32 | Ga0055540_1000099 | 3300003792 | Bacteria | 96187 |
| 33 | Ga0055540_1000670 | 3300003792 | Bacteria | 23785 |
| 34 | Ga0055531_10007396 | 3300003794 | Bacteria | 6009 |
| 35 | Ga0055531_10007669 | 3300003794 | Bacteria | 5835 |
| 36 | Ga0055543_1002444 | 3300004625 | Bacteria | 6139 |
| 37 | Ga0065707_10086199 | 3300005295 | Bacteria | 5602 |
| 38 | Ga0070658_10002633 | 3300005327 | Bacteria | 14953 |
| 39 | Ga0070658_10008499 | 3300005327 | Bacteria | 8254 |
| 40 | Ga0070658_10021485 | 3300005327 | Bacteria | 5172 |
| 41 | Ga0070658_10035099 | 3300005327 | Bacteria | 4038 |
| 42 | Ga0070676_10000943 | 3300005328 | Bacteria | 14431 |
| 43 | Ga0070676_10001127 | 3300005328 | Bacteria | 13348 |
| 44 | Ga0070676_10002226 | 3300005328 | Bacteria | 9892 |
| 45 | Ga0070676_10007868 | 3300005328 | Bacteria | 5730 |
| 46 | Ga0070676_10025720 | 3300005328 | Bacteria | 3329 |
| 47 | Ga0070676_10030869 | 3300005328 | Bacteria | 3059 |
| 48 | Ga0070683_100041409 | 3300005329 | Bacteria | 4237 |
| 49 | Ga0070683_100099773 | 3300005329 | Bacteria | 2733 |
| 50 | Ga0070690_100053337 | 3300005330 | Bacteria | 2587 |
| 51 | Ga0070670_100001968 | 3300005331 | Bacteria | 16801 |
| 52 | Ga0070670_100002937 | 3300005331 | Bacteria | 14114 |
| 53 | Ga0070670_100002946 | 3300005331 | Bacteria | 14099 |
| 54 | Ga0070670_100006486 | 3300005331 | Bacteria | 9902 |
| 55 | Ga0070670_100012554 | 3300005331 | Bacteria | 7252 |
| 56 | Ga0070670_100014553 | 3300005331 | Bacteria | 6754 |
| 57 | Ga0070670_100018268 | 3300005331 | Bacteria | 6015 |
| 58 | Ga0070670_100028425 | 3300005331 | Bacteria | 4812 |
| 59 | Ga0070670_100030673 | 3300005331 | Bacteria | 4630 |
| 60 | Ga0070670_100031977 | 3300005331 | Bacteria | 4531 |
| 61 | Ga0070670_100070455 | 3300005331 | Bacteria | 3001 |
| 62 | Ga0070670_100161218 | 3300005331 | Unclassified | 1943 |
| 63 | Ga0070677_10000779 | 3300005333 | Bacteria | 10602 |
| 64 | Ga0068869_100001034 | 3300005334 | Bacteria | 16191 |
| 65 | Ga0068869_100021747 | 3300005334 | Bacteria | 4415 |
| 66 | Ga0068869_100029284 | 3300005334 | Bacteria | 3857 |
| 67 | Ga0068869_100043100 | 3300005334 | Bacteria | 3239 |
| 68 | Ga0070666_10001106 | 3300005335 | Bacteria | 16462 |
| 69 | Ga0070666_10005279 | 3300005335 | Bacteria | 7917 |
| 70 | Ga0070666_10012037 | 3300005335 | Bacteria | 5447 |
| 71 | Ga0070666_10040886 | 3300005335 | Bacteria | 3096 |
| 72 | Ga0070682_100008067 | 3300005337 | Bacteria | 5932 |
| 73 | Ga0068868_100002333 | 3300005338 | Bacteria | 13132 |
| 74 | Ga0068868_100018190 | 3300005338 | Bacteria | 5250 |
| 75 | Ga0068868_100059025 | 3300005338 | Bacteria | 3034 |
| 76 | Ga0068868_100061036 | 3300005338 | Bacteria | 2986 |
| 77 | Ga0068868_100151373 | 3300005338 | Bacteria | 1911 |
| 78 | Ga0070660_100004244 | 3300005339 | Bacteria | 9897 |
| 79 | Ga0070660_100054324 | 3300005339 | Bacteria | 3093 |
| 80 | Ga0070660_100077310 | 3300005339 | Bacteria | 2608 |
| 81 | Ga0070660_100087794 | 3300005339 | Bacteria | 2448 |
| 82 | Ga0070660_100096359 | 3300005339 | Bacteria | 2339 |
| 83 | Ga0070660_100143901 | 3300005339 | Bacteria | 1914 |
| 84 | Ga0070689_100021929 | 3300005340 | Bacteria | 4761 |
| 85 | Ga0070689_100040790 | 3300005340 | Bacteria | 3560 |
| 86 | Ga0070687_100008151 | 3300005343 | Bacteria | 4418 |
| 87 | Ga0070661_100001036 | 3300005344 | Bacteria | 19652 |
| 88 | Ga0070661_100020782 | 3300005344 | Bacteria | 4684 |
| 89 | Ga0070661_100045589 | 3300005344 | Bacteria | 3205 |
| 90 | Ga0070692_10006369 | 3300005345 | Bacteria | 5125 |
| 91 | Ga0070692_10007979 | 3300005345 | Bacteria | 4696 |
| 92 | Ga0070668_100002102 | 3300005347 | Bacteria | 14565 |
| 93 | Ga0070668_100002402 | 3300005347 | Bacteria | 13778 |
| 94 | Ga0070668_100006289 | 3300005347 | Bacteria | 8790 |
| 95 | Ga0070668_100010557 | 3300005347 | Bacteria | 6869 |
| 96 | Ga0070668_100020482 | 3300005347 | Bacteria | 4992 |
| 97 | Ga0070668_100040202 | 3300005347 | Bacteria | 3579 |
| 98 | Ga0070669_100002383 | 3300005353 | Bacteria | 13599 |
| 99 | Ga0070669_100020975 | 3300005353 | Bacteria | 4668 |
| 100 | Ga0070669_100045047 | 3300005353 | Bacteria | 3214 |
| 101 | Ga0070675_100000127 | 3300005354 | Bacteria | 45462 |
| 102 | Ga0070675_100015803 | 3300005354 | Bacteria | 5975 |
| 103 | Ga0070675_100025409 | 3300005354 | Bacteria | 4749 |
| 104 | Ga0070675_100040443 | 3300005354 | Bacteria | 3806 |
| 105 | Ga0070675_100081222 | 3300005354 | Unclassified | 2703 |
| 106 | Ga0070671_100000385 | 3300005355 | Bacteria | 30358 |
| 107 | Ga0070671_100014500 | 3300005355 | Bacteria | 6370 |
| 108 | Ga0070671_100014712 | 3300005355 | Bacteria | 6324 |
| 109 | Ga0070671_100019954 | 3300005355 | Bacteria | 5460 |
| 110 | Ga0070671_100094882 | 3300005355 | Bacteria | 2500 |
| 111 | Ga0070671_100132750 | 3300005355 | Bacteria | 2098 |
| 112 | Ga0070671_100150289 | 3300005355 | Bacteria | 1966 |
| 113 | Ga0070674_100000721 | 3300005356 | Bacteria | 16880 |
| 114 | Ga0070674_100009759 | 3300005356 | Bacteria | 5768 |
| 115 | Ga0070674_100024845 | 3300005356 | Bacteria | 3892 |
| 116 | Ga0070674_100033035 | 3300005356 | Bacteria | 3441 |
| 117 | Ga0070673_100000167 | 3300005364 | Bacteria | 31804 |
| 118 | Ga0070673_100001120 | 3300005364 | Bacteria | 15374 |
| 119 | Ga0070673_100006709 | 3300005364 | Bacteria | 7506 |
| 120 | Ga0070673_100006814 | 3300005364 | Bacteria | 7463 |
| 121 | Ga0070673_100024381 | 3300005364 | Bacteria | 4436 |
| 122 | Ga0070673_100063657 | 3300005364 | Bacteria | 2935 |
| 123 | Ga0070673_100097161 | 3300005364 | Bacteria | 2418 |
| 124 | Ga0070688_100001497 | 3300005365 | Bacteria | 11642 |
| 125 | Ga0070659_100000182 | 3300005366 | Bacteria | 48054 |
| 126 | Ga0070659_100031751 | 3300005366 | Bacteria | 4092 |
| 127 | Ga0070659_100075130 | 3300005366 | Bacteria | 2693 |
| 128 | Ga0070659_100133953 | 3300005366 | Bacteria | 2014 |
| 129 | Ga0070667_100001902 | 3300005367 | Bacteria | 18530 |
| 130 | Ga0070667_100007173 | 3300005367 | Bacteria | 9261 |
| 131 | Ga0070667_100008145 | 3300005367 | Bacteria | 8688 |
| 132 | Ga0070667_100017704 | 3300005367 | Bacteria | 5905 |
| 133 | Ga0070667_100032675 | 3300005367 | Bacteria | 4341 |
| 134 | Ga0070667_100036296 | 3300005367 | Bacteria | 4132 |
| 135 | Ga0070709_10002358 | 3300005434 | Bacteria | 10231 |
| 136 | Ga0070709_10065357 | 3300005434 | Bacteria | 2329 |
| 137 | Ga0070714_100021195 | 3300005435 | Bacteria | 5315 |
| 138 | Ga0070714_100030190 | 3300005435 | Bacteria | 4510 |
| 139 | Ga0070714_100038078 | 3300005435 | Bacteria | 4043 |
| 140 | Ga0070713_100000097 | 3300005436 | Bacteria | 55735 |
| 141 | Ga0070713_100013435 | 3300005436 | Bacteria | 6046 |
| 142 | Ga0070713_100015379 | 3300005436 | Bacteria | 5717 |
| 143 | Ga0070713_100082867 | 3300005436 | Bacteria | 2740 |
| 144 | Ga0070711_100000353 | 3300005439 | Bacteria | 23775 |
| 145 | Ga0070700_100118724 | 3300005441 | Bacteria | 1769 |
| 146 | Ga0070708_100000315 | 3300005445 | Bacteria | 36417 |
| 147 | Ga0070678_100001077 | 3300005456 | Bacteria | 14291 |
| 148 | Ga0070678_100001165 | 3300005456 | Bacteria | 13936 |
| 149 | Ga0070678_100003624 | 3300005456 | Bacteria | 8612 |
| 150 | Ga0070678_100010441 | 3300005456 | Bacteria | 5674 |
| 151 | Ga0070678_100016869 | 3300005456 | Bacteria | 4684 |
| 152 | Ga0070662_100000120 | 3300005457 | Bacteria | 43782 |
| 153 | Ga0070662_100034067 | 3300005457 | Bacteria | 3589 |
| 154 | Ga0070662_100083645 | 3300005457 | Bacteria | 2382 |
| 155 | Ga0070681_10004889 | 3300005458 | Bacteria | 12854 |
| 156 | Ga0070681_10012410 | 3300005458 | Bacteria | 8451 |
| 157 | Ga0070681_10068442 | 3300005458 | Bacteria | 3516 |
| 158 | Ga0068867_100000844 | 3300005459 | Bacteria | 20625 |
| 159 | Ga0068867_100001859 | 3300005459 | Bacteria | 14670 |
| 160 | Ga0068867_100004280 | 3300005459 | Bacteria | 10043 |
| 161 | Ga0068867_100006992 | 3300005459 | Bacteria | 7974 |
| 162 | Ga0068867_100029758 | 3300005459 | Bacteria | 3936 |
| 163 | Ga0068867_100036279 | 3300005459 | Bacteria | 3578 |
| 164 | Ga0068867_100051318 | 3300005459 | Bacteria | 3042 |
| 165 | Ga0068867_100071733 | 3300005459 | Bacteria | 2591 |
| 166 | Ga0068867_100093664 | 3300005459 | Bacteria | 2283 |
| 167 | Ga0068867_100136825 | 3300005459 | Bacteria | 1910 |
| 168 | Ga0070685_10008492 | 3300005466 | Bacteria | 5283 |
| 169 | Ga0070706_100076770 | 3300005467 | Bacteria | 3092 |
| 170 | Ga0070707_100020374 | 3300005468 | Bacteria | 6254 |
| 171 | Ga0070698_100090351 | 3300005471 | Bacteria | 3046 |
| 172 | Ga0070699_100010100 | 3300005518 | Bacteria | 8174 |
| 173 | Ga0070679_100001334 | 3300005530 | Bacteria | 21772 |
| 174 | Ga0070679_100024216 | 3300005530 | Bacteria | 5949 |
| 175 | Ga0070679_100029797 | 3300005530 | Bacteria | 5384 |
| 176 | Ga0070679_100041149 | 3300005530 | Bacteria | 4600 |
| 177 | Ga0070679_100106471 | 3300005530 | Bacteria | 2790 |
| 178 | Ga0070684_100010382 | 3300005535 | Bacteria | 7374 |
| 179 | Ga0070684_100017898 | 3300005535 | Bacteria | 5824 |
| 180 | Ga0070684_100054289 | 3300005535 | Bacteria | 3491 |
| 181 | Ga0070697_100020263 | 3300005536 | Bacteria | 5260 |
| 182 | Ga0070697_100039030 | 3300005536 | Bacteria | 3838 |
| 183 | Ga0068853_100012981 | 3300005539 | Bacteria | 6791 |
| 184 | Ga0068853_100017799 | 3300005539 | Bacteria | 5867 |
| 185 | Ga0068853_100027393 | 3300005539 | Bacteria | 4788 |
| 186 | Ga0068853_100047410 | 3300005539 | Bacteria | 3687 |
| 187 | Ga0068853_100050373 | 3300005539 | Bacteria | 3583 |
| 188 | Ga0068853_100087053 | 3300005539 | Bacteria | 2740 |
| 189 | Ga0068853_100180578 | 3300005539 | Bacteria | 1914 |
| 190 | Ga0070672_100003372 | 3300005543 | Bacteria | 10351 |
| 191 | Ga0070672_100014345 | 3300005543 | Bacteria | 5615 |
| 192 | Ga0070672_100024561 | 3300005543 | Bacteria | 4457 |
| 193 | Ga0070672_100054414 | 3300005543 | Bacteria | 3132 |
| 194 | Ga0070672_100056718 | 3300005543 | Bacteria | 3073 |
| 195 | Ga0070672_100088525 | 3300005543 | Bacteria | 2493 |
| 196 | Ga0070696_100003984 | 3300005546 | Bacteria | 9844 |
| 197 | Ga0070693_100019783 | 3300005547 | Bacteria | 3538 |
| 198 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 199 | Ga0070665_100005025 | 3300005548 | Bacteria | 13723 |
| 200 | Ga0070665_100010909 | 3300005548 | Bacteria | 9191 |
| 201 | Ga0070665_100012296 | 3300005548 | Bacteria | 8628 |
| 202 | Ga0070665_100035421 | 3300005548 | Bacteria | 5019 |
| 203 | Ga0070665_100065422 | 3300005548 | Bacteria | 3647 |
| 204 | Ga0070665_100092016 | 3300005548 | Bacteria | 3037 |
| 205 | Ga0070665_100101908 | 3300005548 | Bacteria | 2875 |
| 206 | Ga0070665_100172862 | 3300005548 | Bacteria | 2161 |
| 207 | Ga0070704_100090141 | 3300005549 | Bacteria | 2283 |
| 208 | Ga0070704_100220043 | 3300005549 | Bacteria | 1543 |
| 209 | Ga0068855_100001125 | 3300005563 | Bacteria | 33195 |
| 210 | Ga0068855_100003748 | 3300005563 | Bacteria | 18569 |
| 211 | Ga0068855_100004880 | 3300005563 | Bacteria | 16367 |
| 212 | Ga0068855_100008578 | 3300005563 | Bacteria | 12358 |
| 213 | Ga0068855_100009594 | 3300005563 | Bacteria | 11677 |
| 214 | Ga0068855_100017698 | 3300005563 | Bacteria | 8570 |
| 215 | Ga0068855_100025077 | 3300005563 | Bacteria | 7138 |
| 216 | Ga0068855_100025708 | 3300005563 | Bacteria | 7041 |
| 217 | Ga0068855_100032601 | 3300005563 | Bacteria | 6219 |
| 218 | Ga0068855_100089902 | 3300005563 | Bacteria | 3545 |
| 219 | Ga0070664_100000226 | 3300005564 | Bacteria | 40249 |
| 220 | Ga0070664_100028846 | 3300005564 | Bacteria | 4622 |
| 221 | Ga0070664_100036503 | 3300005564 | Bacteria | 4129 |
| 222 | Ga0070664_100078704 | 3300005564 | Bacteria | 2836 |
| 223 | Ga0068857_100003262 | 3300005577 | Bacteria | 13481 |
| 224 | Ga0068857_100084595 | 3300005577 | Bacteria | 2835 |
| 225 | Ga0068857_100179713 | 3300005577 | Unclassified | 1925 |
| 226 | Ga0068857_100336741 | 3300005577 | Bacteria | 1395 |
| 227 | Ga0068854_100006927 | 3300005578 | Bacteria | 7230 |
| 228 | Ga0068854_100012443 | 3300005578 | Bacteria | 5572 |
| 229 | Ga0068854_100039255 | 3300005578 | Bacteria | 3334 |
| 230 | Ga0068854_100060141 | 3300005578 | Bacteria | 2747 |
| 231 | Ga0068856_100001739 | 3300005614 | Bacteria | 22768 |
| 232 | Ga0068856_100002273 | 3300005614 | Bacteria | 19820 |
| 233 | Ga0068856_100005592 | 3300005614 | Bacteria | 12370 |
| 234 | Ga0068856_100006483 | 3300005614 | Bacteria | 11474 |
| 235 | Ga0068856_100024824 | 3300005614 | Bacteria | 5839 |
| 236 | Ga0068856_100025660 | 3300005614 | Bacteria | 5746 |
| 237 | Ga0068856_100044772 | 3300005614 | Unclassified | 4355 |
| 238 | Ga0068856_100194883 | 3300005614 | Bacteria | 2040 |
| 239 | Ga0068856_100207083 | 3300005614 | Bacteria | 1976 |
| 240 | Ga0068856_100207510 | 3300005614 | Bacteria | 1974 |
| 241 | Ga0070702_100013178 | 3300005615 | Bacteria | 4167 |
| 242 | Ga0068852_100000458 | 3300005616 | Bacteria | 26975 |
| 243 | Ga0068852_100000500 | 3300005616 | Bacteria | 25729 |
| 244 | Ga0068852_100000590 | 3300005616 | Bacteria | 23897 |
| 245 | Ga0068852_100000662 | 3300005616 | Bacteria | 22487 |
| 246 | Ga0068852_100002866 | 3300005616 | Bacteria | 11957 |
| 247 | Ga0068852_100018396 | 3300005616 | Bacteria | 5503 |
| 248 | Ga0068852_100018846 | 3300005616 | Bacteria | 5447 |
| 249 | Ga0068852_100032082 | 3300005616 | Bacteria | 4345 |
| 250 | Ga0068852_100044318 | 3300005616 | Bacteria | 3777 |
| 251 | Ga0068852_100089929 | 3300005616 | Bacteria | 2745 |
| 252 | Ga0068852_100123509 | 3300005616 | Bacteria | 2374 |
| 253 | Ga0068859_100001046 | 3300005617 | Bacteria | 28371 |
| 254 | Ga0068859_100003087 | 3300005617 | Bacteria | 16901 |
| 255 | Ga0068859_100014529 | 3300005617 | Bacteria | 7907 |
| 256 | Ga0068859_100040466 | 3300005617 | Bacteria | 4679 |
| 257 | Ga0068859_100119610 | 3300005617 | Bacteria | 2701 |
| 258 | Ga0068859_100147526 | 3300005617 | Bacteria | 2428 |
| 259 | Ga0068859_100161402 | 3300005617 | Bacteria | 2320 |
| 260 | Ga0068864_100001845 | 3300005618 | Bacteria | 17426 |
| 261 | Ga0068864_100002069 | 3300005618 | Bacteria | 16579 |
| 262 | Ga0068864_100003834 | 3300005618 | Bacteria | 12396 |
| 263 | Ga0068866_10004365 | 3300005718 | Bacteria | 5805 |
| 264 | Ga0068866_10030557 | 3300005718 | Bacteria | 2587 |
| 265 | Ga0068861_100002726 | 3300005719 | Bacteria | 11573 |
| 266 | Ga0068861_100005292 | 3300005719 | Bacteria | 8708 |
| 267 | Ga0068861_100027491 | 3300005719 | Bacteria | 4144 |
| 268 | Ga0068851_10000412 | 3300005834 | Bacteria | 19247 |
| 269 | Ga0068851_10001605 | 3300005834 | Bacteria | 9939 |
| 270 | Ga0068851_10007357 | 3300005834 | Bacteria | 5051 |
| 271 | Ga0068851_10007638 | 3300005834 | Bacteria | 4973 |
| 272 | Ga0068870_10037982 | 3300005840 | Bacteria | 2484 |
| 273 | Ga0068863_100002587 | 3300005841 | Bacteria | 17944 |
| 274 | Ga0068863_100004932 | 3300005841 | Bacteria | 13155 |
| 275 | Ga0068863_100021455 | 3300005841 | Bacteria | 6164 |
| 276 | Ga0068863_100022473 | 3300005841 | Bacteria | 6024 |
| 277 | Ga0068863_100050883 | 3300005841 | Bacteria | 3926 |
| 278 | Ga0068863_100055029 | 3300005841 | Bacteria | 3769 |
| 279 | Ga0068863_100111613 | 3300005841 | Bacteria | 2604 |
| 280 | Ga0068863_100214312 | 3300005841 | Bacteria | 1855 |
| 281 | Ga0068858_100001886 | 3300005842 | Bacteria | 21412 |
| 282 | Ga0068858_100012968 | 3300005842 | Bacteria | 7859 |
| 283 | Ga0068858_100014101 | 3300005842 | Bacteria | 7537 |
| 284 | Ga0068858_100023202 | 3300005842 | Bacteria | 5786 |
| 285 | Ga0068858_100058091 | 3300005842 | Bacteria | 3576 |
| 286 | Ga0068858_100224556 | 3300005842 | Bacteria | 1780 |
| 287 | Ga0068858_100226958 | 3300005842 | Bacteria | 1770 |
| 288 | Ga0068860_100002318 | 3300005843 | Bacteria | 20001 |
| 289 | Ga0068860_100004676 | 3300005843 | Bacteria | 13977 |
| 290 | Ga0068860_100014325 | 3300005843 | Bacteria | 7775 |
| 291 | Ga0068860_100017240 | 3300005843 | Bacteria | 7039 |
| 292 | Ga0068860_100026811 | 3300005843 | Bacteria | 5553 |
| 293 | Ga0068860_100027890 | 3300005843 | Bacteria | 5437 |
| 294 | Ga0068860_100083676 | 3300005843 | Bacteria | 3035 |
| 295 | Ga0068860_100132850 | 3300005843 | Bacteria | 2389 |
| 296 | Ga0068862_100014996 | 3300005844 | Bacteria | 6435 |
| 297 | Ga0068862_100023321 | 3300005844 | Bacteria | 5184 |
| 298 | Ga0068862_100107134 | 3300005844 | Unclassified | 2451 |
| 299 | Ga0081539_10011444 | 3300005985 | Bacteria | 7008 |
| 300 | Ga0075363_100008832 | 3300006048 | Bacteria | 4713 |
| 301 | Ga0070715_10013847 | 3300006163 | Bacteria | 2972 |
| 302 | Ga0070716_100010880 | 3300006173 | Bacteria | 4575 |
| 303 | Ga0070712_100067894 | 3300006175 | Bacteria | 2538 |
| 304 | Ga0075369_10021890 | 3300006186 | Bacteria | 2632 |
| 305 | Ga0075366_10000123 | 3300006195 | Bacteria | 32043 |
| 306 | Ga0075366_10001829 | 3300006195 | Bacteria | 10726 |
| 307 | Ga0075366_10014392 | 3300006195 | Bacteria | 4517 |
| 308 | Ga0097621_100000020 | 3300006237 | Bacteria | 86226 |
| 309 | Ga0097621_100015621 | 3300006237 | Bacteria | 5720 |
| 310 | Ga0097621_100037556 | 3300006237 | Bacteria | 3883 |
| 311 | Ga0097621_100045116 | 3300006237 | Bacteria | 3559 |
| 312 | Ga0097621_100066625 | 3300006237 | Bacteria | 2966 |
| 313 | Ga0097621_100081796 | 3300006237 | Bacteria | 2688 |
| 314 | Ga0097621_100171045 | 3300006237 | Bacteria | 1873 |
| 315 | Ga0075370_10020365 | 3300006353 | Bacteria | 3624 |
| 316 | Ga0075370_10028040 | 3300006353 | Bacteria | 3128 |
| 317 | Ga0068871_100000130 | 3300006358 | Bacteria | 47875 |
| 318 | Ga0068871_100003319 | 3300006358 | Bacteria | 11049 |
| 319 | Ga0068871_100014353 | 3300006358 | Bacteria | 5904 |
| 320 | Ga0068871_100050618 | 3300006358 | Bacteria | 3360 |
| 321 | Ga0068871_100166804 | 3300006358 | Bacteria | 1886 |
| 322 | Ga0075428_100019201 | 3300006844 | Bacteria | 7559 |
| 323 | Ga0075433_10023930 | 3300006852 | Bacteria | 5149 |
| 324 | Ga0075434_100046398 | 3300006871 | Bacteria | 4312 |
| 325 | Ga0075434_100234963 | 3300006871 | Bacteria | 1853 |
| 326 | Ga0068865_100000050 | 3300006881 | Bacteria | 65632 |
| 327 | Ga0068865_100011641 | 3300006881 | Bacteria | 5512 |
| 328 | Ga0068865_100046704 | 3300006881 | Bacteria | 2972 |
| 329 | Ga0068865_100060961 | 3300006881 | Bacteria | 2643 |
| 330 | Ga0068865_100081541 | 3300006881 | Bacteria | 2323 |
| 331 | Ga0097620_100001046 | 3300006931 | Bacteria | 28371 |
| 332 | Ga0097620_100003087 | 3300006931 | Bacteria | 16901 |
| 333 | Ga0097620_100014528 | 3300006931 | Bacteria | 7907 |
| 334 | Ga0097620_100040466 | 3300006931 | Bacteria | 4679 |
| 335 | Ga0097620_100119616 | 3300006931 | Bacteria | 2701 |
| 336 | Ga0097620_100147533 | 3300006931 | Bacteria | 2428 |
| 337 | Ga0097620_100161389 | 3300006931 | Bacteria | 2320 |
| 338 | Ga0075435_100095618 | 3300007076 | Bacteria | 2457 |
| 339 | Ga0105240_10003767 | 3300009093 | Bacteria | 23425 |
| 340 | Ga0105240_10005554 | 3300009093 | Bacteria | 18768 |
| 341 | Ga0105240_10014966 | 3300009093 | Bacteria | 10570 |
| 342 | Ga0105240_10034306 | 3300009093 | Bacteria | 6546 |
| 343 | Ga0105240_10045988 | 3300009093 | Bacteria | 5534 |
| 344 | Ga0105240_10084352 | 3300009093 | Bacteria | 3896 |
| 345 | Ga0105240_10110310 | 3300009093 | Bacteria | 3330 |
| 346 | Ga0105240_10144226 | 3300009093 | Bacteria | 2843 |
| 347 | Ga0105240_10188746 | 3300009093 | Bacteria | 2425 |
| 348 | Ga0105240_10258209 | 3300009093 | Bacteria | 2011 |
| 349 | Ga0111539_10002831 | 3300009094 | Bacteria | 23059 |
| 350 | Ga0111539_10032437 | 3300009094 | Bacteria | 6342 |
| 351 | Ga0111539_10091154 | 3300009094 | Bacteria | 3582 |
| 352 | Ga0111539_10235580 | 3300009094 | Bacteria | 2131 |
| 353 | Ga0105247_10003594 | 3300009101 | Bacteria | 10065 |
| 354 | Ga0105247_10108370 | 3300009101 | Bacteria | 1784 |
| 355 | Ga0105247_10126903 | 3300009101 | Bacteria | 1659 |
| 356 | Ga0114129_10252409 | 3300009147 | Bacteria | 2367 |
| 357 | Ga0114129_10478016 | 3300009147 | Unclassified | 1631 |
| 358 | Ga0105243_10051166 | 3300009148 | Bacteria | 3266 |
| 359 | Ga0105243_10160652 | 3300009148 | Bacteria | 1937 |
| 360 | Ga0105241_10004819 | 3300009174 | Bacteria | 9942 |
| 361 | Ga0105241_10005645 | 3300009174 | Bacteria | 9230 |
| 362 | Ga0105241_10017308 | 3300009174 | Bacteria | 5293 |
| 363 | Ga0105241_10112610 | 3300009174 | Bacteria | 2180 |
| 364 | Ga0105242_10004548 | 3300009176 | Bacteria | 10762 |
| 365 | Ga0105242_10006335 | 3300009176 | Bacteria | 9114 |
| 366 | Ga0105242_10029985 | 3300009176 | Bacteria | 4341 |
| 367 | Ga0105242_10059038 | 3300009176 | Bacteria | 3146 |
| 368 | Ga0105242_10066605 | 3300009176 | Bacteria | 2975 |
| 369 | Ga0105242_10104632 | 3300009176 | Bacteria | 2403 |
| 370 | Ga0105248_10004085 | 3300009177 | Bacteria | 16142 |
| 371 | Ga0105248_10031198 | 3300009177 | Bacteria | 5956 |
| 372 | Ga0105248_10031400 | 3300009177 | Bacteria | 5938 |
| 373 | Ga0105248_10038460 | 3300009177 | Bacteria | 5354 |
| 374 | Ga0105248_10076861 | 3300009177 | Bacteria | 3752 |
| 375 | Ga0105248_10148010 | 3300009177 | Bacteria | 2650 |
| 376 | Ga0105248_10153643 | 3300009177 | Bacteria | 2597 |
| 377 | Ga0105237_10000825 | 3300009545 | Bacteria | 42402 |
| 378 | Ga0105237_10003737 | 3300009545 | Bacteria | 17929 |
| 379 | Ga0105237_10007800 | 3300009545 | Bacteria | 11668 |
| 380 | Ga0105237_10021331 | 3300009545 | Bacteria | 6661 |
| 381 | Ga0105237_10164649 | 3300009545 | Bacteria | 2216 |
| 382 | Ga0105237_10229894 | 3300009545 | Bacteria | 1855 |
| 383 | Ga0105238_10000770 | 3300009551 | Bacteria | 33391 |
| 384 | Ga0105238_10012877 | 3300009551 | Bacteria | 8442 |
| 385 | Ga0105238_10020736 | 3300009551 | Bacteria | 6693 |
| 386 | Ga0105238_10027934 | 3300009551 | Bacteria | 5750 |
| 387 | Ga0105238_10034684 | 3300009551 | Bacteria | 5133 |
| 388 | Ga0105238_10073378 | 3300009551 | Bacteria | 3417 |
| 389 | Ga0105238_10076212 | 3300009551 | Bacteria | 3345 |
| 390 | Ga0105249_10005263 | 3300009553 | Bacteria | 11167 |
| 391 | Ga0105249_10027973 | 3300009553 | Bacteria | 5089 |
| 392 | Ga0105249_10046627 | 3300009553 | Bacteria | 3945 |
| 393 | Ga0105249_10077038 | 3300009553 | Bacteria | 3092 |
| 394 | Ga0105249_10078571 | 3300009553 | Bacteria | 3062 |
| 395 | Ga0105249_10080323 | 3300009553 | Bacteria | 3029 |
| 396 | Ga0105249_10097729 | 3300009553 | Bacteria | 2757 |
| 397 | Ga0105239_10000012 | 3300010375 | Bacteria | 332279 |
| 398 | Ga0105239_10000338 | 3300010375 | Eukaryota | 68574 |
| 399 | Ga0105239_10000445 | 3300010375 | Bacteria | 60337 |
| 400 | Ga0105239_10000959 | 3300010375 | Bacteria | 40551 |
| 401 | Ga0105239_10012429 | 3300010375 | Bacteria | 9481 |
| 402 | Ga0105246_10003919 | 3300011119 | Bacteria | 9013 |
| 403 | Ga0157373_10000824 | 3300013100 | Bacteria | 24025 |
| 404 | Ga0157373_10001101 | 3300013100 | Bacteria | 20720 |
| 405 | Ga0157373_10040852 | 3300013100 | Bacteria | 3319 |
| 406 | Ga0157371_10000769 | 3300013102 | Bacteria | 37033 |
| 407 | Ga0157370_10000522 | 3300013104 | Bacteria | 48150 |
| 408 | Ga0157370_10003726 | 3300013104 | Bacteria | 17814 |
| 409 | Ga0157370_10017198 | 3300013104 | Bacteria | 7298 |
| 410 | Ga0157370_10027183 | 3300013104 | Bacteria | 5641 |
| 411 | Ga0157370_10082959 | 3300013104 | Bacteria | 3014 |
| 412 | Ga0157370_10094760 | 3300013104 | Unclassified | 2801 |
| 413 | Ga0157370_10148029 | 3300013104 | Bacteria | 2186 |
| 414 | Ga0157369_10000281 | 3300013105 | Bacteria | 68061 |
| 415 | Ga0157369_10000568 | 3300013105 | Bacteria | 48608 |
| 416 | Ga0157369_10005788 | 3300013105 | Bacteria | 14370 |
| 417 | Ga0157369_10058853 | 3300013105 | Bacteria | 4144 |
| 418 | Ga0157369_10067179 | 3300013105 | Bacteria | 3855 |
| 419 | Ga0157374_10006271 | 3300013296 | Bacteria | 10083 |
| 420 | Ga0157374_10006780 | 3300013296 | Bacteria | 9737 |
| 421 | Ga0157374_10026513 | 3300013296 | Bacteria | 5215 |
| 422 | Ga0157378_10001597 | 3300013297 | Bacteria | 20503 |
| 423 | Ga0157378_10004383 | 3300013297 | Bacteria | 12424 |
| 424 | Ga0157378_10026461 | 3300013297 | Bacteria | 5114 |
| 425 | Ga0157378_10152183 | 3300013297 | Bacteria | 2156 |
| 426 | Ga0163162_10000031 | 3300013306 | Bacteria | 157666 |
| 427 | Ga0163162_10000079 | 3300013306 | Bacteria | 87796 |
| 428 | Ga0163162_10002191 | 3300013306 | Bacteria | 18337 |
| 429 | Ga0163162_10004531 | 3300013306 | Bacteria | 13382 |
| 430 | Ga0163162_10005913 | 3300013306 | Bacteria | 11836 |
| 431 | Ga0163162_10013456 | 3300013306 | Bacteria | 7986 |
| 432 | Ga0163162_10024376 | 3300013306 | Bacteria | 5970 |
| 433 | Ga0163162_10044343 | 3300013306 | Bacteria | 4454 |
| 434 | Ga0163162_10091772 | 3300013306 | Bacteria | 3120 |
| 435 | Ga0163162_10200815 | 3300013306 | Bacteria | 2122 |
| 436 | Ga0157372_10001380 | 3300013307 | Bacteria | 26204 |
| 437 | Ga0157372_10002075 | 3300013307 | Bacteria | 21762 |
| 438 | Ga0157372_10003847 | 3300013307 | Bacteria | 16131 |
| 439 | Ga0157372_10006187 | 3300013307 | Bacteria | 12722 |
| 440 | Ga0157372_10030627 | 3300013307 | Bacteria | 5887 |
| 441 | Ga0157372_10036384 | 3300013307 | Bacteria | 5426 |
| 442 | Ga0157372_10078295 | 3300013307 | Bacteria | 3735 |
| 443 | Ga0157372_10085796 | 3300013307 | Bacteria | 3572 |
| 444 | Ga0157372_10141702 | 3300013307 | Bacteria | 2770 |
| 445 | Ga0157372_10215931 | 3300013307 | Bacteria | 2223 |
| 446 | Ga0157372_10339433 | 3300013307 | Bacteria | 1750 |
| 447 | Ga0157375_10028086 | 3300013308 | Bacteria | 5268 |
| 448 | Ga0157375_10035889 | 3300013308 | Bacteria | 4737 |
| 449 | Ga0157375_10058934 | 3300013308 | Bacteria | 3801 |
| 450 | Ga0157375_10100030 | 3300013308 | Bacteria | 2979 |
| 451 | Ga0163163_10000609 | 3300014325 | Bacteria | 31134 |
| 452 | Ga0163163_10008102 | 3300014325 | Bacteria | 9311 |
| 453 | Ga0157380_10038733 | 3300014326 | Bacteria | 3703 |
| 454 | Ga0157380_10044508 | 3300014326 | Bacteria | 3480 |
| 455 | Ga0157380_10085690 | 3300014326 | Bacteria | 2586 |
| 456 | Ga0157377_10000027 | 3300014745 | Bacteria | 135472 |
| 457 | Ga0157377_10010784 | 3300014745 | Bacteria | 4536 |
| 458 | Ga0157379_10000542 | 3300014968 | Bacteria | 30483 |
| 459 | Ga0157379_10015208 | 3300014968 | Bacteria | 6748 |
| 460 | Ga0157379_10021537 | 3300014968 | Bacteria | 5707 |
| 461 | Ga0157379_10041350 | 3300014968 | Bacteria | 4115 |
| 462 | Ga0157376_10011627 | 3300014969 | Bacteria | 6497 |
| 463 | Ga0213872_10011644 | 3300021361 | Bacteria | 4159 |
| 464 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 465 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 466 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 467 | Ga0207425_1000606 | 3300025245 | Bacteria | 20792 |
| 468 | Ga0209646_1000079 | 3300025246 | Bacteria | 207677 |
| 469 | Ga0209026_1000067 | 3300025250 | Bacteria | 207677 |
| 470 | Ga0209026_1002264 | 3300025250 | Bacteria | 7374 |
| 471 | Ga0209026_1005965 | 3300025250 | Bacteria | 3117 |
| 472 | Ga0209759_1000056 | 3300025256 | Bacteria | 207677 |
| 473 | Ga0209129_1012446 | 3300025258 | Bacteria | 1951 |
| 474 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 475 | Ga0209565_1000041 | 3300025263 | Bacteria | 251081 |
| 476 | Ga0209565_1001982 | 3300025263 | Bacteria | 7988 |
| 477 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 478 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 479 | Ga0209130_1000184 | 3300025284 | Bacteria | 87817 |
| 480 | Ga0209675_1000475 | 3300025291 | Bacteria | 30742 |
| 481 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 482 | Ga0209676_1000106 | 3300025292 | Bacteria | 222576 |
| 483 | Ga0209676_1014775 | 3300025292 | Bacteria | 2915 |
| 484 | Ga0209758_1014977 | 3300025297 | Bacteria | 4059 |
| 485 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 486 | Ga0209050_1000174 | 3300025298 | Bacteria | 148871 |
| 487 | Ga0209050_1008176 | 3300025298 | Bacteria | 5662 |
| 488 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 489 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 490 | Ga0207426_1000174 | 3300025302 | Bacteria | 160877 |
| 491 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 492 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 493 | Ga0209257_1020329 | 3300025304 | Bacteria | 2459 |
| 494 | Ga0207697_10002484 | 3300025315 | Bacteria | 9538 |
| 495 | Ga0207697_10004396 | 3300025315 | Bacteria | 6737 |
| 496 | Ga0207656_10010315 | 3300025321 | Bacteria | 3497 |
| 497 | Ga0207682_10000872 | 3300025893 | Bacteria | 13986 |
| 498 | Ga0207692_10027736 | 3300025898 | Bacteria | 2670 |
| 499 | Ga0207692_10058672 | 3300025898 | Bacteria | 1984 |
| 500 | Ga0207710_10001205 | 3300025900 | Bacteria | 13124 |
| 501 | Ga0207710_10038614 | 3300025900 | Bacteria | 2111 |
| 502 | Ga0207688_10002060 | 3300025901 | Bacteria | 10803 |
| 503 | Ga0207680_10036518 | 3300025903 | Bacteria | 2830 |
| 504 | Ga0207647_10067083 | 3300025904 | Bacteria | 2175 |
| 505 | Ga0207699_10034066 | 3300025906 | Bacteria | 2884 |
| 506 | Ga0207699_10074873 | 3300025906 | Bacteria | 2081 |
| 507 | Ga0207645_10000082 | 3300025907 | Bacteria | 68372 |
| 508 | Ga0207645_10000187 | 3300025907 | Bacteria | 49829 |
| 509 | Ga0207645_10000236 | 3300025907 | Bacteria | 45713 |
| 510 | Ga0207645_10001311 | 3300025907 | Bacteria | 20435 |
| 511 | Ga0207645_10001481 | 3300025907 | Bacteria | 19198 |
| 512 | Ga0207645_10031874 | 3300025907 | Bacteria | 3389 |
| 513 | Ga0207645_10035348 | 3300025907 | Bacteria | 3208 |
| 514 | Ga0207643_10006462 | 3300025908 | Bacteria | 6275 |
| 515 | Ga0207643_10008272 | 3300025908 | Bacteria | 5585 |
| 516 | Ga0207643_10008938 | 3300025908 | Bacteria | 5380 |
| 517 | Ga0207643_10067522 | 3300025908 | Bacteria | 2052 |
| 518 | Ga0207705_10007947 | 3300025909 | Bacteria | 7783 |
| 519 | Ga0207705_10010917 | 3300025909 | Bacteria | 6595 |
| 520 | Ga0207705_10017406 | 3300025909 | Bacteria | 5148 |
| 521 | Ga0207705_10019332 | 3300025909 | Bacteria | 4871 |
| 522 | Ga0207705_10049358 | 3300025909 | Bacteria | 3029 |
| 523 | Ga0207705_10061838 | 3300025909 | Bacteria | 2705 |
| 524 | Ga0207705_10088854 | 3300025909 | Bacteria | 2261 |
| 525 | Ga0207684_10181762 | 3300025910 | Bacteria | 1813 |
| 526 | Ga0207654_10012971 | 3300025911 | Bacteria | 4276 |
| 527 | Ga0207654_10017869 | 3300025911 | Bacteria | 3716 |
| 528 | Ga0207707_10011841 | 3300025912 | Bacteria | 7586 |
| 529 | Ga0207707_10023414 | 3300025912 | Bacteria | 5402 |
| 530 | Ga0207695_10003570 | 3300025913 | Bacteria | 21781 |
| 531 | Ga0207695_10004522 | 3300025913 | Bacteria | 18923 |
| 532 | Ga0207695_10010199 | 3300025913 | Bacteria | 11523 |
| 533 | Ga0207695_10016238 | 3300025913 | Bacteria | 8725 |
| 534 | Ga0207695_10017725 | 3300025913 | Bacteria | 8267 |
| 535 | Ga0207695_10031694 | 3300025913 | Bacteria | 5793 |
| 536 | Ga0207695_10042315 | 3300025913 | Bacteria | 4867 |
| 537 | Ga0207695_10102674 | 3300025913 | Bacteria | 2852 |
| 538 | Ga0207671_10000909 | 3300025914 | Bacteria | 37375 |
| 539 | Ga0207671_10001801 | 3300025914 | Bacteria | 23958 |
| 540 | Ga0207671_10008467 | 3300025914 | Bacteria | 8720 |
| 541 | Ga0207671_10018195 | 3300025914 | Bacteria | 5399 |
| 542 | Ga0207671_10077548 | 3300025914 | Bacteria | 2488 |
| 543 | Ga0207671_10103266 | 3300025914 | Bacteria | 2161 |
| 544 | Ga0207693_10000760 | 3300025915 | Bacteria | 28971 |
| 545 | Ga0207663_10013281 | 3300025916 | Bacteria | 4473 |
| 546 | Ga0207660_10006497 | 3300025917 | Bacteria | 7586 |
| 547 | Ga0207660_10080985 | 3300025917 | Bacteria | 2385 |
| 548 | Ga0207662_10014415 | 3300025918 | Bacteria | 4435 |
| 549 | Ga0207662_10073023 | 3300025918 | Bacteria | 2080 |
| 550 | Ga0207657_10000102 | 3300025919 | Bacteria | 82096 |
| 551 | Ga0207657_10000250 | 3300025919 | Bacteria | 57310 |
| 552 | Ga0207657_10002028 | 3300025919 | Bacteria | 21896 |
| 553 | Ga0207657_10016616 | 3300025919 | Bacteria | 7090 |
| 554 | Ga0207657_10018911 | 3300025919 | Bacteria | 6558 |
| 555 | Ga0207657_10027081 | 3300025919 | Bacteria | 5255 |
| 556 | Ga0207657_10099976 | 3300025919 | Bacteria | 2409 |
| 557 | Ga0207649_10001379 | 3300025920 | Bacteria | 14389 |
| 558 | Ga0207652_10008684 | 3300025921 | Bacteria | 8180 |
| 559 | Ga0207652_10027143 | 3300025921 | Bacteria | 4771 |
| 560 | Ga0207652_10055805 | 3300025921 | Bacteria | 3399 |
| 561 | Ga0207652_10119563 | 3300025921 | Bacteria | 2343 |
| 562 | Ga0207646_10016930 | 3300025922 | Bacteria | 6831 |
| 563 | Ga0207681_10004744 | 3300025923 | Bacteria | 8366 |
| 564 | Ga0207681_10021097 | 3300025923 | Bacteria | 4136 |
| 565 | Ga0207681_10028877 | 3300025923 | Bacteria | 3596 |
| 566 | Ga0207681_10087616 | 3300025923 | Bacteria | 2215 |
| 567 | Ga0207681_10106951 | 3300025923 | Bacteria | 2028 |
| 568 | Ga0207681_10226336 | 3300025923 | Bacteria | 1449 |
| 569 | Ga0207694_10002414 | 3300025924 | Bacteria | 15283 |
| 570 | Ga0207694_10007634 | 3300025924 | Bacteria | 8197 |
| 571 | Ga0207694_10018342 | 3300025924 | Bacteria | 5289 |
| 572 | Ga0207694_10044308 | 3300025924 | Bacteria | 3436 |
| 573 | Ga0207694_10156686 | 3300025924 | Bacteria | 1837 |
| 574 | Ga0207650_10000970 | 3300025925 | Bacteria | 21577 |
| 575 | Ga0207650_10009000 | 3300025925 | Bacteria | 6825 |
| 576 | Ga0207650_10018802 | 3300025925 | Bacteria | 4852 |
| 577 | Ga0207650_10019115 | 3300025925 | Bacteria | 4814 |
| 578 | Ga0207650_10022018 | 3300025925 | Bacteria | 4510 |
| 579 | Ga0207650_10022544 | 3300025925 | Bacteria | 4457 |
| 580 | Ga0207650_10032323 | 3300025925 | Bacteria | 3784 |
| 581 | Ga0207650_10064471 | 3300025925 | Bacteria | 2743 |
| 582 | Ga0207650_10079964 | 3300025925 | Bacteria | 2477 |
| 583 | Ga0207650_10183160 | 3300025925 | Bacteria | 1670 |
| 584 | Ga0207650_10249774 | 3300025925 | Bacteria | 1436 |
| 585 | Ga0207659_10002664 | 3300025926 | Bacteria | 10637 |
| 586 | Ga0207659_10008086 | 3300025926 | Bacteria | 6511 |
| 587 | Ga0207659_10014884 | 3300025926 | Bacteria | 5028 |
| 588 | Ga0207659_10038287 | 3300025926 | Bacteria | 3335 |
| 589 | Ga0207659_10040531 | 3300025926 | Bacteria | 3257 |
| 590 | Ga0207659_10115840 | 3300025926 | Unclassified | 2045 |
| 591 | Ga0207687_10000552 | 3300025927 | Bacteria | 25163 |
| 592 | Ga0207700_10000062 | 3300025928 | Bacteria | 66509 |
| 593 | Ga0207700_10019091 | 3300025928 | Bacteria | 4624 |
| 594 | Ga0207700_10054328 | 3300025928 | Bacteria | 3006 |
| 595 | Ga0207664_10003534 | 3300025929 | Bacteria | 10432 |
| 596 | Ga0207664_10005137 | 3300025929 | Bacteria | 8918 |
| 597 | Ga0207664_10010398 | 3300025929 | Bacteria | 6571 |
| 598 | Ga0207664_10013527 | 3300025929 | Bacteria | 5862 |
| 599 | Ga0207644_10032653 | 3300025931 | Bacteria | 3633 |
| 600 | Ga0207644_10037870 | 3300025931 | Bacteria | 3394 |
| 601 | Ga0207644_10089063 | 3300025931 | Bacteria | 2296 |
| 602 | Ga0207644_10090970 | 3300025931 | Bacteria | 2274 |
| 603 | Ga0207690_10000595 | 3300025932 | Bacteria | 23415 |
| 604 | Ga0207690_10045915 | 3300025932 | Bacteria | 2889 |
| 605 | Ga0207690_10099276 | 3300025932 | Bacteria | 2075 |
| 606 | Ga0207706_10000095 | 3300025933 | Bacteria | 92378 |
| 607 | Ga0207706_10022684 | 3300025933 | Bacteria | 5635 |
| 608 | Ga0207686_10011655 | 3300025934 | Bacteria | 4821 |
| 609 | Ga0207686_10026430 | 3300025934 | Bacteria | 3385 |
| 610 | Ga0207686_10061509 | 3300025934 | Bacteria | 2381 |
| 611 | Ga0207709_10001223 | 3300025935 | Bacteria | 18456 |
| 612 | Ga0207709_10032528 | 3300025935 | Bacteria | 3054 |
| 613 | Ga0207709_10077200 | 3300025935 | Bacteria | 2134 |
| 614 | Ga0207670_10149621 | 3300025936 | Bacteria | 1731 |
| 615 | Ga0207669_10002060 | 3300025937 | Bacteria | 8514 |
| 616 | Ga0207669_10052043 | 3300025937 | Bacteria | 2457 |
| 617 | Ga0207669_10121256 | 3300025937 | Bacteria | 1775 |
| 618 | Ga0207704_10000078 | 3300025938 | Bacteria | 59491 |
| 619 | Ga0207704_10037386 | 3300025938 | Unclassified | 2804 |
| 620 | Ga0207704_10038157 | 3300025938 | Bacteria | 2783 |
| 621 | Ga0207691_10006527 | 3300025940 | Bacteria | 11259 |
| 622 | Ga0207691_10010905 | 3300025940 | Bacteria | 8722 |
| 623 | Ga0207691_10021256 | 3300025940 | Bacteria | 6130 |
| 624 | Ga0207691_10024249 | 3300025940 | Bacteria | 5706 |
| 625 | Ga0207691_10029828 | 3300025940 | Bacteria | 5100 |
| 626 | Ga0207691_10041548 | 3300025940 | Bacteria | 4244 |
| 627 | Ga0207711_10001126 | 3300025941 | Bacteria | 25546 |
| 628 | Ga0207711_10020081 | 3300025941 | Bacteria | 5568 |
| 629 | Ga0207689_10002780 | 3300025942 | Bacteria | 16182 |
| 630 | Ga0207689_10004782 | 3300025942 | Bacteria | 12211 |
| 631 | Ga0207689_10006891 | 3300025942 | Bacteria | 9992 |
| 632 | Ga0207689_10007391 | 3300025942 | Bacteria | 9634 |
| 633 | Ga0207689_10016125 | 3300025942 | Bacteria | 6326 |
| 634 | Ga0207689_10023567 | 3300025942 | Bacteria | 5163 |
| 635 | Ga0207689_10030481 | 3300025942 | Bacteria | 4495 |
| 636 | Ga0207689_10160463 | 3300025942 | Bacteria | 1853 |
| 637 | Ga0207661_10041304 | 3300025944 | Bacteria | 3630 |
| 638 | Ga0207661_10098691 | 3300025944 | Bacteria | 2448 |
| 639 | Ga0207679_10001787 | 3300025945 | Bacteria | 13382 |
| 640 | Ga0207679_10006374 | 3300025945 | Bacteria | 7455 |
| 641 | Ga0207679_10030983 | 3300025945 | Bacteria | 3740 |
| 642 | Ga0207679_10037421 | 3300025945 | Bacteria | 3449 |
| 643 | Ga0207679_10146619 | 3300025945 | Bacteria | 1915 |
| 644 | Ga0207667_10000233 | 3300025949 | Bacteria | 77272 |
| 645 | Ga0207667_10000705 | 3300025949 | Bacteria | 43375 |
| 646 | Ga0207667_10001584 | 3300025949 | Bacteria | 28609 |
| 647 | Ga0207667_10004358 | 3300025949 | Bacteria | 17337 |
| 648 | Ga0207667_10008512 | 3300025949 | Bacteria | 12184 |
| 649 | Ga0207667_10018252 | 3300025949 | Bacteria | 7874 |
| 650 | Ga0207667_10027515 | 3300025949 | Bacteria | 6187 |
| 651 | Ga0207667_10036751 | 3300025949 | Bacteria | 5244 |
| 652 | Ga0207667_10058793 | 3300025949 | Bacteria | 4030 |
| 653 | Ga0207667_10149130 | 3300025949 | Bacteria | 2407 |
| 654 | Ga0207651_10001337 | 3300025960 | Bacteria | 11142 |
| 655 | Ga0207651_10006913 | 3300025960 | Bacteria | 5996 |
| 656 | Ga0207651_10010722 | 3300025960 | Bacteria | 5092 |
| 657 | Ga0207651_10012678 | 3300025960 | Bacteria | 4783 |
| 658 | Ga0207651_10233576 | 3300025960 | Bacteria | 1494 |
| 659 | Ga0207712_10003182 | 3300025961 | Bacteria | 10446 |
| 660 | Ga0207712_10123887 | 3300025961 | Bacteria | 1960 |
| 661 | Ga0207712_10128352 | 3300025961 | Bacteria | 1928 |
| 662 | Ga0207712_10189107 | 3300025961 | Bacteria | 1624 |
| 663 | Ga0207668_10002618 | 3300025972 | Bacteria | 10531 |
| 664 | Ga0207668_10004388 | 3300025972 | Bacteria | 8288 |
| 665 | Ga0207668_10011989 | 3300025972 | Bacteria | 5290 |
| 666 | Ga0207668_10024116 | 3300025972 | Bacteria | 3921 |
| 667 | Ga0207668_10060088 | 3300025972 | Bacteria | 2666 |
| 668 | Ga0207668_10162627 | 3300025972 | Bacteria | 1741 |
| 669 | Ga0207668_10205139 | 3300025972 | Bacteria | 1572 |
| 670 | Ga0207640_10010179 | 3300025981 | Bacteria | 5286 |
| 671 | Ga0207658_10001572 | 3300025986 | Bacteria | 17671 |
| 672 | Ga0207658_10012856 | 3300025986 | Bacteria | 5716 |
| 673 | Ga0207658_10025138 | 3300025986 | Bacteria | 4169 |
| 674 | Ga0207658_10025183 | 3300025986 | Bacteria | 4166 |
| 675 | Ga0207658_10031367 | 3300025986 | Bacteria | 3772 |
| 676 | Ga0207658_10036305 | 3300025986 | Bacteria | 3532 |
| 677 | Ga0207677_10000920 | 3300026023 | Bacteria | 16454 |
| 678 | Ga0207677_10001799 | 3300026023 | Bacteria | 11327 |
| 679 | Ga0207677_10008911 | 3300026023 | Bacteria | 5627 |
| 680 | Ga0207677_10015988 | 3300026023 | Bacteria | 4430 |
| 681 | Ga0207677_10019733 | 3300026023 | Bacteria | 4078 |
| 682 | Ga0207677_10112194 | 3300026023 | Bacteria | 2033 |
| 683 | Ga0207703_10000552 | 3300026035 | Bacteria | 38477 |
| 684 | Ga0207703_10001501 | 3300026035 | Bacteria | 21293 |
| 685 | Ga0207703_10006522 | 3300026035 | Bacteria | 9310 |
| 686 | Ga0207639_10005745 | 3300026041 | Bacteria | 8401 |
| 687 | Ga0207639_10016661 | 3300026041 | Bacteria | 5204 |
| 688 | Ga0207639_10032517 | 3300026041 | Bacteria | 3841 |
| 689 | Ga0207639_10036184 | 3300026041 | Bacteria | 3657 |
| 690 | Ga0207639_10050189 | 3300026041 | Bacteria | 3168 |
| 691 | Ga0207639_10095735 | 3300026041 | Bacteria | 2387 |
| 692 | Ga0207678_10001717 | 3300026067 | Bacteria | 20059 |
| 693 | Ga0207678_10003576 | 3300026067 | Bacteria | 13974 |
| 694 | Ga0207678_10004513 | 3300026067 | Bacteria | 12518 |
| 695 | Ga0207678_10029877 | 3300026067 | Bacteria | 4759 |
| 696 | Ga0207678_10052267 | 3300026067 | Bacteria | 3525 |
| 697 | Ga0207708_10000558 | 3300026075 | Bacteria | 28801 |
| 698 | Ga0207708_10181432 | 3300026075 | Bacteria | 1671 |
| 699 | Ga0207702_10003371 | 3300026078 | Bacteria | 14642 |
| 700 | Ga0207702_10003800 | 3300026078 | Bacteria | 13634 |
| 701 | Ga0207702_10010094 | 3300026078 | Bacteria | 7912 |
| 702 | Ga0207702_10043463 | 3300026078 | Bacteria | 3772 |
| 703 | Ga0207702_10122347 | 3300026078 | Bacteria | 2330 |
| 704 | Ga0207702_10159297 | 3300026078 | Bacteria | 2060 |
| 705 | Ga0207702_10286126 | 3300026078 | Bacteria | 1560 |
| 706 | Ga0207641_10007772 | 3300026088 | Bacteria | 8909 |
| 707 | Ga0207641_10035457 | 3300026088 | Bacteria | 4156 |
| 708 | Ga0207641_10037317 | 3300026088 | Bacteria | 4057 |
| 709 | Ga0207641_10103170 | 3300026088 | Bacteria | 2515 |
| 710 | Ga0207648_10000119 | 3300026089 | Bacteria | 76875 |
| 711 | Ga0207648_10000472 | 3300026089 | Bacteria | 44933 |
| 712 | Ga0207648_10000556 | 3300026089 | Bacteria | 41762 |
| 713 | Ga0207648_10001526 | 3300026089 | Bacteria | 25504 |
| 714 | Ga0207648_10004701 | 3300026089 | Bacteria | 13958 |
| 715 | Ga0207648_10011983 | 3300026089 | Bacteria | 8138 |
| 716 | Ga0207648_10015531 | 3300026089 | Bacteria | 6999 |
| 717 | Ga0207648_10048260 | 3300026089 | Bacteria | 3728 |
| 718 | Ga0207648_10064564 | 3300026089 | Bacteria | 3191 |
| 719 | Ga0207648_10163491 | 3300026089 | Bacteria | 1966 |
| 720 | Ga0207648_10171863 | 3300026089 | Bacteria | 1916 |
| 721 | Ga0207676_10001004 | 3300026095 | Bacteria | 21721 |
| 722 | Ga0207676_10004363 | 3300026095 | Bacteria | 10005 |
| 723 | Ga0207676_10032326 | 3300026095 | Bacteria | 3942 |
| 724 | Ga0207676_10048121 | 3300026095 | Bacteria | 3308 |
| 725 | Ga0207674_10000131 | 3300026116 | Bacteria | 88017 |
| 726 | Ga0207674_10000326 | 3300026116 | Bacteria | 60670 |
| 727 | Ga0207674_10017466 | 3300026116 | Bacteria | 7828 |
| 728 | Ga0207674_10022792 | 3300026116 | Bacteria | 6719 |
| 729 | Ga0207674_10042261 | 3300026116 | Bacteria | 4709 |
| 730 | Ga0207674_10108472 | 3300026116 | Bacteria | 2753 |
| 731 | Ga0207674_10161699 | 3300026116 | Bacteria | 2193 |
| 732 | Ga0207675_100002028 | 3300026118 | Bacteria | 20196 |
| 733 | Ga0207675_100002315 | 3300026118 | Bacteria | 18913 |
| 734 | Ga0207675_100008094 | 3300026118 | Bacteria | 9904 |
| 735 | Ga0207675_100008796 | 3300026118 | Bacteria | 9478 |
| 736 | Ga0207675_100032329 | 3300026118 | Bacteria | 4874 |
| 737 | Ga0207675_100044359 | 3300026118 | Bacteria | 4155 |
| 738 | Ga0207675_100058741 | 3300026118 | Bacteria | 3589 |
| 739 | Ga0207675_100308287 | 3300026118 | Bacteria | 1543 |
| 740 | Ga0207683_10000012 | 3300026121 | Bacteria | 134768 |
| 741 | Ga0207683_10001281 | 3300026121 | Bacteria | 22746 |
| 742 | Ga0207683_10001576 | 3300026121 | Bacteria | 20549 |
| 743 | Ga0207683_10003558 | 3300026121 | Bacteria | 13588 |
| 744 | Ga0207683_10006324 | 3300026121 | Bacteria | 10144 |
| 745 | Ga0207683_10019276 | 3300026121 | Bacteria | 5823 |
| 746 | Ga0207683_10034960 | 3300026121 | Bacteria | 4370 |
| 747 | Ga0207683_10077352 | 3300026121 | Bacteria | 2947 |
| 748 | Ga0207698_10000838 | 3300026142 | Bacteria | 17827 |
| 749 | Ga0207698_10006574 | 3300026142 | Bacteria | 7267 |
| 750 | Ga0207698_10015942 | 3300026142 | Bacteria | 5053 |
| 751 | Ga0207698_10021702 | 3300026142 | Bacteria | 4447 |
| 752 | Ga0207698_10112859 | 3300026142 | Bacteria | 2282 |
| 753 | Ga0207698_10126681 | 3300026142 | Bacteria | 2173 |
| 754 | Ga0207698_10128261 | 3300026142 | Bacteria | 2162 |
| 755 | Ga0209974_10001061 | 3300027876 | Bacteria | 9744 |
| 756 | Ga0209974_10007612 | 3300027876 | Bacteria | 3729 |
| 757 | Ga0207428_10004733 | 3300027907 | Bacteria | 12873 |
| 758 | Ga0207428_10116849 | 3300027907 | Bacteria | 2048 |
| 759 | Ga0268266_10000052 | 3300028379 | Bacteria | 296230 |
| 760 | Ga0268266_10018595 | 3300028379 | Bacteria | 5921 |
| 761 | Ga0268266_10018981 | 3300028379 | Bacteria | 5858 |
| 762 | Ga0268266_10030890 | 3300028379 | Bacteria | 4549 |
| 763 | Ga0268266_10039317 | 3300028379 | Bacteria | 4029 |
| 764 | Ga0268266_10047691 | 3300028379 | Bacteria | 3671 |
| 765 | Ga0268266_10083863 | 3300028379 | Bacteria | 2782 |
| 766 | Ga0268265_10012369 | 3300028380 | Bacteria | 5783 |
| 767 | Ga0268265_10016989 | 3300028380 | Bacteria | 5010 |
| 768 | Ga0268265_10100793 | 3300028380 | Bacteria | 2332 |
| 769 | Ga0268264_10000940 | 3300028381 | Bacteria | 30212 |
| 770 | Ga0268264_10001989 | 3300028381 | Bacteria | 18378 |
| 771 | Ga0268264_10002657 | 3300028381 | Bacteria | 15612 |
| 772 | Ga0268264_10008226 | 3300028381 | Bacteria | 8661 |
| 773 | Ga0268264_10010679 | 3300028381 | Bacteria | 7587 |
| 774 | Ga0268264_10028337 | 3300028381 | Bacteria | 4581 |
| 775 | Ga0268264_10069973 | 3300028381 | Bacteria | 2969 |
| 776 | Ga0307517_10001280 | 3300028786 | Bacteria | 42200 |
| 777 | Ga0307517_10009075 | 3300028786 | Bacteria | 14168 |
| 778 | Ga0307515_10000049 | 3300028794 | Bacteria | 278611 |
| 779 | Ga0307515_10000066 | 3300028794 | Bacteria | 244076 |
| 780 | Ga0307515_10000235 | 3300028794 | Bacteria | 136714 |
| 781 | Ga0307515_10000280 | 3300028794 | Bacteria | 125330 |
| 782 | Ga0307515_10000677 | 3300028794 | Bacteria | 78511 |
| 783 | Ga0307515_10009043 | 3300028794 | Bacteria | 19330 |
| 784 | Ga0307515_10011749 | 3300028794 | Bacteria | 16569 |
| 785 | Ga0307515_10059324 | 3300028794 | Bacteria | 5485 |
| 786 | Ga0307515_10124420 | 3300028794 | Bacteria | 2893 |
| 787 | Ga0307515_10190574 | 3300028794 | Bacteria | 1962 |
| 788 | Ga0307512_10038887 | 3300030522 | Bacteria | 3994 |
| 789 | Ga0265330_10003071 | 3300031235 | Bacteria | 8842 |
| 790 | Ga0265332_10003672 | 3300031238 | Bacteria | 7352 |
| 791 | Ga0265329_10003353 | 3300031242 | Bacteria | 7007 |
| 792 | Ga0265331_10000350 | 3300031250 | Bacteria | 48905 |
| 793 | Ga0265331_10039013 | 3300031250 | Bacteria | 2318 |
| 794 | Ga0265327_10004829 | 3300031251 | Bacteria | 11681 |
| 795 | Ga0265316_10013413 | 3300031344 | Bacteria | 7285 |
| 796 | Ga0307513_10002838 | 3300031456 | Bacteria | 23744 |
| 797 | Ga0307513_10011393 | 3300031456 | Bacteria | 11054 |
| 798 | Ga0307513_10019123 | 3300031456 | Bacteria | 8162 |
| 799 | Ga0307513_10019469 | 3300031456 | Bacteria | 8080 |
| 800 | Ga0307509_10000092 | 3300031507 | Bacteria | 124019 |
| 801 | Ga0307509_10015252 | 3300031507 | Bacteria | 8979 |
| 802 | Ga0307509_10016290 | 3300031507 | Bacteria | 8606 |
| 803 | Ga0307509_10044965 | 3300031507 | Bacteria | 4766 |
| 804 | Ga0307509_10047364 | 3300031507 | Bacteria | 4625 |
| 805 | Ga0307408_100001131 | 3300031548 | Bacteria | 20283 |
| 806 | Ga0307408_100005330 | 3300031548 | Bacteria | 8614 |
| 807 | Ga0307408_100007432 | 3300031548 | Bacteria | 7248 |
| 808 | Ga0307408_100052524 | 3300031548 | Bacteria | 2940 |
| 809 | Ga0307408_100059444 | 3300031548 | Bacteria | 2782 |
| 810 | Ga0307508_10001131 | 3300031616 | Bacteria | 30761 |
| 811 | Ga0307508_10109760 | 3300031616 | Bacteria | 2358 |
| 812 | Ga0265314_10001584 | 3300031711 | Bacteria | 25021 |
| 813 | Ga0265342_10041722 | 3300031712 | Bacteria | 2776 |
| 814 | Ga0307516_10000921 | 3300031730 | Bacteria | 40429 |
| 815 | Ga0307516_10001323 | 3300031730 | Bacteria | 34352 |
| 816 | Ga0307516_10120851 | 3300031730 | Bacteria | 2409 |
| 817 | Ga0307405_10008967 | 3300031731 | Bacteria | 5105 |
| 818 | Ga0307405_10105626 | 3300031731 | Bacteria | 1897 |
| 819 | Ga0307413_10001173 | 3300031824 | Bacteria | 9644 |
| 820 | Ga0307413_10035218 | 3300031824 | Bacteria | 2869 |
| 821 | Ga0307410_10008853 | 3300031852 | Bacteria | 5612 |
| 822 | Ga0307410_10013766 | 3300031852 | Bacteria | 4733 |
| 823 | Ga0307410_10058711 | 3300031852 | Bacteria | 2624 |
| 824 | Ga0307406_10004113 | 3300031901 | Bacteria | 7923 |
| 825 | Ga0307406_10004418 | 3300031901 | Bacteria | 7648 |
| 826 | Ga0307406_10074750 | 3300031901 | Bacteria | 2232 |
| 827 | Ga0307407_10021580 | 3300031903 | Bacteria | 3324 |
| 828 | Ga0307407_10037837 | 3300031903 | Bacteria | 2669 |
| 829 | Ga0307407_10129347 | 3300031903 | Bacteria | 1613 |
| 830 | Ga0307412_10016336 | 3300031911 | Bacteria | 4420 |
| 831 | Ga0307412_10103529 | 3300031911 | Bacteria | 2018 |
| 832 | Ga0307409_100005685 | 3300031995 | Bacteria | 7223 |
| 833 | Ga0307409_100046025 | 3300031995 | Bacteria | 3299 |
| 834 | Ga0307409_100250363 | 3300031995 | Bacteria | 1619 |
| 835 | Ga0307416_100017421 | 3300032002 | Bacteria | 5027 |
| 836 | Ga0307416_100019985 | 3300032002 | Bacteria | 4765 |
| 837 | Ga0307416_100030432 | 3300032002 | Bacteria | 4050 |
| 838 | Ga0307416_100151834 | 3300032002 | Bacteria | 2125 |
| 839 | Ga0307416_100263563 | 3300032002 | Bacteria | 1686 |
| 840 | Ga0307414_10012317 | 3300032004 | Bacteria | 5051 |
| 841 | Ga0307414_10042884 | 3300032004 | Bacteria | 3078 |
| 842 | Ga0307411_10001216 | 3300032005 | Bacteria | 10214 |
| 843 | Ga0307411_10060779 | 3300032005 | Bacteria | 2511 |
| 844 | Ga0307415_100002867 | 3300032126 | Bacteria | 8630 |
| 845 | Ga0307507_10000217 | 3300033179 | Bacteria | 109884 |
| 846 | Ga0307510_10001210 | 3300033180 | Bacteria | 27978 |
| 847 | Ga0307510_10027199 | 3300033180 | Bacteria | 6558 |
| 848 | Ga0307510_10079750 | 3300033180 | Bacteria | 3189 |
| 849 | Ga0373945_0025515 | 3300035116 | Bacteria | 2053 |
| 850 | Ga0373954_0012036 | 3300035118 | Bacteria | 3843 |
| 851 | Ga0373954_0029844 | 3300035118 | Bacteria | 2514 |
| 852 | Ga0373956_0027392 | 3300035119 | Bacteria | 2474 |
| 853 | Ga0373956_0032161 | 3300035119 | Bacteria | 2301 |
| 854 | Ga0373946_0011199 | 3300035171 | Bacteria | 3340 |
| 855 | Ga0373955_0092522 | 3300035172 | Bacteria | 1725 |
| 856 | Ga0373955_0093529 | 3300035172 | Bacteria | 1717 |
| 857 | Ga0373927_0018467 | 3300035695 | Bacteria | 4584 |
| 858 | Ga0373927_0158275 | 3300035695 | Bacteria | 1484 |
| 859 | Ga0373947_0019442 | 3300035725 | Bacteria | 3916 |
| 860 | Ga0373947_0068505 | 3300035725 | Bacteria | 2170 |
| 861 | Ga0373937_0023395 | 3300036401 | Bacteria | 5562 |
| 862 | Ga0373937_0057372 | 3300036401 | Bacteria | 3577 |
| 863 | Ga0373937_0101627 | 3300036401 | Bacteria | 2668 |
| 864 | Ga0373925_0045867 | 3300037068 | Bacteria | 3248 |
| 865 | Ga0373925_0057056 | 3300037068 | Bacteria | 2925 |
| 866 | Ga0373925_0087968 | 3300037068 | Bacteria | 2372 |
| 867 | Ga0395899_0000312 | 3300037312 | Bacteria | 62304 |
| 868 | Ga0395899_0005024 | 3300037312 | Bacteria | 10283 |
| 869 | Ga0395899_0033049 | 3300037312 | Bacteria | 3887 |
| 870 | Ga0395899_0037244 | 3300037312 | Bacteria | 3647 |
| 871 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 872 | Ga0395900_0016070 | 3300037418 | Bacteria | 7627 |
| 873 | Ga0395900_0024174 | 3300037418 | Bacteria | 6221 |
| 874 | Ga0395900_0037247 | 3300037418 | Bacteria | 5017 |
| 875 | Ga0395900_0055217 | 3300037418 | Bacteria | 4090 |
| 876 | Ga0395898_0011650 | 3300037466 | Bacteria | 9123 |
| 877 | Ga0395898_0016629 | 3300037466 | Bacteria | 7518 |
| 878 | Ga0395898_0022644 | 3300037466 | Bacteria | 6361 |
| 879 | Ga0395898_0029647 | 3300037466 | Bacteria | 5477 |
| 880 | Ga0395905_0000037 | 3300037471 | Bacteria | 261808 |
| 881 | Ga0395905_0000047 | 3300037471 | Bacteria | 237582 |
| 882 | Ga0395905_0003737 | 3300037471 | Bacteria | 16126 |
| 883 | Ga0395905_0005966 | 3300037471 | Bacteria | 12339 |
| 884 | Ga0395905_0037922 | 3300037471 | Bacteria | 4522 |
| 885 | Ga0395905_0051808 | 3300037471 | Bacteria | 3844 |
| 886 | Ga0395905_0051833 | 3300037471 | Bacteria | 3843 |
| 887 | Ga0395905_0070888 | 3300037471 | Bacteria | 3266 |
| 888 | Ga0395905_0077091 | 3300037471 | Bacteria | 3123 |
| 889 | Ga0395901_0000166 | 3300038443 | Bacteria | 86352 |
| 890 | Ga0395901_0022451 | 3300038443 | Bacteria | 6468 |
| 891 | Ga0395901_0026677 | 3300038443 | Bacteria | 5931 |
| 892 | Ga0395901_0158562 | 3300038443 | Bacteria | 2376 |
| 893 | Ga0436361_0101055 | 3300039447 | Bacteria | 5085 |
| 894 | Ga0436361_0387461 | 3300039447 | Bacteria | 4040 |
| 895 | Ga0436361_0602515 | 3300039447 | Bacteria | 4188 |
| 896 | Ga0451807_2046709 | 3300041486 | Bacteria | 1849 |
| 897 | Ga0439442_006759 | 3300042002 | Bacteria | 2303 |
| 898 | Ga0439449_0001337 | 3300042007 | Bacteria | 9659 |
| 899 | Ga0439450_015383 | 3300042008 | Bacteria | 1566 |
| 900 | Ga0439434_0009633 | 3300042435 | Bacteria | 2842 |
| 901 | Ga0439464_0010067 | 3300042439 | Bacteria | 2494 |
| 902 | Ga0451577_0003837 | 3300042876 | Bacteria | 16345 |
| 903 | Ga0451577_0004801 | 3300042876 | Bacteria | 14114 |
| 904 | Ga0451577_0018853 | 3300042876 | Bacteria | 6351 |
| 905 | Ga0451577_0031085 | 3300042876 | Bacteria | 4819 |
| 906 | Ga0451577_0126793 | 3300042876 | Bacteria | 2287 |
| 907 | Ga0451577_0205636 | 3300042876 | Bacteria | 1777 |
| 908 | Ga0466969_0023280 | 3300044656 | Bacteria | 3192 |
| 909 | Ga0466969_0066378 | 3300044656 | Bacteria | 1742 |
| 910 | Ga0453683_0001373 | 3300044673 | Bacteria | 21220 |
| 911 | Ga0453683_0004216 | 3300044673 | Bacteria | 10280 |
| 912 | Ga0466966_0004622 | 3300044684 | Bacteria | 9070 |
| 913 | Ga0466961_0046472 | 3300044693 | Bacteria | 2776 |
| 914 | Ga0453684_0091081 | 3300044712 | Bacteria | 3765 |
| 915 | Ga0453684_0152158 | 3300044712 | Bacteria | 2748 |
| 916 | Ga0453684_0166848 | 3300044712 | Bacteria | 2598 |
| 917 | Ga0453684_0243052 | 3300044712 | Bacteria | 2071 |
| 918 | Ga0466957_0004733 | 3300044842 | Bacteria | 7622 |
| 919 | Ga0466957_0018659 | 3300044842 | Bacteria | 4075 |
| 920 | Ga0466959_0067260 | 3300045049 | Bacteria | 2598 |
| 921 | Ga0451576_0001526 | 3300045051 | Bacteria | 38976 |
| 922 | Ga0451576_0002571 | 3300045051 | Bacteria | 26734 |
| 923 | Ga0451576_0012222 | 3300045051 | Bacteria | 9671 |
| 924 | Ga0451576_0024684 | 3300045051 | Bacteria | 6489 |
| 925 | Ga0451576_0047462 | 3300045051 | Bacteria | 4515 |
| 926 | Ga0451576_0083326 | 3300045051 | Bacteria | 3327 |
| 927 | Ga0451576_0155382 | 3300045051 | Bacteria | 2386 |
| 928 | Ga0451576_0204142 | 3300045051 | Bacteria | 2064 |
| 929 | Ga0466967_0078750 | 3300045976 | Bacteria | 2970 |
| 930 | Ga0495592_0000647 | 3300046454 | Bacteria | 24156 |
| 931 | Ga0495629_0089218 | 3300046459 | Bacteria | 2151 |
| 932 | Ga0495651_0064769 | 3300046462 | Bacteria | 2793 |
| 933 | Ga0495651_0152253 | 3300046462 | Bacteria | 1666 |
| 934 | Ga0495650_0000087 | 3300046471 | Bacteria | 234870 |
| 935 | Ga0495650_0021968 | 3300046471 | Bacteria | 3069 |
| 936 | Ga0495662_0004418 | 3300046476 | Bacteria | 7060 |
| 937 | Ga0495585_0000167 | 3300046492 | Bacteria | 70874 |
| 938 | Ga0495585_0004197 | 3300046492 | Bacteria | 9409 |
| 939 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 940 | Ga0495606_0010890 | 3300046507 | Bacteria | 7486 |
| 941 | Ga0495610_0007675 | 3300046512 | Bacteria | 7124 |
| 942 | Ga0495610_0023176 | 3300046512 | Bacteria | 3381 |
| 943 | Ga0495616_0001285 | 3300046513 | Bacteria | 17645 |
| 944 | Ga0495616_0005065 | 3300046513 | Bacteria | 8195 |
| 945 | Ga0495628_0132189 | 3300046516 | Bacteria | 1908 |
| 946 | Ga0495643_0024523 | 3300046522 | Bacteria | 3420 |
| 947 | Ga0495648_0002287 | 3300046524 | Bacteria | 17883 |
| 948 | Ga0495665_0042231 | 3300046531 | Bacteria | 2427 |
| 949 | Ga0495587_0016567 | 3300046536 | Bacteria | 4585 |
| 950 | Ga0495645_0013509 | 3300046543 | Bacteria | 5776 |
| 951 | Ga0495645_0110622 | 3300046543 | Bacteria | 1944 |
| 952 | Ga0495633_0000029 | 3300046558 | Bacteria | 200381 |
| 953 | Ga0495633_0003966 | 3300046558 | Bacteria | 9612 |
| 954 | Ga0495633_0063742 | 3300046558 | Bacteria | 1724 |
| 955 | Ga0495667_0102154 | 3300046559 | Bacteria | 1854 |
| 956 | Ga0495668_0000012 | 3300046616 | Bacteria | 458817 |
| 957 | Ga0495625_0000008 | 3300046660 | Bacteria | 536165 |
| 958 | Ga0495625_0000817 | 3300046660 | Bacteria | 42929 |
| 959 | Ga0495625_0003937 | 3300046660 | Bacteria | 14273 |
| 960 | Ga0495625_0071820 | 3300046660 | Bacteria | 2428 |
| 961 | Ga0495635_0013743 | 3300046663 | Bacteria | 5665 |
| 962 | Ga0495661_0000511 | 3300046665 | Bacteria | 40405 |
| 963 | Ga0495661_0016001 | 3300046665 | Bacteria | 4986 |
| 964 | Ga0495657_0036134 | 3300046675 | Bacteria | 3417 |
| 965 | Ga0495599_0000518 | 3300046678 | Bacteria | 22134 |
| 966 | Ga0495623_0074316 | 3300046679 | Bacteria | 2112 |
| 967 | Ga0495646_0030491 | 3300046680 | Bacteria | 3368 |
| 968 | Ga0495647_0021925 | 3300046681 | Bacteria | 2304 |
| 969 | Ga0495658_0093000 | 3300046683 | Bacteria | 1788 |
| 970 | Ga0495613_0017437 | 3300046689 | Bacteria | 5347 |
| 971 | Ga0495671_0020496 | 3300046692 | Bacteria | 3483 |
| 972 | Ga0495649_0000018 | 3300046694 | Bacteria | 220586 |
| 973 | Ga0495649_0003733 | 3300046694 | Bacteria | 10126 |
| 974 | Ga0495660_0009229 | 3300046810 | Bacteria | 5765 |
| 975 | Ga0495660_0011718 | 3300046810 | Bacteria | 5085 |
| 976 | Ga0495581_0001231 | 3300047315 | Bacteria | 14106 |
| 977 | Ga0495672_0006515 | 3300047320 | Bacteria | 9013 |
| 978 | Ga0495687_000972 | 3300047443 | Bacteria | 29181 |
| 979 | Ga0495687_006509 | 3300047443 | Bacteria | 7139 |
| 980 | Ga0495684_0114587 | 3300047471 | Bacteria | 2032 |
| 981 | Ga0495684_0135189 | 3300047471 | Bacteria | 1850 |
| 982 | Ga0495686_0000052 | 3300047472 | Bacteria | 262622 |
| 983 | Ga0495686_0016918 | 3300047472 | Bacteria | 4928 |
| 984 | Ga0495593_0043130 | 3300047673 | Bacteria | 2419 |
| 985 | Ga0495602_0162242 | 3300048088 | Bacteria | 1744 |
| 986 | Ga0495614_0042691 | 3300048089 | Bacteria | 1944 |
| 987 | Ga0495626_0019083 | 3300048091 | Bacteria | 3432 |
| 988 | Ga0495626_0030834 | 3300048091 | Bacteria | 2584 |
| 989 | Ga0496100_0113080 | 3300048903 | Bacteria | 1889 |
| 990 | Ga0496101_0037780 | 3300048904 | Bacteria | 3427 |
| 991 | Ga0496104_0026942 | 3300048907 | Bacteria | 5314 |
| 992 | Ga0496104_0214547 | 3300048907 | Bacteria | 1836 |
| 993 | Ga0496105_0118888 | 3300048908 | Bacteria | 2180 |
| 994 | Ga0496106_0012494 | 3300048909 | Bacteria | 6272 |
| 995 | Ga0496107_0011591 | 3300048910 | Bacteria | 6145 |
| 996 | Ga0496107_0109398 | 3300048910 | Bacteria | 2030 |
| 997 | Ga0496108_0005893 | 3300048911 | Bacteria | 9933 |
| 998 | Ga0496108_0099821 | 3300048911 | Bacteria | 2475 |
| 999 | Ga0496109_0006900 | 3300048912 | Bacteria | 9579 |
| 1000 | Ga0496109_0029081 | 3300048912 | Bacteria | 4947 |
| 1001 | Ga0496110_0137183 | 3300048913 | Bacteria | 2211 |
| 1002 | Ga0496110_0137968 | 3300048913 | Bacteria | 2205 |
| 1003 | Ga0496111_0042368 | 3300048914 | Bacteria | 3269 |
| 1004 | Ga0496112_0000236 | 3300048915 | Bacteria | 35432 |
| 1005 | Ga0496112_0023002 | 3300048915 | Bacteria | 5947 |
| 1006 | Ga0496115_0040835 | 3300048918 | Bacteria | 3690 |
| 1007 | Ga0496116_0070112 | 3300048919 | Bacteria | 2226 |
| 1008 | Ga0495678_003683 | 3300049459 | Bacteria | 9280 |
| 1009 | Ga0501042_0101295 | 3300049578 | Bacteria | 2071 |
| 1010 | Ga0501043_0000020 | 3300049579 | Bacteria | 155270 |
| 1011 | Ga0501046_0000039 | 3300049580 | Bacteria | 155237 |
| 1012 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 1013 | Ga0501048_0001183 | 3300049582 | Bacteria | 19737 |
| 1014 | Ga0501070_0143876 | 3300049586 | Bacteria | 1969 |
| 1015 | Ga0501198_000035 | 3300049649 | Bacteria | 54148 |
| 1016 | Ga0501222_000039 | 3300049662 | Bacteria | 50352 |
| 1017 | Ga0501223_000254 | 3300049663 | Bacteria | 13632 |
| 1018 | Ga0501080_0178880 | 3300049742 | Bacteria | 1953 |
| 1019 | Ga0501262_000906 | 3300049759 | Bacteria | 3355 |
| 1020 | Ga0501045_0030746 | 3300049824 | Bacteria | 3887 |
| 1021 | nmdc:mga0yw44_41248_c1 | 3300050492 | Bacteria | 2747 |
| 1022 | nmdc:mga0k408_171_c1 | 3300050493 | Bacteria | 34186 |
| 1023 | nmdc:mga0k408_18817_c1 | 3300050493 | Bacteria | 3856 |
| 1024 | nmdc:mga0k408_563_c2 | 3300050493 | Bacteria | 17614 |
| 1025 | nmdc:mga06z11_6500_c1 | 3300050494 | Bacteria | 4761 |
| 1026 | nmdc:mga07m45_17960_c2 | 3300050496 | Bacteria | 3492 |
| 1027 | nmdc:mga05p37_60287_c1 | 3300050507 | Bacteria | 4672 |
| 1028 | nmdc:mga09592_4095_c1 | 3300050508 | Bacteria | 11773 |
| 1029 | nmdc:mga0qj67_138537_c1 | 3300050509 | Bacteria | 1972 |
| 1030 | nmdc:mga08y16_164560_c1 | 3300050511 | Bacteria | 2304 |
| 1031 | nmdc:mga08y16_53021_c1 | 3300050511 | Bacteria | 4242 |
| 1032 | nmdc:mga08y16_9326_c1 | 3300050511 | Bacteria | 10292 |
| 1033 | nmdc:mga0n895_140025_c1 | 3300050512 | Bacteria | 2447 |
| 1034 | nmdc:mga0a205_30530_c1 | 3300050515 | Bacteria | 5160 |
| 1035 | Ga0495601_0010088 | 3300053077 | Bacteria | 5609 |
| 1036 | Ga0495595_0043292 | 3300053084 | Bacteria | 2065 |
| 1037 | Ga0495619_0091589 | 3300053085 | Bacteria | 2058 |
| 1038 | Ga0500644_0002460 | 3300053088 | Bacteria | 4630 |
| 1039 | Ga0500650_0059612 | 3300053098 | Bacteria | 1781 |
| 1040 | Ga0500593_000168 | 3300053117 | Bacteria | 26386 |
| 1041 | Ga0500594_0010869 | 3300053118 | Bacteria | 2118 |
| 1042 | Ga0500608_002485 | 3300053122 | Bacteria | 6714 |
| 1043 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 1044 | Ga0500618_017345 | 3300053125 | Bacteria | 1792 |
| 1045 | Ga0500652_041654 | 3300053131 | Bacteria | 1850 |
| 1046 | Ga0500658_0003545 | 3300053134 | Bacteria | 5892 |
| 1047 | Ga0500559_0000017 | 3300053136 | Bacteria | 143646 |
| 1048 | Ga0500568_0007469 | 3300053139 | Bacteria | 5359 |
| 1049 | Ga0500577_0044331 | 3300053142 | Bacteria | 1639 |
| 1050 | Ga0500616_0011047 | 3300053153 | Bacteria | 5370 |
| 1051 | Ga0500622_0003035 | 3300053156 | Bacteria | 11596 |
| 1052 | Ga0500622_0009359 | 3300053156 | Bacteria | 5422 |
| 1053 | Ga0500624_000554 | 3300053157 | Bacteria | 10469 |
| 1054 | Ga0500645_000333 | 3300053730 | Bacteria | 33591 |
| 1055 | Ga0500645_002999 | 3300053730 | Bacteria | 7146 |
| 1056 | Ga0500587_001288 | 3300053739 | Bacteria | 3512 |
| 1057 | 2511245442 | 2511231002 | Bacteria | 5042903 |
| 1058 | 2547370910 | 2547132103 | Bacteria | 5115736 |
| 1059 | 2599478253 | 2599185184 | Bacteria | 6430550 |
| 1060 | 2644305162 | 2643221654 | Bacteria | 5273570 |
| 1061 | 2843692632 | 2843690924 | Bacteria | 5169057 |
| 1062 | 2881103706 | 2881101125 | Bacteria | 4590519 |
| 1063 | 2919438949 | 2919437846 | Bacteria | 6199444 |
| 1064 | 2928080697 | 2928078545 | Bacteria | 6534839 |
| 1065 | 2928150922 | 2928147474 | Bacteria | 6512076 |
| 1066 | 2932082921 | 2932082852 | Bacteria | 6563563 |
| 1067 | Ga0373925_0034608 | |||
| 1068 | JGI24739J22299_10005527 | |||
| 1069 | JGI24735J21928_10000004 | |||
| 1070 | JGI24751J29686_10001458 | |||
| 1071 | JGI25155J39150_1000184 | |||
| 1072 | JGI25156J39149_1000100 | |||
| 1073 | JGI25162J39368_1000017 | |||
| 1074 | JGI25162J39368_1000774 | |||
| 1075 | JGI25154J39366_1000121 | |||
| 1076 | JGI25157J39369_1000130 | |||
| 1077 | JGI25150J39212_1001463 | |||
| 1078 | JGI25159J45721_1000190 | |||
| 1079 | JGI25151J46595_10011468 | |||
| 1080 | JGI25165J46597_1002106 | |||
| 1081 | rootH1_10005314 | |||
| 1082 | rootH2_10218036 | |||
| 1083 | rootH1_10009528 | |||
| 1084 | rootH1_10122910 | |||
| 1085 | JGI25160J50197_1000345 | |||
| 1086 | JGI25160J50197_1000460 | |||
| 1087 | JGI25161J50226_1000007 | |||
| 1088 | Ga0055537_1000183 | |||
| 1089 | Ga0055537_1000254 | |||
| 1090 | Ga0055537_1011407 | |||
| 1091 | Ga0055524_1000101 | |||
| 1092 | Ga0055524_1000471 | |||
| 1093 | Ga0055536_1016321 | |||
| 1094 | Ga0055536_1016335 | |||
| 1095 | Ga0055534_1000846 | |||
| 1096 | Ga0055528_1001026 | |||
| 1097 | Ga0055530_10003916 | |||
| 1098 | Ga0055540_1000099 | |||
| 1099 | Ga0055540_1000670 | |||
| 1100 | Ga0055531_10007396 | |||
| 1101 | Ga0055531_10007669 | |||
| 1102 | Ga0055543_1002444 | |||
| 1103 | Ga0065707_10086199 | |||
| 1104 | Ga0070658_10002633 | |||
| 1105 | Ga0070658_10008499 | |||
| 1106 | Ga0070658_10021485 | |||
| 1107 | Ga0070658_10035099 | |||
| 1108 | Ga0070676_10000943 | |||
| 1109 | Ga0070676_10001127 | |||
| 1110 | Ga0070676_10002226 | |||
| 1111 | Ga0070676_10007868 | |||
| 1112 | Ga0070676_10025720 | |||
| 1113 | Ga0070676_10030869 | |||
| 1114 | Ga0070683_100041409 | |||
| 1115 | Ga0070683_100099773 | |||
| 1116 | Ga0070690_100053337 | |||
| 1117 | Ga0070670_100001968 | |||
| 1118 | Ga0070670_100002937 | |||
| 1119 | Ga0070670_100002946 | |||
| 1120 | Ga0070670_100006486 | |||
| 1121 | Ga0070670_100012554 | |||
| 1122 | Ga0070670_100014553 | |||
| 1123 | Ga0070670_100018268 | |||
| 1124 | Ga0070670_100028425 | |||
| 1125 | Ga0070670_100030673 | |||
| 1126 | Ga0070670_100031977 | |||
| 1127 | Ga0070670_100070455 | |||
| 1128 | Ga0070670_100161218 | |||
| 1129 | Ga0070677_10000779 | |||
| 1130 | Ga0068869_100001034 | |||
| 1131 | Ga0068869_100021747 | |||
| 1132 | Ga0068869_100029284 | |||
| 1133 | Ga0068869_100043100 | |||
| 1134 | Ga0070666_10001106 | |||
| 1135 | Ga0070666_10005279 | |||
| 1136 | Ga0070666_10012037 | |||
| 1137 | Ga0070666_10040886 | |||
| 1138 | Ga0070682_100008067 | |||
| 1139 | Ga0068868_100002333 | |||
| 1140 | Ga0068868_100018190 | |||
| 1141 | Ga0068868_100059025 | |||
| 1142 | Ga0068868_100061036 | |||
| 1143 | Ga0068868_100151373 | |||
| 1144 | Ga0070660_100004244 | |||
| 1145 | Ga0070660_100054324 | |||
| 1146 | Ga0070660_100077310 | |||
| 1147 | Ga0070660_100087794 | |||
| 1148 | Ga0070660_100096359 | |||
| 1149 | Ga0070660_100143901 | |||
| 1150 | Ga0070689_100021929 | |||
| 1151 | Ga0070689_100040790 | |||
| 1152 | Ga0070687_100008151 | |||
| 1153 | Ga0070661_100001036 | |||
| 1154 | Ga0070661_100020782 | |||
| 1155 | Ga0070661_100045589 | |||
| 1156 | Ga0070692_10006369 | |||
| 1157 | Ga0070692_10007979 | |||
| 1158 | Ga0070668_100002102 | |||
| 1159 | Ga0070668_100002402 | |||
| 1160 | Ga0070668_100006289 | |||
| 1161 | Ga0070668_100010557 | |||
| 1162 | Ga0070668_100020482 | |||
| 1163 | Ga0070668_100040202 | |||
| 1164 | Ga0070669_100002383 | |||
| 1165 | Ga0070669_100020975 | |||
| 1166 | Ga0070669_100045047 | |||
| 1167 | Ga0070675_100000127 | |||
| 1168 | Ga0070675_100015803 | |||
| 1169 | Ga0070675_100025409 | |||
| 1170 | Ga0070675_100040443 | |||
| 1171 | Ga0070675_100081222 | |||
| 1172 | Ga0070671_100000385 | |||
| 1173 | Ga0070671_100014500 | |||
| 1174 | Ga0070671_100014712 | |||
| 1175 | Ga0070671_100019954 | |||
| 1176 | Ga0070671_100094882 | |||
| 1177 | Ga0070671_100132750 | |||
| 1178 | Ga0070671_100150289 | |||
| 1179 | Ga0070674_100000721 | |||
| 1180 | Ga0070674_100009759 | |||
| 1181 | Ga0070674_100024845 | |||
| 1182 | Ga0070674_100033035 | |||
| 1183 | Ga0070673_100000167 | |||
| 1184 | Ga0070673_100001120 | |||
| 1185 | Ga0070673_100006709 | |||
| 1186 | Ga0070673_100006814 | |||
| 1187 | Ga0070673_100024381 | |||
| 1188 | Ga0070673_100063657 | |||
| 1189 | Ga0070673_100097161 | |||
| 1190 | Ga0070688_100001497 | |||
| 1191 | Ga0070659_100000182 | |||
| 1192 | Ga0070659_100031751 | |||
| 1193 | Ga0070659_100075130 | |||
| 1194 | Ga0070659_100133953 | |||
| 1195 | Ga0070667_100001902 | |||
| 1196 | Ga0070667_100007173 | |||
| 1197 | Ga0070667_100008145 | |||
| 1198 | Ga0070667_100017704 | |||
| 1199 | Ga0070667_100032675 | |||
| 1200 | Ga0070667_100036296 | |||
| 1201 | Ga0070709_10002358 | |||
| 1202 | Ga0070709_10065357 | |||
| 1203 | Ga0070714_100021195 | |||
| 1204 | Ga0070714_100030190 | |||
| 1205 | Ga0070714_100038078 | |||
| 1206 | Ga0070713_100000097 | |||
| 1207 | Ga0070713_100013435 | |||
| 1208 | Ga0070713_100015379 | |||
| 1209 | Ga0070713_100082867 | |||
| 1210 | Ga0070711_100000353 | |||
| 1211 | Ga0070700_100118724 | |||
| 1212 | Ga0070708_100000315 | |||
| 1213 | Ga0070678_100001077 | |||
| 1214 | Ga0070678_100001165 | |||
| 1215 | Ga0070678_100003624 | |||
| 1216 | Ga0070678_100010441 | |||
| 1217 | Ga0070678_100016869 | |||
| 1218 | Ga0070662_100000120 | |||
| 1219 | Ga0070662_100034067 | |||
| 1220 | Ga0070662_100083645 | |||
| 1221 | Ga0070681_10004889 | |||
| 1222 | Ga0070681_10012410 | |||
| 1223 | Ga0070681_10068442 | |||
| 1224 | Ga0068867_100000844 | |||
| 1225 | Ga0068867_100001859 | |||
| 1226 | Ga0068867_100004280 | |||
| 1227 | Ga0068867_100006992 | |||
| 1228 | Ga0068867_100029758 | |||
| 1229 | Ga0068867_100036279 | |||
| 1230 | Ga0068867_100051318 | |||
| 1231 | Ga0068867_100071733 | |||
| 1232 | Ga0068867_100093664 | |||
| 1233 | Ga0068867_100136825 | |||
| 1234 | Ga0070685_10008492 | |||
| 1235 | Ga0070706_100076770 | |||
| 1236 | Ga0070707_100020374 | |||
| 1237 | Ga0070698_100090351 | |||
| 1238 | Ga0070699_100010100 | |||
| 1239 | Ga0070679_100001334 | |||
| 1240 | Ga0070679_100024216 | |||
| 1241 | Ga0070679_100029797 | |||
| 1242 | Ga0070679_100041149 | |||
| 1243 | Ga0070679_100106471 | |||
| 1244 | Ga0070684_100010382 | |||
| 1245 | Ga0070684_100017898 | |||
| 1246 | Ga0070684_100054289 | |||
| 1247 | Ga0070697_100020263 | |||
| 1248 | Ga0070697_100039030 | |||
| 1249 | Ga0068853_100012981 | |||
| 1250 | Ga0068853_100017799 | |||
| 1251 | Ga0068853_100027393 | |||
| 1252 | Ga0068853_100047410 | |||
| 1253 | Ga0068853_100050373 | |||
| 1254 | Ga0068853_100087053 | |||
| 1255 | Ga0068853_100180578 | |||
| 1256 | Ga0070672_100003372 | |||
| 1257 | Ga0070672_100014345 | |||
| 1258 | Ga0070672_100024561 | |||
| 1259 | Ga0070672_100054414 | |||
| 1260 | Ga0070672_100056718 | |||
| 1261 | Ga0070672_100088525 | |||
| 1262 | Ga0070696_100003984 | |||
| 1263 | Ga0070693_100019783 | |||
| 1264 | Ga0070665_100000003 | |||
| 1265 | Ga0070665_100005025 | |||
| 1266 | Ga0070665_100010909 | |||
| 1267 | Ga0070665_100012296 | |||
| 1268 | Ga0070665_100035421 | |||
| 1269 | Ga0070665_100065422 | |||
| 1270 | Ga0070665_100092016 | |||
| 1271 | Ga0070665_100101908 | |||
| 1272 | Ga0070665_100172862 | |||
| 1273 | Ga0070704_100090141 | |||
| 1274 | Ga0070704_100220043 | |||
| 1275 | Ga0068855_100001125 | |||
| 1276 | Ga0068855_100003748 | |||
| 1277 | Ga0068855_100004880 | |||
| 1278 | Ga0068855_100008578 | |||
| 1279 | Ga0068855_100009594 | |||
| 1280 | Ga0068855_100017698 | |||
| 1281 | Ga0068855_100025077 | |||
| 1282 | Ga0068855_100025708 | |||
| 1283 | Ga0068855_100032601 | |||
| 1284 | Ga0068855_100089902 | |||
| 1285 | Ga0070664_100000226 | |||
| 1286 | Ga0070664_100028846 | |||
| 1287 | Ga0070664_100036503 | |||
| 1288 | Ga0070664_100078704 | |||
| 1289 | Ga0068857_100003262 | |||
| 1290 | Ga0068857_100084595 | |||
| 1291 | Ga0068857_100179713 | |||
| 1292 | Ga0068857_100336741 | |||
| 1293 | Ga0068854_100006927 | |||
| 1294 | Ga0068854_100012443 | |||
| 1295 | Ga0068854_100039255 | |||
| 1296 | Ga0068854_100060141 | |||
| 1297 | Ga0068856_100001739 | |||
| 1298 | Ga0068856_100002273 | |||
| 1299 | Ga0068856_100005592 | |||
| 1300 | Ga0068856_100006483 | |||
| 1301 | Ga0068856_100024824 | |||
| 1302 | Ga0068856_100025660 | |||
| 1303 | Ga0068856_100044772 | |||
| 1304 | Ga0068856_100194883 | |||
| 1305 | Ga0068856_100207083 | |||
| 1306 | Ga0068856_100207510 | |||
| 1307 | Ga0070702_100013178 | |||
| 1308 | Ga0068852_100000458 | |||
| 1309 | Ga0068852_100000500 | |||
| 1310 | Ga0068852_100000590 | |||
| 1311 | Ga0068852_100000662 | |||
| 1312 | Ga0068852_100002866 | |||
| 1313 | Ga0068852_100018396 | |||
| 1314 | Ga0068852_100018846 | |||
| 1315 | Ga0068852_100032082 | |||
| 1316 | Ga0068852_100044318 | |||
| 1317 | Ga0068852_100089929 | |||
| 1318 | Ga0068852_100123509 | |||
| 1319 | Ga0068859_100001046 | |||
| 1320 | Ga0068859_100003087 | |||
| 1321 | Ga0068859_100014529 | |||
| 1322 | Ga0068859_100040466 | |||
| 1323 | Ga0068859_100119610 | |||
| 1324 | Ga0068859_100147526 | |||
| 1325 | Ga0068859_100161402 | |||
| 1326 | Ga0068864_100001845 | |||
| 1327 | Ga0068864_100002069 | |||
| 1328 | Ga0068864_100003834 | |||
| 1329 | Ga0068866_10004365 | |||
| 1330 | Ga0068866_10030557 | |||
| 1331 | Ga0068861_100002726 | |||
| 1332 | Ga0068861_100005292 | |||
| 1333 | Ga0068861_100027491 | |||
| 1334 | Ga0068851_10000412 | |||
| 1335 | Ga0068851_10001605 | |||
| 1336 | Ga0068851_10007357 | |||
| 1337 | Ga0068851_10007638 | |||
| 1338 | Ga0068870_10037982 | |||
| 1339 | Ga0068863_100002587 | |||
| 1340 | Ga0068863_100004932 | |||
| 1341 | Ga0068863_100021455 | |||
| 1342 | Ga0068863_100022473 | |||
| 1343 | Ga0068863_100050883 | |||
| 1344 | Ga0068863_100055029 | |||
| 1345 | Ga0068863_100111613 | |||
| 1346 | Ga0068863_100214312 | |||
| 1347 | Ga0068858_100001886 | |||
| 1348 | Ga0068858_100012968 | |||
| 1349 | Ga0068858_100014101 | |||
| 1350 | Ga0068858_100023202 | |||
| 1351 | Ga0068858_100058091 | |||
| 1352 | Ga0068858_100224556 | |||
| 1353 | Ga0068858_100226958 | |||
| 1354 | Ga0068860_100002318 | |||
| 1355 | Ga0068860_100004676 | |||
| 1356 | Ga0068860_100014325 | |||
| 1357 | Ga0068860_100017240 | |||
| 1358 | Ga0068860_100026811 | |||
| 1359 | Ga0068860_100027890 | |||
| 1360 | Ga0068860_100083676 | |||
| 1361 | Ga0068860_100132850 | |||
| 1362 | Ga0068862_100014996 | |||
| 1363 | Ga0068862_100023321 | |||
| 1364 | Ga0068862_100107134 | |||
| 1365 | Ga0081539_10011444 | |||
| 1366 | Ga0075363_100008832 | |||
| 1367 | Ga0070715_10013847 | |||
| 1368 | Ga0070716_100010880 | |||
| 1369 | Ga0070712_100067894 | |||
| 1370 | Ga0075369_10021890 | |||
| 1371 | Ga0075366_10000123 | |||
| 1372 | Ga0075366_10001829 | |||
| 1373 | Ga0075366_10014392 | |||
| 1374 | Ga0097621_100000020 | |||
| 1375 | Ga0097621_100015621 | |||
| 1376 | Ga0097621_100037556 | |||
| 1377 | Ga0097621_100045116 | |||
| 1378 | Ga0097621_100066625 | |||
| 1379 | Ga0097621_100081796 | |||
| 1380 | Ga0097621_100171045 | |||
| 1381 | Ga0075370_10020365 | |||
| 1382 | Ga0075370_10028040 | |||
| 1383 | Ga0068871_100000130 | |||
| 1384 | Ga0068871_100003319 | |||
| 1385 | Ga0068871_100014353 | |||
| 1386 | Ga0068871_100050618 | |||
| 1387 | Ga0068871_100166804 | |||
| 1388 | Ga0075428_100019201 | |||
| 1389 | Ga0075433_10023930 | |||
| 1390 | Ga0075434_100046398 | |||
| 1391 | Ga0075434_100234963 | |||
| 1392 | Ga0068865_100000050 | |||
| 1393 | Ga0068865_100011641 | |||
| 1394 | Ga0068865_100046704 | |||
| 1395 | Ga0068865_100060961 | |||
| 1396 | Ga0068865_100081541 | |||
| 1397 | Ga0097620_100001046 | |||
| 1398 | Ga0097620_100003087 | |||
| 1399 | Ga0097620_100014528 | |||
| 1400 | Ga0097620_100040466 | |||
| 1401 | Ga0097620_100119616 | |||
| 1402 | Ga0097620_100147533 | |||
| 1403 | Ga0097620_100161389 | |||
| 1404 | Ga0075435_100095618 | |||
| 1405 | Ga0105240_10003767 | |||
| 1406 | Ga0105240_10005554 | |||
| 1407 | Ga0105240_10014966 | |||
| 1408 | Ga0105240_10034306 | |||
| 1409 | Ga0105240_10045988 | |||
| 1410 | Ga0105240_10084352 | |||
| 1411 | Ga0105240_10110310 | |||
| 1412 | Ga0105240_10144226 | |||
| 1413 | Ga0105240_10188746 | |||
| 1414 | Ga0105240_10258209 | |||
| 1415 | Ga0111539_10002831 | |||
| 1416 | Ga0111539_10032437 | |||
| 1417 | Ga0111539_10091154 | |||
| 1418 | Ga0111539_10235580 | |||
| 1419 | Ga0105247_10003594 | |||
| 1420 | Ga0105247_10108370 | |||
| 1421 | Ga0105247_10126903 | |||
| 1422 | Ga0114129_10252409 | |||
| 1423 | Ga0114129_10478016 | |||
| 1424 | Ga0105243_10051166 | |||
| 1425 | Ga0105243_10160652 | |||
| 1426 | Ga0105241_10004819 | |||
| 1427 | Ga0105241_10005645 | |||
| 1428 | Ga0105241_10017308 | |||
| 1429 | Ga0105241_10112610 | |||
| 1430 | Ga0105242_10004548 | |||
| 1431 | Ga0105242_10006335 | |||
| 1432 | Ga0105242_10029985 | |||
| 1433 | Ga0105242_10059038 | |||
| 1434 | Ga0105242_10066605 | |||
| 1435 | Ga0105242_10104632 | |||
| 1436 | Ga0105248_10004085 | |||
| 1437 | Ga0105248_10031198 | |||
| 1438 | Ga0105248_10031400 | |||
| 1439 | Ga0105248_10038460 | |||
| 1440 | Ga0105248_10076861 | |||
| 1441 | Ga0105248_10148010 | |||
| 1442 | Ga0105248_10153643 | |||
| 1443 | Ga0105237_10000825 | |||
| 1444 | Ga0105237_10003737 | |||
| 1445 | Ga0105237_10007800 | |||
| 1446 | Ga0105237_10021331 | |||
| 1447 | Ga0105237_10164649 | |||
| 1448 | Ga0105237_10229894 | |||
| 1449 | Ga0105238_10000770 | |||
| 1450 | Ga0105238_10012877 | |||
| 1451 | Ga0105238_10020736 | |||
| 1452 | Ga0105238_10027934 | |||
| 1453 | Ga0105238_10034684 | |||
| 1454 | Ga0105238_10073378 | |||
| 1455 | Ga0105238_10076212 | |||
| 1456 | Ga0105249_10005263 | |||
| 1457 | Ga0105249_10027973 | |||
| 1458 | Ga0105249_10046627 | |||
| 1459 | Ga0105249_10077038 | |||
| 1460 | Ga0105249_10078571 | |||
| 1461 | Ga0105249_10080323 | |||
| 1462 | Ga0105249_10097729 | |||
| 1463 | Ga0105239_10000012 | |||
| 1464 | Ga0105239_10000338 | |||
| 1465 | Ga0105239_10000445 | |||
| 1466 | Ga0105239_10000959 | |||
| 1467 | Ga0105239_10012429 | |||
| 1468 | Ga0105246_10003919 | |||
| 1469 | Ga0157373_10000824 | |||
| 1470 | Ga0157373_10001101 | |||
| 1471 | Ga0157373_10040852 | |||
| 1472 | Ga0157371_10000769 | |||
| 1473 | Ga0157370_10000522 | |||
| 1474 | Ga0157370_10003726 | |||
| 1475 | Ga0157370_10017198 | |||
| 1476 | Ga0157370_10027183 | |||
| 1477 | Ga0157370_10082959 | |||
| 1478 | Ga0157370_10094760 | |||
| 1479 | Ga0157370_10148029 | |||
| 1480 | Ga0157369_10000281 | |||
| 1481 | Ga0157369_10000568 | |||
| 1482 | Ga0157369_10005788 | |||
| 1483 | Ga0157369_10058853 | |||
| 1484 | Ga0157369_10067179 | |||
| 1485 | Ga0157374_10006271 | |||
| 1486 | Ga0157374_10006780 | |||
| 1487 | Ga0157374_10026513 | |||
| 1488 | Ga0157378_10001597 | |||
| 1489 | Ga0157378_10004383 | |||
| 1490 | Ga0157378_10026461 | |||
| 1491 | Ga0157378_10152183 | |||
| 1492 | Ga0163162_10000031 | |||
| 1493 | Ga0163162_10000079 | |||
| 1494 | Ga0163162_10002191 | |||
| 1495 | Ga0163162_10004531 | |||
| 1496 | Ga0163162_10005913 | |||
| 1497 | Ga0163162_10013456 | |||
| 1498 | Ga0163162_10024376 | |||
| 1499 | Ga0163162_10044343 | |||
| 1500 | Ga0163162_10091772 | |||
| 1501 | Ga0163162_10200815 | |||
| 1502 | Ga0157372_10001380 | |||
| 1503 | Ga0157372_10002075 | |||
| 1504 | Ga0157372_10003847 | |||
| 1505 | Ga0157372_10006187 | |||
| 1506 | Ga0157372_10030627 | |||
| 1507 | Ga0157372_10036384 | |||
| 1508 | Ga0157372_10078295 | |||
| 1509 | Ga0157372_10085796 | |||
| 1510 | Ga0157372_10141702 | |||
| 1511 | Ga0157372_10215931 | |||
| 1512 | Ga0157372_10339433 | |||
| 1513 | Ga0157375_10028086 | |||
| 1514 | Ga0157375_10035889 | |||
| 1515 | Ga0157375_10058934 | |||
| 1516 | Ga0157375_10100030 | |||
| 1517 | Ga0163163_10000609 | |||
| 1518 | Ga0163163_10008102 | |||
| 1519 | Ga0157380_10038733 | |||
| 1520 | Ga0157380_10044508 | |||
| 1521 | Ga0157380_10085690 | |||
| 1522 | Ga0157377_10000027 | |||
| 1523 | Ga0157377_10010784 | |||
| 1524 | Ga0157379_10000542 | |||
| 1525 | Ga0157379_10015208 | |||
| 1526 | Ga0157379_10021537 | |||
| 1527 | Ga0157379_10041350 | |||
| 1528 | Ga0157376_10011627 | |||
| 1529 | Ga0213872_10011644 | |||
| 1530 | Ga0209435_100008 | |||
| 1531 | Ga0209437_100024 | |||
| 1532 | Ga0209437_100052 | |||
| 1533 | Ga0207425_1000606 | |||
| 1534 | Ga0209646_1000079 | |||
| 1535 | Ga0209026_1000067 | |||
| 1536 | Ga0209026_1002264 | |||
| 1537 | Ga0209026_1005965 | |||
| 1538 | Ga0209759_1000056 | |||
| 1539 | Ga0209129_1012446 | |||
| 1540 | Ga0209233_1000067 | |||
| 1541 | Ga0209565_1000041 | |||
| 1542 | Ga0209565_1001982 | |||
| 1543 | Ga0209673_1000012 | |||
| 1544 | Ga0209130_1000014 | |||
| 1545 | Ga0209130_1000184 | |||
| 1546 | Ga0209675_1000475 | |||
| 1547 | Ga0209676_1000013 | |||
| 1548 | Ga0209676_1000106 | |||
| 1549 | Ga0209676_1014775 | |||
| 1550 | Ga0209758_1014977 | |||
| 1551 | Ga0209050_1000008 | |||
| 1552 | Ga0209050_1000174 | |||
| 1553 | Ga0209050_1008176 | |||
| 1554 | Ga0209256_1000003 | |||
| 1555 | Ga0207426_1000091 | |||
| 1556 | Ga0207426_1000174 | |||
| 1557 | Ga0209051_1000005 | |||
| 1558 | Ga0209257_1000048 | |||
| 1559 | Ga0209257_1020329 | |||
| 1560 | Ga0207697_10002484 | |||
| 1561 | Ga0207697_10004396 | |||
| 1562 | Ga0207656_10010315 | |||
| 1563 | Ga0207682_10000872 | |||
| 1564 | Ga0207692_10027736 | |||
| 1565 | Ga0207692_10058672 | |||
| 1566 | Ga0207710_10001205 | |||
| 1567 | Ga0207710_10038614 | |||
| 1568 | Ga0207688_10002060 | |||
| 1569 | Ga0207680_10036518 | |||
| 1570 | Ga0207647_10067083 | |||
| 1571 | Ga0207699_10034066 | |||
| 1572 | Ga0207699_10074873 | |||
| 1573 | Ga0207645_10000082 | |||
| 1574 | Ga0207645_10000187 | |||
| 1575 | Ga0207645_10000236 | |||
| 1576 | Ga0207645_10001311 | |||
| 1577 | Ga0207645_10001481 | |||
| 1578 | Ga0207645_10031874 | |||
| 1579 | Ga0207645_10035348 | |||
| 1580 | Ga0207643_10006462 | |||
| 1581 | Ga0207643_10008272 | |||
| 1582 | Ga0207643_10008938 | |||
| 1583 | Ga0207643_10067522 | |||
| 1584 | Ga0207705_10007947 | |||
| 1585 | Ga0207705_10010917 | |||
| 1586 | Ga0207705_10017406 | |||
| 1587 | Ga0207705_10019332 | |||
| 1588 | Ga0207705_10049358 | |||
| 1589 | Ga0207705_10061838 | |||
| 1590 | Ga0207705_10088854 | |||
| 1591 | Ga0207684_10181762 | |||
| 1592 | Ga0207654_10012971 | |||
| 1593 | Ga0207654_10017869 | |||
| 1594 | Ga0207707_10011841 | |||
| 1595 | Ga0207707_10023414 | |||
| 1596 | Ga0207695_10003570 | |||
| 1597 | Ga0207695_10004522 | |||
| 1598 | Ga0207695_10010199 | |||
| 1599 | Ga0207695_10016238 | |||
| 1600 | Ga0207695_10017725 | |||
| 1601 | Ga0207695_10031694 | |||
| 1602 | Ga0207695_10042315 | |||
| 1603 | Ga0207695_10102674 | |||
| 1604 | Ga0207671_10000909 | |||
| 1605 | Ga0207671_10001801 | |||
| 1606 | Ga0207671_10008467 | |||
| 1607 | Ga0207671_10018195 | |||
| 1608 | Ga0207671_10077548 | |||
| 1609 | Ga0207671_10103266 | |||
| 1610 | Ga0207693_10000760 | |||
| 1611 | Ga0207663_10013281 | |||
| 1612 | Ga0207660_10006497 | |||
| 1613 | Ga0207660_10080985 | |||
| 1614 | Ga0207662_10014415 | |||
| 1615 | Ga0207662_10073023 | |||
| 1616 | Ga0207657_10000102 | |||
| 1617 | Ga0207657_10000250 | |||
| 1618 | Ga0207657_10002028 | |||
| 1619 | Ga0207657_10016616 | |||
| 1620 | Ga0207657_10018911 | |||
| 1621 | Ga0207657_10027081 | |||
| 1622 | Ga0207657_10099976 | |||
| 1623 | Ga0207649_10001379 | |||
| 1624 | Ga0207652_10008684 | |||
| 1625 | Ga0207652_10027143 | |||
| 1626 | Ga0207652_10055805 | |||
| 1627 | Ga0207652_10119563 | |||
| 1628 | Ga0207646_10016930 | |||
| 1629 | Ga0207681_10004744 | |||
| 1630 | Ga0207681_10021097 | |||
| 1631 | Ga0207681_10028877 | |||
| 1632 | Ga0207681_10087616 | |||
| 1633 | Ga0207681_10106951 | |||
| 1634 | Ga0207681_10226336 | |||
| 1635 | Ga0207694_10002414 | |||
| 1636 | Ga0207694_10007634 | |||
| 1637 | Ga0207694_10018342 | |||
| 1638 | Ga0207694_10044308 | |||
| 1639 | Ga0207694_10156686 | |||
| 1640 | Ga0207650_10000970 | |||
| 1641 | Ga0207650_10009000 | |||
| 1642 | Ga0207650_10018802 | |||
| 1643 | Ga0207650_10019115 | |||
| 1644 | Ga0207650_10022018 | |||
| 1645 | Ga0207650_10022544 | |||
| 1646 | Ga0207650_10032323 | |||
| 1647 | Ga0207650_10064471 | |||
| 1648 | Ga0207650_10079964 | |||
| 1649 | Ga0207650_10183160 | |||
| 1650 | Ga0207650_10249774 | |||
| 1651 | Ga0207659_10002664 | |||
| 1652 | Ga0207659_10008086 | |||
| 1653 | Ga0207659_10014884 | |||
| 1654 | Ga0207659_10038287 | |||
| 1655 | Ga0207659_10040531 | |||
| 1656 | Ga0207659_10115840 | |||
| 1657 | Ga0207687_10000552 | |||
| 1658 | Ga0207700_10000062 | |||
| 1659 | Ga0207700_10019091 | |||
| 1660 | Ga0207700_10054328 | |||
| 1661 | Ga0207664_10003534 | |||
| 1662 | Ga0207664_10005137 | |||
| 1663 | Ga0207664_10010398 | |||
| 1664 | Ga0207664_10013527 | |||
| 1665 | Ga0207644_10032653 | |||
| 1666 | Ga0207644_10037870 | |||
| 1667 | Ga0207644_10089063 | |||
| 1668 | Ga0207644_10090970 | |||
| 1669 | Ga0207690_10000595 | |||
| 1670 | Ga0207690_10045915 | |||
| 1671 | Ga0207690_10099276 | |||
| 1672 | Ga0207706_10000095 | |||
| 1673 | Ga0207706_10022684 | |||
| 1674 | Ga0207686_10011655 | |||
| 1675 | Ga0207686_10026430 | |||
| 1676 | Ga0207686_10061509 | |||
| 1677 | Ga0207709_10001223 | |||
| 1678 | Ga0207709_10032528 | |||
| 1679 | Ga0207709_10077200 | |||
| 1680 | Ga0207670_10149621 | |||
| 1681 | Ga0207669_10002060 | |||
| 1682 | Ga0207669_10052043 | |||
| 1683 | Ga0207669_10121256 | |||
| 1684 | Ga0207704_10000078 | |||
| 1685 | Ga0207704_10037386 | |||
| 1686 | Ga0207704_10038157 | |||
| 1687 | Ga0207691_10006527 | |||
| 1688 | Ga0207691_10010905 | |||
| 1689 | Ga0207691_10021256 | |||
| 1690 | Ga0207691_10024249 | |||
| 1691 | Ga0207691_10029828 | |||
| 1692 | Ga0207691_10041548 | |||
| 1693 | Ga0207711_10001126 | |||
| 1694 | Ga0207711_10020081 | |||
| 1695 | Ga0207689_10002780 | |||
| 1696 | Ga0207689_10004782 | |||
| 1697 | Ga0207689_10006891 | |||
| 1698 | Ga0207689_10007391 | |||
| 1699 | Ga0207689_10016125 | |||
| 1700 | Ga0207689_10023567 | |||
| 1701 | Ga0207689_10030481 | |||
| 1702 | Ga0207689_10160463 | |||
| 1703 | Ga0207661_10041304 | |||
| 1704 | Ga0207661_10098691 | |||
| 1705 | Ga0207679_10001787 | |||
| 1706 | Ga0207679_10006374 | |||
| 1707 | Ga0207679_10030983 | |||
| 1708 | Ga0207679_10037421 | |||
| 1709 | Ga0207679_10146619 | |||
| 1710 | Ga0207667_10000233 | |||
| 1711 | Ga0207667_10000705 | |||
| 1712 | Ga0207667_10001584 | |||
| 1713 | Ga0207667_10004358 | |||
| 1714 | Ga0207667_10008512 | |||
| 1715 | Ga0207667_10018252 | |||
| 1716 | Ga0207667_10027515 | |||
| 1717 | Ga0207667_10036751 | |||
| 1718 | Ga0207667_10058793 | |||
| 1719 | Ga0207667_10149130 | |||
| 1720 | Ga0207651_10001337 | |||
| 1721 | Ga0207651_10006913 | |||
| 1722 | Ga0207651_10010722 | |||
| 1723 | Ga0207651_10012678 | |||
| 1724 | Ga0207651_10233576 | |||
| 1725 | Ga0207712_10003182 | |||
| 1726 | Ga0207712_10123887 | |||
| 1727 | Ga0207712_10128352 | |||
| 1728 | Ga0207712_10189107 | |||
| 1729 | Ga0207668_10002618 | |||
| 1730 | Ga0207668_10004388 | |||
| 1731 | Ga0207668_10011989 | |||
| 1732 | Ga0207668_10024116 | |||
| 1733 | Ga0207668_10060088 | |||
| 1734 | Ga0207668_10162627 | |||
| 1735 | Ga0207668_10205139 | |||
| 1736 | Ga0207640_10010179 | |||
| 1737 | Ga0207658_10001572 | |||
| 1738 | Ga0207658_10012856 | |||
| 1739 | Ga0207658_10025138 | |||
| 1740 | Ga0207658_10025183 | |||
| 1741 | Ga0207658_10031367 | |||
| 1742 | Ga0207658_10036305 | |||
| 1743 | Ga0207677_10000920 | |||
| 1744 | Ga0207677_10001799 | |||
| 1745 | Ga0207677_10008911 | |||
| 1746 | Ga0207677_10015988 | |||
| 1747 | Ga0207677_10019733 | |||
| 1748 | Ga0207677_10112194 | |||
| 1749 | Ga0207703_10000552 | |||
| 1750 | Ga0207703_10001501 | |||
| 1751 | Ga0207703_10006522 | |||
| 1752 | Ga0207639_10005745 | |||
| 1753 | Ga0207639_10016661 | |||
| 1754 | Ga0207639_10032517 | |||
| 1755 | Ga0207639_10036184 | |||
| 1756 | Ga0207639_10050189 | |||
| 1757 | Ga0207639_10095735 | |||
| 1758 | Ga0207678_10001717 | |||
| 1759 | Ga0207678_10003576 | |||
| 1760 | Ga0207678_10004513 | |||
| 1761 | Ga0207678_10029877 | |||
| 1762 | Ga0207678_10052267 | |||
| 1763 | Ga0207708_10000558 | |||
| 1764 | Ga0207708_10181432 | |||
| 1765 | Ga0207702_10003371 | |||
| 1766 | Ga0207702_10003800 | |||
| 1767 | Ga0207702_10010094 | |||
| 1768 | Ga0207702_10043463 | |||
| 1769 | Ga0207702_10122347 | |||
| 1770 | Ga0207702_10159297 | |||
| 1771 | Ga0207702_10286126 | |||
| 1772 | Ga0207641_10007772 | |||
| 1773 | Ga0207641_10035457 | |||
| 1774 | Ga0207641_10037317 | |||
| 1775 | Ga0207641_10103170 | |||
| 1776 | Ga0207648_10000119 | |||
| 1777 | Ga0207648_10000472 | |||
| 1778 | Ga0207648_10000556 | |||
| 1779 | Ga0207648_10001526 | |||
| 1780 | Ga0207648_10004701 | |||
| 1781 | Ga0207648_10011983 | |||
| 1782 | Ga0207648_10015531 | |||
| 1783 | Ga0207648_10048260 | |||
| 1784 | Ga0207648_10064564 | |||
| 1785 | Ga0207648_10163491 | |||
| 1786 | Ga0207648_10171863 | |||
| 1787 | Ga0207676_10001004 | |||
| 1788 | Ga0207676_10004363 | |||
| 1789 | Ga0207676_10032326 | |||
| 1790 | Ga0207676_10048121 | |||
| 1791 | Ga0207674_10000131 | |||
| 1792 | Ga0207674_10000326 | |||
| 1793 | Ga0207674_10017466 | |||
| 1794 | Ga0207674_10022792 | |||
| 1795 | Ga0207674_10042261 | |||
| 1796 | Ga0207674_10108472 | |||
| 1797 | Ga0207674_10161699 | |||
| 1798 | Ga0207675_100002028 | |||
| 1799 | Ga0207675_100002315 | |||
| 1800 | Ga0207675_100008094 | |||
| 1801 | Ga0207675_100008796 | |||
| 1802 | Ga0207675_100032329 | |||
| 1803 | Ga0207675_100044359 | |||
| 1804 | Ga0207675_100058741 | |||
| 1805 | Ga0207675_100308287 | |||
| 1806 | Ga0207683_10000012 | |||
| 1807 | Ga0207683_10001281 | |||
| 1808 | Ga0207683_10001576 | |||
| 1809 | Ga0207683_10003558 | |||
| 1810 | Ga0207683_10006324 | |||
| 1811 | Ga0207683_10019276 | |||
| 1812 | Ga0207683_10034960 | |||
| 1813 | Ga0207683_10077352 | |||
| 1814 | Ga0207698_10000838 | |||
| 1815 | Ga0207698_10006574 | |||
| 1816 | Ga0207698_10015942 | |||
| 1817 | Ga0207698_10021702 | |||
| 1818 | Ga0207698_10112859 | |||
| 1819 | Ga0207698_10126681 | |||
| 1820 | Ga0207698_10128261 | |||
| 1821 | Ga0209974_10001061 | |||
| 1822 | Ga0209974_10007612 | |||
| 1823 | Ga0207428_10004733 | |||
| 1824 | Ga0207428_10116849 | |||
| 1825 | Ga0268266_10000052 | |||
| 1826 | Ga0268266_10018595 | |||
| 1827 | Ga0268266_10018981 | |||
| 1828 | Ga0268266_10030890 | |||
| 1829 | Ga0268266_10039317 | |||
| 1830 | Ga0268266_10047691 | |||
| 1831 | Ga0268266_10083863 | |||
| 1832 | Ga0268265_10012369 | |||
| 1833 | Ga0268265_10016989 | |||
| 1834 | Ga0268265_10100793 | |||
| 1835 | Ga0268264_10000940 | |||
| 1836 | Ga0268264_10001989 | |||
| 1837 | Ga0268264_10002657 | |||
| 1838 | Ga0268264_10008226 | |||
| 1839 | Ga0268264_10010679 | |||
| 1840 | Ga0268264_10028337 | |||
| 1841 | Ga0268264_10069973 | |||
| 1842 | Ga0307517_10001280 | |||
| 1843 | Ga0307517_10009075 | |||
| 1844 | Ga0307515_10000049 | |||
| 1845 | Ga0307515_10000066 | |||
| 1846 | Ga0307515_10000235 | |||
| 1847 | Ga0307515_10000280 | |||
| 1848 | Ga0307515_10000677 | |||
| 1849 | Ga0307515_10009043 | |||
| 1850 | Ga0307515_10011749 | |||
| 1851 | Ga0307515_10059324 | |||
| 1852 | Ga0307515_10124420 | |||
| 1853 | Ga0307515_10190574 | |||
| 1854 | Ga0307512_10038887 | |||
| 1855 | Ga0265330_10003071 | |||
| 1856 | Ga0265332_10003672 | |||
| 1857 | Ga0265329_10003353 | |||
| 1858 | Ga0265331_10000350 | |||
| 1859 | Ga0265331_10039013 | |||
| 1860 | Ga0265327_10004829 | |||
| 1861 | Ga0265316_10013413 | |||
| 1862 | Ga0307513_10002838 | |||
| 1863 | Ga0307513_10011393 | |||
| 1864 | Ga0307513_10019123 | |||
| 1865 | Ga0307513_10019469 | |||
| 1866 | Ga0307509_10000092 | |||
| 1867 | Ga0307509_10015252 | |||
| 1868 | Ga0307509_10016290 | |||
| 1869 | Ga0307509_10044965 | |||
| 1870 | Ga0307509_10047364 | |||
| 1871 | Ga0307408_100001131 | |||
| 1872 | Ga0307408_100005330 | |||
| 1873 | Ga0307408_100007432 | |||
| 1874 | Ga0307408_100052524 | |||
| 1875 | Ga0307408_100059444 | |||
| 1876 | Ga0307508_10001131 | |||
| 1877 | Ga0307508_10109760 | |||
| 1878 | Ga0265314_10001584 | |||
| 1879 | Ga0265342_10041722 | |||
| 1880 | Ga0307516_10000921 | |||
| 1881 | Ga0307516_10001323 | |||
| 1882 | Ga0307516_10120851 | |||
| 1883 | Ga0307405_10008967 | |||
| 1884 | Ga0307405_10105626 | |||
| 1885 | Ga0307413_10001173 | |||
| 1886 | Ga0307413_10035218 | |||
| 1887 | Ga0307410_10008853 | |||
| 1888 | Ga0307410_10013766 | |||
| 1889 | Ga0307410_10058711 | |||
| 1890 | Ga0307406_10004113 | |||
| 1891 | Ga0307406_10004418 | |||
| 1892 | Ga0307406_10074750 | |||
| 1893 | Ga0307407_10021580 | |||
| 1894 | Ga0307407_10037837 | |||
| 1895 | Ga0307407_10129347 | |||
| 1896 | Ga0307412_10016336 | |||
| 1897 | Ga0307412_10103529 | |||
| 1898 | Ga0307409_100005685 | |||
| 1899 | Ga0307409_100046025 | |||
| 1900 | Ga0307409_100250363 | |||
| 1901 | Ga0307416_100017421 | |||
| 1902 | Ga0307416_100019985 | |||
| 1903 | Ga0307416_100030432 | |||
| 1904 | Ga0307416_100151834 | |||
| 1905 | Ga0307416_100263563 | |||
| 1906 | Ga0307414_10012317 | |||
| 1907 | Ga0307414_10042884 | |||
| 1908 | Ga0307411_10001216 | |||
| 1909 | Ga0307411_10060779 | |||
| 1910 | Ga0307415_100002867 | |||
| 1911 | Ga0307507_10000217 | |||
| 1912 | Ga0307510_10001210 | |||
| 1913 | Ga0307510_10027199 | |||
| 1914 | Ga0307510_10079750 | |||
| 1915 | Ga0373945_0025515 | |||
| 1916 | Ga0373954_0012036 | |||
| 1917 | Ga0373954_0029844 | |||
| 1918 | Ga0373956_0027392 | |||
| 1919 | Ga0373956_0032161 | |||
| 1920 | Ga0373946_0011199 | |||
| 1921 | Ga0373955_0092522 | |||
| 1922 | Ga0373955_0093529 | |||
| 1923 | Ga0373927_0018467 | |||
| 1924 | Ga0373927_0158275 | |||
| 1925 | Ga0373947_0019442 | |||
| 1926 | Ga0373947_0068505 | |||
| 1927 | Ga0373937_0023395 | |||
| 1928 | Ga0373937_0057372 | |||
| 1929 | Ga0373937_0101627 | |||
| 1930 | Ga0373925_0045867 | |||
| 1931 | Ga0373925_0057056 | |||
| 1932 | Ga0373925_0087968 | |||
| 1933 | Ga0395899_0000312 | |||
| 1934 | Ga0395899_0005024 | |||
| 1935 | Ga0395899_0033049 | |||
| 1936 | Ga0395899_0037244 | |||
| 1937 | Ga0395900_0000014 | |||
| 1938 | Ga0395900_0016070 | |||
| 1939 | Ga0395900_0024174 | |||
| 1940 | Ga0395900_0037247 | |||
| 1941 | Ga0395900_0055217 | |||
| 1942 | Ga0395898_0011650 | |||
| 1943 | Ga0395898_0016629 | |||
| 1944 | Ga0395898_0022644 | |||
| 1945 | Ga0395898_0029647 | |||
| 1946 | Ga0395905_0000037 | |||
| 1947 | Ga0395905_0000047 | |||
| 1948 | Ga0395905_0003737 | |||
| 1949 | Ga0395905_0005966 | |||
| 1950 | Ga0395905_0037922 | |||
| 1951 | Ga0395905_0051808 | |||
| 1952 | Ga0395905_0051833 | |||
| 1953 | Ga0395905_0070888 | |||
| 1954 | Ga0395905_0077091 | |||
| 1955 | Ga0395901_0000166 | |||
| 1956 | Ga0395901_0022451 | |||
| 1957 | Ga0395901_0026677 | |||
| 1958 | Ga0395901_0158562 | |||
| 1959 | Ga0436361_0101055 | |||
| 1960 | Ga0436361_0387461 | |||
| 1961 | Ga0436361_0602515 | |||
| 1962 | Ga0451807_2046709 | |||
| 1963 | Ga0439442_006759 | |||
| 1964 | Ga0439449_0001337 | |||
| 1965 | Ga0439450_015383 | |||
| 1966 | Ga0439434_0009633 | |||
| 1967 | Ga0439464_0010067 | |||
| 1968 | Ga0451577_0003837 | |||
| 1969 | Ga0451577_0004801 | |||
| 1970 | Ga0451577_0018853 | |||
| 1971 | Ga0451577_0031085 | |||
| 1972 | Ga0451577_0126793 | |||
| 1973 | Ga0451577_0205636 | |||
| 1974 | Ga0466969_0023280 | |||
| 1975 | Ga0466969_0066378 | |||
| 1976 | Ga0453683_0001373 | |||
| 1977 | Ga0453683_0004216 | |||
| 1978 | Ga0466966_0004622 | |||
| 1979 | Ga0466961_0046472 | |||
| 1980 | Ga0453684_0091081 | |||
| 1981 | Ga0453684_0152158 | |||
| 1982 | Ga0453684_0166848 | |||
| 1983 | Ga0453684_0243052 | |||
| 1984 | Ga0466957_0004733 | |||
| 1985 | Ga0466957_0018659 | |||
| 1986 | Ga0466959_0067260 | |||
| 1987 | Ga0451576_0001526 | |||
| 1988 | Ga0451576_0002571 | |||
| 1989 | Ga0451576_0012222 | |||
| 1990 | Ga0451576_0024684 | |||
| 1991 | Ga0451576_0047462 | |||
| 1992 | Ga0451576_0083326 | |||
| 1993 | Ga0451576_0155382 | |||
| 1994 | Ga0451576_0204142 | |||
| 1995 | Ga0466967_0078750 | |||
| 1996 | Ga0495592_0000647 | |||
| 1997 | Ga0495629_0089218 | |||
| 1998 | Ga0495651_0064769 | |||
| 1999 | Ga0495651_0152253 | |||
| 2000 | Ga0495650_0000087 | |||
| 2001 | Ga0495650_0021968 | |||
| 2002 | Ga0495662_0004418 | |||
| 2003 | Ga0495585_0000167 | |||
| 2004 | Ga0495585_0004197 | |||
| 2005 | Ga0495606_0000052 | |||
| 2006 | Ga0495606_0010890 | |||
| 2007 | Ga0495610_0007675 | |||
| 2008 | Ga0495610_0023176 | |||
| 2009 | Ga0495616_0001285 | |||
| 2010 | Ga0495616_0005065 | |||
| 2011 | Ga0495628_0132189 | |||
| 2012 | Ga0495643_0024523 | |||
| 2013 | Ga0495648_0002287 | |||
| 2014 | Ga0495665_0042231 | |||
| 2015 | Ga0495587_0016567 | |||
| 2016 | Ga0495645_0013509 | |||
| 2017 | Ga0495645_0110622 | |||
| 2018 | Ga0495633_0000029 | |||
| 2019 | Ga0495633_0003966 | |||
| 2020 | Ga0495633_0063742 | |||
| 2021 | Ga0495667_0102154 | |||
| 2022 | Ga0495668_0000012 | |||
| 2023 | Ga0495625_0000008 | |||
| 2024 | Ga0495625_0000817 | |||
| 2025 | Ga0495625_0003937 | |||
| 2026 | Ga0495625_0071820 | |||
| 2027 | Ga0495635_0013743 | |||
| 2028 | Ga0495661_0000511 | |||
| 2029 | Ga0495661_0016001 | |||
| 2030 | Ga0495657_0036134 | |||
| 2031 | Ga0495599_0000518 | |||
| 2032 | Ga0495623_0074316 | |||
| 2033 | Ga0495646_0030491 | |||
| 2034 | Ga0495647_0021925 | |||
| 2035 | Ga0495658_0093000 | |||
| 2036 | Ga0495613_0017437 | |||
| 2037 | Ga0495671_0020496 | |||
| 2038 | Ga0495649_0000018 | |||
| 2039 | Ga0495649_0003733 | |||
| 2040 | Ga0495660_0009229 | |||
| 2041 | Ga0495660_0011718 | |||
| 2042 | Ga0495581_0001231 | |||
| 2043 | Ga0495672_0006515 | |||
| 2044 | Ga0495687_000972 | |||
| 2045 | Ga0495687_006509 | |||
| 2046 | Ga0495684_0114587 | |||
| 2047 | Ga0495684_0135189 | |||
| 2048 | Ga0495686_0000052 | |||
| 2049 | Ga0495686_0016918 | |||
| 2050 | Ga0495593_0043130 | |||
| 2051 | Ga0495602_0162242 | |||
| 2052 | Ga0495614_0042691 | |||
| 2053 | Ga0495626_0019083 | |||
| 2054 | Ga0495626_0030834 | |||
| 2055 | Ga0496100_0113080 | |||
| 2056 | Ga0496101_0037780 | |||
| 2057 | Ga0496104_0026942 | |||
| 2058 | Ga0496104_0214547 | |||
| 2059 | Ga0496105_0118888 | |||
| 2060 | Ga0496106_0012494 | |||
| 2061 | Ga0496107_0011591 | |||
| 2062 | Ga0496107_0109398 | |||
| 2063 | Ga0496108_0005893 | |||
| 2064 | Ga0496108_0099821 | |||
| 2065 | Ga0496109_0006900 | |||
| 2066 | Ga0496109_0029081 | |||
| 2067 | Ga0496110_0137183 | |||
| 2068 | Ga0496110_0137968 | |||
| 2069 | Ga0496111_0042368 | |||
| 2070 | Ga0496112_0000236 | |||
| 2071 | Ga0496112_0023002 | |||
| 2072 | Ga0496115_0040835 | |||
| 2073 | Ga0496116_0070112 | |||
| 2074 | Ga0495678_003683 | |||
| 2075 | Ga0501042_0101295 | |||
| 2076 | Ga0501043_0000020 | |||
| 2077 | Ga0501046_0000039 | |||
| 2078 | Ga0501047_0000028 | |||
| 2079 | Ga0501048_0001183 | |||
| 2080 | Ga0501070_0143876 | |||
| 2081 | Ga0501198_000035 | |||
| 2082 | Ga0501222_000039 | |||
| 2083 | Ga0501223_000254 | |||
| 2084 | Ga0501080_0178880 | |||
| 2085 | Ga0501262_000906 | |||
| 2086 | Ga0501045_0030746 | |||
| 2087 | nmdc:mga0yw44_41248_c1 | |||
| 2088 | nmdc:mga0k408_171_c1 | |||
| 2089 | nmdc:mga0k408_18817_c1 | |||
| 2090 | nmdc:mga0k408_563_c2 | |||
| 2091 | nmdc:mga06z11_6500_c1 | |||
| 2092 | nmdc:mga07m45_17960_c2 | |||
| 2093 | nmdc:mga05p37_60287_c1 | |||
| 2094 | nmdc:mga09592_4095_c1 | |||
| 2095 | nmdc:mga0qj67_138537_c1 | |||
| 2096 | nmdc:mga08y16_164560_c1 | |||
| 2097 | nmdc:mga08y16_53021_c1 | |||
| 2098 | nmdc:mga08y16_9326_c1 | |||
| 2099 | nmdc:mga0n895_140025_c1 | |||
| 2100 | nmdc:mga0a205_30530_c1 | |||
| 2101 | Ga0495601_0010088 | |||
| 2102 | Ga0495595_0043292 | |||
| 2103 | Ga0495619_0091589 | |||
| 2104 | Ga0500644_0002460 | |||
| 2105 | Ga0500650_0059612 | |||
| 2106 | Ga0500593_000168 | |||
| 2107 | Ga0500594_0010869 | |||
| 2108 | Ga0500608_002485 | |||
| 2109 | Ga0500618_000037 | |||
| 2110 | Ga0500618_017345 | |||
| 2111 | Ga0500652_041654 | |||
| 2112 | Ga0500658_0003545 | |||
| 2113 | Ga0500559_0000017 | |||
| 2114 | Ga0500568_0007469 | |||
| 2115 | Ga0500577_0044331 | |||
| 2116 | Ga0500616_0011047 | |||
| 2117 | Ga0500622_0003035 | |||
| 2118 | Ga0500622_0009359 | |||
| 2119 | Ga0500624_000554 | |||
| 2120 | Ga0500645_000333 | |||
| 2121 | Ga0500645_002999 | |||
| 2122 | Ga0500587_001288 | |||
| 2123 | 2511245442 | |||
| 2124 | 2547370910 | |||
| 2125 | 2599478253 | |||
| 2126 | 2644305162 | |||
| 2127 | 2843692632 | |||
| 2128 | 2881103706 | |||
| 2129 | 2919438949 | |||
| 2130 | 2928080697 | |||
| 2131 | 2928150922 | |||
| 2132 | 2932082921 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dm3-assembly5.cif.gz_E | crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp | 0.9154 | 1 | 450 |
| 5dm3-assembly5.cif.gz_E | crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp | 0.9108 | 1 | 450 |
| 5dm3-assembly10.cif.gz_C | crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp | 0.905 | 2 | 450 |
| 5dm3-assembly11.cif.gz_D | crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp | 0.9045 | 1 | 450 |
| 5dm3-assembly10.cif.gz_C | crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp | 0.9028 | 2 | 450 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6X5K1_121_455_3.30.590.10 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain | 0.9527 | 115 | 450 | 3.30.590.10 |
| af_P0C7B6_183_520_3.30.590.10 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain | 0.9472 | 115 | 451 | 3.30.590.10 |
| af_P0C7B6_183_520_3.30.590.10 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain | 0.9417 | 115 | 451 | 3.30.590.10 |
| af_I6X5K1_121_455_3.30.590.10 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain | 0.9416 | 115 | 450 | 3.30.590.10 |
| af_P0C7B6_69_180_3.10.20.70 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain | 0.9094 | 2 | 110 | 3.10.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535PT47-F1-model_v4 | Glutamine synthetase | 0.9795 | 120 | 385 |
GO:0004356
|
| AF-A0A4Q3WZA9-F1-model_v4 | deleted | 0.9744 | 4 | 358 |
|
| AF-A0A535PT47-F1-model_v4 | Glutamine synthetase | 0.9723 | 120 | 385 |
GO:0004356
|
| AF-A0A2M7WPB7-F1-model_v4 | Glutamine synthetase | 0.967 | 112 | 340 |
GO:0004356
|
| AF-A0A509LGE4-F1-model_v4 | Glutamine synthetase | 0.966 | 2 | 320 |
GO:0004356
GO:0006542 |