F489449
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1068 | 559 | 2136 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0073023|Ga0495648_0073023_147_905 |
| Length | 252 |
| Sequence | MTGGSLPFLCQQQAYNFRPRYSVGFVLEENLMFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVELPGNGFAADVSRETLDCTAMNDLKSGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVARTENARAVEFRIRAPKELARYIAHKGSITVDGTSLTVNAVDGAEFLLTIIPHTLSETIMASYQPGRRVNLEVDLLARYLERLLLGDKAAEPTAGSTITESFLAQNGYLKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 52 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 101 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 103 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 112 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 113 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 114 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 115 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 116 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 117 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 122 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 134 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 135 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 136 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 137 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 138 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 139 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 140 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 141 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 142 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 143 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 144 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 145 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 146 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 147 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 148 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 149 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 150 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 151 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 152 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 153 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 154 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 155 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 156 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 157 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 158 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 159 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 160 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 161 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 162 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 163 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 164 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 165 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 166 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 167 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 168 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 169 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 170 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 171 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 172 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 173 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 174 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 175 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 176 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 177 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 253 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 254 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 255 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 256 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 259 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 260 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 261 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 262 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 263 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 278 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 281 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 282 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 283 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 284 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 285 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 286 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 287 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 288 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 289 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 290 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 291 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 292 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 293 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 294 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 295 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 296 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 297 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 298 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 299 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 300 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 301 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 302 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 303 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 304 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 305 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 306 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 307 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 308 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 309 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 310 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 311 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 312 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 313 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 314 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 315 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 316 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 317 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 318 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 319 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 320 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 321 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 322 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 323 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 324 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 325 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 326 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 327 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 328 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 329 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 330 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 331 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 332 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 333 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 334 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 335 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 336 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 337 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 338 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 339 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 340 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 341 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 342 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 343 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 344 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 345 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 346 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 347 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 348 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 349 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 350 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 351 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 352 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 353 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 354 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 355 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 356 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 357 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 358 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 359 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 360 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 361 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 362 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 363 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 364 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 365 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 366 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 367 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 368 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 369 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 370 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 371 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 372 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 373 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 374 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 375 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 376 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 377 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 378 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 379 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 380 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 381 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 382 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 383 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 384 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 385 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 386 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 387 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 388 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 389 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 390 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 391 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 392 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 393 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 394 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 395 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 396 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 397 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 398 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 399 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 400 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 401 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 402 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 403 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 404 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 405 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 406 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 407 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 408 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 409 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 410 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 411 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 412 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 413 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 414 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 415 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 416 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 417 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 418 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 419 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 420 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 421 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 422 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 423 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 424 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 425 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 426 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 427 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 428 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 429 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 430 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 431 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 432 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 433 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 434 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 435 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 436 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 437 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 438 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 439 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 440 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 441 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 442 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 443 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 444 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 445 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 446 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 447 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 448 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 449 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 450 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 451 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 452 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 453 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 454 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 455 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 456 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 457 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 458 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 459 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 460 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 461 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 462 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 463 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 464 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 465 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 466 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 467 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 468 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 469 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 470 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 471 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 472 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 473 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 474 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 475 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 476 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 477 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 478 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 479 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 480 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 481 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 482 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 483 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 484 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 485 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 486 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 487 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 488 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 489 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 490 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 491 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 492 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 493 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 494 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 495 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 496 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 497 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 498 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 499 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 500 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 501 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 502 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 503 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 504 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 505 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 506 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 507 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 508 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 509 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 510 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 511 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 512 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 513 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 514 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 515 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 516 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 517 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 518 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 519 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 520 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 521 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 522 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 523 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 524 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 525 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 526 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 527 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 528 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 529 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 530 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 531 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 532 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 533 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 534 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 535 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 536 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 537 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 538 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 539 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 540 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 541 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 542 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 543 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 544 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 545 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 546 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 547 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 548 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 549 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 550 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 551 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 552 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 553 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 554 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 555 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 556 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 557 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 558 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 559 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.22 |
| Metatranscriptomes | 0.66 |
| Isolates | 26.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 5.9 |
| Nodule | 2.9 |
| Rhizoplane | 7.49 |
| Rhizosphere | 69.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495648_0073023 | 3300046524 | Bacteria | 1982 |
| 2 | SwRhRL2b_contig_2478714 | 2162886007 | Bacteria | 1035 |
| 3 | JGI25162J39368_1005306 | 3300002737 | Bacteria | 2591 |
| 4 | JGI25162J39368_1005513 | 3300002737 | Bacteria | 2449 |
| 5 | JGI25154J39366_1004759 | 3300002738 | Bacteria | 2327 |
| 6 | JGI25163J39215_1001948 | 3300002771 | Bacteria | 2591 |
| 7 | JGI25163J39215_1002029 | 3300002771 | Bacteria | 2449 |
| 8 | JGI25164J39214_1002669 | 3300002772 | Bacteria | 2591 |
| 9 | JGI25164J39214_1002812 | 3300002772 | Bacteria | 2449 |
| 10 | JGI25165J46597_1005143 | 3300003214 | Bacteria | 2591 |
| 11 | JGI25165J46597_1005440 | 3300003214 | Bacteria | 2449 |
| 12 | rootH1_10001451 | 3300003323 | Bacteria | 19518 |
| 13 | rootH1_10025242 | 3300003323 | Bacteria | 17315 |
| 14 | Ga0055538_1000042 | 3300003751 | Bacteria | 164754 |
| 15 | Ga0055539_1000055 | 3300003752 | Bacteria | 164754 |
| 16 | Ga0055533_1000067 | 3300003756 | Bacteria | 164754 |
| 17 | Ga0055532_1000053 | 3300003758 | Bacteria | 164751 |
| 18 | Ga0055525_1000103 | 3300003759 | Bacteria | 134778 |
| 19 | Ga0055535_1002633 | 3300003761 | Bacteria | 5971 |
| 20 | Ga0055536_1002107 | 3300003781 | Bacteria | 11324 |
| 21 | Ga0055536_1013930 | 3300003781 | Bacteria | 2861 |
| 22 | Ga0055536_1017823 | 3300003781 | Bacteria | 2305 |
| 23 | Ga0055530_10004850 | 3300003791 | Bacteria | 6722 |
| 24 | Ga0055530_10015387 | 3300003791 | Bacteria | 2499 |
| 25 | Ga0055530_10015585 | 3300003791 | Bacteria | 2472 |
| 26 | Ga0055540_1000330 | 3300003792 | Bacteria | 41330 |
| 27 | Ga0055540_1000552 | 3300003792 | Bacteria | 27915 |
| 28 | Ga0055540_1009024 | 3300003792 | Bacteria | 3506 |
| 29 | Ga0055540_1021543 | 3300003792 | Bacteria | 1670 |
| 30 | Ga0055531_10000125 | 3300003794 | Bacteria | 86349 |
| 31 | Ga0055541_1000042 | 3300003841 | Bacteria | 164754 |
| 32 | Ga0058692_1017633 | 3300003856 | Bacteria | 1563 |
| 33 | Ga0065714_10003334 | 3300005288 | Bacteria | 11093 |
| 34 | Ga0065714_10012864 | 3300005288 | Bacteria | 2248 |
| 35 | Ga0065714_10086001 | 3300005288 | Bacteria | 2120 |
| 36 | Ga0065704_10009187 | 3300005289 | Bacteria | 4565 |
| 37 | Ga0065704_10032660 | 3300005289 | Bacteria | 1196 |
| 38 | Ga0065704_10161370 | 3300005289 | Bacteria | 1352 |
| 39 | Ga0065704_10212940 | 3300005289 | Bacteria | 1102 |
| 40 | Ga0065712_10011834 | 3300005290 | Bacteria | 2451 |
| 41 | Ga0065712_10068081 | 3300005290 | Bacteria | 15301 |
| 42 | Ga0070670_100000686 | 3300005331 | Bacteria | 26278 |
| 43 | Ga0070661_100000664 | 3300005344 | Bacteria | 25245 |
| 44 | Ga0070669_100000417 | 3300005353 | Bacteria | 32587 |
| 45 | Ga0070669_100001254 | 3300005353 | Bacteria | 18423 |
| 46 | Ga0070669_100283914 | 3300005353 | Bacteria | 1327 |
| 47 | Ga0070673_100681125 | 3300005364 | Bacteria | 943 |
| 48 | Ga0070663_100337175 | 3300005455 | Bacteria | 1217 |
| 49 | Ga0070662_100000042 | 3300005457 | Bacteria | 72274 |
| 50 | Ga0070662_100045050 | 3300005457 | Bacteria | 3163 |
| 51 | Ga0070665_100031276 | 3300005548 | Bacteria | 5357 |
| 52 | Ga0070665_100150735 | 3300005548 | Bacteria | 2328 |
| 53 | Ga0070664_100000733 | 3300005564 | Bacteria | 25237 |
| 54 | Ga0068854_100007019 | 3300005578 | Bacteria | 7185 |
| 55 | Ga0068859_101243290 | 3300005617 | Bacteria | 820 |
| 56 | Ga0068851_10000002 | 3300005834 | Bacteria | 302756 |
| 57 | Ga0075432_10012148 | 3300006058 | Bacteria | 2927 |
| 58 | Ga0075432_10018695 | 3300006058 | Bacteria | 2364 |
| 59 | Ga0075432_10102147 | 3300006058 | Bacteria | 1060 |
| 60 | Ga0075362_10070790 | 3300006177 | Bacteria | 1592 |
| 61 | Ga0075362_10132324 | 3300006177 | Bacteria | 1187 |
| 62 | Ga0075369_10089781 | 3300006186 | Bacteria | 1370 |
| 63 | Ga0097620_101243042 | 3300006931 | Bacteria | 820 |
| 64 | Ga0099823_1000360 | 3300006944 | Bacteria | 28884 |
| 65 | Ga0079104_1000478 | 3300006946 | Bacteria | 44469 |
| 66 | Ga0079104_1000630 | 3300006946 | Bacteria | 34371 |
| 67 | Ga0079104_1018176 | 3300006946 | Bacteria | 1999 |
| 68 | Ga0105251_10000011 | 3300009011 | Bacteria | 180176 |
| 69 | Ga0105251_10000163 | 3300009011 | Bacteria | 68706 |
| 70 | Ga0105251_10003296 | 3300009011 | Bacteria | 11815 |
| 71 | Ga0105251_10022564 | 3300009011 | Bacteria | 3265 |
| 72 | Ga0105251_10034835 | 3300009011 | Bacteria | 2488 |
| 73 | Ga0105251_10047747 | 3300009011 | Bacteria | 2056 |
| 74 | Ga0105251_10058309 | 3300009011 | Bacteria | 1823 |
| 75 | Ga0105251_10072165 | 3300009011 | Bacteria | 1605 |
| 76 | Ga0105244_10003742 | 3300009036 | Bacteria | 10742 |
| 77 | Ga0105244_10007401 | 3300009036 | Bacteria | 6978 |
| 78 | Ga0105244_10010383 | 3300009036 | Bacteria | 5650 |
| 79 | Ga0105244_10040053 | 3300009036 | Bacteria | 2435 |
| 80 | Ga0105244_10043153 | 3300009036 | Bacteria | 2328 |
| 81 | Ga0105244_10044573 | 3300009036 | Bacteria | 2285 |
| 82 | Ga0105244_10045278 | 3300009036 | Bacteria | 2264 |
| 83 | Ga0105244_10078772 | 3300009036 | Bacteria | 1633 |
| 84 | Ga0105244_10099077 | 3300009036 | Bacteria | 1427 |
| 85 | Ga0105250_10001071 | 3300009092 | Bacteria | 15533 |
| 86 | Ga0105250_10013916 | 3300009092 | Bacteria | 3313 |
| 87 | Ga0105250_10024365 | 3300009092 | Bacteria | 2438 |
| 88 | Ga0105250_10025701 | 3300009092 | Bacteria | 2373 |
| 89 | Ga0105250_10027894 | 3300009092 | Bacteria | 2275 |
| 90 | Ga0105250_10192138 | 3300009092 | Bacteria | 859 |
| 91 | Ga0105245_10740487 | 3300009098 | Bacteria | 1018 |
| 92 | Ga0105243_10000188 | 3300009148 | Bacteria | 71863 |
| 93 | Ga0105243_10001384 | 3300009148 | Bacteria | 21521 |
| 94 | Ga0105243_10048181 | 3300009148 | Bacteria | 3358 |
| 95 | Ga0105243_10070431 | 3300009148 | Bacteria | 2824 |
| 96 | Ga0105243_10102040 | 3300009148 | Bacteria | 2383 |
| 97 | Ga0105242_10000489 | 3300009176 | Bacteria | 31476 |
| 98 | Ga0105248_10021285 | 3300009177 | Bacteria | 7187 |
| 99 | Ga0105237_10002187 | 3300009545 | Bacteria | 24489 |
| 100 | Ga0105237_10201739 | 3300009545 | Bacteria | 1989 |
| 101 | Ga0105249_10821813 | 3300009553 | Bacteria | 994 |
| 102 | Ga0105246_10032547 | 3300011119 | Bacteria | 3458 |
| 103 | Ga0105246_10038380 | 3300011119 | Bacteria | 3220 |
| 104 | Ga0105246_10052541 | 3300011119 | Bacteria | 2801 |
| 105 | Ga0105246_10054731 | 3300011119 | Bacteria | 2751 |
| 106 | Ga0157336_1000676 | 3300012477 | Bacteria | 1592 |
| 107 | Ga0157345_1000583 | 3300012498 | Bacteria | 3189 |
| 108 | Ga0157373_10012234 | 3300013100 | Bacteria | 6309 |
| 109 | Ga0157373_10082456 | 3300013100 | Bacteria | 2267 |
| 110 | Ga0157373_10085261 | 3300013100 | Bacteria | 2226 |
| 111 | Ga0157371_10000243 | 3300013102 | Bacteria | 77959 |
| 112 | Ga0157371_10035661 | 3300013102 | Bacteria | 3565 |
| 113 | Ga0157371_10081760 | 3300013102 | Bacteria | 2287 |
| 114 | Ga0157371_10124307 | 3300013102 | Bacteria | 1835 |
| 115 | Ga0157371_10396060 | 3300013102 | Bacteria | 1010 |
| 116 | Ga0157371_10573519 | 3300013102 | Bacteria | 838 |
| 117 | Ga0157371_10573520 | 3300013102 | Bacteria | 838 |
| 118 | Ga0157370_10000199 | 3300013104 | Bacteria | 75511 |
| 119 | Ga0157370_10140916 | 3300013104 | Bacteria | 2246 |
| 120 | Ga0157370_10141103 | 3300013104 | Bacteria | 2245 |
| 121 | Ga0157370_10919384 | 3300013104 | Bacteria | 794 |
| 122 | Ga0157369_10109808 | 3300013105 | Bacteria | 2932 |
| 123 | Ga0157369_10178907 | 3300013105 | Bacteria | 2232 |
| 124 | Ga0157369_10648022 | 3300013105 | Bacteria | 1089 |
| 125 | Ga0157369_10668585 | 3300013105 | Bacteria | 1070 |
| 126 | Ga0157369_10713790 | 3300013105 | Bacteria | 1032 |
| 127 | Ga0163162_10164309 | 3300013306 | Bacteria | 2343 |
| 128 | Ga0163162_10176131 | 3300013306 | Bacteria | 2264 |
| 129 | Ga0157372_10001840 | 3300013307 | Bacteria | 22986 |
| 130 | Ga0157372_10042028 | 3300013307 | Bacteria | 5054 |
| 131 | Ga0182008_10002892 | 3300014497 | Bacteria | 10626 |
| 132 | Ga0182008_10043820 | 3300014497 | Bacteria | 2227 |
| 133 | Ga0182008_10051354 | 3300014497 | Bacteria | 2045 |
| 134 | Ga0182008_10052508 | 3300014497 | Bacteria | 2020 |
| 135 | Ga0182006_1005570 | 3300015261 | Bacteria | 5980 |
| 136 | Ga0182006_1031266 | 3300015261 | Bacteria | 2146 |
| 137 | Ga0182006_1031761 | 3300015261 | Bacteria | 2126 |
| 138 | Ga0182006_1049210 | 3300015261 | Bacteria | 1627 |
| 139 | Ga0182006_1108978 | 3300015261 | Bacteria | 974 |
| 140 | Ga0182007_10019444 | 3300015262 | Bacteria | 2441 |
| 141 | Ga0182007_10026349 | 3300015262 | Bacteria | 2016 |
| 142 | Ga0182005_1008848 | 3300015265 | Bacteria | 2955 |
| 143 | Ga0182005_1014004 | 3300015265 | Bacteria | 2250 |
| 144 | Ga0182005_1038979 | 3300015265 | Bacteria | 1293 |
| 145 | Ga0163161_10110357 | 3300017792 | Bacteria | 2056 |
| 146 | Ga0163161_10742042 | 3300017792 | Bacteria | 821 |
| 147 | Ga0163161_10873663 | 3300017792 | Bacteria | 760 |
| 148 | Ga0209435_103159 | 3300025206 | Bacteria | 1888 |
| 149 | Ga0209760_100058 | 3300025207 | Bacteria | 98827 |
| 150 | Ga0209760_100060 | 3300025207 | Bacteria | 97274 |
| 151 | Ga0209784_100060 | 3300025224 | Bacteria | 164838 |
| 152 | Ga0209566_100075 | 3300025225 | Bacteria | 164838 |
| 153 | Ga0209566_100644 | 3300025225 | Bacteria | 21095 |
| 154 | Ga0209674_100100 | 3300025226 | Bacteria | 164838 |
| 155 | Ga0209147_100096 | 3300025229 | Bacteria | 164838 |
| 156 | Ga0209563_100118 | 3300025230 | Bacteria | 131627 |
| 157 | Ga0209563_100242 | 3300025230 | Bacteria | 26179 |
| 158 | Ga0207427_100056 | 3300025231 | Bacteria | 204343 |
| 159 | Ga0207427_100063 | 3300025231 | Bacteria | 177711 |
| 160 | Ga0209437_100065 | 3300025233 | Bacteria | 332417 |
| 161 | Ga0209437_100133 | 3300025233 | Bacteria | 178493 |
| 162 | Ga0209258_100221 | 3300025242 | Bacteria | 108497 |
| 163 | Ga0209646_1000230 | 3300025246 | Bacteria | 59499 |
| 164 | Ga0209677_100057 | 3300025253 | Bacteria | 164838 |
| 165 | Ga0209759_1001811 | 3300025256 | Bacteria | 10796 |
| 166 | Ga0209233_1000085 | 3300025261 | Bacteria | 333078 |
| 167 | Ga0209233_1000133 | 3300025261 | Bacteria | 202716 |
| 168 | Ga0209675_1004836 | 3300025291 | Bacteria | 5837 |
| 169 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 170 | Ga0209676_1000314 | 3300025292 | Bacteria | 94905 |
| 171 | Ga0209676_1000337 | 3300025292 | Bacteria | 89361 |
| 172 | Ga0209676_1001941 | 3300025292 | Bacteria | 16658 |
| 173 | Ga0209676_1018983 | 3300025292 | Bacteria | 2379 |
| 174 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 175 | Ga0209050_1000080 | 3300025298 | Bacteria | 275154 |
| 176 | Ga0209050_1000106 | 3300025298 | Bacteria | 224396 |
| 177 | Ga0209050_1002168 | 3300025298 | Bacteria | 17764 |
| 178 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 179 | Ga0209051_1000260 | 3300025303 | Bacteria | 88213 |
| 180 | Ga0209051_1000283 | 3300025303 | Bacteria | 82731 |
| 181 | Ga0209051_1023520 | 3300025303 | Bacteria | 2558 |
| 182 | Ga0209257_1000185 | 3300025304 | Bacteria | 155047 |
| 183 | Ga0207656_10000010 | 3300025321 | Bacteria | 192224 |
| 184 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 185 | Ga0207696_1000118 | 3300025711 | Bacteria | 147902 |
| 186 | Ga0207696_1000168 | 3300025711 | Bacteria | 103496 |
| 187 | Ga0207696_1000339 | 3300025711 | Bacteria | 48686 |
| 188 | Ga0207696_1006336 | 3300025711 | Bacteria | 4778 |
| 189 | Ga0207696_1007078 | 3300025711 | Bacteria | 4435 |
| 190 | Ga0207696_1015131 | 3300025711 | Bacteria | 2623 |
| 191 | Ga0207655_1000104 | 3300025728 | Bacteria | 184765 |
| 192 | Ga0207655_1000120 | 3300025728 | Bacteria | 157018 |
| 193 | Ga0207655_1000415 | 3300025728 | Bacteria | 58289 |
| 194 | Ga0207655_1000606 | 3300025728 | Bacteria | 43412 |
| 195 | Ga0207655_1000921 | 3300025728 | Bacteria | 30542 |
| 196 | Ga0207655_1001228 | 3300025728 | Bacteria | 24726 |
| 197 | Ga0207655_1001571 | 3300025728 | Bacteria | 20542 |
| 198 | Ga0207655_1005549 | 3300025728 | Bacteria | 8553 |
| 199 | Ga0207655_1006374 | 3300025728 | Bacteria | 7832 |
| 200 | Ga0207655_1030279 | 3300025728 | Bacteria | 2519 |
| 201 | Ga0207655_1037818 | 3300025728 | Bacteria | 2119 |
| 202 | Ga0207655_1075129 | 3300025728 | Bacteria | 1241 |
| 203 | Ga0207655_1087892 | 3300025728 | Bacteria | 1101 |
| 204 | Ga0207713_1000049 | 3300025735 | Bacteria | 227882 |
| 205 | Ga0207713_1000073 | 3300025735 | Bacteria | 181519 |
| 206 | Ga0207713_1000261 | 3300025735 | Bacteria | 65024 |
| 207 | Ga0207713_1001031 | 3300025735 | Bacteria | 24228 |
| 208 | Ga0207713_1003024 | 3300025735 | Bacteria | 11729 |
| 209 | Ga0207713_1004132 | 3300025735 | Bacteria | 9552 |
| 210 | Ga0207713_1004152 | 3300025735 | Bacteria | 9518 |
| 211 | Ga0207713_1005408 | 3300025735 | Bacteria | 7997 |
| 212 | Ga0207713_1007215 | 3300025735 | Bacteria | 6611 |
| 213 | Ga0207713_1008483 | 3300025735 | Bacteria | 5914 |
| 214 | Ga0207713_1020756 | 3300025735 | Bacteria | 3171 |
| 215 | Ga0207713_1024817 | 3300025735 | Bacteria | 2783 |
| 216 | Ga0207713_1036082 | 3300025735 | Bacteria | 2125 |
| 217 | Ga0207713_1039597 | 3300025735 | Bacteria | 1986 |
| 218 | Ga0207713_1044187 | 3300025735 | Bacteria | 1832 |
| 219 | Ga0207713_1075843 | 3300025735 | Bacteria | 1225 |
| 220 | Ga0207705_10244038 | 3300025909 | Bacteria | 1369 |
| 221 | Ga0207671_10000380 | 3300025914 | Bacteria | 62950 |
| 222 | Ga0207649_10000041 | 3300025920 | Bacteria | 117781 |
| 223 | Ga0207649_10723761 | 3300025920 | Bacteria | 773 |
| 224 | Ga0207681_10000342 | 3300025923 | Bacteria | 33558 |
| 225 | Ga0207681_10006860 | 3300025923 | Bacteria | 6984 |
| 226 | Ga0207681_10283672 | 3300025923 | Bacteria | 1305 |
| 227 | Ga0207650_10000278 | 3300025925 | Bacteria | 53364 |
| 228 | Ga0207650_10000324 | 3300025925 | Bacteria | 46570 |
| 229 | Ga0207706_10000128 | 3300025933 | Bacteria | 81615 |
| 230 | Ga0207706_10012214 | 3300025933 | Bacteria | 7827 |
| 231 | Ga0207686_10001625 | 3300025934 | Bacteria | 12587 |
| 232 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 233 | Ga0207709_10000343 | 3300025935 | Bacteria | 48072 |
| 234 | Ga0207709_10046034 | 3300025935 | Bacteria | 2645 |
| 235 | Ga0207709_10278852 | 3300025935 | Bacteria | 1234 |
| 236 | Ga0207669_10130435 | 3300025937 | Bacteria | 1726 |
| 237 | Ga0207711_10057873 | 3300025941 | Bacteria | 3333 |
| 238 | Ga0207679_10000081 | 3300025945 | Bacteria | 84888 |
| 239 | Ga0207712_10607671 | 3300025961 | Bacteria | 946 |
| 240 | Ga0207640_10008549 | 3300025981 | Bacteria | 5686 |
| 241 | Ga0209281_1000070 | 3300027111 | Bacteria | 277098 |
| 242 | Ga0209281_1000127 | 3300027111 | Bacteria | 200036 |
| 243 | Ga0209281_1002082 | 3300027111 | Bacteria | 8960 |
| 244 | Ga0209281_1011659 | 3300027111 | Bacteria | 1959 |
| 245 | Ga0209973_1008316 | 3300027252 | Bacteria | 1181 |
| 246 | Ga0209389_1000020 | 3300027296 | Bacteria | 172003 |
| 247 | Ga0209389_1065562 | 3300027296 | Bacteria | 2125 |
| 248 | Ga0209371_1000228 | 3300027312 | Bacteria | 72315 |
| 249 | Ga0209371_1000302 | 3300027312 | Bacteria | 55126 |
| 250 | Ga0209371_1004867 | 3300027312 | Bacteria | 5619 |
| 251 | Ga0209969_1007382 | 3300027360 | Bacteria | 1553 |
| 252 | Ga0209996_1002060 | 3300027395 | Bacteria | 2480 |
| 253 | Ga0209995_1002220 | 3300027471 | Bacteria | 3057 |
| 254 | Ga0209999_1012969 | 3300027543 | Bacteria | 1511 |
| 255 | Ga0209999_1042362 | 3300027543 | Bacteria | 854 |
| 256 | Ga0207428_10014173 | 3300027907 | Bacteria | 6938 |
| 257 | Ga0207428_10050869 | 3300027907 | Bacteria | 3312 |
| 258 | Ga0207428_10101513 | 3300027907 | Bacteria | 2223 |
| 259 | Ga0207428_10109854 | 3300027907 | Bacteria | 2124 |
| 260 | Ga0207428_10146760 | 3300027907 | Bacteria | 1797 |
| 261 | Ga0207428_10160413 | 3300027907 | Bacteria | 1708 |
| 262 | Ga0268266_10007379 | 3300028379 | Bacteria | 9928 |
| 263 | Ga0268266_10447827 | 3300028379 | Bacteria | 1227 |
| 264 | Ga0268256_1000188 | 3300030500 | Bacteria | 72315 |
| 265 | Ga0268256_1000669 | 3300030500 | Bacteria | 26000 |
| 266 | Ga0268256_1006735 | 3300030500 | Bacteria | 4223 |
| 267 | Ga0316177_1078431 | 3300030731 | Bacteria | 2742 |
| 268 | Ga0314311_1094938 | 3300030733 | Bacteria | 6797 |
| 269 | Ga0316179_1075362 | 3300030734 | Bacteria | 1196 |
| 270 | Ga0316178_1011341 | 3300030735 | Bacteria | 8135 |
| 271 | Ga0316183_1006673 | 3300030742 | Bacteria | 837 |
| 272 | Ga0316183_1205059 | 3300030742 | Bacteria | 1714 |
| 273 | Ga0316181_1020879 | 3300030744 | Bacteria | 7161 |
| 274 | Ga0316181_1093595 | 3300030744 | Bacteria | 3354 |
| 275 | Ga0265331_10007682 | 3300031250 | Bacteria | 6207 |
| 276 | Ga0265327_10001699 | 3300031251 | Bacteria | 26311 |
| 277 | Ga0265327_10003331 | 3300031251 | Bacteria | 15531 |
| 278 | Ga0265327_10003570 | 3300031251 | Bacteria | 14714 |
| 279 | Ga0265316_10002392 | 3300031344 | Bacteria | 19536 |
| 280 | Ga0307408_100000013 | 3300031548 | Bacteria | 386212 |
| 281 | Ga0307408_100000192 | 3300031548 | Bacteria | 65993 |
| 282 | Ga0307408_100059501 | 3300031548 | Bacteria | 2780 |
| 283 | Ga0307408_100104143 | 3300031548 | Bacteria | 2167 |
| 284 | Ga0307408_101040811 | 3300031548 | Bacteria | 756 |
| 285 | Ga0316575_10002085 | 3300031665 | Bacteria | 6677 |
| 286 | Ga0316575_10054629 | 3300031665 | Bacteria | 1590 |
| 287 | Ga0307516_10100762 | 3300031730 | Bacteria | 2704 |
| 288 | Ga0307405_10079322 | 3300031731 | Bacteria | 2139 |
| 289 | Ga0307405_10084243 | 3300031731 | Bacteria | 2086 |
| 290 | Ga0307413_10076951 | 3300031824 | Bacteria | 2122 |
| 291 | Ga0307406_10001571 | 3300031901 | Bacteria | 12584 |
| 292 | Ga0307407_10060628 | 3300031903 | Bacteria | 2208 |
| 293 | Ga0307412_10275955 | 3300031911 | Bacteria | 1317 |
| 294 | Ga0307412_10852062 | 3300031911 | Bacteria | 795 |
| 295 | Ga0307409_100164583 | 3300031995 | Bacteria | 1944 |
| 296 | Ga0307416_100355594 | 3300032002 | Bacteria | 1484 |
| 297 | Ga0307416_100810323 | 3300032002 | Bacteria | 1032 |
| 298 | Ga0307416_101578477 | 3300032002 | Bacteria | 762 |
| 299 | Ga0307414_10014793 | 3300032004 | Bacteria | 4690 |
| 300 | Ga0307414_10079818 | 3300032004 | Bacteria | 2390 |
| 301 | Ga0307414_10095095 | 3300032004 | Bacteria | 2225 |
| 302 | Ga0307411_10032563 | 3300032005 | Bacteria | 3222 |
| 303 | Ga0307411_10080529 | 3300032005 | Bacteria | 2239 |
| 304 | Ga0316593_10122454 | 3300032168 | Bacteria | 935 |
| 305 | Ga0307510_10067813 | 3300033180 | Bacteria | 3587 |
| 306 | Ga0316574_0009395 | 3300035398 | Bacteria | 5477 |
| 307 | Ga0316582_0138732 | 3300036647 | Bacteria | 1638 |
| 308 | Ga0316582_0439337 | 3300036647 | Bacteria | 899 |
| 309 | Ga0316584_0016769 | 3300036712 | Bacteria | 5255 |
| 310 | Ga0316584_0150926 | 3300036712 | Bacteria | 1730 |
| 311 | Ga0237819_00789 | 3300038705 | Bacteria | 10134 |
| 312 | Ga0400485_00908 | 3300038735 | Bacteria | 2719 |
| 313 | Ga0400486_03367 | 3300038742 | Bacteria | 4720 |
| 314 | Ga0400483_245346 | 3300039062 | Bacteria | 1034 |
| 315 | Ga0400483_271482 | 3300039062 | Bacteria | 3860 |
| 316 | Ga0400489_54721 | 3300039093 | Bacteria | 1400 |
| 317 | Ga0439436_0056726 | 3300041404 | Bacteria | 1099 |
| 318 | Ga0439438_002874 | 3300041405 | Bacteria | 7164 |
| 319 | Ga0439438_005405 | 3300041405 | Bacteria | 4705 |
| 320 | Ga0439438_013588 | 3300041405 | Bacteria | 2450 |
| 321 | Ga0439438_019662 | 3300041405 | Bacteria | 1906 |
| 322 | Ga0439438_020305 | 3300041405 | Bacteria | 1865 |
| 323 | Ga0439438_022354 | 3300041405 | Bacteria | 1754 |
| 324 | Ga0439438_025244 | 3300041405 | Bacteria | 1621 |
| 325 | Ga0439447_005046 | 3300041407 | Bacteria | 4442 |
| 326 | Ga0439447_008010 | 3300041407 | Bacteria | 3303 |
| 327 | Ga0439447_013421 | 3300041407 | Bacteria | 2323 |
| 328 | Ga0439447_013584 | 3300041407 | Bacteria | 2305 |
| 329 | Ga0439466_0004914 | 3300041411 | Bacteria | 5136 |
| 330 | Ga0439466_0006573 | 3300041411 | Bacteria | 4416 |
| 331 | Ga0439466_0020358 | 3300041411 | Bacteria | 2364 |
| 332 | Ga0439466_0022380 | 3300041411 | Bacteria | 2231 |
| 333 | Ga0439466_0027219 | 3300041411 | Bacteria | 1981 |
| 334 | Ga0439466_0035356 | 3300041411 | Bacteria | 1690 |
| 335 | Ga0439466_0050004 | 3300041411 | Bacteria | 1371 |
| 336 | Ga0439466_0057743 | 3300041411 | Bacteria | 1256 |
| 337 | Ga0439465_0183859 | 3300041413 | Bacteria | 757 |
| 338 | Ga0451843_0221753 | 3300041509 | Bacteria | 1607 |
| 339 | Ga0451855_1859058 | 3300041511 | Bacteria | 876 |
| 340 | Ga0439437_000899 | 3300042000 | Bacteria | 3091 |
| 341 | Ga0439432_002353 | 3300042006 | Bacteria | 7134 |
| 342 | Ga0439432_006366 | 3300042006 | Bacteria | 4223 |
| 343 | Ga0439432_012974 | 3300042006 | Bacteria | 2838 |
| 344 | Ga0439432_020988 | 3300042006 | Bacteria | 2168 |
| 345 | Ga0439432_027068 | 3300042006 | Bacteria | 1874 |
| 346 | Ga0439432_126370 | 3300042006 | Bacteria | 755 |
| 347 | Ga0439449_0104606 | 3300042007 | Bacteria | 1047 |
| 348 | Ga0439451_000464 | 3300042009 | Bacteria | 7884 |
| 349 | Ga0439452_007545 | 3300042010 | Bacteria | 3329 |
| 350 | Ga0439452_013254 | 3300042010 | Bacteria | 2319 |
| 351 | Ga0439452_013601 | 3300042010 | Bacteria | 2280 |
| 352 | Ga0439452_013880 | 3300042010 | Bacteria | 2251 |
| 353 | Ga0439452_015689 | 3300042010 | Bacteria | 2071 |
| 354 | Ga0439456_000103 | 3300042013 | Bacteria | 28631 |
| 355 | Ga0439456_007236 | 3300042013 | Bacteria | 2274 |
| 356 | Ga0439463_000187 | 3300042016 | Bacteria | 16491 |
| 357 | Ga0439463_000495 | 3300042016 | Bacteria | 11003 |
| 358 | Ga0439463_008136 | 3300042016 | Bacteria | 2586 |
| 359 | Ga0450911_000022 | 3300042115 | Bacteria | 91239 |
| 360 | Ga0450911_002724 | 3300042115 | Bacteria | 3355 |
| 361 | Ga0450911_003507 | 3300042115 | Bacteria | 2750 |
| 362 | Ga0450923_053418 | 3300042125 | Bacteria | 871 |
| 363 | Ga0450890_007951 | 3300042127 | Bacteria | 1356 |
| 364 | Ga0450902_000456 | 3300042137 | Bacteria | 5068 |
| 365 | Ga0450902_001945 | 3300042137 | Bacteria | 2881 |
| 366 | Ga0450903_003615 | 3300042138 | Bacteria | 2669 |
| 367 | Ga0450904_001485 | 3300042139 | Bacteria | 3253 |
| 368 | Ga0450904_002387 | 3300042139 | Bacteria | 2254 |
| 369 | Ga0450905_000070 | 3300042142 | Bacteria | 9618 |
| 370 | Ga0450906_004475 | 3300042145 | Bacteria | 2929 |
| 371 | Ga0450907_002607 | 3300042146 | Bacteria | 3376 |
| 372 | Ga0450907_003068 | 3300042146 | Bacteria | 3036 |
| 373 | Ga0450910_004219 | 3300042147 | Bacteria | 1937 |
| 374 | Ga0439446_0000864 | 3300042156 | Bacteria | 6495 |
| 375 | Ga0439446_0002450 | 3300042156 | Bacteria | 4454 |
| 376 | Ga0439446_0012710 | 3300042156 | Bacteria | 2302 |
| 377 | Ga0439446_0013034 | 3300042156 | Bacteria | 2276 |
| 378 | Ga0439446_0017685 | 3300042156 | Bacteria | 1993 |
| 379 | Ga0450908_006061 | 3300042184 | Bacteria | 2307 |
| 380 | Ga0450909_002548 | 3300042185 | Bacteria | 2581 |
| 381 | Ga0450909_005861 | 3300042185 | Bacteria | 1772 |
| 382 | Ga0439434_0007187 | 3300042435 | Bacteria | 3262 |
| 383 | Ga0439434_0025739 | 3300042435 | Bacteria | 1776 |
| 384 | Ga0439459_0017311 | 3300042438 | Bacteria | 1341 |
| 385 | Ga0439464_0108102 | 3300042439 | Bacteria | 849 |
| 386 | Ga0439460_0001891 | 3300042461 | Bacteria | 4995 |
| 387 | Ga0439460_0008816 | 3300042461 | Bacteria | 2550 |
| 388 | Ga0439460_0023645 | 3300042461 | Bacteria | 1696 |
| 389 | Ga0450893_0008181 | 3300042532 | Bacteria | 1701 |
| 390 | Ga0451577_0077381 | 3300042876 | Bacteria | 2966 |
| 391 | Ga0451577_0719363 | 3300042876 | Bacteria | 904 |
| 392 | Ga0439440_0001951 | 3300042993 | Bacteria | 3833 |
| 393 | Ga0466961_0148238 | 3300044693 | Bacteria | 1466 |
| 394 | Ga0453684_0001596 | 3300044712 | Bacteria | 62273 |
| 395 | Ga0453684_0006330 | 3300044712 | Bacteria | 22598 |
| 396 | Ga0453684_0144478 | 3300044712 | Bacteria | 2836 |
| 397 | Ga0453684_0215480 | 3300044712 | Bacteria | 2228 |
| 398 | Ga0451576_0000174 | 3300045051 | Bacteria | 162062 |
| 399 | Ga0495617_006470 | 3300046452 | Bacteria | 4104 |
| 400 | Ga0495617_009460 | 3300046452 | Bacteria | 3347 |
| 401 | Ga0495617_023101 | 3300046452 | Bacteria | 2101 |
| 402 | Ga0495627_000037 | 3300046453 | Bacteria | 198542 |
| 403 | Ga0495627_000291 | 3300046453 | Bacteria | 49966 |
| 404 | Ga0495627_010669 | 3300046453 | Bacteria | 3330 |
| 405 | Ga0495627_011003 | 3300046453 | Bacteria | 3261 |
| 406 | Ga0495627_012131 | 3300046453 | Bacteria | 3068 |
| 407 | Ga0495627_047436 | 3300046453 | Bacteria | 1302 |
| 408 | Ga0495603_0038509 | 3300046455 | Bacteria | 2866 |
| 409 | Ga0495603_0158086 | 3300046455 | Bacteria | 1315 |
| 410 | Ga0495590_0015406 | 3300046457 | Bacteria | 2775 |
| 411 | Ga0495590_0020517 | 3300046457 | Bacteria | 2347 |
| 412 | Ga0495590_0029866 | 3300046457 | Bacteria | 1910 |
| 413 | Ga0495591_000036 | 3300046458 | Bacteria | 167479 |
| 414 | Ga0495591_000753 | 3300046458 | Bacteria | 23393 |
| 415 | Ga0495591_002445 | 3300046458 | Bacteria | 10328 |
| 416 | Ga0495591_002891 | 3300046458 | Bacteria | 9213 |
| 417 | Ga0495591_009904 | 3300046458 | Bacteria | 3743 |
| 418 | Ga0495591_010733 | 3300046458 | Bacteria | 3524 |
| 419 | Ga0495591_018415 | 3300046458 | Bacteria | 2369 |
| 420 | Ga0495591_019925 | 3300046458 | Bacteria | 2231 |
| 421 | Ga0495629_0193868 | 3300046459 | Bacteria | 1406 |
| 422 | Ga0495638_0031267 | 3300046460 | Bacteria | 3421 |
| 423 | Ga0495638_0045618 | 3300046460 | Bacteria | 2756 |
| 424 | Ga0495638_0049486 | 3300046460 | Bacteria | 2627 |
| 425 | Ga0495638_0100145 | 3300046460 | Bacteria | 1734 |
| 426 | Ga0495638_0113834 | 3300046460 | Bacteria | 1604 |
| 427 | Ga0495638_0248350 | 3300046460 | Bacteria | 982 |
| 428 | Ga0495653_0001298 | 3300046463 | Bacteria | 19360 |
| 429 | Ga0495653_0046779 | 3300046463 | Bacteria | 3349 |
| 430 | Ga0495650_0000311 | 3300046471 | Bacteria | 87755 |
| 431 | Ga0495650_0003191 | 3300046471 | Bacteria | 12212 |
| 432 | Ga0495650_0010347 | 3300046471 | Bacteria | 5212 |
| 433 | Ga0495650_0027431 | 3300046471 | Bacteria | 2631 |
| 434 | Ga0495650_0036991 | 3300046471 | Bacteria | 2129 |
| 435 | Ga0495605_0000033 | 3300046474 | Bacteria | 209203 |
| 436 | Ga0495605_0000209 | 3300046474 | Bacteria | 71906 |
| 437 | Ga0495605_0001216 | 3300046474 | Bacteria | 17156 |
| 438 | Ga0495605_0002128 | 3300046474 | Bacteria | 12385 |
| 439 | Ga0495605_0016035 | 3300046474 | Bacteria | 4064 |
| 440 | Ga0495605_0030986 | 3300046474 | Bacteria | 2735 |
| 441 | Ga0495605_0051663 | 3300046474 | Bacteria | 2000 |
| 442 | Ga0495605_0079791 | 3300046474 | Bacteria | 1532 |
| 443 | Ga0495605_0166072 | 3300046474 | Bacteria | 977 |
| 444 | Ga0495639_0000248 | 3300046475 | Bacteria | 26780 |
| 445 | Ga0495639_0109206 | 3300046475 | Bacteria | 1311 |
| 446 | Ga0495584_0038504 | 3300046491 | Bacteria | 2416 |
| 447 | Ga0495584_0039709 | 3300046491 | Bacteria | 2377 |
| 448 | Ga0495584_0041802 | 3300046491 | Bacteria | 2313 |
| 449 | Ga0495584_0042048 | 3300046491 | Bacteria | 2306 |
| 450 | Ga0495584_0044790 | 3300046491 | Bacteria | 2232 |
| 451 | Ga0495584_0051173 | 3300046491 | Bacteria | 2080 |
| 452 | Ga0495584_0066506 | 3300046491 | Bacteria | 1812 |
| 453 | Ga0495585_0002501 | 3300046492 | Bacteria | 13087 |
| 454 | Ga0495585_0022154 | 3300046492 | Bacteria | 3647 |
| 455 | Ga0495585_0089473 | 3300046492 | Bacteria | 1659 |
| 456 | Ga0495585_0106987 | 3300046492 | Bacteria | 1490 |
| 457 | Ga0495585_0153449 | 3300046492 | Bacteria | 1199 |
| 458 | Ga0495594_0016504 | 3300046499 | Bacteria | 3890 |
| 459 | Ga0495594_0181063 | 3300046499 | Bacteria | 1199 |
| 460 | Ga0495596_0000258 | 3300046500 | Bacteria | 35383 |
| 461 | Ga0495596_0063601 | 3300046500 | Bacteria | 1435 |
| 462 | Ga0495607_0000482 | 3300046501 | Bacteria | 39874 |
| 463 | Ga0495607_0000938 | 3300046501 | Bacteria | 27121 |
| 464 | Ga0495607_0001384 | 3300046501 | Bacteria | 21585 |
| 465 | Ga0495607_0002109 | 3300046501 | Bacteria | 16605 |
| 466 | Ga0495607_0002221 | 3300046501 | Bacteria | 16069 |
| 467 | Ga0495607_0003809 | 3300046501 | Bacteria | 11379 |
| 468 | Ga0495607_0025076 | 3300046501 | Bacteria | 3712 |
| 469 | Ga0495607_0053155 | 3300046501 | Bacteria | 2342 |
| 470 | Ga0495607_0060395 | 3300046501 | Bacteria | 2158 |
| 471 | Ga0495607_0064082 | 3300046501 | Bacteria | 2077 |
| 472 | Ga0495607_0159648 | 3300046501 | Bacteria | 1146 |
| 473 | Ga0495607_0174988 | 3300046501 | Bacteria | 1080 |
| 474 | Ga0495607_0180299 | 3300046501 | Bacteria | 1059 |
| 475 | Ga0495583_0000031 | 3300046506 | Bacteria | 253982 |
| 476 | Ga0495583_0000583 | 3300046506 | Bacteria | 50031 |
| 477 | Ga0495583_0000830 | 3300046506 | Bacteria | 37819 |
| 478 | Ga0495583_0006886 | 3300046506 | Bacteria | 7313 |
| 479 | Ga0495583_0007941 | 3300046506 | Bacteria | 6571 |
| 480 | Ga0495583_0008728 | 3300046506 | Bacteria | 6153 |
| 481 | Ga0495583_0014672 | 3300046506 | Bacteria | 4308 |
| 482 | Ga0495583_0045314 | 3300046506 | Bacteria | 2035 |
| 483 | Ga0495606_0000271 | 3300046507 | Bacteria | 90916 |
| 484 | Ga0495606_0001608 | 3300046507 | Bacteria | 29469 |
| 485 | Ga0495606_0021027 | 3300046507 | Bacteria | 4790 |
| 486 | Ga0495606_0030559 | 3300046507 | Bacteria | 3762 |
| 487 | Ga0495606_0047696 | 3300046507 | Bacteria | 2822 |
| 488 | Ga0495606_0186134 | 3300046507 | Bacteria | 1194 |
| 489 | Ga0495606_0220015 | 3300046507 | Bacteria | 1070 |
| 490 | Ga0495610_0007823 | 3300046512 | Bacteria | 7041 |
| 491 | Ga0495610_0012332 | 3300046512 | Bacteria | 5154 |
| 492 | Ga0495610_0015008 | 3300046512 | Bacteria | 4520 |
| 493 | Ga0495610_0043317 | 3300046512 | Bacteria | 2243 |
| 494 | Ga0495610_0044480 | 3300046512 | Bacteria | 2204 |
| 495 | Ga0495616_0020878 | 3300046513 | Bacteria | 3556 |
| 496 | Ga0495616_0030970 | 3300046513 | Bacteria | 2806 |
| 497 | Ga0495616_0042996 | 3300046513 | Bacteria | 2297 |
| 498 | Ga0495616_0043388 | 3300046513 | Bacteria | 2285 |
| 499 | Ga0495616_0095238 | 3300046513 | Bacteria | 1403 |
| 500 | Ga0495616_0155289 | 3300046513 | Bacteria | 1032 |
| 501 | Ga0495620_0000112 | 3300046515 | Bacteria | 64688 |
| 502 | Ga0495620_0000222 | 3300046515 | Bacteria | 42955 |
| 503 | Ga0495620_0005934 | 3300046515 | Bacteria | 6769 |
| 504 | Ga0495620_0020043 | 3300046515 | Bacteria | 3273 |
| 505 | Ga0495620_0031315 | 3300046515 | Bacteria | 2438 |
| 506 | Ga0495630_0108345 | 3300046517 | Bacteria | 2104 |
| 507 | Ga0495631_0006265 | 3300046518 | Bacteria | 6161 |
| 508 | Ga0495631_0027697 | 3300046518 | Bacteria | 2591 |
| 509 | Ga0495631_0057391 | 3300046518 | Bacteria | 1694 |
| 510 | Ga0495631_0066960 | 3300046518 | Bacteria | 1554 |
| 511 | Ga0495632_0001173 | 3300046519 | Bacteria | 22288 |
| 512 | Ga0495632_0001768 | 3300046519 | Bacteria | 17482 |
| 513 | Ga0495632_0004961 | 3300046519 | Bacteria | 8914 |
| 514 | Ga0495632_0028752 | 3300046519 | Bacteria | 2899 |
| 515 | Ga0495632_0039577 | 3300046519 | Bacteria | 2379 |
| 516 | Ga0495632_0042967 | 3300046519 | Bacteria | 2262 |
| 517 | Ga0495632_0043209 | 3300046519 | Bacteria | 2254 |
| 518 | Ga0495632_0050671 | 3300046519 | Bacteria | 2046 |
| 519 | Ga0495632_0053357 | 3300046519 | Bacteria | 1985 |
| 520 | Ga0495632_0124728 | 3300046519 | Bacteria | 1201 |
| 521 | Ga0495632_0172623 | 3300046519 | Bacteria | 992 |
| 522 | Ga0495637_0000064 | 3300046520 | Bacteria | 92793 |
| 523 | Ga0495637_0000110 | 3300046520 | Bacteria | 59616 |
| 524 | Ga0495637_0005109 | 3300046520 | Bacteria | 6730 |
| 525 | Ga0495637_0008823 | 3300046520 | Bacteria | 4937 |
| 526 | Ga0495637_0011594 | 3300046520 | Bacteria | 4232 |
| 527 | Ga0495637_0022282 | 3300046520 | Bacteria | 2890 |
| 528 | Ga0495637_0030035 | 3300046520 | Bacteria | 2413 |
| 529 | Ga0495637_0031705 | 3300046520 | Bacteria | 2335 |
| 530 | Ga0495637_0060345 | 3300046520 | Bacteria | 1558 |
| 531 | Ga0495637_0076926 | 3300046520 | Bacteria | 1336 |
| 532 | Ga0495643_0000175 | 3300046522 | Bacteria | 102200 |
| 533 | Ga0495643_0001951 | 3300046522 | Bacteria | 17354 |
| 534 | Ga0495643_0002575 | 3300046522 | Bacteria | 14165 |
| 535 | Ga0495643_0003738 | 3300046522 | Bacteria | 11016 |
| 536 | Ga0495643_0007213 | 3300046522 | Bacteria | 7203 |
| 537 | Ga0495643_0030249 | 3300046522 | Bacteria | 3025 |
| 538 | Ga0495643_0046696 | 3300046522 | Bacteria | 2347 |
| 539 | Ga0495643_0064532 | 3300046522 | Bacteria | 1934 |
| 540 | Ga0495643_0091610 | 3300046522 | Bacteria | 1567 |
| 541 | Ga0495643_0099515 | 3300046522 | Bacteria | 1491 |
| 542 | Ga0495644_0003744 | 3300046523 | Bacteria | 5983 |
| 543 | Ga0495644_0015990 | 3300046523 | Bacteria | 2874 |
| 544 | Ga0495644_0020181 | 3300046523 | Bacteria | 2542 |
| 545 | Ga0495644_0025150 | 3300046523 | Bacteria | 2261 |
| 546 | Ga0495648_0001400 | 3300046524 | Bacteria | 23699 |
| 547 | Ga0495648_0002582 | 3300046524 | Bacteria | 16589 |
| 548 | Ga0495648_0028056 | 3300046524 | Bacteria | 3755 |
| 549 | Ga0495648_0032418 | 3300046524 | Bacteria | 3428 |
| 550 | Ga0495648_0057222 | 3300046524 | Bacteria | 2340 |
| 551 | Ga0495648_0057481 | 3300046524 | Bacteria | 2332 |
| 552 | Ga0495648_0077708 | 3300046524 | Bacteria | 1901 |
| 553 | Ga0495648_0139014 | 3300046524 | Bacteria | 1280 |
| 554 | Ga0495666_0019569 | 3300046526 | Bacteria | 3357 |
| 555 | Ga0495642_0000266 | 3300046528 | Bacteria | 29529 |
| 556 | Ga0495642_0027458 | 3300046528 | Bacteria | 2265 |
| 557 | Ga0495654_0000773 | 3300046530 | Bacteria | 24692 |
| 558 | Ga0495654_0002519 | 3300046530 | Bacteria | 11772 |
| 559 | Ga0495654_0002645 | 3300046530 | Bacteria | 11383 |
| 560 | Ga0495654_0002943 | 3300046530 | Bacteria | 10659 |
| 561 | Ga0495654_0024207 | 3300046530 | Bacteria | 3138 |
| 562 | Ga0495654_0030911 | 3300046530 | Bacteria | 2720 |
| 563 | Ga0495654_0052489 | 3300046530 | Bacteria | 1985 |
| 564 | Ga0495654_0061597 | 3300046530 | Bacteria | 1801 |
| 565 | Ga0495654_0091541 | 3300046530 | Bacteria | 1410 |
| 566 | Ga0495654_0141112 | 3300046530 | Bacteria | 1073 |
| 567 | Ga0495587_0041989 | 3300046536 | Bacteria | 2728 |
| 568 | Ga0495587_0045522 | 3300046536 | Bacteria | 2607 |
| 569 | Ga0495609_0000018 | 3300046538 | Bacteria | 302609 |
| 570 | Ga0495609_0000089 | 3300046538 | Bacteria | 107029 |
| 571 | Ga0495609_0000161 | 3300046538 | Bacteria | 69842 |
| 572 | Ga0495609_0061372 | 3300046538 | Bacteria | 1660 |
| 573 | Ga0495597_0000026 | 3300046542 | Bacteria | 139551 |
| 574 | Ga0495597_0001094 | 3300046542 | Bacteria | 20566 |
| 575 | Ga0495597_0040454 | 3300046542 | Bacteria | 2083 |
| 576 | Ga0495597_0055525 | 3300046542 | Bacteria | 1736 |
| 577 | Ga0495622_0003910 | 3300046557 | Bacteria | 6962 |
| 578 | Ga0495622_0008666 | 3300046557 | Bacteria | 4713 |
| 579 | Ga0495622_0016546 | 3300046557 | Bacteria | 3435 |
| 580 | Ga0495633_0000062 | 3300046558 | Bacteria | 142101 |
| 581 | Ga0495633_0037387 | 3300046558 | Bacteria | 2322 |
| 582 | Ga0495656_0049529 | 3300046615 | Bacteria | 1789 |
| 583 | Ga0495668_0031470 | 3300046616 | Bacteria | 2990 |
| 584 | Ga0495668_0033489 | 3300046616 | Bacteria | 2887 |
| 585 | Ga0495668_0177243 | 3300046616 | Bacteria | 1168 |
| 586 | Ga0495634_0068312 | 3300046642 | Bacteria | 2348 |
| 587 | Ga0495611_0000395 | 3300046648 | Bacteria | 27443 |
| 588 | Ga0495611_0035575 | 3300046648 | Bacteria | 2206 |
| 589 | Ga0495625_0000194 | 3300046660 | Bacteria | 96964 |
| 590 | Ga0495625_0057392 | 3300046660 | Bacteria | 2768 |
| 591 | Ga0495625_0069189 | 3300046660 | Bacteria | 2480 |
| 592 | Ga0495635_0107839 | 3300046663 | Bacteria | 1902 |
| 593 | Ga0495659_0008033 | 3300046664 | Bacteria | 3349 |
| 594 | Ga0495659_0018348 | 3300046664 | Bacteria | 2330 |
| 595 | Ga0495661_0000016 | 3300046665 | Bacteria | 213593 |
| 596 | Ga0495661_0000093 | 3300046665 | Bacteria | 109808 |
| 597 | Ga0495661_0000115 | 3300046665 | Bacteria | 95492 |
| 598 | Ga0495661_0000233 | 3300046665 | Bacteria | 64169 |
| 599 | Ga0495661_0000541 | 3300046665 | Bacteria | 39054 |
| 600 | Ga0495661_0085050 | 3300046665 | Bacteria | 1813 |
| 601 | Ga0495661_0123173 | 3300046665 | Bacteria | 1429 |
| 602 | Ga0495623_0063662 | 3300046679 | Bacteria | 2308 |
| 603 | Ga0495646_0100477 | 3300046680 | Bacteria | 1659 |
| 604 | Ga0495669_0027980 | 3300046684 | Bacteria | 2466 |
| 605 | Ga0495669_0281982 | 3300046684 | Bacteria | 799 |
| 606 | Ga0495670_0008132 | 3300046691 | Bacteria | 5154 |
| 607 | Ga0495670_0029437 | 3300046691 | Bacteria | 2725 |
| 608 | Ga0495670_0036942 | 3300046691 | Bacteria | 2434 |
| 609 | Ga0495670_0043992 | 3300046691 | Bacteria | 2229 |
| 610 | Ga0495670_0118586 | 3300046691 | Bacteria | 1374 |
| 611 | Ga0495671_0001725 | 3300046692 | Bacteria | 14193 |
| 612 | Ga0495671_0010701 | 3300046692 | Bacteria | 5073 |
| 613 | Ga0495671_0021549 | 3300046692 | Bacteria | 3382 |
| 614 | Ga0495671_0041876 | 3300046692 | Bacteria | 2304 |
| 615 | Ga0495671_0042619 | 3300046692 | Bacteria | 2280 |
| 616 | Ga0495671_0048067 | 3300046692 | Bacteria | 2129 |
| 617 | Ga0495671_0050804 | 3300046692 | Bacteria | 2063 |
| 618 | Ga0495671_0054127 | 3300046692 | Bacteria | 1990 |
| 619 | Ga0495671_0076883 | 3300046692 | Bacteria | 1636 |
| 620 | Ga0495649_0001210 | 3300046694 | Bacteria | 19916 |
| 621 | Ga0495649_0001934 | 3300046694 | Bacteria | 15091 |
| 622 | Ga0495649_0008385 | 3300046694 | Bacteria | 6218 |
| 623 | Ga0495649_0032935 | 3300046694 | Bacteria | 2853 |
| 624 | Ga0495649_0033119 | 3300046694 | Bacteria | 2844 |
| 625 | Ga0495649_0040252 | 3300046694 | Bacteria | 2560 |
| 626 | Ga0495649_0040894 | 3300046694 | Bacteria | 2536 |
| 627 | Ga0495649_0045564 | 3300046694 | Bacteria | 2390 |
| 628 | Ga0495649_0085978 | 3300046694 | Bacteria | 1678 |
| 629 | Ga0495589_0018396 | 3300046794 | Bacteria | 3582 |
| 630 | Ga0495589_0027152 | 3300046794 | Bacteria | 2895 |
| 631 | Ga0495589_0178872 | 3300046794 | Bacteria | 1006 |
| 632 | Ga0495600_0160842 | 3300046809 | Bacteria | 1451 |
| 633 | Ga0495660_0000540 | 3300046810 | Bacteria | 30975 |
| 634 | Ga0495660_0001212 | 3300046810 | Bacteria | 18042 |
| 635 | Ga0495660_0001791 | 3300046810 | Bacteria | 14180 |
| 636 | Ga0495660_0018356 | 3300046810 | Bacteria | 4021 |
| 637 | Ga0495660_0024621 | 3300046810 | Bacteria | 3428 |
| 638 | Ga0495660_0045237 | 3300046810 | Bacteria | 2417 |
| 639 | Ga0495660_0063961 | 3300046810 | Bacteria | 1967 |
| 640 | Ga0495660_0090833 | 3300046810 | Bacteria | 1587 |
| 641 | Ga0495660_0092737 | 3300046810 | Bacteria | 1566 |
| 642 | Ga0495660_0102861 | 3300046810 | Bacteria | 1468 |
| 643 | Ga0495604_0077308 | 3300047317 | Bacteria | 2501 |
| 644 | Ga0495604_0104275 | 3300047317 | Bacteria | 2078 |
| 645 | Ga0495636_0025372 | 3300047318 | Bacteria | 2406 |
| 646 | Ga0495672_0002759 | 3300047320 | Bacteria | 15720 |
| 647 | Ga0495672_0004062 | 3300047320 | Bacteria | 12214 |
| 648 | Ga0495672_0015156 | 3300047320 | Bacteria | 5246 |
| 649 | Ga0495672_0024361 | 3300047320 | Bacteria | 3900 |
| 650 | Ga0495672_0025709 | 3300047320 | Bacteria | 3763 |
| 651 | Ga0495672_0026547 | 3300047320 | Bacteria | 3693 |
| 652 | Ga0495672_0034982 | 3300047320 | Bacteria | 3097 |
| 653 | Ga0495672_0039959 | 3300047320 | Bacteria | 2849 |
| 654 | Ga0495672_0064617 | 3300047320 | Bacteria | 2094 |
| 655 | Ga0495672_0258084 | 3300047320 | Bacteria | 842 |
| 656 | Ga0495676_0000052 | 3300047321 | Bacteria | 97049 |
| 657 | Ga0495676_0041268 | 3300047321 | Bacteria | 3799 |
| 658 | Ga0495680_0054078 | 3300047322 | Bacteria | 3120 |
| 659 | Ga0495680_0076800 | 3300047322 | Bacteria | 2531 |
| 660 | Ga0495680_0084812 | 3300047322 | Bacteria | 2386 |
| 661 | Ga0495683_0000137 | 3300047323 | Bacteria | 71500 |
| 662 | Ga0495683_0000254 | 3300047323 | Bacteria | 48222 |
| 663 | Ga0495683_0031552 | 3300047323 | Bacteria | 2700 |
| 664 | Ga0495683_0040465 | 3300047323 | Bacteria | 2354 |
| 665 | Ga0495683_0044021 | 3300047323 | Bacteria | 2245 |
| 666 | Ga0495683_0049012 | 3300047323 | Bacteria | 2117 |
| 667 | Ga0495683_0054943 | 3300047323 | Bacteria | 1983 |
| 668 | Ga0495683_0090511 | 3300047323 | Bacteria | 1483 |
| 669 | Ga0495687_019088 | 3300047443 | Bacteria | 3373 |
| 670 | Ga0495687_031228 | 3300047443 | Bacteria | 2445 |
| 671 | Ga0495675_0167747 | 3300047444 | Bacteria | 1349 |
| 672 | Ga0495675_0177245 | 3300047444 | Bacteria | 1306 |
| 673 | Ga0495677_0015191 | 3300047445 | Bacteria | 2798 |
| 674 | Ga0495679_000136 | 3300047446 | Bacteria | 65848 |
| 675 | Ga0495679_000368 | 3300047446 | Bacteria | 34941 |
| 676 | Ga0495679_019406 | 3300047446 | Bacteria | 2389 |
| 677 | Ga0495673_0000487 | 3300047469 | Bacteria | 42373 |
| 678 | Ga0495673_0000858 | 3300047469 | Bacteria | 28212 |
| 679 | Ga0495673_0004566 | 3300047469 | Bacteria | 8633 |
| 680 | Ga0495673_0012245 | 3300047469 | Bacteria | 4561 |
| 681 | Ga0495673_0024335 | 3300047469 | Bacteria | 2928 |
| 682 | Ga0495673_0027595 | 3300047469 | Bacteria | 2699 |
| 683 | Ga0495673_0037928 | 3300047469 | Bacteria | 2196 |
| 684 | Ga0495673_0194970 | 3300047469 | Bacteria | 760 |
| 685 | Ga0495673_0202809 | 3300047469 | Bacteria | 741 |
| 686 | Ga0495673_0203908 | 3300047469 | Bacteria | 738 |
| 687 | Ga0495681_0006934 | 3300047470 | Bacteria | 7344 |
| 688 | Ga0495681_0022764 | 3300047470 | Bacteria | 3344 |
| 689 | Ga0495681_0028546 | 3300047470 | Bacteria | 2868 |
| 690 | Ga0495681_0037709 | 3300047470 | Bacteria | 2377 |
| 691 | Ga0495681_0039118 | 3300047470 | Bacteria | 2318 |
| 692 | Ga0495681_0040587 | 3300047470 | Bacteria | 2265 |
| 693 | Ga0495681_0042086 | 3300047470 | Bacteria | 2213 |
| 694 | Ga0495681_0044871 | 3300047470 | Bacteria | 2120 |
| 695 | Ga0495681_0118793 | 3300047470 | Bacteria | 1136 |
| 696 | Ga0495681_0146527 | 3300047470 | Bacteria | 993 |
| 697 | Ga0495686_0041182 | 3300047472 | Bacteria | 2941 |
| 698 | Ga0495686_0074046 | 3300047472 | Bacteria | 2090 |
| 699 | Ga0495626_0000126 | 3300048091 | Bacteria | 99054 |
| 700 | Ga0495626_0016183 | 3300048091 | Bacteria | 3795 |
| 701 | Ga0495626_0019595 | 3300048091 | Bacteria | 3382 |
| 702 | Ga0495626_0026996 | 3300048091 | Bacteria | 2793 |
| 703 | Ga0495626_0035412 | 3300048091 | Bacteria | 2382 |
| 704 | Ga0495626_0035440 | 3300048091 | Bacteria | 2381 |
| 705 | Ga0495626_0038193 | 3300048091 | Bacteria | 2277 |
| 706 | Ga0496102_0134254 | 3300048905 | Bacteria | 2318 |
| 707 | Ga0496102_0559426 | 3300048905 | Bacteria | 1066 |
| 708 | Ga0496102_0733024 | 3300048905 | Bacteria | 911 |
| 709 | Ga0496103_0172472 | 3300048906 | Bacteria | 1389 |
| 710 | Ga0496106_0132833 | 3300048909 | Bacteria | 1953 |
| 711 | Ga0496110_0277946 | 3300048913 | Bacteria | 1525 |
| 712 | Ga0496110_0319094 | 3300048913 | Bacteria | 1415 |
| 713 | Ga0496110_0343334 | 3300048913 | Bacteria | 1360 |
| 714 | Ga0496110_0434333 | 3300048913 | Bacteria | 1197 |
| 715 | Ga0496112_0287635 | 3300048915 | Bacteria | 1590 |
| 716 | Ga0496113_0401979 | 3300048916 | Bacteria | 1100 |
| 717 | Ga0496114_0012182 | 3300048917 | Bacteria | 6881 |
| 718 | Ga0496116_0000488 | 3300048919 | Bacteria | 54504 |
| 719 | Ga0496116_0019231 | 3300048919 | Bacteria | 5235 |
| 720 | Ga0496116_0037567 | 3300048919 | Bacteria | 3375 |
| 721 | Ga0496116_0073735 | 3300048919 | Bacteria | 2150 |
| 722 | Ga0496116_0106046 | 3300048919 | Bacteria | 1665 |
| 723 | Ga0496117_0000666 | 3300048920 | Bacteria | 55020 |
| 724 | Ga0496117_0004216 | 3300048920 | Bacteria | 16058 |
| 725 | Ga0496117_0067351 | 3300048920 | Bacteria | 2423 |
| 726 | Ga0496117_0072615 | 3300048920 | Bacteria | 2299 |
| 727 | Ga0496118_0003760 | 3300048921 | Bacteria | 18753 |
| 728 | Ga0496118_0004272 | 3300048921 | Bacteria | 17091 |
| 729 | Ga0496118_0030186 | 3300048921 | Bacteria | 4530 |
| 730 | Ga0496118_0041647 | 3300048921 | Bacteria | 3633 |
| 731 | Ga0496119_0000220 | 3300048922 | Bacteria | 81054 |
| 732 | Ga0496120_0002773 | 3300048923 | Bacteria | 17043 |
| 733 | Ga0496121_0000867 | 3300048924 | Bacteria | 54641 |
| 734 | Ga0496121_0002170 | 3300048924 | Bacteria | 30723 |
| 735 | Ga0496121_0079897 | 3300048924 | Bacteria | 2594 |
| 736 | Ga0496121_0103065 | 3300048924 | Bacteria | 2196 |
| 737 | Ga0496122_0000434 | 3300048925 | Bacteria | 87536 |
| 738 | Ga0496122_0002929 | 3300048925 | Bacteria | 23272 |
| 739 | Ga0496122_0081632 | 3300048925 | Bacteria | 2249 |
| 740 | Ga0496122_0093236 | 3300048925 | Bacteria | 2043 |
| 741 | Ga0496122_0163129 | 3300048925 | Bacteria | 1355 |
| 742 | Ga0496123_0000318 | 3300048926 | Bacteria | 91911 |
| 743 | Ga0496123_0002268 | 3300048926 | Bacteria | 24237 |
| 744 | Ga0496123_0003514 | 3300048926 | Bacteria | 17459 |
| 745 | Ga0496123_0013642 | 3300048926 | Bacteria | 6798 |
| 746 | Ga0496123_0014247 | 3300048926 | Bacteria | 6606 |
| 747 | Ga0496124_0000471 | 3300048927 | Bacteria | 69533 |
| 748 | Ga0496124_0005898 | 3300048927 | Bacteria | 13552 |
| 749 | Ga0496124_0013915 | 3300048927 | Bacteria | 7821 |
| 750 | Ga0496124_0045602 | 3300048927 | Bacteria | 3758 |
| 751 | Ga0496124_0069900 | 3300048927 | Bacteria | 2913 |
| 752 | Ga0496125_0001551 | 3300048928 | Bacteria | 32793 |
| 753 | Ga0496125_0039422 | 3300048928 | Bacteria | 4068 |
| 754 | Ga0496125_0057784 | 3300048928 | Bacteria | 3139 |
| 755 | Ga0496125_0082115 | 3300048928 | Bacteria | 2458 |
| 756 | Ga0496126_0027779 | 3300048929 | Bacteria | 5399 |
| 757 | Ga0496126_0277065 | 3300048929 | Bacteria | 1390 |
| 758 | Ga0501306_009733 | 3300049127 | Bacteria | 1197 |
| 759 | Ga0501305_018629 | 3300049161 | Bacteria | 1006 |
| 760 | Ga0495678_000021 | 3300049459 | Bacteria | 239150 |
| 761 | Ga0495678_000169 | 3300049459 | Bacteria | 76063 |
| 762 | Ga0495678_002042 | 3300049459 | Bacteria | 14448 |
| 763 | Ga0495678_029007 | 3300049459 | Bacteria | 2328 |
| 764 | Ga0495678_029232 | 3300049459 | Bacteria | 2316 |
| 765 | Ga0495678_078603 | 3300049459 | Bacteria | 1190 |
| 766 | Ga0495678_086008 | 3300049459 | Bacteria | 1118 |
| 767 | Ga0495678_127788 | 3300049459 | Bacteria | 845 |
| 768 | Ga0495682_0000597 | 3300049460 | Bacteria | 24443 |
| 769 | Ga0495682_0001213 | 3300049460 | Bacteria | 14658 |
| 770 | Ga0495682_0028092 | 3300049460 | Bacteria | 2085 |
| 771 | Ga0495682_0111657 | 3300049460 | Bacteria | 979 |
| 772 | Ga0501312_004226 | 3300049528 | Bacteria | 1679 |
| 773 | Ga0501312_014527 | 3300049528 | Bacteria | 1107 |
| 774 | Ga0501323_020451 | 3300049539 | Bacteria | 869 |
| 775 | Ga0501335_008315 | 3300049551 | Bacteria | 974 |
| 776 | Ga0501032_0247168 | 3300049569 | Bacteria | 1158 |
| 777 | Ga0501032_0513831 | 3300049569 | Bacteria | 765 |
| 778 | Ga0501034_0000214 | 3300049571 | Bacteria | 110247 |
| 779 | Ga0501034_0148754 | 3300049571 | Bacteria | 2318 |
| 780 | Ga0501037_0040282 | 3300049573 | Bacteria | 3438 |
| 781 | Ga0501038_0363218 | 3300049574 | Bacteria | 1126 |
| 782 | Ga0501039_0006128 | 3300049575 | Bacteria | 9130 |
| 783 | Ga0501039_0367515 | 3300049575 | Bacteria | 1130 |
| 784 | Ga0501040_0249150 | 3300049576 | Bacteria | 1267 |
| 785 | Ga0501076_0229649 | 3300049592 | Bacteria | 1517 |
| 786 | Ga0501230_026813 | 3300049667 | Bacteria | 1048 |
| 787 | Ga0501226_000004 | 3300049853 | Bacteria | 284656 |
| 788 | nmdc:mga00v17_296811_c1 | 3300050491 | Bacteria | 741 |
| 789 | Ga0500573_0052401 | 3300053140 | Bacteria | 2346 |
| 790 | 2511257980 | 2511231004 | Bacteria | 6669789 |
| 791 | 2511264623 | 2511231006 | Bacteria | 6794709 |
| 792 | 2511269428 | 2511231007 | Bacteria | 6306603 |
| 793 | 2511276542 | 2511231008 | Bacteria | 6624100 |
| 794 | 2511290487 | 2511231010 | Bacteria | 6373152 |
| 795 | 2511296677 | 2511231011 | Bacteria | 6149768 |
| 796 | 2511299129 | 2511231012 | Bacteria | 6738011 |
| 797 | 2511312747 | 2511231014 | Bacteria | 6462302 |
| 798 | 2511321343 | 2511231015 | Bacteria | 6598026 |
| 799 | 2511325915 | 2511231016 | Bacteria | 6704427 |
| 800 | 2511331957 | 2511231017 | Bacteria | 6503007 |
| 801 | 2511340787 | 2511231018 | Bacteria | 6436256 |
| 802 | 2511346386 | 2511231019 | Bacteria | 6520662 |
| 803 | 2511353026 | 2511231020 | Bacteria | 6115223 |
| 804 | 2511356683 | 2511231021 | Bacteria | 7302637 |
| 805 | 2511364650 | 2511231022 | Bacteria | 6719296 |
| 806 | 2511369245 | 2511231023 | Bacteria | 6808468 |
| 807 | 2511374274 | 2511231024 | Bacteria | 5835885 |
| 808 | 2511412033 | 2511231031 | Bacteria | 6558529 |
| 809 | 2511827236 | 2511231156 | Bacteria | 6845832 |
| 810 | 2512327964 | 2512047018 | Bacteria | 6663241 |
| 811 | 2554813224 | 2554235132 | Bacteria | 6772433 |
| 812 | 2555246605 | 2554235231 | Bacteria | 5215788 |
| 813 | 2555672417 | 2554235341 | Bacteria | 6867980 |
| 814 | 2583794873 | 2582580891 | Bacteria | 6800976 |
| 815 | 2587738659 | 2585428059 | Bacteria | 8696589 |
| 816 | 2595315611 | 2593339198 | Bacteria | 7267884 |
| 817 | 2597860483 | 2597489887 | Bacteria | 6666321 |
| 818 | 2597866236 | 2597489888 | Bacteria | 6179543 |
| 819 | 2597872070 | 2597489889 | Bacteria | 6297495 |
| 820 | 2599358130 | 2599185160 | Bacteria | 6844013 |
| 821 | 2599364493 | 2599185161 | Bacteria | 6960462 |
| 822 | 2599370971 | 2599185162 | Bacteria | 6957254 |
| 823 | 2599376993 | 2599185163 | Bacteria | 6995158 |
| 824 | 2599383295 | 2599185164 | Bacteria | 6841688 |
| 825 | 2599389742 | 2599185165 | Bacteria | 6843250 |
| 826 | 2599396039 | 2599185166 | Bacteria | 6959206 |
| 827 | 2599401278 | 2599185167 | Bacteria | 6353609 |
| 828 | 2599407879 | 2599185168 | Bacteria | 6997636 |
| 829 | 2599453007 | 2599185179 | Bacteria | 6611171 |
| 830 | 2599464945 | 2599185181 | Bacteria | 6844519 |
| 831 | 2599471270 | 2599185182 | Bacteria | 6883168 |
| 832 | 2599486665 | 2599185185 | Bacteria | 6652270 |
| 833 | 2599494140 | 2599185186 | Bacteria | 6831633 |
| 834 | 2599504956 | 2599185188 | Bacteria | 6164180 |
| 835 | 2599509755 | 2599185189 | Bacteria | 5862825 |
| 836 | 2599516356 | 2599185190 | Bacteria | 6285678 |
| 837 | 2599520169 | 2599185191 | Bacteria | 6297582 |
| 838 | 2599615585 | 2599185212 | Bacteria | 6765997 |
| 839 | 2599773506 | 2599185248 | Bacteria | 6696816 |
| 840 | 2599807200 | 2599185257 | Bacteria | 6492581 |
| 841 | 2599881609 | 2599185288 | Bacteria | 6666191 |
| 842 | 2599889993 | 2599185289 | Bacteria | 6778765 |
| 843 | 2599895672 | 2599185290 | Bacteria | 6289611 |
| 844 | 2599901716 | 2599185291 | Bacteria | 6775623 |
| 845 | 2599930516 | 2599185300 | Bacteria | 6062622 |
| 846 | 2599944950 | 2599185302 | Bacteria | 5954930 |
| 847 | 2599951872 | 2599185303 | Bacteria | 6512725 |
| 848 | 2599955321 | 2599185304 | Bacteria | 5951361 |
| 849 | 2599962857 | 2599185305 | Bacteria | 6748700 |
| 850 | 2599967753 | 2599185306 | Bacteria | 6637356 |
| 851 | 2599974044 | 2599185307 | Bacteria | 6194719 |
| 852 | 2599978985 | 2599185308 | Bacteria | 6621546 |
| 853 | 2599984053 | 2599185309 | Bacteria | 5969593 |
| 854 | 2599990226 | 2599185310 | Bacteria | 6014457 |
| 855 | 2599996881 | 2599185311 | Bacteria | 6354990 |
| 856 | 2600001835 | 2599185312 | Bacteria | 5912071 |
| 857 | 2600008950 | 2599185313 | Bacteria | 6658188 |
| 858 | 2600012945 | 2599185314 | Bacteria | 6621749 |
| 859 | 2600020796 | 2599185315 | Bacteria | 6771107 |
| 860 | 2600025748 | 2599185316 | Bacteria | 6320029 |
| 861 | 2600031074 | 2599185317 | Bacteria | 6435722 |
| 862 | 2600038434 | 2599185318 | Bacteria | 6961590 |
| 863 | 2600043766 | 2599185319 | Bacteria | 6637840 |
| 864 | 2600048760 | 2599185320 | Bacteria | 5963263 |
| 865 | 2600055576 | 2599185321 | Bacteria | 6764560 |
| 866 | 2600062018 | 2599185322 | Bacteria | 6763055 |
| 867 | 2600067259 | 2599185323 | Bacteria | 6688755 |
| 868 | 2600073352 | 2599185324 | Bacteria | 6590677 |
| 869 | 2600079903 | 2599185325 | Bacteria | 6324919 |
| 870 | 2600217677 | 2599185356 | Bacteria | 6843884 |
| 871 | 2600360935 | 2600254930 | Bacteria | 6431253 |
| 872 | 2600367866 | 2600254931 | Bacteria | 6734225 |
| 873 | 2600445298 | 2600254954 | Bacteria | 5100516 |
| 874 | 2601628642 | 2600255283 | Bacteria | 6061572 |
| 875 | 2601693827 | 2600255296 | Bacteria | 5784754 |
| 876 | 2601777844 | 2600255313 | Bacteria | 6842543 |
| 877 | 2601800589 | 2600255318 | Bacteria | 6383414 |
| 878 | 2602007805 | 2600255389 | Bacteria | 5275336 |
| 879 | 2606078603 | 2603880185 | Bacteria | 6379190 |
| 880 | 2606125737 | 2603880199 | Bacteria | 6377649 |
| 881 | 2608384038 | 2606217733 | Bacteria | 6360972 |
| 882 | 2621297221 | 2619619299 | Bacteria | 6649820 |
| 883 | 2624483002 | 2623620443 | Bacteria | 6427864 |
| 884 | 2624494531 | 2623620446 | Bacteria | 6500345 |
| 885 | 2643844973 | 2643221565 | Bacteria | 6216018 |
| 886 | 2643870818 | 2643221571 | Bacteria | 6228673 |
| 887 | 2643957681 | 2643221589 | Bacteria | 6250934 |
| 888 | 2644025797 | 2643221602 | Bacteria | 6249926 |
| 889 | 2644188372 | 2643221633 | Bacteria | 6733554 |
| 890 | 2644232287 | 2643221641 | Bacteria | 4490190 |
| 891 | 2644286646 | 2643221650 | Bacteria | 7029547 |
| 892 | 2644426829 | 2643221676 | Bacteria | 8119172 |
| 893 | 2644621294 | 2643221713 | Bacteria | 6554480 |
| 894 | 2652545064 | 2651869719 | Bacteria | 6047974 |
| 895 | 2671094187 | 2667528170 | Bacteria | 6786960 |
| 896 | 2671100667 | 2667528171 | Bacteria | 6900659 |
| 897 | 2671129687 | 2667528176 | Bacteria | 6724917 |
| 898 | 2671773240 | 2671180172 | Bacteria | 6495783 |
| 899 | 2673822198 | 2671180694 | Bacteria | 7506943 |
| 900 | 2677899032 | 2675903420 | Bacteria | 6247433 |
| 901 | 2678265746 | 2675903515 | Bacteria | 6580491 |
| 902 | 2715752427 | 2713897148 | Bacteria | 5883533 |
| 903 | 2715759178 | 2713897149 | Bacteria | 6506249 |
| 904 | 2718636214 | 2718217725 | Bacteria | 5758958 |
| 905 | 2723250971 | 2721755607 | Bacteria | 5841722 |
| 906 | 2729145591 | 2728369097 | Bacteria | 4333476 |
| 907 | 2738673035 | 2738541265 | Bacteria | 6594665 |
| 908 | 2738690995 | 2738541271 | Bacteria | 5657310 |
| 909 | 2738716184 | 2738541276 | Bacteria | 4690596 |
| 910 | 2738751428 | 2738541282 | Bacteria | 6593925 |
| 911 | 2738810161 | 2738541294 | Bacteria | 6925949 |
| 912 | 2738860469 | 2738541303 | Bacteria | 6591772 |
| 913 | 2738897521 | 2738541309 | Bacteria | 6926455 |
| 914 | 2739198068 | 2738543004 | Bacteria | 6381073 |
| 915 | 2739230446 | 2738543010 | Bacteria | 5583595 |
| 916 | 2739262183 | 2738543015 | Bacteria | 6750701 |
| 917 | 2739266868 | 2738543016 | Bacteria | 5657564 |
| 918 | 2739287047 | 2738543020 | Bacteria | 5718238 |
| 919 | 2739292360 | 2738543021 | Bacteria | 5718241 |
| 920 | 2739314957 | 2738543025 | Bacteria | 6600348 |
| 921 | 2740169293 | 2739367898 | Bacteria | 4367674 |
| 922 | 2743740038 | 2740892503 | Bacteria | 6855563 |
| 923 | 2745006980 | 2744054620 | Bacteria | 6551379 |
| 924 | 2765586221 | 2765235841 | Bacteria | 6137024 |
| 925 | 2774121908 | 2773857670 | Bacteria | 6407454 |
| 926 | 2774137145 | 2773857673 | Bacteria | 6513460 |
| 927 | 2784262230 | 2784132063 | Bacteria | 6262788 |
| 928 | 2784314571 | 2784132072 | Bacteria | 6596533 |
| 929 | 2794595178 | 2791355520 | Bacteria | 5948615 |
| 930 | 2807410456 | 2806310737 | Bacteria | 5751088 |
| 931 | 2807458801 | 2806310745 | Bacteria | 5742165 |
| 932 | 2808858073 | 2808606361 | Bacteria | 6136259 |
| 933 | 2808906523 | 2808606373 | Bacteria | 4423627 |
| 934 | 2808926196 | 2808606376 | Bacteria | 6248667 |
| 935 | 2808932321 | 2808606377 | Bacteria | 6646337 |
| 936 | 2808938244 | 2808606378 | Bacteria | 6177535 |
| 937 | 2808941214 | 2808606379 | Bacteria | 5022697 |
| 938 | 2808948297 | 2808606380 | Bacteria | 6248705 |
| 939 | 2808954442 | 2808606381 | Bacteria | 6646461 |
| 940 | 2808961475 | 2808606382 | Bacteria | 6841132 |
| 941 | 2808966559 | 2808606383 | Bacteria | 6138645 |
| 942 | 2808977483 | 2808606385 | Bacteria | 6711065 |
| 943 | 2808992859 | 2808606388 | Bacteria | 6706662 |
| 944 | 2809001389 | 2808606389 | Bacteria | 6138126 |
| 945 | 2809219185 | 2808606445 | Bacteria | 6057339 |
| 946 | 2812368950 | 2811994881 | Bacteria | 6298475 |
| 947 | 2817493661 | 2816332298 | Bacteria | 6852809 |
| 948 | 2819659296 | 2818991456 | Bacteria | 6123676 |
| 949 | 2819669284 | 2818991459 | Bacteria | 8736032 |
| 950 | 2819706334 | 2818991464 | Bacteria | 6907494 |
| 951 | 2823422020 | 2823421272 | Bacteria | 5372474 |
| 952 | 2825655507 | 2825651385 | Bacteria | 6715909 |
| 953 | 2826582820 | 2826581358 | Bacteria | 5963467 |
| 954 | 2834033154 | 2834028612 | Bacteria | 6354979 |
| 955 | 2842808385 | 2842805378 | Bacteria | 5385175 |
| 956 | 2842819865 | 2842815866 | Bacteria | 5947510 |
| 957 | 2842829038 | 2842826826 | Bacteria | 5974129 |
| 958 | 2842836878 | 2842832357 | Bacteria | 5959113 |
| 959 | 2842840523 | 2842837860 | Bacteria | 6066181 |
| 960 | 2842847612 | 2842843487 | Bacteria | 6004777 |
| 961 | 2842852884 | 2842849001 | Bacteria | 5924277 |
| 962 | 2842859181 | 2842854478 | Bacteria | 6143501 |
| 963 | 2844666591 | 2844665904 | Bacteria | 6817974 |
| 964 | 2852618045 | 2852612431 | Bacteria | 6885235 |
| 965 | 2852661124 | 2852657418 | Bacteria | 6472974 |
| 966 | 2852673103 | 2852667396 | Bacteria | 6885555 |
| 967 | 2857453747 | 2857453340 | Bacteria | 8090534 |
| 968 | 2860343991 | 2860339153 | Bacteria | 6846989 |
| 969 | 2860872633 | 2860867994 | Bacteria | 5645326 |
| 970 | 2878034940 | 2878029506 | Bacteria | 6418441 |
| 971 | 2880235581 | 2880230671 | Bacteria | 6140320 |
| 972 | 2904522558 | 2904518522 | Bacteria | 6068986 |
| 973 | 2904554150 | 2904550169 | Bacteria | 6221258 |
| 974 | 2904762018 | 2904755435 | Bacteria | 7986759 |
| 975 | 2908452173 | 2908446538 | Bacteria | 6829095 |
| 976 | 2912968489 | 2912963787 | Bacteria | 5646108 |
| 977 | 2913042153 | 2913036834 | Bacteria | 6704877 |
| 978 | 2917076300 | 2917070673 | Bacteria | 6868303 |
| 979 | 2917834514 | 2917832318 | Bacteria | 5346010 |
| 980 | 2919067685 | 2919063839 | Bacteria | 6302690 |
| 981 | 2919127308 | 2919125081 | Bacteria | 5385106 |
| 982 | 2919158639 | 2919155634 | Bacteria | 4860545 |
| 983 | 2919390549 | 2919385768 | Bacteria | 5897293 |
| 984 | 2919418607 | 2919414237 | Bacteria | 5429133 |
| 985 | 2919431498 | 2919425241 | Bacteria | 8055701 |
| 986 | 2919461651 | 2919456309 | Bacteria | 6586567 |
| 987 | 2919485982 | 2919481497 | Bacteria | 6907839 |
| 988 | 2919492668 | 2919487758 | Bacteria | 5929766 |
| 989 | 2919506314 | 2919501602 | Bacteria | 5286340 |
| 990 | 2919701369 | 2919697872 | Bacteria | 6553725 |
| 991 | 2923159129 | 2923153595 | Bacteria | 6870622 |
| 992 | 2923523025 | 2923519811 | Bacteria | 6298479 |
| 993 | 2923591100 | 2923586266 | Bacteria | 6565975 |
| 994 | 2926067384 | 2926063275 | Bacteria | 5285848 |
| 995 | 2929149541 | 2929144301 | Bacteria | 6622272 |
| 996 | 2929194746 | 2929189879 | Bacteria | 5930554 |
| 997 | 2931373056 | 2931369376 | Bacteria | 6847892 |
| 998 | 2931396022 | 2931390751 | Bacteria | 6273349 |
| 999 | 2931397655 | 2931396565 | Bacteria | 7251677 |
| 1000 | 2935359724 | 2935353572 | Unclassified | 6955622 |
| 1001 | 2939641926 | 2939636861 | Bacteria | 6297853 |
| 1002 | 2939654591 | 2939651529 | Bacteria | 5895393 |
| 1003 | 2945931311 | 2945928738 | Bacteria | 6053221 |
| 1004 | 2945966378 | 2945961074 | Bacteria | 7342064 |
| 1005 | 2946007348 | 2946006987 | Bacteria | 6705746 |
| 1006 | 2946033237 | 2946027586 | Bacteria | 6049274 |
| 1007 | 2947234025 | 2947233263 | Bacteria | 6439278 |
| 1008 | 2969309768 | 2969304461 | Bacteria | 6601805 |
| 1009 | 2971411019 | 2971410472 | Bacteria | 8311090 |
| 1010 | 2974294488 | 2974289157 | Bacteria | 6080362 |
| 1011 | 2977257974 | 2977254563 | Bacteria | 4828420 |
| 1012 | 2980126843 | 2980125574 | Bacteria | 5567337 |
| 1013 | 2980189773 | 2980182181 | Bacteria | 9454109 |
| 1014 | 2984287030 | 2984286254 | Bacteria | 6702062 |
| 1015 | 2984507044 | 2984504281 | Bacteria | 5262371 |
| 1016 | 2988731089 | 2988728565 | Bacteria | 6124362 |
| 1017 | 2989395510 | 2989392574 | Bacteria | 4554005 |
| 1018 | 2990198218 | 2990196909 | Bacteria | 4054280 |
| 1019 | 2990278998 | 2990275345 | Bacteria | 4887158 |
| 1020 | 2998144993 | 2998139840 | Bacteria | 6073514 |
| 1021 | 3007255653 | 3007252601 | Bacteria | 4559114 |
| 1022 | 3007320252 | 3007315729 | Bacteria | 5076637 |
| 1023 | 3007398779 | 3007395558 | Bacteria | 6755444 |
| 1024 | 3007425312 | 3007419365 | Bacteria | 7026924 |
| 1025 | 3007516780 | 3007511990 | Bacteria | 6481491 |
| 1026 | 3007614719 | 3007614139 | Bacteria | 6053559 |
| 1027 | 3007621208 | 3007619802 | Bacteria | 6411688 |
| 1028 | 3007721306 | 3007718800 | Bacteria | 5971527 |
| 1029 | 3007809384 | 3007803356 | Bacteria | 5931491 |
| 1030 | 3007860198 | 3007855910 | Bacteria | 5637581 |
| 1031 | 3007866452 | 3007861166 | Bacteria | 6045338 |
| 1032 | 3007867149 | 3007866637 | Bacteria | 5899198 |
| 1033 | 3007874208 | 3007872151 | Bacteria | 5268868 |
| 1034 | 637322856 | 637000220 | Bacteria | 7074893 |
| 1035 | 640486794 | 640427133 | Bacteria | 4567418 |
| 1036 | 651174645 | 651053060 | Bacteria | 4689946 |
| 1037 | 8001524969 | 8001522603 | Bacteria | 4726425 |
| 1038 | 8011355933 | 8011350971 | Bacteria | 6158957 |
| 1039 | 8015693215 | 8015687852 | Bacteria | 6613826 |
| 1040 | 8016730889 | 8016728285 | Bacteria | 5263933 |
| 1041 | 8019771222 | 8019769354 | Bacteria | 6924660 |
| 1042 | 8019780466 | 8019775933 | Bacteria | 6858656 |
| 1043 | 8029995905 | 8029995093 | Bacteria | 5990776 |
| 1044 | 8034966880 | 8034962539 | Bacteria | 4884839 |
| 1045 | 8052499434 | 8052494512 | Bacteria | 5765634 |
| 1046 | 8054289411 | 8054285046 | Bacteria | 6919322 |
| 1047 | 8054352914 | 8054347763 | Bacteria | 5901107 |
| 1048 | 8054508519 | 8054503363 | Bacteria | 6101651 |
| 1049 | 8054613001 | 8054609563 | Bacteria | 5170090 |
| 1050 | 8054933562 | 8054929484 | Bacteria | 5599761 |
| 1051 | 8055776465 | 8055770955 | Bacteria | 6827675 |
| 1052 | 8055823493 | 8055817908 | Bacteria | 6609162 |
| 1053 | 8055880492 | 8055878733 | Bacteria | 5907058 |
| 1054 | 8056115751 | 8056115690 | Bacteria | 5527654 |
| 1055 | 8056121295 | 8056120720 | Bacteria | 5758328 |
| 1056 | 8056131209 | 8056125926 | Bacteria | 6228218 |
| 1057 | 8056136926 | 8056131705 | Bacteria | 6107031 |
| 1058 | 8056138008 | 8056137416 | Bacteria | 6147080 |
| 1059 | 8056148360 | 8056143049 | Bacteria | 6307666 |
| 1060 | 8056151887 | 8056148874 | Bacteria | 6479865 |
| 1061 | 8056156407 | 8056155041 | Bacteria | 6486948 |
| 1062 | 8056163196 | 8056161164 | Bacteria | 6106669 |
| 1063 | 8056171575 | 8056166840 | Bacteria | 5820959 |
| 1064 | 8056172245 | 8056172158 | Bacteria | 6133900 |
| 1065 | 8056179283 | 8056177738 | Bacteria | 6748268 |
| 1066 | 8056536440 | 8056533031 | Bacteria | 8964429 |
| 1067 | 8056572041 | 8056569372 | Bacteria | 5997322 |
| 1068 | 8057803878 | 8057798959 | Bacteria | 6713499 |
| 1069 | Ga0495648_0073023 | |||
| 1070 | SwRhRL2b_contig_2478714 | |||
| 1071 | JGI25162J39368_1005306 | |||
| 1072 | JGI25162J39368_1005513 | |||
| 1073 | JGI25154J39366_1004759 | |||
| 1074 | JGI25163J39215_1001948 | |||
| 1075 | JGI25163J39215_1002029 | |||
| 1076 | JGI25164J39214_1002669 | |||
| 1077 | JGI25164J39214_1002812 | |||
| 1078 | JGI25165J46597_1005143 | |||
| 1079 | JGI25165J46597_1005440 | |||
| 1080 | rootH1_10001451 | |||
| 1081 | rootH1_10025242 | |||
| 1082 | Ga0055538_1000042 | |||
| 1083 | Ga0055539_1000055 | |||
| 1084 | Ga0055533_1000067 | |||
| 1085 | Ga0055532_1000053 | |||
| 1086 | Ga0055525_1000103 | |||
| 1087 | Ga0055535_1002633 | |||
| 1088 | Ga0055536_1002107 | |||
| 1089 | Ga0055536_1013930 | |||
| 1090 | Ga0055536_1017823 | |||
| 1091 | Ga0055530_10004850 | |||
| 1092 | Ga0055530_10015387 | |||
| 1093 | Ga0055530_10015585 | |||
| 1094 | Ga0055540_1000330 | |||
| 1095 | Ga0055540_1000552 | |||
| 1096 | Ga0055540_1009024 | |||
| 1097 | Ga0055540_1021543 | |||
| 1098 | Ga0055531_10000125 | |||
| 1099 | Ga0055541_1000042 | |||
| 1100 | Ga0058692_1017633 | |||
| 1101 | Ga0065714_10003334 | |||
| 1102 | Ga0065714_10012864 | |||
| 1103 | Ga0065714_10086001 | |||
| 1104 | Ga0065704_10009187 | |||
| 1105 | Ga0065704_10032660 | |||
| 1106 | Ga0065704_10161370 | |||
| 1107 | Ga0065704_10212940 | |||
| 1108 | Ga0065712_10011834 | |||
| 1109 | Ga0065712_10068081 | |||
| 1110 | Ga0070670_100000686 | |||
| 1111 | Ga0070661_100000664 | |||
| 1112 | Ga0070669_100000417 | |||
| 1113 | Ga0070669_100001254 | |||
| 1114 | Ga0070669_100283914 | |||
| 1115 | Ga0070673_100681125 | |||
| 1116 | Ga0070663_100337175 | |||
| 1117 | Ga0070662_100000042 | |||
| 1118 | Ga0070662_100045050 | |||
| 1119 | Ga0070665_100031276 | |||
| 1120 | Ga0070665_100150735 | |||
| 1121 | Ga0070664_100000733 | |||
| 1122 | Ga0068854_100007019 | |||
| 1123 | Ga0068859_101243290 | |||
| 1124 | Ga0068851_10000002 | |||
| 1125 | Ga0075432_10012148 | |||
| 1126 | Ga0075432_10018695 | |||
| 1127 | Ga0075432_10102147 | |||
| 1128 | Ga0075362_10070790 | |||
| 1129 | Ga0075362_10132324 | |||
| 1130 | Ga0075369_10089781 | |||
| 1131 | Ga0097620_101243042 | |||
| 1132 | Ga0099823_1000360 | |||
| 1133 | Ga0079104_1000478 | |||
| 1134 | Ga0079104_1000630 | |||
| 1135 | Ga0079104_1018176 | |||
| 1136 | Ga0105251_10000011 | |||
| 1137 | Ga0105251_10000163 | |||
| 1138 | Ga0105251_10003296 | |||
| 1139 | Ga0105251_10022564 | |||
| 1140 | Ga0105251_10034835 | |||
| 1141 | Ga0105251_10047747 | |||
| 1142 | Ga0105251_10058309 | |||
| 1143 | Ga0105251_10072165 | |||
| 1144 | Ga0105244_10003742 | |||
| 1145 | Ga0105244_10007401 | |||
| 1146 | Ga0105244_10010383 | |||
| 1147 | Ga0105244_10040053 | |||
| 1148 | Ga0105244_10043153 | |||
| 1149 | Ga0105244_10044573 | |||
| 1150 | Ga0105244_10045278 | |||
| 1151 | Ga0105244_10078772 | |||
| 1152 | Ga0105244_10099077 | |||
| 1153 | Ga0105250_10001071 | |||
| 1154 | Ga0105250_10013916 | |||
| 1155 | Ga0105250_10024365 | |||
| 1156 | Ga0105250_10025701 | |||
| 1157 | Ga0105250_10027894 | |||
| 1158 | Ga0105250_10192138 | |||
| 1159 | Ga0105245_10740487 | |||
| 1160 | Ga0105243_10000188 | |||
| 1161 | Ga0105243_10001384 | |||
| 1162 | Ga0105243_10048181 | |||
| 1163 | Ga0105243_10070431 | |||
| 1164 | Ga0105243_10102040 | |||
| 1165 | Ga0105242_10000489 | |||
| 1166 | Ga0105248_10021285 | |||
| 1167 | Ga0105237_10002187 | |||
| 1168 | Ga0105237_10201739 | |||
| 1169 | Ga0105249_10821813 | |||
| 1170 | Ga0105246_10032547 | |||
| 1171 | Ga0105246_10038380 | |||
| 1172 | Ga0105246_10052541 | |||
| 1173 | Ga0105246_10054731 | |||
| 1174 | Ga0157336_1000676 | |||
| 1175 | Ga0157345_1000583 | |||
| 1176 | Ga0157373_10012234 | |||
| 1177 | Ga0157373_10082456 | |||
| 1178 | Ga0157373_10085261 | |||
| 1179 | Ga0157371_10000243 | |||
| 1180 | Ga0157371_10035661 | |||
| 1181 | Ga0157371_10081760 | |||
| 1182 | Ga0157371_10124307 | |||
| 1183 | Ga0157371_10396060 | |||
| 1184 | Ga0157371_10573519 | |||
| 1185 | Ga0157371_10573520 | |||
| 1186 | Ga0157370_10000199 | |||
| 1187 | Ga0157370_10140916 | |||
| 1188 | Ga0157370_10141103 | |||
| 1189 | Ga0157370_10919384 | |||
| 1190 | Ga0157369_10109808 | |||
| 1191 | Ga0157369_10178907 | |||
| 1192 | Ga0157369_10648022 | |||
| 1193 | Ga0157369_10668585 | |||
| 1194 | Ga0157369_10713790 | |||
| 1195 | Ga0163162_10164309 | |||
| 1196 | Ga0163162_10176131 | |||
| 1197 | Ga0157372_10001840 | |||
| 1198 | Ga0157372_10042028 | |||
| 1199 | Ga0182008_10002892 | |||
| 1200 | Ga0182008_10043820 | |||
| 1201 | Ga0182008_10051354 | |||
| 1202 | Ga0182008_10052508 | |||
| 1203 | Ga0182006_1005570 | |||
| 1204 | Ga0182006_1031266 | |||
| 1205 | Ga0182006_1031761 | |||
| 1206 | Ga0182006_1049210 | |||
| 1207 | Ga0182006_1108978 | |||
| 1208 | Ga0182007_10019444 | |||
| 1209 | Ga0182007_10026349 | |||
| 1210 | Ga0182005_1008848 | |||
| 1211 | Ga0182005_1014004 | |||
| 1212 | Ga0182005_1038979 | |||
| 1213 | Ga0163161_10110357 | |||
| 1214 | Ga0163161_10742042 | |||
| 1215 | Ga0163161_10873663 | |||
| 1216 | Ga0209435_103159 | |||
| 1217 | Ga0209760_100058 | |||
| 1218 | Ga0209760_100060 | |||
| 1219 | Ga0209784_100060 | |||
| 1220 | Ga0209566_100075 | |||
| 1221 | Ga0209566_100644 | |||
| 1222 | Ga0209674_100100 | |||
| 1223 | Ga0209147_100096 | |||
| 1224 | Ga0209563_100118 | |||
| 1225 | Ga0209563_100242 | |||
| 1226 | Ga0207427_100056 | |||
| 1227 | Ga0207427_100063 | |||
| 1228 | Ga0209437_100065 | |||
| 1229 | Ga0209437_100133 | |||
| 1230 | Ga0209258_100221 | |||
| 1231 | Ga0209646_1000230 | |||
| 1232 | Ga0209677_100057 | |||
| 1233 | Ga0209759_1001811 | |||
| 1234 | Ga0209233_1000085 | |||
| 1235 | Ga0209233_1000133 | |||
| 1236 | Ga0209675_1004836 | |||
| 1237 | Ga0209676_1000076 | |||
| 1238 | Ga0209676_1000314 | |||
| 1239 | Ga0209676_1000337 | |||
| 1240 | Ga0209676_1001941 | |||
| 1241 | Ga0209676_1018983 | |||
| 1242 | Ga0209050_1000063 | |||
| 1243 | Ga0209050_1000080 | |||
| 1244 | Ga0209050_1000106 | |||
| 1245 | Ga0209050_1002168 | |||
| 1246 | Ga0209051_1000045 | |||
| 1247 | Ga0209051_1000260 | |||
| 1248 | Ga0209051_1000283 | |||
| 1249 | Ga0209051_1023520 | |||
| 1250 | Ga0209257_1000185 | |||
| 1251 | Ga0207656_10000010 | |||
| 1252 | Ga0207696_1000047 | |||
| 1253 | Ga0207696_1000118 | |||
| 1254 | Ga0207696_1000168 | |||
| 1255 | Ga0207696_1000339 | |||
| 1256 | Ga0207696_1006336 | |||
| 1257 | Ga0207696_1007078 | |||
| 1258 | Ga0207696_1015131 | |||
| 1259 | Ga0207655_1000104 | |||
| 1260 | Ga0207655_1000120 | |||
| 1261 | Ga0207655_1000415 | |||
| 1262 | Ga0207655_1000606 | |||
| 1263 | Ga0207655_1000921 | |||
| 1264 | Ga0207655_1001228 | |||
| 1265 | Ga0207655_1001571 | |||
| 1266 | Ga0207655_1005549 | |||
| 1267 | Ga0207655_1006374 | |||
| 1268 | Ga0207655_1030279 | |||
| 1269 | Ga0207655_1037818 | |||
| 1270 | Ga0207655_1075129 | |||
| 1271 | Ga0207655_1087892 | |||
| 1272 | Ga0207713_1000049 | |||
| 1273 | Ga0207713_1000073 | |||
| 1274 | Ga0207713_1000261 | |||
| 1275 | Ga0207713_1001031 | |||
| 1276 | Ga0207713_1003024 | |||
| 1277 | Ga0207713_1004132 | |||
| 1278 | Ga0207713_1004152 | |||
| 1279 | Ga0207713_1005408 | |||
| 1280 | Ga0207713_1007215 | |||
| 1281 | Ga0207713_1008483 | |||
| 1282 | Ga0207713_1020756 | |||
| 1283 | Ga0207713_1024817 | |||
| 1284 | Ga0207713_1036082 | |||
| 1285 | Ga0207713_1039597 | |||
| 1286 | Ga0207713_1044187 | |||
| 1287 | Ga0207713_1075843 | |||
| 1288 | Ga0207705_10244038 | |||
| 1289 | Ga0207671_10000380 | |||
| 1290 | Ga0207649_10000041 | |||
| 1291 | Ga0207649_10723761 | |||
| 1292 | Ga0207681_10000342 | |||
| 1293 | Ga0207681_10006860 | |||
| 1294 | Ga0207681_10283672 | |||
| 1295 | Ga0207650_10000278 | |||
| 1296 | Ga0207650_10000324 | |||
| 1297 | Ga0207706_10000128 | |||
| 1298 | Ga0207706_10012214 | |||
| 1299 | Ga0207686_10001625 | |||
| 1300 | Ga0207709_10000030 | |||
| 1301 | Ga0207709_10000343 | |||
| 1302 | Ga0207709_10046034 | |||
| 1303 | Ga0207709_10278852 | |||
| 1304 | Ga0207669_10130435 | |||
| 1305 | Ga0207711_10057873 | |||
| 1306 | Ga0207679_10000081 | |||
| 1307 | Ga0207712_10607671 | |||
| 1308 | Ga0207640_10008549 | |||
| 1309 | Ga0209281_1000070 | |||
| 1310 | Ga0209281_1000127 | |||
| 1311 | Ga0209281_1002082 | |||
| 1312 | Ga0209281_1011659 | |||
| 1313 | Ga0209973_1008316 | |||
| 1314 | Ga0209389_1000020 | |||
| 1315 | Ga0209389_1065562 | |||
| 1316 | Ga0209371_1000228 | |||
| 1317 | Ga0209371_1000302 | |||
| 1318 | Ga0209371_1004867 | |||
| 1319 | Ga0209969_1007382 | |||
| 1320 | Ga0209996_1002060 | |||
| 1321 | Ga0209995_1002220 | |||
| 1322 | Ga0209999_1012969 | |||
| 1323 | Ga0209999_1042362 | |||
| 1324 | Ga0207428_10014173 | |||
| 1325 | Ga0207428_10050869 | |||
| 1326 | Ga0207428_10101513 | |||
| 1327 | Ga0207428_10109854 | |||
| 1328 | Ga0207428_10146760 | |||
| 1329 | Ga0207428_10160413 | |||
| 1330 | Ga0268266_10007379 | |||
| 1331 | Ga0268266_10447827 | |||
| 1332 | Ga0268256_1000188 | |||
| 1333 | Ga0268256_1000669 | |||
| 1334 | Ga0268256_1006735 | |||
| 1335 | Ga0316177_1078431 | |||
| 1336 | Ga0314311_1094938 | |||
| 1337 | Ga0316179_1075362 | |||
| 1338 | Ga0316178_1011341 | |||
| 1339 | Ga0316183_1006673 | |||
| 1340 | Ga0316183_1205059 | |||
| 1341 | Ga0316181_1020879 | |||
| 1342 | Ga0316181_1093595 | |||
| 1343 | Ga0265331_10007682 | |||
| 1344 | Ga0265327_10001699 | |||
| 1345 | Ga0265327_10003331 | |||
| 1346 | Ga0265327_10003570 | |||
| 1347 | Ga0265316_10002392 | |||
| 1348 | Ga0307408_100000013 | |||
| 1349 | Ga0307408_100000192 | |||
| 1350 | Ga0307408_100059501 | |||
| 1351 | Ga0307408_100104143 | |||
| 1352 | Ga0307408_101040811 | |||
| 1353 | Ga0316575_10002085 | |||
| 1354 | Ga0316575_10054629 | |||
| 1355 | Ga0307516_10100762 | |||
| 1356 | Ga0307405_10079322 | |||
| 1357 | Ga0307405_10084243 | |||
| 1358 | Ga0307413_10076951 | |||
| 1359 | Ga0307406_10001571 | |||
| 1360 | Ga0307407_10060628 | |||
| 1361 | Ga0307412_10275955 | |||
| 1362 | Ga0307412_10852062 | |||
| 1363 | Ga0307409_100164583 | |||
| 1364 | Ga0307416_100355594 | |||
| 1365 | Ga0307416_100810323 | |||
| 1366 | Ga0307416_101578477 | |||
| 1367 | Ga0307414_10014793 | |||
| 1368 | Ga0307414_10079818 | |||
| 1369 | Ga0307414_10095095 | |||
| 1370 | Ga0307411_10032563 | |||
| 1371 | Ga0307411_10080529 | |||
| 1372 | Ga0316593_10122454 | |||
| 1373 | Ga0307510_10067813 | |||
| 1374 | Ga0316574_0009395 | |||
| 1375 | Ga0316582_0138732 | |||
| 1376 | Ga0316582_0439337 | |||
| 1377 | Ga0316584_0016769 | |||
| 1378 | Ga0316584_0150926 | |||
| 1379 | Ga0237819_00789 | |||
| 1380 | Ga0400485_00908 | |||
| 1381 | Ga0400486_03367 | |||
| 1382 | Ga0400483_245346 | |||
| 1383 | Ga0400483_271482 | |||
| 1384 | Ga0400489_54721 | |||
| 1385 | Ga0439436_0056726 | |||
| 1386 | Ga0439438_002874 | |||
| 1387 | Ga0439438_005405 | |||
| 1388 | Ga0439438_013588 | |||
| 1389 | Ga0439438_019662 | |||
| 1390 | Ga0439438_020305 | |||
| 1391 | Ga0439438_022354 | |||
| 1392 | Ga0439438_025244 | |||
| 1393 | Ga0439447_005046 | |||
| 1394 | Ga0439447_008010 | |||
| 1395 | Ga0439447_013421 | |||
| 1396 | Ga0439447_013584 | |||
| 1397 | Ga0439466_0004914 | |||
| 1398 | Ga0439466_0006573 | |||
| 1399 | Ga0439466_0020358 | |||
| 1400 | Ga0439466_0022380 | |||
| 1401 | Ga0439466_0027219 | |||
| 1402 | Ga0439466_0035356 | |||
| 1403 | Ga0439466_0050004 | |||
| 1404 | Ga0439466_0057743 | |||
| 1405 | Ga0439465_0183859 | |||
| 1406 | Ga0451843_0221753 | |||
| 1407 | Ga0451855_1859058 | |||
| 1408 | Ga0439437_000899 | |||
| 1409 | Ga0439432_002353 | |||
| 1410 | Ga0439432_006366 | |||
| 1411 | Ga0439432_012974 | |||
| 1412 | Ga0439432_020988 | |||
| 1413 | Ga0439432_027068 | |||
| 1414 | Ga0439432_126370 | |||
| 1415 | Ga0439449_0104606 | |||
| 1416 | Ga0439451_000464 | |||
| 1417 | Ga0439452_007545 | |||
| 1418 | Ga0439452_013254 | |||
| 1419 | Ga0439452_013601 | |||
| 1420 | Ga0439452_013880 | |||
| 1421 | Ga0439452_015689 | |||
| 1422 | Ga0439456_000103 | |||
| 1423 | Ga0439456_007236 | |||
| 1424 | Ga0439463_000187 | |||
| 1425 | Ga0439463_000495 | |||
| 1426 | Ga0439463_008136 | |||
| 1427 | Ga0450911_000022 | |||
| 1428 | Ga0450911_002724 | |||
| 1429 | Ga0450911_003507 | |||
| 1430 | Ga0450923_053418 | |||
| 1431 | Ga0450890_007951 | |||
| 1432 | Ga0450902_000456 | |||
| 1433 | Ga0450902_001945 | |||
| 1434 | Ga0450903_003615 | |||
| 1435 | Ga0450904_001485 | |||
| 1436 | Ga0450904_002387 | |||
| 1437 | Ga0450905_000070 | |||
| 1438 | Ga0450906_004475 | |||
| 1439 | Ga0450907_002607 | |||
| 1440 | Ga0450907_003068 | |||
| 1441 | Ga0450910_004219 | |||
| 1442 | Ga0439446_0000864 | |||
| 1443 | Ga0439446_0002450 | |||
| 1444 | Ga0439446_0012710 | |||
| 1445 | Ga0439446_0013034 | |||
| 1446 | Ga0439446_0017685 | |||
| 1447 | Ga0450908_006061 | |||
| 1448 | Ga0450909_002548 | |||
| 1449 | Ga0450909_005861 | |||
| 1450 | Ga0439434_0007187 | |||
| 1451 | Ga0439434_0025739 | |||
| 1452 | Ga0439459_0017311 | |||
| 1453 | Ga0439464_0108102 | |||
| 1454 | Ga0439460_0001891 | |||
| 1455 | Ga0439460_0008816 | |||
| 1456 | Ga0439460_0023645 | |||
| 1457 | Ga0450893_0008181 | |||
| 1458 | Ga0451577_0077381 | |||
| 1459 | Ga0451577_0719363 | |||
| 1460 | Ga0439440_0001951 | |||
| 1461 | Ga0466961_0148238 | |||
| 1462 | Ga0453684_0001596 | |||
| 1463 | Ga0453684_0006330 | |||
| 1464 | Ga0453684_0144478 | |||
| 1465 | Ga0453684_0215480 | |||
| 1466 | Ga0451576_0000174 | |||
| 1467 | Ga0495617_006470 | |||
| 1468 | Ga0495617_009460 | |||
| 1469 | Ga0495617_023101 | |||
| 1470 | Ga0495627_000037 | |||
| 1471 | Ga0495627_000291 | |||
| 1472 | Ga0495627_010669 | |||
| 1473 | Ga0495627_011003 | |||
| 1474 | Ga0495627_012131 | |||
| 1475 | Ga0495627_047436 | |||
| 1476 | Ga0495603_0038509 | |||
| 1477 | Ga0495603_0158086 | |||
| 1478 | Ga0495590_0015406 | |||
| 1479 | Ga0495590_0020517 | |||
| 1480 | Ga0495590_0029866 | |||
| 1481 | Ga0495591_000036 | |||
| 1482 | Ga0495591_000753 | |||
| 1483 | Ga0495591_002445 | |||
| 1484 | Ga0495591_002891 | |||
| 1485 | Ga0495591_009904 | |||
| 1486 | Ga0495591_010733 | |||
| 1487 | Ga0495591_018415 | |||
| 1488 | Ga0495591_019925 | |||
| 1489 | Ga0495629_0193868 | |||
| 1490 | Ga0495638_0031267 | |||
| 1491 | Ga0495638_0045618 | |||
| 1492 | Ga0495638_0049486 | |||
| 1493 | Ga0495638_0100145 | |||
| 1494 | Ga0495638_0113834 | |||
| 1495 | Ga0495638_0248350 | |||
| 1496 | Ga0495653_0001298 | |||
| 1497 | Ga0495653_0046779 | |||
| 1498 | Ga0495650_0000311 | |||
| 1499 | Ga0495650_0003191 | |||
| 1500 | Ga0495650_0010347 | |||
| 1501 | Ga0495650_0027431 | |||
| 1502 | Ga0495650_0036991 | |||
| 1503 | Ga0495605_0000033 | |||
| 1504 | Ga0495605_0000209 | |||
| 1505 | Ga0495605_0001216 | |||
| 1506 | Ga0495605_0002128 | |||
| 1507 | Ga0495605_0016035 | |||
| 1508 | Ga0495605_0030986 | |||
| 1509 | Ga0495605_0051663 | |||
| 1510 | Ga0495605_0079791 | |||
| 1511 | Ga0495605_0166072 | |||
| 1512 | Ga0495639_0000248 | |||
| 1513 | Ga0495639_0109206 | |||
| 1514 | Ga0495584_0038504 | |||
| 1515 | Ga0495584_0039709 | |||
| 1516 | Ga0495584_0041802 | |||
| 1517 | Ga0495584_0042048 | |||
| 1518 | Ga0495584_0044790 | |||
| 1519 | Ga0495584_0051173 | |||
| 1520 | Ga0495584_0066506 | |||
| 1521 | Ga0495585_0002501 | |||
| 1522 | Ga0495585_0022154 | |||
| 1523 | Ga0495585_0089473 | |||
| 1524 | Ga0495585_0106987 | |||
| 1525 | Ga0495585_0153449 | |||
| 1526 | Ga0495594_0016504 | |||
| 1527 | Ga0495594_0181063 | |||
| 1528 | Ga0495596_0000258 | |||
| 1529 | Ga0495596_0063601 | |||
| 1530 | Ga0495607_0000482 | |||
| 1531 | Ga0495607_0000938 | |||
| 1532 | Ga0495607_0001384 | |||
| 1533 | Ga0495607_0002109 | |||
| 1534 | Ga0495607_0002221 | |||
| 1535 | Ga0495607_0003809 | |||
| 1536 | Ga0495607_0025076 | |||
| 1537 | Ga0495607_0053155 | |||
| 1538 | Ga0495607_0060395 | |||
| 1539 | Ga0495607_0064082 | |||
| 1540 | Ga0495607_0159648 | |||
| 1541 | Ga0495607_0174988 | |||
| 1542 | Ga0495607_0180299 | |||
| 1543 | Ga0495583_0000031 | |||
| 1544 | Ga0495583_0000583 | |||
| 1545 | Ga0495583_0000830 | |||
| 1546 | Ga0495583_0006886 | |||
| 1547 | Ga0495583_0007941 | |||
| 1548 | Ga0495583_0008728 | |||
| 1549 | Ga0495583_0014672 | |||
| 1550 | Ga0495583_0045314 | |||
| 1551 | Ga0495606_0000271 | |||
| 1552 | Ga0495606_0001608 | |||
| 1553 | Ga0495606_0021027 | |||
| 1554 | Ga0495606_0030559 | |||
| 1555 | Ga0495606_0047696 | |||
| 1556 | Ga0495606_0186134 | |||
| 1557 | Ga0495606_0220015 | |||
| 1558 | Ga0495610_0007823 | |||
| 1559 | Ga0495610_0012332 | |||
| 1560 | Ga0495610_0015008 | |||
| 1561 | Ga0495610_0043317 | |||
| 1562 | Ga0495610_0044480 | |||
| 1563 | Ga0495616_0020878 | |||
| 1564 | Ga0495616_0030970 | |||
| 1565 | Ga0495616_0042996 | |||
| 1566 | Ga0495616_0043388 | |||
| 1567 | Ga0495616_0095238 | |||
| 1568 | Ga0495616_0155289 | |||
| 1569 | Ga0495620_0000112 | |||
| 1570 | Ga0495620_0000222 | |||
| 1571 | Ga0495620_0005934 | |||
| 1572 | Ga0495620_0020043 | |||
| 1573 | Ga0495620_0031315 | |||
| 1574 | Ga0495630_0108345 | |||
| 1575 | Ga0495631_0006265 | |||
| 1576 | Ga0495631_0027697 | |||
| 1577 | Ga0495631_0057391 | |||
| 1578 | Ga0495631_0066960 | |||
| 1579 | Ga0495632_0001173 | |||
| 1580 | Ga0495632_0001768 | |||
| 1581 | Ga0495632_0004961 | |||
| 1582 | Ga0495632_0028752 | |||
| 1583 | Ga0495632_0039577 | |||
| 1584 | Ga0495632_0042967 | |||
| 1585 | Ga0495632_0043209 | |||
| 1586 | Ga0495632_0050671 | |||
| 1587 | Ga0495632_0053357 | |||
| 1588 | Ga0495632_0124728 | |||
| 1589 | Ga0495632_0172623 | |||
| 1590 | Ga0495637_0000064 | |||
| 1591 | Ga0495637_0000110 | |||
| 1592 | Ga0495637_0005109 | |||
| 1593 | Ga0495637_0008823 | |||
| 1594 | Ga0495637_0011594 | |||
| 1595 | Ga0495637_0022282 | |||
| 1596 | Ga0495637_0030035 | |||
| 1597 | Ga0495637_0031705 | |||
| 1598 | Ga0495637_0060345 | |||
| 1599 | Ga0495637_0076926 | |||
| 1600 | Ga0495643_0000175 | |||
| 1601 | Ga0495643_0001951 | |||
| 1602 | Ga0495643_0002575 | |||
| 1603 | Ga0495643_0003738 | |||
| 1604 | Ga0495643_0007213 | |||
| 1605 | Ga0495643_0030249 | |||
| 1606 | Ga0495643_0046696 | |||
| 1607 | Ga0495643_0064532 | |||
| 1608 | Ga0495643_0091610 | |||
| 1609 | Ga0495643_0099515 | |||
| 1610 | Ga0495644_0003744 | |||
| 1611 | Ga0495644_0015990 | |||
| 1612 | Ga0495644_0020181 | |||
| 1613 | Ga0495644_0025150 | |||
| 1614 | Ga0495648_0001400 | |||
| 1615 | Ga0495648_0002582 | |||
| 1616 | Ga0495648_0028056 | |||
| 1617 | Ga0495648_0032418 | |||
| 1618 | Ga0495648_0057222 | |||
| 1619 | Ga0495648_0057481 | |||
| 1620 | Ga0495648_0077708 | |||
| 1621 | Ga0495648_0139014 | |||
| 1622 | Ga0495666_0019569 | |||
| 1623 | Ga0495642_0000266 | |||
| 1624 | Ga0495642_0027458 | |||
| 1625 | Ga0495654_0000773 | |||
| 1626 | Ga0495654_0002519 | |||
| 1627 | Ga0495654_0002645 | |||
| 1628 | Ga0495654_0002943 | |||
| 1629 | Ga0495654_0024207 | |||
| 1630 | Ga0495654_0030911 | |||
| 1631 | Ga0495654_0052489 | |||
| 1632 | Ga0495654_0061597 | |||
| 1633 | Ga0495654_0091541 | |||
| 1634 | Ga0495654_0141112 | |||
| 1635 | Ga0495587_0041989 | |||
| 1636 | Ga0495587_0045522 | |||
| 1637 | Ga0495609_0000018 | |||
| 1638 | Ga0495609_0000089 | |||
| 1639 | Ga0495609_0000161 | |||
| 1640 | Ga0495609_0061372 | |||
| 1641 | Ga0495597_0000026 | |||
| 1642 | Ga0495597_0001094 | |||
| 1643 | Ga0495597_0040454 | |||
| 1644 | Ga0495597_0055525 | |||
| 1645 | Ga0495622_0003910 | |||
| 1646 | Ga0495622_0008666 | |||
| 1647 | Ga0495622_0016546 | |||
| 1648 | Ga0495633_0000062 | |||
| 1649 | Ga0495633_0037387 | |||
| 1650 | Ga0495656_0049529 | |||
| 1651 | Ga0495668_0031470 | |||
| 1652 | Ga0495668_0033489 | |||
| 1653 | Ga0495668_0177243 | |||
| 1654 | Ga0495634_0068312 | |||
| 1655 | Ga0495611_0000395 | |||
| 1656 | Ga0495611_0035575 | |||
| 1657 | Ga0495625_0000194 | |||
| 1658 | Ga0495625_0057392 | |||
| 1659 | Ga0495625_0069189 | |||
| 1660 | Ga0495635_0107839 | |||
| 1661 | Ga0495659_0008033 | |||
| 1662 | Ga0495659_0018348 | |||
| 1663 | Ga0495661_0000016 | |||
| 1664 | Ga0495661_0000093 | |||
| 1665 | Ga0495661_0000115 | |||
| 1666 | Ga0495661_0000233 | |||
| 1667 | Ga0495661_0000541 | |||
| 1668 | Ga0495661_0085050 | |||
| 1669 | Ga0495661_0123173 | |||
| 1670 | Ga0495623_0063662 | |||
| 1671 | Ga0495646_0100477 | |||
| 1672 | Ga0495669_0027980 | |||
| 1673 | Ga0495669_0281982 | |||
| 1674 | Ga0495670_0008132 | |||
| 1675 | Ga0495670_0029437 | |||
| 1676 | Ga0495670_0036942 | |||
| 1677 | Ga0495670_0043992 | |||
| 1678 | Ga0495670_0118586 | |||
| 1679 | Ga0495671_0001725 | |||
| 1680 | Ga0495671_0010701 | |||
| 1681 | Ga0495671_0021549 | |||
| 1682 | Ga0495671_0041876 | |||
| 1683 | Ga0495671_0042619 | |||
| 1684 | Ga0495671_0048067 | |||
| 1685 | Ga0495671_0050804 | |||
| 1686 | Ga0495671_0054127 | |||
| 1687 | Ga0495671_0076883 | |||
| 1688 | Ga0495649_0001210 | |||
| 1689 | Ga0495649_0001934 | |||
| 1690 | Ga0495649_0008385 | |||
| 1691 | Ga0495649_0032935 | |||
| 1692 | Ga0495649_0033119 | |||
| 1693 | Ga0495649_0040252 | |||
| 1694 | Ga0495649_0040894 | |||
| 1695 | Ga0495649_0045564 | |||
| 1696 | Ga0495649_0085978 | |||
| 1697 | Ga0495589_0018396 | |||
| 1698 | Ga0495589_0027152 | |||
| 1699 | Ga0495589_0178872 | |||
| 1700 | Ga0495600_0160842 | |||
| 1701 | Ga0495660_0000540 | |||
| 1702 | Ga0495660_0001212 | |||
| 1703 | Ga0495660_0001791 | |||
| 1704 | Ga0495660_0018356 | |||
| 1705 | Ga0495660_0024621 | |||
| 1706 | Ga0495660_0045237 | |||
| 1707 | Ga0495660_0063961 | |||
| 1708 | Ga0495660_0090833 | |||
| 1709 | Ga0495660_0092737 | |||
| 1710 | Ga0495660_0102861 | |||
| 1711 | Ga0495604_0077308 | |||
| 1712 | Ga0495604_0104275 | |||
| 1713 | Ga0495636_0025372 | |||
| 1714 | Ga0495672_0002759 | |||
| 1715 | Ga0495672_0004062 | |||
| 1716 | Ga0495672_0015156 | |||
| 1717 | Ga0495672_0024361 | |||
| 1718 | Ga0495672_0025709 | |||
| 1719 | Ga0495672_0026547 | |||
| 1720 | Ga0495672_0034982 | |||
| 1721 | Ga0495672_0039959 | |||
| 1722 | Ga0495672_0064617 | |||
| 1723 | Ga0495672_0258084 | |||
| 1724 | Ga0495676_0000052 | |||
| 1725 | Ga0495676_0041268 | |||
| 1726 | Ga0495680_0054078 | |||
| 1727 | Ga0495680_0076800 | |||
| 1728 | Ga0495680_0084812 | |||
| 1729 | Ga0495683_0000137 | |||
| 1730 | Ga0495683_0000254 | |||
| 1731 | Ga0495683_0031552 | |||
| 1732 | Ga0495683_0040465 | |||
| 1733 | Ga0495683_0044021 | |||
| 1734 | Ga0495683_0049012 | |||
| 1735 | Ga0495683_0054943 | |||
| 1736 | Ga0495683_0090511 | |||
| 1737 | Ga0495687_019088 | |||
| 1738 | Ga0495687_031228 | |||
| 1739 | Ga0495675_0167747 | |||
| 1740 | Ga0495675_0177245 | |||
| 1741 | Ga0495677_0015191 | |||
| 1742 | Ga0495679_000136 | |||
| 1743 | Ga0495679_000368 | |||
| 1744 | Ga0495679_019406 | |||
| 1745 | Ga0495673_0000487 | |||
| 1746 | Ga0495673_0000858 | |||
| 1747 | Ga0495673_0004566 | |||
| 1748 | Ga0495673_0012245 | |||
| 1749 | Ga0495673_0024335 | |||
| 1750 | Ga0495673_0027595 | |||
| 1751 | Ga0495673_0037928 | |||
| 1752 | Ga0495673_0194970 | |||
| 1753 | Ga0495673_0202809 | |||
| 1754 | Ga0495673_0203908 | |||
| 1755 | Ga0495681_0006934 | |||
| 1756 | Ga0495681_0022764 | |||
| 1757 | Ga0495681_0028546 | |||
| 1758 | Ga0495681_0037709 | |||
| 1759 | Ga0495681_0039118 | |||
| 1760 | Ga0495681_0040587 | |||
| 1761 | Ga0495681_0042086 | |||
| 1762 | Ga0495681_0044871 | |||
| 1763 | Ga0495681_0118793 | |||
| 1764 | Ga0495681_0146527 | |||
| 1765 | Ga0495686_0041182 | |||
| 1766 | Ga0495686_0074046 | |||
| 1767 | Ga0495626_0000126 | |||
| 1768 | Ga0495626_0016183 | |||
| 1769 | Ga0495626_0019595 | |||
| 1770 | Ga0495626_0026996 | |||
| 1771 | Ga0495626_0035412 | |||
| 1772 | Ga0495626_0035440 | |||
| 1773 | Ga0495626_0038193 | |||
| 1774 | Ga0496102_0134254 | |||
| 1775 | Ga0496102_0559426 | |||
| 1776 | Ga0496102_0733024 | |||
| 1777 | Ga0496103_0172472 | |||
| 1778 | Ga0496106_0132833 | |||
| 1779 | Ga0496110_0277946 | |||
| 1780 | Ga0496110_0319094 | |||
| 1781 | Ga0496110_0343334 | |||
| 1782 | Ga0496110_0434333 | |||
| 1783 | Ga0496112_0287635 | |||
| 1784 | Ga0496113_0401979 | |||
| 1785 | Ga0496114_0012182 | |||
| 1786 | Ga0496116_0000488 | |||
| 1787 | Ga0496116_0019231 | |||
| 1788 | Ga0496116_0037567 | |||
| 1789 | Ga0496116_0073735 | |||
| 1790 | Ga0496116_0106046 | |||
| 1791 | Ga0496117_0000666 | |||
| 1792 | Ga0496117_0004216 | |||
| 1793 | Ga0496117_0067351 | |||
| 1794 | Ga0496117_0072615 | |||
| 1795 | Ga0496118_0003760 | |||
| 1796 | Ga0496118_0004272 | |||
| 1797 | Ga0496118_0030186 | |||
| 1798 | Ga0496118_0041647 | |||
| 1799 | Ga0496119_0000220 | |||
| 1800 | Ga0496120_0002773 | |||
| 1801 | Ga0496121_0000867 | |||
| 1802 | Ga0496121_0002170 | |||
| 1803 | Ga0496121_0079897 | |||
| 1804 | Ga0496121_0103065 | |||
| 1805 | Ga0496122_0000434 | |||
| 1806 | Ga0496122_0002929 | |||
| 1807 | Ga0496122_0081632 | |||
| 1808 | Ga0496122_0093236 | |||
| 1809 | Ga0496122_0163129 | |||
| 1810 | Ga0496123_0000318 | |||
| 1811 | Ga0496123_0002268 | |||
| 1812 | Ga0496123_0003514 | |||
| 1813 | Ga0496123_0013642 | |||
| 1814 | Ga0496123_0014247 | |||
| 1815 | Ga0496124_0000471 | |||
| 1816 | Ga0496124_0005898 | |||
| 1817 | Ga0496124_0013915 | |||
| 1818 | Ga0496124_0045602 | |||
| 1819 | Ga0496124_0069900 | |||
| 1820 | Ga0496125_0001551 | |||
| 1821 | Ga0496125_0039422 | |||
| 1822 | Ga0496125_0057784 | |||
| 1823 | Ga0496125_0082115 | |||
| 1824 | Ga0496126_0027779 | |||
| 1825 | Ga0496126_0277065 | |||
| 1826 | Ga0501306_009733 | |||
| 1827 | Ga0501305_018629 | |||
| 1828 | Ga0495678_000021 | |||
| 1829 | Ga0495678_000169 | |||
| 1830 | Ga0495678_002042 | |||
| 1831 | Ga0495678_029007 | |||
| 1832 | Ga0495678_029232 | |||
| 1833 | Ga0495678_078603 | |||
| 1834 | Ga0495678_086008 | |||
| 1835 | Ga0495678_127788 | |||
| 1836 | Ga0495682_0000597 | |||
| 1837 | Ga0495682_0001213 | |||
| 1838 | Ga0495682_0028092 | |||
| 1839 | Ga0495682_0111657 | |||
| 1840 | Ga0501312_004226 | |||
| 1841 | Ga0501312_014527 | |||
| 1842 | Ga0501323_020451 | |||
| 1843 | Ga0501335_008315 | |||
| 1844 | Ga0501032_0247168 | |||
| 1845 | Ga0501032_0513831 | |||
| 1846 | Ga0501034_0000214 | |||
| 1847 | Ga0501034_0148754 | |||
| 1848 | Ga0501037_0040282 | |||
| 1849 | Ga0501038_0363218 | |||
| 1850 | Ga0501039_0006128 | |||
| 1851 | Ga0501039_0367515 | |||
| 1852 | Ga0501040_0249150 | |||
| 1853 | Ga0501076_0229649 | |||
| 1854 | Ga0501230_026813 | |||
| 1855 | Ga0501226_000004 | |||
| 1856 | nmdc:mga00v17_296811_c1 | |||
| 1857 | Ga0500573_0052401 | |||
| 1858 | 2511257980 | |||
| 1859 | 2511264623 | |||
| 1860 | 2511269428 | |||
| 1861 | 2511276542 | |||
| 1862 | 2511290487 | |||
| 1863 | 2511296677 | |||
| 1864 | 2511299129 | |||
| 1865 | 2511312747 | |||
| 1866 | 2511321343 | |||
| 1867 | 2511325915 | |||
| 1868 | 2511331957 | |||
| 1869 | 2511340787 | |||
| 1870 | 2511346386 | |||
| 1871 | 2511353026 | |||
| 1872 | 2511356683 | |||
| 1873 | 2511364650 | |||
| 1874 | 2511369245 | |||
| 1875 | 2511374274 | |||
| 1876 | 2511412033 | |||
| 1877 | 2511827236 | |||
| 1878 | 2512327964 | |||
| 1879 | 2554813224 | |||
| 1880 | 2555246605 | |||
| 1881 | 2555672417 | |||
| 1882 | 2583794873 | |||
| 1883 | 2587738659 | |||
| 1884 | 2595315611 | |||
| 1885 | 2597860483 | |||
| 1886 | 2597866236 | |||
| 1887 | 2597872070 | |||
| 1888 | 2599358130 | |||
| 1889 | 2599364493 | |||
| 1890 | 2599370971 | |||
| 1891 | 2599376993 | |||
| 1892 | 2599383295 | |||
| 1893 | 2599389742 | |||
| 1894 | 2599396039 | |||
| 1895 | 2599401278 | |||
| 1896 | 2599407879 | |||
| 1897 | 2599453007 | |||
| 1898 | 2599464945 | |||
| 1899 | 2599471270 | |||
| 1900 | 2599486665 | |||
| 1901 | 2599494140 | |||
| 1902 | 2599504956 | |||
| 1903 | 2599509755 | |||
| 1904 | 2599516356 | |||
| 1905 | 2599520169 | |||
| 1906 | 2599615585 | |||
| 1907 | 2599773506 | |||
| 1908 | 2599807200 | |||
| 1909 | 2599881609 | |||
| 1910 | 2599889993 | |||
| 1911 | 2599895672 | |||
| 1912 | 2599901716 | |||
| 1913 | 2599930516 | |||
| 1914 | 2599944950 | |||
| 1915 | 2599951872 | |||
| 1916 | 2599955321 | |||
| 1917 | 2599962857 | |||
| 1918 | 2599967753 | |||
| 1919 | 2599974044 | |||
| 1920 | 2599978985 | |||
| 1921 | 2599984053 | |||
| 1922 | 2599990226 | |||
| 1923 | 2599996881 | |||
| 1924 | 2600001835 | |||
| 1925 | 2600008950 | |||
| 1926 | 2600012945 | |||
| 1927 | 2600020796 | |||
| 1928 | 2600025748 | |||
| 1929 | 2600031074 | |||
| 1930 | 2600038434 | |||
| 1931 | 2600043766 | |||
| 1932 | 2600048760 | |||
| 1933 | 2600055576 | |||
| 1934 | 2600062018 | |||
| 1935 | 2600067259 | |||
| 1936 | 2600073352 | |||
| 1937 | 2600079903 | |||
| 1938 | 2600217677 | |||
| 1939 | 2600360935 | |||
| 1940 | 2600367866 | |||
| 1941 | 2600445298 | |||
| 1942 | 2601628642 | |||
| 1943 | 2601693827 | |||
| 1944 | 2601777844 | |||
| 1945 | 2601800589 | |||
| 1946 | 2602007805 | |||
| 1947 | 2606078603 | |||
| 1948 | 2606125737 | |||
| 1949 | 2608384038 | |||
| 1950 | 2621297221 | |||
| 1951 | 2624483002 | |||
| 1952 | 2624494531 | |||
| 1953 | 2643844973 | |||
| 1954 | 2643870818 | |||
| 1955 | 2643957681 | |||
| 1956 | 2644025797 | |||
| 1957 | 2644188372 | |||
| 1958 | 2644232287 | |||
| 1959 | 2644286646 | |||
| 1960 | 2644426829 | |||
| 1961 | 2644621294 | |||
| 1962 | 2652545064 | |||
| 1963 | 2671094187 | |||
| 1964 | 2671100667 | |||
| 1965 | 2671129687 | |||
| 1966 | 2671773240 | |||
| 1967 | 2673822198 | |||
| 1968 | 2677899032 | |||
| 1969 | 2678265746 | |||
| 1970 | 2715752427 | |||
| 1971 | 2715759178 | |||
| 1972 | 2718636214 | |||
| 1973 | 2723250971 | |||
| 1974 | 2729145591 | |||
| 1975 | 2738673035 | |||
| 1976 | 2738690995 | |||
| 1977 | 2738716184 | |||
| 1978 | 2738751428 | |||
| 1979 | 2738810161 | |||
| 1980 | 2738860469 | |||
| 1981 | 2738897521 | |||
| 1982 | 2739198068 | |||
| 1983 | 2739230446 | |||
| 1984 | 2739262183 | |||
| 1985 | 2739266868 | |||
| 1986 | 2739287047 | |||
| 1987 | 2739292360 | |||
| 1988 | 2739314957 | |||
| 1989 | 2740169293 | |||
| 1990 | 2743740038 | |||
| 1991 | 2745006980 | |||
| 1992 | 2765586221 | |||
| 1993 | 2774121908 | |||
| 1994 | 2774137145 | |||
| 1995 | 2784262230 | |||
| 1996 | 2784314571 | |||
| 1997 | 2794595178 | |||
| 1998 | 2807410456 | |||
| 1999 | 2807458801 | |||
| 2000 | 2808858073 | |||
| 2001 | 2808906523 | |||
| 2002 | 2808926196 | |||
| 2003 | 2808932321 | |||
| 2004 | 2808938244 | |||
| 2005 | 2808941214 | |||
| 2006 | 2808948297 | |||
| 2007 | 2808954442 | |||
| 2008 | 2808961475 | |||
| 2009 | 2808966559 | |||
| 2010 | 2808977483 | |||
| 2011 | 2808992859 | |||
| 2012 | 2809001389 | |||
| 2013 | 2809219185 | |||
| 2014 | 2812368950 | |||
| 2015 | 2817493661 | |||
| 2016 | 2819659296 | |||
| 2017 | 2819669284 | |||
| 2018 | 2819706334 | |||
| 2019 | 2823422020 | |||
| 2020 | 2825655507 | |||
| 2021 | 2826582820 | |||
| 2022 | 2834033154 | |||
| 2023 | 2842808385 | |||
| 2024 | 2842819865 | |||
| 2025 | 2842829038 | |||
| 2026 | 2842836878 | |||
| 2027 | 2842840523 | |||
| 2028 | 2842847612 | |||
| 2029 | 2842852884 | |||
| 2030 | 2842859181 | |||
| 2031 | 2844666591 | |||
| 2032 | 2852618045 | |||
| 2033 | 2852661124 | |||
| 2034 | 2852673103 | |||
| 2035 | 2857453747 | |||
| 2036 | 2860343991 | |||
| 2037 | 2860872633 | |||
| 2038 | 2878034940 | |||
| 2039 | 2880235581 | |||
| 2040 | 2904522558 | |||
| 2041 | 2904554150 | |||
| 2042 | 2904762018 | |||
| 2043 | 2908452173 | |||
| 2044 | 2912968489 | |||
| 2045 | 2913042153 | |||
| 2046 | 2917076300 | |||
| 2047 | 2917834514 | |||
| 2048 | 2919067685 | |||
| 2049 | 2919127308 | |||
| 2050 | 2919158639 | |||
| 2051 | 2919390549 | |||
| 2052 | 2919418607 | |||
| 2053 | 2919431498 | |||
| 2054 | 2919461651 | |||
| 2055 | 2919485982 | |||
| 2056 | 2919492668 | |||
| 2057 | 2919506314 | |||
| 2058 | 2919701369 | |||
| 2059 | 2923159129 | |||
| 2060 | 2923523025 | |||
| 2061 | 2923591100 | |||
| 2062 | 2926067384 | |||
| 2063 | 2929149541 | |||
| 2064 | 2929194746 | |||
| 2065 | 2931373056 | |||
| 2066 | 2931396022 | |||
| 2067 | 2931397655 | |||
| 2068 | 2935359724 | |||
| 2069 | 2939641926 | |||
| 2070 | 2939654591 | |||
| 2071 | 2945931311 | |||
| 2072 | 2945966378 | |||
| 2073 | 2946007348 | |||
| 2074 | 2946033237 | |||
| 2075 | 2947234025 | |||
| 2076 | 2969309768 | |||
| 2077 | 2971411019 | |||
| 2078 | 2974294488 | |||
| 2079 | 2977257974 | |||
| 2080 | 2980126843 | |||
| 2081 | 2980189773 | |||
| 2082 | 2984287030 | |||
| 2083 | 2984507044 | |||
| 2084 | 2988731089 | |||
| 2085 | 2989395510 | |||
| 2086 | 2990198218 | |||
| 2087 | 2990278998 | |||
| 2088 | 2998144993 | |||
| 2089 | 3007255653 | |||
| 2090 | 3007320252 | |||
| 2091 | 3007398779 | |||
| 2092 | 3007425312 | |||
| 2093 | 3007516780 | |||
| 2094 | 3007614719 | |||
| 2095 | 3007621208 | |||
| 2096 | 3007721306 | |||
| 2097 | 3007809384 | |||
| 2098 | 3007860198 | |||
| 2099 | 3007866452 | |||
| 2100 | 3007867149 | |||
| 2101 | 3007874208 | |||
| 2102 | 637322856 | |||
| 2103 | 640486794 | |||
| 2104 | 651174645 | |||
| 2105 | 8001524969 | |||
| 2106 | 8011355933 | |||
| 2107 | 8015693215 | |||
| 2108 | 8016730889 | |||
| 2109 | 8019771222 | |||
| 2110 | 8019780466 | |||
| 2111 | 8029995905 | |||
| 2112 | 8034966880 | |||
| 2113 | 8052499434 | |||
| 2114 | 8054289411 | |||
| 2115 | 8054352914 | |||
| 2116 | 8054508519 | |||
| 2117 | 8054613001 | |||
| 2118 | 8054933562 | |||
| 2119 | 8055776465 | |||
| 2120 | 8055823493 | |||
| 2121 | 8055880492 | |||
| 2122 | 8056115751 | |||
| 2123 | 8056121295 | |||
| 2124 | 8056131209 | |||
| 2125 | 8056136926 | |||
| 2126 | 8056138008 | |||
| 2127 | 8056148360 | |||
| 2128 | 8056151887 | |||
| 2129 | 8056156407 | |||
| 2130 | 8056163196 | |||
| 2131 | 8056171575 | |||
| 2132 | 8056172245 | |||
| 2133 | 8056179283 | |||
| 2134 | 8056536440 | |||
| 2135 | 8056572041 | |||
| 2136 | 8057803878 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pkv-assembly1.cif.gz_B | the n-terminal domain of riboflavin synthase in complex with riboflavin | 0.9698 | 1 | 87 |
| 4g6i-assembly1.cif.gz_B | crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin | 0.9663 | 1 | 195 |
| 4fxu-assembly1.cif.gz_A | crystallographic structure of trimeric riboflavin synthase from brucella abortus | 0.9649 | 1 | 195 |
| 1pkv-assembly1.cif.gz_B | the n-terminal domain of riboflavin synthase in complex with riboflavin | 0.959 | 1 | 87 |
| 4fxu-assembly1.cif.gz_A | crystallographic structure of trimeric riboflavin synthase from brucella abortus | 0.9553 | 1 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fxuC02 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9651 | 102 | 192 | 2.40.30.20 |
| af_Q2FXG0_1_88_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9613 | 1 | 89 | 2.40.30.20 |
| af_P0AFU8_1_89_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9593 | 1 | 89 | 2.40.30.20 |
| 4fxuA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.959 | 1 | 89 | 2.40.30.20 |
| af_A0A1D8PP67_110_218_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9558 | 102 | 194 | 2.40.30.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A066RW78-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9886 | 1 | 189 |
GO:0004746
GO:0009231 |
| AF-A0A0Q0CFZ6-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9865 | 2 | 202 |
GO:0004746
GO:0009231 |
| AF-A0A844M1F6-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9839 | 1 | 194 |
GO:0004746
GO:0009231 |
| AF-A0A066RW78-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9834 | 1 | 189 |
GO:0004746
GO:0009231 |
| AF-A0A1S9CYA2-F1-model_v4 | Riboflavin synthase (EC 2.5.1.9) | 0.9833 | 1 | 194 |
GO:0004746
GO:0009231 |