F489477

General Info

Members Datasets Scaffolds Average Seq Length
1071 810 2143 242

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10002224|JGI24740J21852_1000222410
Length 252
Sequence MSRPALALFIFVIAALSPELAAAQQLSQQLPTDLLNAPVNGSVAAWIIRTFGLLTILSIAPGILIMVTSFPRFIIAFSILRTGMGLATTPSNMILLSLSLFMTFYVMSPTFDQAWKDGVQPLLANQVSEADAVQRIAEPFRTFMSNNTRDKDLKLFVDLAKERGQSTVVDNKIDYRVLIPAFMISEIRRGFEIGFLVVLPFLVIDLIVSTIVMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVGSLVRSFH

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
55 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
56 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
70 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
71 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
72 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
73 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
74 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
75 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
76 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
110 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
116 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
127 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
138 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
139 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
140 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
141 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
142 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
222 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
223 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
224 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
225 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
230 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
235 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
236 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
237 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
240 2509276019 Ensifer aridi TW10 Isolate Nodule
241 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
242 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
243 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
244 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
245 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
246 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
247 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
248 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
249 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
250 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
251 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
252 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
253 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
254 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
255 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
256 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
257 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
258 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
259 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
260 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
261 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
262 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
263 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
264 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
265 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
266 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
267 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
268 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
269 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
270 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
271 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
272 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
273 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
274 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
275 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
276 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
277 2516143018 Ensifer sp. BR816 Isolate Nodule
278 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
279 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
280 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
281 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
282 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
283 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
284 2519899620 Rhizobium sp. Pop5 Isolate Nodule
285 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
286 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
287 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
288 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
289 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
290 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
291 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
292 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
293 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
294 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
295 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
296 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
297 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
298 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
299 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
300 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
301 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
302 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
303 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
304 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
305 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
306 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
307 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
308 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
309 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
310 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
311 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
312 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
313 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
314 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
315 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
316 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
317 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
318 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
319 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
320 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
321 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
322 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
323 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
324 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
325 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
326 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
327 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
328 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
329 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
330 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
331 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
332 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
333 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
334 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
335 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
336 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
337 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
338 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
339 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
340 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
341 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
342 2643221557 Ensifer sp. Root558 Isolate Unclassified
343 2643221558 Rhizobium sp. Root149 Isolate Unclassified
344 2643221568 Rhizobium sp. Root564 Isolate Unclassified
345 2643221582 Rhizobium sp. Root651 Isolate Unclassified
346 2643221599 Rhizobium sp. Root708 Isolate Unclassified
347 2643221607 Rhizobium sp. Root73 Isolate Unclassified
348 2643221610 Ensifer sp. Root74 Isolate Unclassified
349 2643221618 Ensifer sp. Root231 Isolate Unclassified
350 2643221626 Ensifer sp. Root31 Isolate Unclassified
351 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
352 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
353 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
354 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
355 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
356 2643221655 Ensifer sp. Root1252 Isolate Unclassified
357 2643221659 Ensifer sp. Root127 Isolate Unclassified
358 2643221668 Ensifer sp. Root423 Isolate Unclassified
359 2643221675 Ensifer sp. Root1298 Isolate Unclassified
360 2643221680 Ensifer sp. Root1312 Isolate Unclassified
361 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
362 2643221688 Rhizobium sp. Root482 Isolate Unclassified
363 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
364 2643221693 Rhizobium sp. Root491 Isolate Unclassified
365 2643221698 Ensifer sp. Root142 Isolate Unclassified
366 2643221712 Ensifer sp. Root258 Isolate Unclassified
367 2643221718 Rhizobium sp. Root268 Isolate Unclassified
368 2643221719 Rhizobium sp. Root274 Isolate Unclassified
369 2643221723 Ensifer sp. Root278 Isolate Unclassified
370 2643221726 Ensifer sp. Root954 Isolate Unclassified
371 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
372 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
373 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
374 2718217882 Rhizobium sp. N741 Isolate Nodule
375 2718217927 Rhizobium sp. N324 Isolate Nodule
376 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
377 2718218009 Rhizobium sp. N561 Isolate Nodule
378 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
379 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
380 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
381 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
382 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
383 2718218363 Rhizobium sp. N113 Isolate Nodule
384 2718218365 Rhizobium sp. N731 Isolate Nodule
385 2718218366 Rhizobium sp. N621 Isolate Nodule
386 2718218423 Rhizobium sp. N941 Isolate Nodule
387 2721755514 Rhizobium sp. N6212 Isolate Nodule
388 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
389 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
390 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
391 2721755809 Rhizobium sp. N541 Isolate Nodule
392 2721755810 Rhizobium sp. N871 Isolate Nodule
393 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
394 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
395 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
396 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
397 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
398 2728369365 Rhizobium sp. N1341 Isolate Nodule
399 2728369397 Rhizobium sp. N1314 Isolate Nodule
400 2738541293 Rhizobium sp. GV031 Isolate Unclassified
401 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
402 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
403 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
404 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
405 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
406 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
407 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
408 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
409 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
410 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
411 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
412 2791355256 Rhizobium sp. M10 Isolate Nodule
413 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
414 2791355260 Rhizobium sp. L9 Isolate Nodule
415 2791355261 Rhizobium sp. J15 Isolate Nodule
416 2791355262 Rhizobium sp. M1 Isolate Nodule
417 2791355263 Rhizobium chutanense C5 Isolate Nodule
418 2791355264 Rhizobium sp. S9 Isolate Nodule
419 2791355265 Rhizobium sp. H4 Isolate Nodule
420 2791355266 Rhizobium sp. L43 Isolate Nodule
421 2791355267 Rhizobium sp. L18 Isolate Nodule
422 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
423 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
424 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
425 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
426 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
427 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
428 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
429 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
430 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
431 2802429633 Rhizobium anhuiense J3 Isolate Nodule
432 2802429634 Rhizobium anhuiense S10 Isolate Nodule
433 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
434 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
435 2802429637 Rhizobium anhuiense C15 Isolate Nodule
436 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
437 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
438 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
439 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
440 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
441 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
442 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
443 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
444 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
445 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
446 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
447 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
448 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
449 2838048938 Rhizobium pisi 27/80 Isolate Nodule
450 2838061910 Rhizobium phaseoli L15 Isolate Nodule
451 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
452 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
453 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
454 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
455 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
456 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
457 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
458 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
459 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
460 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
461 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
462 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
463 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
464 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
465 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
466 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
467 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
468 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
469 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
470 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
471 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
472 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
473 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
474 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
475 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
476 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
477 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
478 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
479 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
480 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
481 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
482 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
483 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
484 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
485 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
486 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
487 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
488 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
489 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
490 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
491 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
492 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
493 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
494 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
495 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
496 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
497 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
498 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
499 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
500 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
501 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
502 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
503 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
504 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
505 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
506 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
507 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
508 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
509 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
510 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
511 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
512 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
513 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
514 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
515 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
516 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
517 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
518 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
519 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
520 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
521 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
522 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
523 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
524 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
525 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
526 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
527 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
528 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
529 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
530 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
531 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
532 2844163670 Ensifer sp. 1H6 Isolate Unclassified
533 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
534 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
535 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
536 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
537 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
538 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
539 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
540 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
541 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
542 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
543 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
544 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
545 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
546 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
547 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
548 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
549 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
550 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
551 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
552 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
553 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
554 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
555 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
556 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
557 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
558 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
559 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
560 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
561 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
562 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
563 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
564 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
565 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
566 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
567 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
568 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
569 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
570 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
571 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
572 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
573 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
574 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
575 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
576 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
577 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
578 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
579 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
580 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
581 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
582 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
583 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
584 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
585 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
586 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
587 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
588 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
589 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
590 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
591 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
592 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
593 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
594 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
595 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
596 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
597 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
598 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
599 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
600 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
601 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
602 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
603 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
604 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
605 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
606 2933599457 Rhizobium phaseoli M3 Isolate Nodule
607 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
608 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
609 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
610 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
611 2936381700 Rhizobium chutanense C16 Isolate Unclassified
612 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
613 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
614 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
615 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
616 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
617 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
618 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
619 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
620 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
621 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
622 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
623 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
624 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
625 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
626 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
627 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
628 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
629 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
630 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
631 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
632 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
633 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
634 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
635 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
636 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
637 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
638 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
639 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
640 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
641 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
642 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
643 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
644 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
645 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
646 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
647 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
648 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
649 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
650 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
651 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
652 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
653 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
654 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
655 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
656 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
657 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
658 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
659 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
660 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
661 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
662 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
663 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
664 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
665 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
666 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
667 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
668 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
669 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
670 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
671 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
672 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
673 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
674 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
675 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
676 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
677 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
678 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
679 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
680 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
681 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
682 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
683 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
684 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
685 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
686 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
687 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
688 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
689 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
690 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
691 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
692 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
693 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
694 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
695 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
696 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
697 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
698 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
699 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
700 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
701 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
702 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
703 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
704 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
705 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
706 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
707 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
708 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
709 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
710 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
711 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
712 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
713 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
714 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
715 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
716 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
717 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
718 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
719 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
720 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
721 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
722 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
723 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
724 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
725 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
726 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
727 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
728 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
729 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
730 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
731 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
732 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
733 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
734 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
735 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
736 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
737 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
738 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
739 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
740 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
741 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
742 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
743 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
744 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
745 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
746 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
747 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
748 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
749 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
750 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
751 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
752 2996887358 Rhizobium sp. R711 Isolate Nodule
753 2996893221 Rhizobium sp. R635 Isolate Nodule
754 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
755 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
756 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
757 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
758 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
759 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
760 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
761 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
762 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
763 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
764 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
765 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
766 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
767 8005258706 Rhizobium sp. R693 Isolate Nodule
768 8005275841 Rhizobium sp. N4311 Isolate Nodule
769 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
770 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
771 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
772 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
773 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
774 8005321885 Rhizobium sp. R72 Isolate Nodule
775 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
776 8005382845 Rhizobium sp. R634 Isolate Nodule
777 8005395548 Rhizobium sp. R339 Isolate Nodule
778 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
779 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
780 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
781 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
782 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
783 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
784 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
785 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
786 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
787 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
788 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
789 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
790 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
791 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
792 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
793 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
794 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
795 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
796 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
797 8018176218 Rhizobium sp. N122 Isolate Nodule
798 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
799 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
800 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
801 8024501048 Rhizobium sp. H4 Isolate Nodule
802 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
803 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
804 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
805 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
806 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
807 8056382006 Rhizobium croatiense 13T Isolate Nodule
808 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
809 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
810 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.5
Metatranscriptomes 0
Isolates 53.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 18.3
Nodule 40.99
Rhizoplane 2.05
Rhizosphere 20.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002224 3300001979 Bacteria 8860
2 JGI25155J39150_1000157 3300002704 Bacteria 30370
3 JGI25156J39149_1000029 3300002705 Bacteria 126505
4 JGI25162J39368_1001710 3300002737 Bacteria 10667
5 JGI25162J39368_1001836 3300002737 Bacteria 9901
6 JGI25154J39366_1000286 3300002738 Bacteria 30355
7 JGI25158J39367_1000475 3300002739 Bacteria 8179
8 JGI25157J39369_1000247 3300002741 Bacteria 41079
9 JGI25152J39213_1000608 3300002773 Bacteria 19286
10 JGI25152J39213_1005563 3300002773 Bacteria 3627
11 JGI25152J39213_1013884 3300002773 Bacteria 1657
12 JGI25152J39213_1020298 3300002773 Bacteria 1189
13 JGI25150J39212_1000012 3300002774 Bacteria 182468
14 JGI25150J39212_1004181 3300002774 Bacteria 3252
15 JGI25159J45721_1000137 3300002987 Bacteria 34522
16 JGI25159J45721_1000442 3300002987 Bacteria 19125
17 JGI25159J45721_1017373 3300002987 Bacteria 1491
18 JGI25151J46595_10000025 3300003187 Bacteria 213302
19 JGI25151J46595_10001279 3300003187 Bacteria 17751
20 JGI25151J46595_10026131 3300003187 Bacteria 2361
21 JGI25151J46595_10053231 3300003187 Bacteria 1354
22 JGI25165J46597_1000491 3300003214 Bacteria 38149
23 JGI25165J46597_1001462 3300003214 Bacteria 12326
24 JGI25153J46596_10001245 3300003215 Bacteria 15361
25 JGI25153J46596_10007405 3300003215 Bacteria 5404
26 JGI25153J46596_10012617 3300003215 Bacteria 3627
27 rootH1_10018497 3300003316 Bacteria 11457
28 rootH1_10018497 3300003323 Bacteria 2129
29 rootL2_10003154 3300003322 Bacteria 23718
30 JGI25160J50197_1000003 3300003354 Bacteria 482719
31 JGI25160J50197_1000041 3300003354 Bacteria 152843
32 JGI25160J50197_1003209 3300003354 Bacteria 7399
33 JGI25160J50197_1003874 3300003354 Bacteria 6564
34 JGI25160J50197_1007018 3300003354 Bacteria 4462
35 JGI25161J50226_1000002 3300003374 Bacteria 420324
36 JGI25161J50226_1000143 3300003374 Bacteria 49711
37 JGI25161J50226_1003758 3300003374 Bacteria 3369
38 JGI25161J50226_1008273 3300003374 Bacteria 1619
39 Ga0055526_1004376 3300003771 Bacteria 8519
40 Ga0055526_1007684 3300003771 Bacteria 5544
41 Ga0055526_1008179 3300003771 Bacteria 5261
42 Ga0055526_1011225 3300003771 Bacteria 4064
43 Ga0055524_1002097 3300003775 Bacteria 10545
44 Ga0055524_1005057 3300003775 Bacteria 5965
45 Ga0055524_1016872 3300003775 Bacteria 2596
46 Ga0055524_1040211 3300003775 Bacteria 1196
47 Ga0055524_1046174 3300003775 Bacteria 1039
48 Ga0055536_1007049 3300003781 Bacteria 5105
49 Ga0055536_1016218 3300003781 Bacteria 2501
50 Ga0055528_1000604 3300003790 Bacteria 26951
51 Ga0055528_1002124 3300003790 Bacteria 10937
52 Ga0055528_1003474 3300003790 Bacteria 7873
53 Ga0055530_10011416 3300003791 Bacteria 3191
54 Ga0055540_1010291 3300003792 Bacteria 3125
55 Ga0055540_1010872 3300003792 Bacteria 2992
56 Ga0055540_1016520 3300003792 Bacteria 2098
57 Ga0055531_10001158 3300003794 Bacteria 20326
58 Ga0055531_10011190 3300003794 Bacteria 4361
59 Ga0058692_1000711 3300003856 Bacteria 13619
60 Ga0058692_1002517 3300003856 Bacteria 6093
61 Ga0058692_1008627 3300003856 Bacteria 2625
62 Ga0055543_1000008 3300004625 Bacteria 202062
63 Ga0055543_1000158 3300004625 Bacteria 56811
64 Ga0055543_1000263 3300004625 Bacteria 39326
65 Ga0055543_1002646 3300004625 Bacteria 5765
66 Ga0065165_1000031 3300005262 Bacteria 216330
67 Ga0065165_1000084 3300005262 Bacteria 154822
68 Ga0065165_1008370 3300005262 Bacteria 4856
69 Ga0065704_10094625 3300005289 Bacteria 2528
70 Ga0070670_100000429 3300005331 Bacteria 34669
71 Ga0070666_10274361 3300005335 Bacteria 1198
72 Ga0070668_100060783 3300005347 Bacteria 2927
73 Ga0070669_100022788 3300005353 Bacteria 4479
74 Ga0070669_100308064 3300005353 Bacteria 1276
75 Ga0070671_100025725 3300005355 Bacteria 4831
76 Ga0070667_100417451 3300005367 Bacteria 1223
77 Ga0070662_100519098 3300005457 Bacteria 995
78 Ga0070672_100435188 3300005543 Bacteria 1128
79 Ga0068855_100032285 3300005563 Bacteria 6252
80 Ga0068856_100033613 3300005614 Bacteria 5022
81 Ga0075365_10000706 3300006038 Bacteria 13439
82 Ga0075365_10002708 3300006038 Bacteria 8826
83 Ga0075365_10003528 3300006038 Bacteria 8086
84 Ga0075368_10002386 3300006042 Bacteria 6116
85 Ga0075364_10000235 3300006051 Bacteria 26402
86 Ga0075364_10021986 3300006051 Bacteria 4024
87 Ga0075362_10004342 3300006177 Bacteria 5080
88 Ga0075362_10051921 3300006177 Bacteria 1836
89 Ga0075367_10035139 3300006178 Bacteria 2899
90 Ga0075367_10255791 3300006178 Bacteria 1099
91 Ga0075369_10004459 3300006186 Bacteria 5172
92 Ga0075369_10023653 3300006186 Bacteria 2541
93 Ga0075369_10037884 3300006186 Bacteria 2055
94 Ga0075369_10040257 3300006186 Bacteria 1997
95 Ga0075370_10099949 3300006353 Bacteria 1678
96 Ga0075370_10134048 3300006353 Bacteria 1446
97 Ga0079104_1002099 3300006946 Bacteria 11418
98 Ga0099826_10011459 3300006948 Bacteria 6671
99 Ga0099826_10061402 3300006948 Bacteria 2442
100 Ga0105251_10009601 3300009011 Bacteria 5697
101 Ga0105250_10106232 3300009092 Bacteria 1148
102 Ga0105240_10000460 3300009093 Bacteria 74956
103 Ga0105248_10021903 3300009177 Bacteria 7081
104 Ga0105248_10703875 3300009177 Bacteria 1140
105 Ga0105237_10000814 3300009545 Bacteria 42652
106 Ga0105249_10050573 3300009553 Bacteria 3789
107 Ga0123340_1012051 3300009763 Bacteria 7832
108 Ga0123341_1000040 3300009765 Bacteria 59249
109 Ga0123341_1022045 3300009765 Bacteria 5321
110 Ga0123341_1043603 3300009765 Bacteria 2797
111 Ga0123342_1010304 3300009766 Bacteria 10778
112 Ga0105239_10000961 3300010375 Bacteria 40476
113 Ga0105246_10227785 3300011119 Bacteria 1466
114 Ga0105246_10443463 3300011119 Bacteria 1089
115 Ga0157319_1000713 3300012497 Bacteria 1548
116 Ga0157373_10031417 3300013100 Bacteria 3823
117 Ga0157373_10049612 3300013100 Bacteria 2990
118 Ga0157371_10000004 3300013102 Bacteria 512593
119 Ga0157371_10302916 3300013102 Bacteria 1157
120 Ga0157370_10000185 3300013104 Bacteria 78153
121 Ga0157370_10000952 3300013104 Bacteria 36741
122 Ga0157370_10021550 3300013104 Bacteria 6420
123 Ga0157370_10231053 3300013104 Bacteria 1712
124 Ga0157369_10014549 3300013105 Bacteria 8877
125 Ga0157369_10038500 3300013105 Bacteria 5228
126 Ga0157369_10410052 3300013105 Bacteria 1405
127 Ga0171463_1001 3300013249 Bacteria 1406070
128 Ga0163163_10308531 3300014325 Bacteria 1635
129 Ga0182008_10010273 3300014497 Bacteria 5016
130 Ga0182007_10003032 3300015262 Bacteria 8111
131 Ga0182005_1001269 3300015265 Bacteria 10379
132 Ga0183363_1032 3300015690 Bacteria 48614
133 Ga0214544_1000012 3300021320 Bacteria 229808
134 Ga0214542_1000011 3300021321 Bacteria 238260
135 Ga0214543_1000004 3300021327 Bacteria 527190
136 Ga0214543_1000259 3300021327 Bacteria 81880
137 Ga0228711_1000019 3300022739 Bacteria 111795
138 Ga0228710_1000022 3300022740 Bacteria 111795
139 Ga0209435_100011 3300025206 Bacteria 413027
140 Ga0209436_100051 3300025208 Bacteria 64359
141 Ga0209437_100056 3300025233 Bacteria 363071
142 Ga0209437_100196 3300025233 Bacteria 121199
143 Ga0209437_108739 3300025233 Bacteria 1608
144 Ga0207425_1000012 3300025245 Bacteria 528324
145 Ga0207425_1001591 3300025245 Bacteria 9209
146 Ga0207425_1011920 3300025245 Bacteria 2056
147 Ga0209646_1000024 3300025246 Bacteria 413027
148 Ga0209646_1009783 3300025246 Bacteria 1515
149 Ga0209646_1014562 3300025246 Bacteria 1182
150 Ga0209026_1000030 3300025250 Bacteria 329811
151 Ga0209677_101356 3300025253 Bacteria 10727
152 Ga0209759_1000011 3300025256 Bacteria 413027
153 Ga0209759_1017932 3300025256 Bacteria 1727
154 Ga0209129_1000081 3300025258 Bacteria 183694
155 Ga0209129_1000982 3300025258 Bacteria 17096
156 Ga0209129_1000989 3300025258 Bacteria 17017
157 Ga0209129_1001354 3300025258 Bacteria 13831
158 Ga0209129_1001463 3300025258 Bacteria 13170
159 Ga0209129_1001626 3300025258 Bacteria 12187
160 Ga0209129_1001904 3300025258 Bacteria 11006
161 Ga0209129_1029031 3300025258 Bacteria 935
162 Ga0209233_1000037 3300025261 Bacteria 554620
163 Ga0209233_1000071 3300025261 Bacteria 363290
164 Ga0209233_1002018 3300025261 Bacteria 7695
165 Ga0209565_1028241 3300025263 Bacteria 1110
166 Ga0209455_1023551 3300025272 Bacteria 1152
167 Ga0209673_1000015 3300025273 Bacteria 530618
168 Ga0209673_1000704 3300025273 Bacteria 47438
169 Ga0209673_1000999 3300025273 Bacteria 34430
170 Ga0209673_1003255 3300025273 Bacteria 9799
171 Ga0209673_1004004 3300025273 Bacteria 8179
172 Ga0209673_1057944 3300025273 Bacteria 983
173 Ga0209130_1000002 3300025284 Bacteria 722648
174 Ga0209130_1000005 3300025284 Bacteria 599620
175 Ga0209130_1000088 3300025284 Bacteria 152927
176 Ga0209130_1016676 3300025284 Bacteria 1770
177 Ga0209676_1006985 3300025292 Bacteria 5427
178 Ga0209676_1012033 3300025292 Bacteria 3437
179 Ga0209025_1000024 3300025294 Bacteria 528324
180 Ga0209025_1000037 3300025294 Bacteria 383429
181 Ga0209025_1000060 3300025294 Bacteria 305017
182 Ga0209025_1000295 3300025294 Bacteria 111489
183 Ga0209025_1001006 3300025294 Bacteria 41784
184 Ga0209025_1004005 3300025294 Bacteria 13205
185 Ga0209025_1004161 3300025294 Bacteria 12814
186 Ga0209025_1008048 3300025294 Bacteria 7678
187 Ga0209025_1008685 3300025294 Bacteria 7259
188 Ga0209025_1016641 3300025294 Bacteria 4315
189 Ga0209025_1024533 3300025294 Bacteria 3106
190 Ga0209564_1000093 3300025295 Bacteria 245793
191 Ga0209564_1000382 3300025295 Bacteria 81070
192 Ga0209564_1000576 3300025295 Bacteria 58256
193 Ga0209564_1000811 3300025295 Bacteria 42680
194 Ga0209564_1007365 3300025295 Bacteria 5697
195 Ga0209564_1008452 3300025295 Bacteria 5074
196 Ga0209758_1000046 3300025297 Bacteria 364931
197 Ga0209758_1000349 3300025297 Bacteria 84164
198 Ga0209758_1000575 3300025297 Bacteria 57471
199 Ga0209758_1000810 3300025297 Bacteria 44076
200 Ga0209758_1003540 3300025297 Bacteria 14058
201 Ga0209758_1003807 3300025297 Bacteria 13285
202 Ga0209758_1019380 3300025297 Bacteria 3282
203 Ga0209050_1001493 3300025298 Bacteria 24848
204 Ga0209050_1011099 3300025298 Bacteria 4325
205 Ga0209256_1000027 3300025299 Bacteria 423283
206 Ga0209256_1000646 3300025299 Bacteria 47375
207 Ga0209256_1001165 3300025299 Bacteria 29689
208 Ga0209256_1004480 3300025299 Bacteria 8732
209 Ga0209256_1007277 3300025299 Bacteria 5516
210 Ga0209256_1011923 3300025299 Bacteria 3406
211 Ga0209256_1055446 3300025299 Bacteria 941
212 Ga0207426_1000012 3300025302 Bacteria 730942
213 Ga0207426_1000013 3300025302 Bacteria 721897
214 Ga0207426_1000015 3300025302 Bacteria 599316
215 Ga0207426_1000063 3300025302 Bacteria 358920
216 Ga0207426_1000172 3300025302 Bacteria 163690
217 Ga0207426_1004643 3300025302 Bacteria 6606
218 Ga0209051_1002797 3300025303 Bacteria 12036
219 Ga0209051_1003520 3300025303 Bacteria 10222
220 Ga0209051_1005151 3300025303 Bacteria 7751
221 Ga0209051_1008947 3300025303 Bacteria 5226
222 Ga0209257_1000598 3300025304 Bacteria 59869
223 Ga0209257_1012590 3300025304 Bacteria 3888
224 Ga0209257_1033745 3300025304 Bacteria 1605
225 Ga0207680_10426635 3300025903 Bacteria 939
226 Ga0207695_10000036 3300025913 Bacteria 477897
227 Ga0207671_10000517 3300025914 Bacteria 52359
228 Ga0207650_10000391 3300025925 Bacteria 40030
229 Ga0207644_10168192 3300025931 Bacteria 1709
230 Ga0207711_10064708 3300025941 Bacteria 3159
231 Ga0207711_10776751 3300025941 Bacteria 892
232 Ga0207667_10031210 3300025949 Bacteria 5754
233 Ga0207712_10341718 3300025961 Bacteria 1241
234 Ga0207668_10221747 3300025972 Bacteria 1519
235 Ga0207658_10074415 3300025986 Bacteria 2581
236 Ga0207658_10280443 3300025986 Bacteria 1428
237 Ga0207702_10024802 3300026078 Bacteria 4975
238 Ga0209281_1000200 3300027111 Bacteria 135685
239 Ga0209281_1000227 3300027111 Bacteria 119329
240 Ga0209281_1000488 3300027111 Bacteria 54963
241 Ga0209371_1000009 3300027312 Bacteria 963030
242 Ga0209371_1000315 3300027312 Bacteria 53030
243 Ga0209371_1000812 3300027312 Bacteria 25762
244 Ga0209282_1000042 3300027666 Bacteria 119329
245 Ga0209282_1003287 3300027666 Bacteria 9580
246 Ga0209282_1088566 3300027666 Bacteria 1629
247 Ga0209813_10000319 3300027866 Bacteria 12720
248 Ga0268266_10035955 3300028379 Bacteria 4213
249 Ga0268266_10048948 3300028379 Bacteria 3623
250 Ga0307515_10000121 3300028794 Bacteria 188657
251 Ga0307515_10001439 3300028794 Bacteria 53690
252 Ga0307515_10021464 3300028794 Bacteria 11449
253 Ga0268256_1000010 3300030500 Bacteria 963034
254 Ga0268256_1001455 3300030500 Bacteria 14225
255 Ga0268256_1002157 3300030500 Bacteria 10454
256 Ga0316181_1189898 3300030744 Bacteria 9925
257 Ga0307513_10031494 3300031456 Bacteria 6004
258 Ga0307405_10300981 3300031731 Bacteria 1217
259 Ga0307410_10465669 3300031852 Bacteria 1034
260 Ga0307406_10087397 3300031901 Bacteria 2089
261 Ga0307406_10090297 3300031901 Bacteria 2061
262 Ga0307412_10001886 3300031911 Bacteria 11600
263 Ga0315914_1000009 3300031967 Bacteria 182444
264 Ga0307409_100335718 3300031995 Bacteria 1420
265 Ga0307416_100555729 3300032002 Bacteria 1222
266 Ga0307414_10248017 3300032004 Bacteria 1478
267 Ga0307414_10467597 3300032004 Bacteria 1109
268 Ga0315913_1000015 3300033430 Bacteria 119325
269 Ga0315915_1000013 3300033464 Bacteria 182438
270 Ga0373935_0026244 3300035692 Bacteria 3594
271 Ga0373927_0000086 3300035695 Bacteria 69853
272 Ga0373925_0001218 3300037068 Bacteria 22717
273 Ga0395905_0006471 3300037471 Bacteria 11787
274 Ga0395905_0083916 3300037471 Bacteria 2984
275 Ga0439436_0007534 3300041404 Bacteria 3350
276 Ga0439436_0008049 3300041404 Bacteria 3239
277 Ga0439436_0031469 3300041404 Bacteria 1540
278 Ga0439439_0039213 3300041406 Bacteria 1224
279 Ga0439465_0006265 3300041413 Bacteria 3778
280 Ga0439465_0082470 3300041413 Bacteria 1092
281 Ga0451787_590894 3300041441 Bacteria 2028
282 Ga0451789_0321844 3300041443 Bacteria 1021
283 Ga0451797_0172901 3300041453 Bacteria 696
284 Ga0451798_0416552 3300041458 Bacteria 1453
285 Ga0451804_0691989 3300041463 Bacteria 1128
286 Ga0451839_0165476 3300041496 Bacteria 1521
287 Ga0451841_0303195 3300041498 Bacteria 1790
288 Ga0451845_0532907 3300041501 Bacteria 1572
289 Ga0451843_0506256 3300041509 Bacteria 842
290 Ga0451855_0418294 3300041511 Bacteria 1099
291 Ga0451853_1034512 3300041512 Bacteria 2848
292 Ga0439432_059599 3300042006 Bacteria 1179
293 Ga0439449_0032835 3300042007 Bacteria 1934
294 Ga0439449_0047055 3300042007 Bacteria 1598
295 Ga0439449_0066520 3300042007 Bacteria 1329
296 Ga0450910_032056 3300042147 Bacteria 828
297 Ga0466968_0067192 3300044735 Bacteria 1554
298 Ga0495592_0088318 3300046454 Bacteria 2228
299 Ga0495638_0000788 3300046460 Bacteria 33436
300 Ga0495638_0094795 3300046460 Bacteria 1793
301 Ga0495638_0113697 3300046460 Bacteria 1606
302 Ga0495651_0038428 3300046462 Bacteria 3727
303 Ga0495605_0002202 3300046474 Bacteria 12167
304 Ga0495662_0026278 3300046476 Bacteria 2812
305 Ga0495584_0130526 3300046491 Bacteria 1275
306 Ga0495596_0075155 3300046500 Bacteria 1312
307 Ga0495607_0081215 3300046501 Bacteria 1781
308 Ga0495583_0006566 3300046506 Bacteria 7574
309 Ga0495606_0002855 3300046507 Bacteria 19133
310 Ga0495606_0014709 3300046507 Bacteria 6083
311 Ga0495606_0024724 3300046507 Bacteria 4321
312 Ga0495610_0001051 3300046512 Bacteria 25387
313 Ga0495610_0009369 3300046512 Bacteria 6196
314 Ga0495610_0040442 3300046512 Bacteria 2350
315 Ga0495620_0015428 3300046515 Bacteria 3859
316 Ga0495620_0100353 3300046515 Bacteria 1154
317 Ga0495631_0001806 3300046518 Bacteria 12649
318 Ga0495631_0073518 3300046518 Bacteria 1476
319 Ga0495632_0000817 3300046519 Bacteria 27522
320 Ga0495632_0027857 3300046519 Bacteria 2954
321 Ga0495632_0125937 3300046519 Bacteria 1194
322 Ga0495643_0071509 3300046522 Bacteria 1820
323 Ga0495652_0116192 3300046529 Bacteria 2143
324 Ga0495654_0000321 3300046530 Bacteria 42082
325 Ga0495587_0032692 3300046536 Bacteria 3144
326 Ga0495633_0031716 3300046558 Bacteria 2559
327 Ga0495633_0064503 3300046558 Bacteria 1712
328 Ga0495633_0113103 3300046558 Bacteria 1259
329 Ga0495668_0091020 3300046616 Bacteria 1671
330 Ga0495625_0003290 3300046660 Bacteria 16308
331 Ga0495625_0019916 3300046660 Bacteria 5191
332 Ga0495588_0000488 3300046674 Bacteria 19644
333 Ga0495657_0027002 3300046675 Bacteria 4058
334 Ga0495670_0296756 3300046691 Bacteria 866
335 Ga0495671_0158315 3300046692 Bacteria 1102
336 Ga0495671_0175189 3300046692 Bacteria 1042
337 Ga0495600_0052667 3300046809 Bacteria 2657
338 Ga0495604_0015489 3300047317 Bacteria 6086
339 Ga0495672_0144173 3300047320 Bacteria 1241
340 Ga0495683_0130950 3300047323 Bacteria 1183
341 Ga0495683_0236451 3300047323 Bacteria 808
342 Ga0495687_046991 3300047443 Bacteria 1860
343 Ga0495686_0000458 3300047472 Bacteria 61256
344 Ga0495686_0008978 3300047472 Bacteria 7256
345 Ga0495686_0032498 3300047472 Bacteria 3377
346 Ga0495686_0207051 3300047472 Bacteria 1122
347 Ga0496100_0247022 3300048903 Bacteria 1319
348 Ga0496103_0074026 3300048906 Bacteria 2134
349 Ga0496104_0089636 3300048907 Bacteria 2938
350 Ga0496106_0000986 3300048909 Bacteria 20772
351 Ga0496106_0058720 3300048909 Bacteria 2913
352 Ga0496106_0702246 3300048909 Bacteria 806
353 Ga0496110_0492428 3300048913 Bacteria 1116
354 Ga0496111_0002979 3300048914 Bacteria 10377
355 Ga0496116_0000100 3300048919 Bacteria 194740
356 Ga0496116_0008021 3300048919 Bacteria 9241
357 Ga0496116_0008831 3300048919 Bacteria 8681
358 Ga0496116_0009409 3300048919 Bacteria 8330
359 Ga0496116_0012698 3300048919 Bacteria 6852
360 Ga0496116_0026966 3300048919 Bacteria 4189
361 Ga0496116_0029292 3300048919 Bacteria 3972
362 Ga0496116_0053685 3300048919 Bacteria 2660
363 Ga0496117_0000002 3300048920 Bacteria 2483758
364 Ga0496117_0001409 3300048920 Bacteria 34874
365 Ga0496117_0005803 3300048920 Bacteria 12796
366 Ga0496117_0007589 3300048920 Bacteria 10544
367 Ga0496117_0049744 3300048920 Bacteria 2978
368 Ga0496117_0126219 3300048920 Bacteria 1561
369 Ga0496118_0001173 3300048921 Bacteria 40450
370 Ga0496118_0002665 3300048921 Bacteria 23596
371 Ga0496118_0020543 3300048921 Bacteria 5852
372 Ga0496118_0022298 3300048921 Bacteria 5543
373 Ga0496118_0039260 3300048921 Bacteria 3780
374 Ga0496119_0012345 3300048922 Bacteria 6946
375 Ga0496119_0016464 3300048922 Bacteria 5627
376 Ga0496119_0021287 3300048922 Bacteria 4692
377 Ga0496119_0050150 3300048922 Bacteria 2575
378 Ga0496119_0103760 3300048922 Bacteria 1592
379 Ga0496120_0000021 3300048923 Bacteria 250966
380 Ga0496120_0006668 3300048923 Bacteria 8802
381 Ga0496120_0007520 3300048923 Bacteria 8088
382 Ga0496120_0063178 3300048923 Bacteria 2061
383 Ga0496121_0000001 3300048924 Bacteria 1830318
384 Ga0496121_0001709 3300048924 Bacteria 35918
385 Ga0496121_0005304 3300048924 Bacteria 16594
386 Ga0496121_0009812 3300048924 Bacteria 10936
387 Ga0496121_0024590 3300048924 Bacteria 5753
388 Ga0496121_0030081 3300048924 Bacteria 4998
389 Ga0496121_0053733 3300048924 Bacteria 3372
390 Ga0496121_0128768 3300048924 Bacteria 1898
391 Ga0496122_0000001 3300048925 Bacteria 1827766
392 Ga0496122_0000009 3300048925 Bacteria 584024
393 Ga0496122_0000147 3300048925 Bacteria 165589
394 Ga0496122_0002139 3300048925 Bacteria 29041
395 Ga0496122_0009578 3300048925 Bacteria 10162
396 Ga0496122_0033440 3300048925 Bacteria 4229
397 Ga0496122_0040826 3300048925 Bacteria 3680
398 Ga0496122_0158534 3300048925 Bacteria 1384
399 Ga0496122_0191956 3300048925 Bacteria 1204
400 Ga0496123_0000001 3300048926 Bacteria 1831497
401 Ga0496123_0000020 3300048926 Bacteria 388748
402 Ga0496123_0000158 3300048926 Bacteria 136078
403 Ga0496123_0005678 3300048926 Bacteria 12452
404 Ga0496123_0006344 3300048926 Bacteria 11485
405 Ga0496123_0011116 3300048926 Bacteria 7850
406 Ga0496123_0031916 3300048926 Bacteria 3823
407 Ga0496123_0032274 3300048926 Bacteria 3795
408 Ga0496123_0077162 3300048926 Bacteria 2047
409 Ga0496123_0093754 3300048926 Bacteria 1772
410 Ga0496124_0000063 3300048927 Bacteria 229705
411 Ga0496124_0000551 3300048927 Bacteria 63371
412 Ga0496124_0000801 3300048927 Bacteria 51088
413 Ga0496124_0010835 3300048927 Bacteria 9182
414 Ga0496124_0012087 3300048927 Bacteria 8567
415 Ga0496124_0012285 3300048927 Bacteria 8459
416 Ga0496124_0022893 3300048927 Bacteria 5719
417 Ga0496124_0073712 3300048927 Bacteria 2824
418 Ga0496124_0153849 3300048927 Bacteria 1801
419 Ga0496124_0302527 3300048927 Bacteria 1154
420 Ga0496124_0344621 3300048927 Bacteria 1056
421 Ga0496125_0000001 3300048928 Bacteria 1766138
422 Ga0496125_0000981 3300048928 Bacteria 44598
423 Ga0496125_0009950 3300048928 Bacteria 9669
424 Ga0496125_0027312 3300048928 Bacteria 5177
425 Ga0496125_0046819 3300048928 Bacteria 3624
426 Ga0496125_0351579 3300048928 Bacteria 880
427 Ga0496126_0000094 3300048929 Bacteria 208184
428 Ga0496126_0000195 3300048929 Bacteria 135582
429 Ga0496126_0002865 3300048929 Bacteria 22522
430 Ga0496126_0024745 3300048929 Bacteria 5791
431 Ga0496126_0037195 3300048929 Bacteria 4544
432 Ga0501300_006771 3300049523 Bacteria 1682
433 Ga0501031_0026988 3300049568 Bacteria 3743
434 Ga0501032_0015645 3300049569 Bacteria 5349
435 Ga0501032_0098662 3300049569 Bacteria 1935
436 Ga0501033_0000396 3300049570 Bacteria 41913
437 Ga0501033_0067127 3300049570 Bacteria 2637
438 Ga0501034_0559400 3300049571 Bacteria 1052
439 Ga0501037_0004951 3300049573 Bacteria 9687
440 Ga0501037_0071387 3300049573 Bacteria 2526
441 Ga0501038_0059768 3300049574 Bacteria 3264
442 Ga0501038_0098982 3300049574 Bacteria 2431
443 Ga0501040_0114766 3300049576 Bacteria 1886
444 Ga0501043_0013294 3300049579 Bacteria 6438
445 Ga0501043_0013895 3300049579 Bacteria 6299
446 Ga0501047_0032799 3300049581 Bacteria 5014
447 Ga0501047_0042433 3300049581 Bacteria 4396
448 Ga0501083_0048280 3300049744 Bacteria 2873
449 Ga0501280_009240 3300049776 Bacteria 1371
450 Ga0501280_012633 3300049776 Bacteria 1187
451 Ga0501035_0000647 3300049822 Bacteria 38388
452 Ga0501035_0034240 3300049822 Bacteria 4616
453 Ga0501035_0165335 3300049822 Bacteria 1914
454 Ga0501044_0094256 3300049823 Bacteria 3019
455 Ga0501045_0105927 3300049824 Bacteria 2084
456 nmdc:mga03683_6227_c1 3300050489 Bacteria 4074
457 nmdc:mga00v17_2508_c1 3300050491 Bacteria 9391
458 nmdc:mga00v17_39_c1 3300050491 Bacteria 82050
459 nmdc:mga00v17_453_c1 3300050491 Bacteria 23007
460 nmdc:mga0yw44_164_c1 3300050492 Bacteria 23001
461 nmdc:mga0yw44_3246_c1 3300050492 Bacteria 7166
462 nmdc:mga0k408_161130_c1 3300050493 Bacteria 1337
463 nmdc:mga0k408_45175_c1 3300050493 Bacteria 2541
464 nmdc:mga07m45_15052_c1 3300050496 Bacteria 4131
465 nmdc:mga07m45_19454_c1 3300050496 Bacteria 3680
466 nmdc:mga0sz30_153_c1 3300050516 Bacteria 25440
467 nmdc:mga0sz30_20113_c1 3300050516 Bacteria 2274
468 nmdc:mga0sz30_44091_c1 3300050516 Bacteria 1878
469 Ga0495619_0069770 3300053085 Bacteria 2350
470 Ga0500578_0060522 3300053086 Bacteria 2419
471 Ga0500578_0180404 3300053086 Bacteria 1301
472 Ga0500560_004045 3300053107 Bacteria 3060
473 Ga0500569_095945 3300053109 Bacteria 966
474 Ga0500594_0056631 3300053118 Bacteria 1119
475 Ga0500608_035540 3300053122 Bacteria 2376
476 Ga0500618_000119 3300053125 Bacteria 64330
477 Ga0500618_000359 3300053125 Bacteria 31723
478 Ga0500618_005102 3300053125 Bacteria 4046
479 Ga0500618_023878 3300053125 Bacteria 1477
480 Ga0500658_0011500 3300053134 Bacteria 3261
481 Ga0500658_0034992 3300053134 Bacteria 1986
482 Ga0500559_0009400 3300053136 Bacteria 4230
483 Ga0500568_0000972 3300053139 Bacteria 19741
484 Ga0500568_0006879 3300053139 Bacteria 5657
485 Ga0500573_0032566 3300053140 Bacteria 3007
486 Ga0500573_0040733 3300053140 Bacteria 2683
487 Ga0500590_001432 3300053148 Bacteria 9824
488 Ga0500604_0032344 3300053151 Bacteria 1541
489 Ga0500616_0001605 3300053153 Bacteria 21079
490 Ga0500616_0003072 3300053153 Bacteria 13111
491 Ga0500622_0002052 3300053156 Bacteria 15003
492 Ga0500622_0003666 3300053156 Bacteria 10089
493 Ga0500622_0125217 3300053156 Bacteria 1242
494 Ga0500624_000586 3300053157 Bacteria 10029
495 Ga0500624_012781 3300053157 Bacteria 1246
496 Ga0500627_0057833 3300053158 Bacteria 1702
497 Ga0500633_0090065 3300053160 Bacteria 1119
498 Ga0500634_0000819 3300053161 Bacteria 10920
499 Ga0500636_0000010 3300053177 Bacteria 145932
500 2509106992 2508501122 Bacteria 6292184
501 2509375052 2509276019 Bacteria 6802256
502 2509388491 2509276021 Bacteria 7634384
503 2509444041 2509276033 Bacteria 7180565
504 2510131362 2510065019 Bacteria 6903379
505 2510303602 2510065057 Bacteria 6649661
506 2510839770 2510461069 Bacteria 5505000
507 2510897716 2510461076 Bacteria 8618824
508 2511134819 2510917022 Bacteria 6504556
509 2511171558 2510917026 Bacteria 7046020
510 2511184737 2510917028 Bacteria 6185411
511 2511195298 2510917030 Bacteria 7460662
512 2511500474 2511231052 Bacteria 6974333
513 2512531938 2512047086 Bacteria 6850303
514 2512972736 2512875026 Bacteria 6861065
515 2513570580 2513237084 Bacteria 7231967
516 2513580266 2513237085 Bacteria 7695351
517 2513585450 2513237086 Bacteria 7265287
518 2513596682 2513237088 Bacteria 6927906
519 2513602875 2513237089 Bacteria 6553624
520 2513616699 2513237091 Bacteria 6900273
521 2513634199 2513237093 Bacteria 7545552
522 2513713242 2513237103 Bacteria 7647401
523 2513864905 2513237138 Bacteria 7368160
524 2513885612 2513237140 Bacteria 7076289
525 2513907358 2513237143 Bacteria 6664116
526 2513910301 2513237144 Bacteria 7530820
527 2513929811 2513237146 Bacteria 7166346
528 2513986165 2513237156 Bacteria 6402557
529 2513996714 2513237159 Bacteria 6810126
530 2514005127 2513237160 Bacteria 6650282
531 2514020298 2513237162 Bacteria 7468464
532 2515110315 2515075009 Bacteria 7288508
533 2515607676 2515154107 Bacteria 6795637
534 2515634523 2515154113 Bacteria 7807172
535 2515643748 2515154114 Bacteria 7848616
536 2515657146 2515154116 Bacteria 7552979
537 2515743353 2515154134 Bacteria 7220242
538 2516204387 2516143018 Bacteria 6951533
539 2516891807 2516653046 Bacteria 6989037
540 2517039000 2516653077 Bacteria 7555578
541 2517079266 2516653085 Bacteria 7346596
542 2517093195 2517093000 Bacteria 7412387
543 2517409464 2517287029 Bacteria 6905599
544 2517568605 2517487022 Bacteria 7227575
545 2520378918 2519899620 Bacteria 6499161
546 2524450579 2524023207 Bacteria 6813453
547 2524458309 2524023209 Bacteria 6679728
548 2530647873 2529292951 Bacteria 6916614
549 2535515044 2534681796 Bacteria 7146037
550 2537872740 2537561587 Bacteria 5425293
551 2551675622 2551306084 Bacteria 8942552
552 2551684062 2551306085 Bacteria 7347181
553 2551691831 2551306086 Bacteria 6843938
554 2551700468 2551306087 Bacteria 7351905
555 2551712190 2551306089 Bacteria 7162724
556 2551721041 2551306090 Bacteria 7953713
557 2551726754 2551306091 Bacteria 7086830
558 2551734459 2551306092 Bacteria 6992595
559 2551740131 2551306093 Bacteria 7064773
560 2554246577 2554235003 Bacteria 5877155
561 2558866056 2558860100 Bacteria 8458965
562 2558866652 2558860100 Bacteria 8458965
563 2559293805 2558860242 Bacteria 5568029
564 2561466845 2558860983 Bacteria 4133860
565 2585164948 2582581283 Bacteria 6030556
566 2585203621 2582581294 Bacteria 6626667
567 2585223709 2582581298 Bacteria 7315509
568 2585229767 2582581299 Bacteria 6518058
569 2585255967 2582581304 Bacteria 5831370
570 2585265324 2582581306 Bacteria 6450535
571 2585273885 2582581307 Bacteria 6597605
572 2585280186 2582581308 Bacteria 7413247
573 2585326033 2582581315 Bacteria 7318924
574 2585330202 2582581316 Bacteria 7774528
575 2585385542 2582581865 Bacteria 6644329
576 2585391958 2582581866 Bacteria 6859583
577 2585398602 2582581867 Bacteria 7184437
578 2585529317 2585427526 Bacteria 7258840
579 2585533563 2585427527 Bacteria 7273426
580 2585539631 2585427528 Bacteria 6842387
581 2585545695 2585427529 Bacteria 7395659
582 2585553152 2585427530 Bacteria 7383882
583 2585560061 2585427531 Bacteria 6992870
584 2585819248 2585427590 Bacteria 6824633
585 2585837588 2585427593 Bacteria 7141551
586 2585844154 2585427594 Bacteria 6180594
587 2585900736 2585427608 Bacteria 6544331
588 2585905759 2585427609 Bacteria 6667127
589 2585994349 2585427633 Bacteria 6413184
590 2585998807 2585427634 Bacteria 6455027
591 2587979125 2585428125 Bacteria 6662905
592 2599332962 2599185156 Bacteria 5403036
593 2599419241 2599185170 Bacteria 7295545
594 2599606060 2599185210 Bacteria 5624189
595 2599719602 2599185236 Bacteria 6875203
596 2600191400 2599185352 Bacteria 7228948
597 2600374657 2600254933 Bacteria 4750527
598 2601609222 2600255279 Bacteria 5605316
599 2601745997 2600255308 Bacteria 5611129
600 2616297063 2615840624 Bacteria 6557588
601 2616310267 2615840626 Bacteria 7921970
602 2616553352 2615840698 Bacteria 7319877
603 2617380315 2617270742 Bacteria 6808054
604 2643806235 2643221557 Bacteria 7184309
605 2643812864 2643221558 Bacteria 5460675
606 2643856369 2643221568 Bacteria 5187270
607 2643921206 2643221582 Bacteria 5804683
608 2644004846 2643221599 Bacteria 6292121
609 2644047181 2643221607 Bacteria 6314006
610 2644070161 2643221610 Bacteria 7480339
611 2644103297 2643221618 Bacteria 7717186
612 2644144236 2643221626 Bacteria 8069654
613 2644190523 2643221634 Bacteria 6705461
614 2644199552 2643221636 Bacteria 6583769
615 2644206758 2643221637 Bacteria 5345260
616 2644241598 2643221643 Bacteria 5749658
617 2644297688 2643221653 Bacteria 4569637
618 2644306227 2643221655 Bacteria 7722067
619 2644330476 2643221659 Bacteria 7890716
620 2644377497 2643221668 Bacteria 7306521
621 2644420923 2643221675 Bacteria 7473456
622 2644454446 2643221680 Bacteria 7473610
623 2644479970 2643221686 Bacteria 6310811
624 2644492296 2643221688 Bacteria 5260751
625 2644496805 2643221689 Bacteria 6042950
626 2644519281 2643221693 Bacteria 5513853
627 2644542777 2643221698 Bacteria 7756764
628 2644611838 2643221712 Bacteria 7729434
629 2644650406 2643221718 Bacteria 5345506
630 2644655941 2643221719 Bacteria 4568197
631 2644671913 2643221723 Bacteria 7095460
632 2644692384 2643221726 Bacteria 7455827
633 2657681848 2657244999 Bacteria 5946535
634 2671113716 2667528174 Bacteria 6435400
635 2692317305 2690316117 Bacteria 6800650
636 2719179515 2718217882 Bacteria 6556348
637 2719384071 2718217927 Bacteria 6972593
638 2719663862 2718217997 Bacteria 6740740
639 2719730185 2718218009 Bacteria 6478651
640 2720490281 2718218199 Bacteria 6740745
641 2720611658 2718218232 Bacteria 6720332
642 2720618507 2718218233 Bacteria 6662049
643 2720629915 2718218235 Bacteria 6630699
644 2720773610 2718218269 Bacteria 6906114
645 2721145608 2718218363 Bacteria 6524337
646 2721157125 2718218365 Bacteria 6274507
647 2721162487 2718218366 Bacteria 6425255
648 2721397841 2718218423 Bacteria 6438183
649 2722838657 2721755514 Bacteria 6424414
650 2723025281 2721755556 Bacteria 6745503
651 2723558866 2721755684 Bacteria 6859907
652 2723565436 2721755685 Bacteria 6704835
653 2724036651 2721755809 Bacteria 6438790
654 2724042941 2721755810 Bacteria 6479005
655 2724088217 2721755819 Bacteria 6906405
656 2724102701 2721755822 Bacteria 6726041
657 2724108597 2721755823 Bacteria 6752556
658 2725948940 2724679232 Bacteria 7646494
659 2730106217 2728369352 Bacteria 6745171
660 2730162752 2728369365 Bacteria 6555560
661 2730296757 2728369397 Bacteria 6274511
662 2738801293 2738541293 Bacteria 7065685
663 2738948300 2738541317 Bacteria 5340176
664 2739037021 2738541333 Bacteria 7106503
665 2753461296 2751185821 Bacteria 6189929
666 2766066619 2765235942 Bacteria 7445910
667 2776912017 2775507049 Bacteria 6284736
668 2778179662 2775507266 Bacteria 7392367
669 2792582970 2791355082 Bacteria 5973319
670 2792623857 2791355091 Bacteria 6135441
671 2792629763 2791355092 Bacteria 6248105
672 2792638096 2791355094 Bacteria 7011481
673 2793283862 2791355253 Bacteria 5171699
674 2793295262 2791355256 Bacteria 6798008
675 2793316384 2791355259 Bacteria 7254731
676 2793323386 2791355260 Bacteria 6598818
677 2793326220 2791355261 Bacteria 6661293
678 2793334280 2791355262 Bacteria 6774204
679 2793341860 2791355263 Bacteria 6872478
680 2793348197 2791355264 Bacteria 6429314
681 2793355737 2791355265 Bacteria 6539969
682 2793361566 2791355266 Bacteria 7116587
683 2793364622 2791355267 Bacteria 7222458
684 2802720362 2802428858 Bacteria 6636079
685 2802726182 2802428859 Bacteria 6667919
686 2802731654 2802428860 Bacteria 6525526
687 2802739405 2802428861 Bacteria 6534206
688 2802742547 2802428862 Bacteria 6633353
689 2802749252 2802428863 Bacteria 6410669
690 2804750868 2802429268 Bacteria 6094027
691 2805929317 2802429605 Bacteria 6875453
692 2805932424 2802429606 Bacteria 6346811
693 2806047597 2802429633 Bacteria 7341974
694 2806055016 2802429634 Bacteria 7083200
695 2806062082 2802429635 Bacteria 7650140
696 2806067192 2802429636 Bacteria 7597525
697 2806076513 2802429637 Bacteria 7067217
698 2808986420 2808606387 Bacteria 5697198
699 2819245270 2818991272 Bacteria 4622173
700 2819556550 2818991439 Bacteria 6907412
701 2819608463 2818991448 Bacteria 6772224
702 2819640568 2818991453 Bacteria 7181617
703 2819686271 2818991461 Bacteria 7026071
704 2821123583 2821123053 Bacteria 7836056
705 2837651907 2837651117 Bacteria 3772164
706 2838020230 2838016132 Bacteria 6577831
707 2838025749 2838022645 Bacteria 6494267
708 2838029346 2838029111 Bacteria 6603031
709 2838037075 2838035591 Bacteria 7166484
710 2838044483 2838042994 Bacteria 6046894
711 2838051554 2838048938 Bacteria 6044578
712 2838064029 2838061910 Bacteria 6794874
713 2838071056 2838068647 Bacteria 6208656
714 2838075322 2838074704 Bacteria 6785777
715 2838663748 2838661181 Bacteria 7385261
716 2838672449 2838668709 Bacteria 6671819
717 2838677278 2838675328 Bacteria 4909118
718 2838680530 2838680041 Bacteria 6545511
719 2838691637 2838686498 Bacteria 7807632
720 2838695437 2838694306 Bacteria 6853137
721 2838703809 2838701080 Bacteria 6669771
722 2838708814 2838707686 Bacteria 6619912
723 2838716166 2838714209 Bacteria 5525906
724 2838720034 2838719591 Bacteria 5523910
725 2838726918 2838724970 Bacteria 4908691
726 2838733879 2838729681 Bacteria 7400765
727 2838739383 2838736955 Bacteria 5760694
728 2838747057 2838742623 Bacteria 7396178
729 2841843281 2841840854 Bacteria 5761912
730 2841846966 2841846520 Bacteria 5345850
731 2841856198 2841851746 Bacteria 7532261
732 2841860506 2841859092 Bacteria 5436171
733 2841866867 2841864319 Bacteria 6742987
734 2842079951 2842077413 Bacteria 6508645
735 2842112155 2842110456 Bacteria 7656360
736 2842120569 2842118031 Bacteria 7033875
737 2842127005 2842124991 Bacteria 5346824
738 2842132171 2842130223 Bacteria 4909145
739 2842143063 2842140634 Bacteria 5759631
740 2842148399 2842146304 Bacteria 5957337
741 2842152660 2842152218 Bacteria 4908957
742 2842161986 2842156927 Bacteria 6894975
743 2842169638 2842163707 Bacteria 6916235
744 2842172411 2842170452 Bacteria 5525737
745 2842176279 2842175837 Bacteria 4908771
746 2842185828 2842180545 Bacteria 6888678
747 2842189273 2842187318 Bacteria 5524014
748 2842192831 2842192696 Bacteria 6147454
749 2842202900 2842198810 Bacteria 6608673
750 2842207006 2842205361 Bacteria 6340321
751 2842213587 2842211629 Bacteria 5523832
752 2842218849 2842217011 Bacteria 7497767
753 2842224795 2842224351 Bacteria 5524473
754 2842235356 2842229732 Bacteria 7475766
755 2842238225 2842237096 Bacteria 6620661
756 2842248189 2842243621 Bacteria 7421798
757 2842253465 2842250916 Bacteria 6579627
758 2842262217 2842257432 Bacteria 7401195
759 2842268816 2842264693 Bacteria 6472963
760 2842276610 2842271015 Bacteria 7807131
761 2842280301 2842278818 Bacteria 6340002
762 2842286783 2842285085 Bacteria 6011953
763 2842293612 2842291075 Bacteria 7076806
764 2842299505 2842298080 Bacteria 6123127
765 2842306556 2842304105 Bacteria 7023636
766 2842312676 2842311132 Bacteria 6616990
767 2842322459 2842317721 Bacteria 6793725
768 2842343129 2842341865 Bacteria 7003929
769 2842360932 2842357229 Bacteria 6485165
770 2842367146 2842363717 Bacteria 6844742
771 2842370993 2842370503 Bacteria 7038661
772 2842380009 2842377471 Bacteria 7140707
773 2842387080 2842384541 Bacteria 7057858
774 2842399193 2842395702 Bacteria 6780583
775 2842403664 2842402390 Bacteria 6681310
776 2842410634 2842409023 Bacteria 6687331
777 2842417280 2842415677 Bacteria 6596907
778 2842424671 2842422224 Bacteria 6239196
779 2842432984 2842428310 Bacteria 6767288
780 2842439289 2842434925 Bacteria 6502746
781 2842445918 2842441272 Bacteria 6769273
782 2842451901 2842447887 Bacteria 6754142
783 2842467104 2842462802 Bacteria 6588055
784 2842473868 2842469257 Bacteria 6752936
785 2842476224 2842475841 Bacteria 6603183
786 2842487689 2842482326 Bacteria 7212537
787 2842492515 2842489311 Bacteria 6620893
788 2842500095 2842495871 Bacteria 6820686
789 2842502874 2842502639 Bacteria 6604161
790 2842509150 2842509118 Bacteria 6850950
791 2842517291 2842515876 Bacteria 5436280
792 2842521645 2842521101 Bacteria 6569494
793 2842923270 2842922631 Bacteria 5824079
794 2844165196 2844163670 Bacteria 7266046
795 2844456046 2844454524 Bacteria 7952546
796 2847417627 2847417321 Bacteria 6913799
797 2848992432 2848992105 Bacteria 6810864
798 2850079928 2850079185 Bacteria 6848280
799 2852388423 2852387548 Bacteria 8025568
800 2854898216 2854896431 Bacteria 5869725
801 2854919898 2854916844 Bacteria 5725939
802 2855831723 2855825444 Bacteria 6785811
803 2855839947 2855839649 Bacteria 7135830
804 2855874585 2855872281 Bacteria 6964271
805 2857521699 2857516855 Bacteria 7787325
806 2857531147 2857531043 Bacteria 6754041
807 2858803920 2858800743 Bacteria 6603254
808 2891374987 2891373044 Bacteria 5202277
809 2896391604 2896384573 Bacteria 7700774
810 2899792571 2899792073 Bacteria 4926588
811 2899805355 2899803654 Bacteria 5577784
812 2899847840 2899845264 Bacteria 5672268
813 2913298041 2913295892 Bacteria 6333755
814 2913313358 2913308742 Bacteria 5350706
815 2915980735 2915980308 Bacteria 6624279
816 2915987720 2915986958 Bacteria 6739310
817 2915998252 2915993759 Bacteria 7016183
818 2916002796 2916000859 Bacteria 6865702
819 2916011053 2916007675 Bacteria 6898660
820 2916015473 2916014648 Bacteria 6946486
821 2916022114 2916021584 Bacteria 6854472
822 2916031082 2916028427 Bacteria 6748433
823 2916041246 2916035215 Bacteria 6755766
824 2916045620 2916041962 Bacteria 6820487
825 2916053775 2916048683 Bacteria 6543552
826 2916057354 2916055098 Bacteria 6758838
827 2916063698 2916061851 Bacteria 6737736
828 2916071741 2916068649 Bacteria 6943657
829 2916081834 2916076590 Bacteria 6596108
830 2919101405 2919100787 Bacteria 7710546
831 2919116369 2919114240 Bacteria 5700270
832 2919166864 2919166419 Bacteria 4952238
833 2919172141 2919171160 Bacteria 6499771
834 2919408745 2919408235 Bacteria 6149349
835 2920763445 2920760137 Bacteria 7427611
836 2920823319 2920822456 Bacteria 6897201
837 2921204739 2921201388 Bacteria 6926299
838 2921209304 2921208531 Bacteria 6745326
839 2921242056 2921237296 Bacteria 6876710
840 2921248868 2921244191 Bacteria 6568419
841 2921257207 2921250672 Bacteria 6677771
842 2921263898 2921257292 Bacteria 6808382
843 2921266429 2921263974 Bacteria 6864552
844 2921283148 2921282425 Bacteria 6826397
845 2921290606 2921289301 Bacteria 7316391
846 2923557091 2923556063 Bacteria 6793593
847 2924150570 2924144063 Bacteria 6883928
848 2924156553 2924150972 Bacteria 7169444
849 2924163445 2924158325 Bacteria 7188855
850 2924170381 2924165586 Bacteria 7260590
851 2924178004 2924172951 Bacteria 6749356
852 2924181821 2924179722 Bacteria 6843264
853 2924190754 2924186466 Bacteria 6876637
854 2924200017 2924193448 Bacteria 6955718
855 2924202640 2924200457 Bacteria 6757188
856 2924209099 2924207177 Bacteria 6917007
857 2924218834 2924214083 Bacteria 7080103
858 2924222315 2924221636 Bacteria 7113495
859 2924234998 2924228884 Bacteria 6633132
860 2926757323 2926754445 Bacteria 5964435
861 2926761539 2926760298 Bacteria 5505990
862 2929138859 2929138655 Bacteria 5810547
863 2933007305 2933006813 Bacteria 4912075
864 2933015104 2933011516 Bacteria 5439334
865 2933573625 2933570622 Bacteria 7023390
866 2933587483 2933586486 Bacteria 7667493
867 2933594511 2933594066 Bacteria 5594265
868 2933601855 2933599457 Bacteria 5858799
869 2935895961 2935894831 Bacteria 6620579
870 2935907219 2935901341 Bacteria 7341747
871 2936368983 2936367885 Bacteria 7324495
872 2936378401 2936375103 Bacteria 6652732
873 2936383687 2936381700 Bacteria 7006523
874 2936997882 2936996657 Bacteria 6298727
875 2937009269 2937002841 Bacteria 6934057
876 2937014835 2937009748 Bacteria 6746052
877 2937022421 2937016420 Bacteria 6782579
878 2937028771 2937023124 Bacteria 6815156
879 2937034577 2937029754 Bacteria 6424026
880 2937041262 2937036028 Bacteria 6846469
881 2937047542 2937042894 Bacteria 6741576
882 2937051218 2937049772 Bacteria 6757901
883 2937062613 2937056579 Bacteria 7107896
884 2937068313 2937063883 Bacteria 7199456
885 2937073022 2937071275 Bacteria 6984483
886 2937078789 2937078374 Bacteria 6610289
887 2937089075 2937084907 Bacteria 6618516
888 2937096876 2937091812 Bacteria 6979387
889 2937103498 2937098957 Bacteria 7249374
890 2937111523 2937106411 Bacteria 6947143
891 2937114725 2937113482 Bacteria 6505872
892 2937125613 2937119839 Bacteria 6597547
893 2937132383 2937126314 Bacteria 6771275
894 2941500769 2941499720 Bacteria 7599444
895 2957382105 2957375807 Bacteria 6425588
896 2957388555 2957382221 Bacteria 6737050
897 2957394018 2957388812 Bacteria 6778072
898 2957396091 2957395598 Bacteria 6822399
899 2957408212 2957402308 Bacteria 6741770
900 2957412065 2957408893 Bacteria 6558585
901 2957422062 2957415311 Bacteria 6991633
902 2957423268 2957422303 Bacteria 7172205
903 2957434040 2957430029 Bacteria 7022557
904 2957442590 2957437181 Bacteria 6568994
905 2957447176 2957443900 Bacteria 6869977
906 2957452433 2957450854 Bacteria 6765715
907 2957462774 2957457609 Bacteria 6967680
908 2957466266 2957464669 Bacteria 6568877
909 2957477861 2957471148 Bacteria 6797643
910 2957479735 2957478035 Bacteria 6756658
911 2957486202 2957484790 Bacteria 6703082
912 2957496083 2957491536 Bacteria 6695180
913 2957500545 2957498199 Bacteria 7126688
914 2957507318 2957505466 Bacteria 7253085
915 2960584936 2960584000 Bacteria 6864594
916 2960594718 2960591022 Bacteria 6622873
917 2960598287 2960597568 Bacteria 6550735
918 2960610835 2960603979 Bacteria 6898737
919 2960616881 2960610863 Bacteria 6691244
920 2960621648 2960617483 Bacteria 6727748
921 2960630927 2960624210 Bacteria 6875384
922 2960637505 2960631154 Bacteria 6732508
923 2960643514 2960637947 Bacteria 7296468
924 2960647964 2960645483 Bacteria 7211087
925 2960658341 2960652885 Bacteria 7083688
926 2960660460 2960660292 Bacteria 7041660
927 2960672305 2960667422 Bacteria 6763020
928 2960680288 2960674078 Bacteria 6609048
929 2960686563 2960680706 Bacteria 6624464
930 2960690275 2960687367 Bacteria 6535474
931 2960698872 2960693952 Bacteria 6749742
932 2964613053 2964607997 Bacteria 7101408
933 2964616499 2964615318 Bacteria 6809089
934 2964624140 2964621998 Bacteria 6834995
935 2964632756 2964628898 Bacteria 7083044
936 2964636560 2964636051 Bacteria 7091832
937 2964643739 2964643177 Bacteria 6820887
938 2964650283 2964649959 Bacteria 6675118
939 2964663655 2964656573 Bacteria 7100150
940 2964664939 2964663802 Bacteria 7019362
941 2964675009 2964670856 Bacteria 6851364
942 2964683340 2964678106 Bacteria 6792020
943 2964686965 2964685014 Bacteria 6839111
944 2964692267 2964691889 Bacteria 6802758
945 2964700505 2964698721 Bacteria 6765331
946 2964709927 2964705432 Bacteria 7114648
947 2964713188 2964712639 Bacteria 6695970
948 2964721784 2964719344 Bacteria 7286602
949 2967667625 2967664464 Bacteria 6948836
950 2967673640 2967671571 Bacteria 7021409
951 2967684909 2967678726 Bacteria 7264382
952 2967691477 2967686174 Bacteria 6678622
953 2967695021 2967693043 Bacteria 6804451
954 2967702971 2967699805 Bacteria 6854538
955 2967707327 2967706974 Bacteria 7186053
956 2967714615 2967714385 Bacteria 7000047
957 2967722510 2967721400 Bacteria 7073753
958 2967730510 2967728569 Bacteria 6641507
959 2967740739 2967735183 Bacteria 6827012
960 2967748230 2967742019 Bacteria 6794534
961 2967755004 2967748971 Bacteria 6733771
962 2967761846 2967755722 Bacteria 6814706
963 2967763618 2967762386 Bacteria 6923502
964 2967772985 2967769361 Bacteria 6587838
965 2967782512 2967775926 Bacteria 6738189
966 2970022824 2970019648 Bacteria 7072033
967 2970030531 2970026789 Bacteria 6785236
968 2970036993 2970033650 Bacteria 7118744
969 2970045441 2970040964 Bacteria 6731123
970 2970054856 2970047711 Bacteria 7088379
971 2970060896 2970054988 Bacteria 6611507
972 2970064014 2970061556 Bacteria 7099761
973 2970073973 2970068827 Bacteria 7123112
974 2970082322 2970076120 Bacteria 6697332
975 2970088502 2970082768 Bacteria 6183754
976 2970091335 2970088815 Bacteria 6933825
977 2970097598 2970095765 Bacteria 6936963
978 2970108348 2970102677 Bacteria 6812532
979 2970115639 2970109326 Bacteria 6863976
980 2970118613 2970116247 Bacteria 6501857
981 2970124343 2970122695 Bacteria 6625855
982 2970131519 2970129317 Bacteria 6806560
983 2970136487 2970136068 Bacteria 7207982
984 2970148492 2970143518 Bacteria 6446480
985 2970151753 2970149975 Bacteria 6779706
986 2970157463 2970156795 Bacteria 7168044
987 2970170189 2970164137 Bacteria 6861252
988 2970175707 2970170962 Bacteria 6876229
989 2970181947 2970177841 Bacteria 6768001
990 2970191741 2970184632 Bacteria 7054431
991 2970192820 2970191845 Bacteria 7032787
992 2977519575 2977516862 Bacteria 6940108
993 2977529182 2977523885 Bacteria 6960446
994 2977535813 2977530762 Bacteria 6951399
995 2977542077 2977537788 Bacteria 6929320
996 2977549513 2977544691 Bacteria 6875412
997 2977553629 2977551784 Bacteria 7125765
998 2977559414 2977558990 Bacteria 6863948
999 2977566936 2977565890 Bacteria 6901543
1000 2977574560 2977572785 Bacteria 6763888
1001 2977580389 2977579622 Bacteria 6772100
1002 2978973280 2978969890 Bacteria 5400756
1003 2979093171 2979089926 Bacteria 5670289
1004 2979099442 2979095461 Bacteria 5669583
1005 2979105141 2979100975 Bacteria 5423623
1006 2984513000 2984509177 Bacteria 5274802
1007 2984520635 2984518228 Bacteria 5277463
1008 2984539929 2984537506 Bacteria 5277481
1009 2984591561 2984587000 Bacteria 5263363
1010 2984602119 2984601300 Bacteria 5455244
1011 2989351463 2989349275 Bacteria 6349068
1012 2989772739 2989771324 Bacteria 5605128
1013 2989777370 2989776772 Bacteria 4843317
1014 2996888460 2996887358 Bacteria 5795980
1015 2996893379 2996893221 Bacteria 5823108
1016 3003931900 3003930520 Bacteria 5667563
1017 3005411177 3005409236 Bacteria 7188837
1018 3005422863 3005416602 Bacteria 7064308
1019 3005446128 3005445848 Bacteria 6906074
1020 3005452787 3005452660 Bacteria 5889319
1021 639646594 639633055 Bacteria 7751309
1022 643824491 643692032 Bacteria 6891900
1023 648740857 648276728 Bacteria 6968865
1024 650738994 650716007 Bacteria 5573770
1025 8003572628 8003570095 Bacteria 5747666
1026 8003992399 8003992118 Bacteria 7266902
1027 8003999728 8003999396 Bacteria 7063185
1028 8005247442 8005246636 Bacteria 4933972
1029 8005263424 8005258706 Bacteria 6184835
1030 8005278782 8005275841 Bacteria 6929066
1031 8005289064 8005282627 Bacteria 6675747
1032 8005291138 8005289223 Bacteria 6634003
1033 8005301495 8005301065 Bacteria 6614431
1034 8005309249 8005307578 Bacteria 7395396
1035 8005321601 8005314921 Bacteria 7072929
1036 8005322987 8005321885 Bacteria 5795980
1037 8005377489 8005376324 Bacteria 6590079
1038 8005387352 8005382845 Bacteria 6732062
1039 8005400070 8005395548 Bacteria 6806915
1040 8005432876 8005430974 Bacteria 6689030
1041 8005460954 8005460587 Bacteria 7157962
1042 8005484893 8005484373 Bacteria 6297373
1043 8005498606 8005497431 Bacteria 6477605
1044 8005543716 8005542996 Bacteria 7077758
1045 8005560567 8005556819 Bacteria 6908598
1046 8005563975 8005563573 Bacteria 7153261
1047 8005576866 8005570704 Bacteria 6957481
1048 8005619798 8005619151 Bacteria 7030230
1049 8005628370 8005626139 Bacteria 6534237
1050 8005649587 8005645114 Bacteria 6950293
1051 8005660336 8005658619 Bacteria 4500593
1052 8005670017 8005668836 Bacteria 6953162
1053 8005685170 8005682033 Bacteria 6726518
1054 8005690211 8005688590 Bacteria 6610080
1055 8005699309 8005695170 Bacteria 6912330
1056 8018133066 8018127388 Bacteria 7351159
1057 8018153033 8018150411 Bacteria 5549903
1058 8018168968 8018163183 Bacteria 7277977
1059 8018178856 8018176218 Bacteria 6896178
1060 8023684296 8023680758 Bacteria 7729763
1061 8024480221 8024479707 Bacteria 6954785
1062 8024491466 8024486573 Bacteria 6540512
1063 8024501658 8024501048 Bacteria 6427847
1064 8046770757 8046767195 Bacteria 7547379
1065 8049293425 8049293176 Bacteria 6128433
1066 8054559262 8054558443 Bacteria 5204801
1067 8055433461 8055431914 Bacteria 4551896
1068 8056375579 8056375014 Bacteria 7006639
1069 8056385893 8056382006 Bacteria 6408074
1070 8056878991 8056875544 Bacteria 4355797
1071 8057577781 8057575449 Bacteria 7367519
1072 8057875993 8057874678 Bacteria 7494653
1073 JGI24740J21852_10002224
1074 JGI25155J39150_1000157
1075 JGI25156J39149_1000029
1076 JGI25162J39368_1001710
1077 JGI25162J39368_1001836
1078 JGI25154J39366_1000286
1079 JGI25158J39367_1000475
1080 JGI25157J39369_1000247
1081 JGI25152J39213_1000608
1082 JGI25152J39213_1005563
1083 JGI25152J39213_1013884
1084 JGI25152J39213_1020298
1085 JGI25150J39212_1000012
1086 JGI25150J39212_1004181
1087 JGI25159J45721_1000137
1088 JGI25159J45721_1000442
1089 JGI25159J45721_1017373
1090 JGI25151J46595_10000025
1091 JGI25151J46595_10001279
1092 JGI25151J46595_10026131
1093 JGI25151J46595_10053231
1094 JGI25165J46597_1000491
1095 JGI25165J46597_1001462
1096 JGI25153J46596_10001245
1097 JGI25153J46596_10007405
1098 JGI25153J46596_10012617
1099 rootH1_10018497
1100 rootL2_10003154
1101 JGI25160J50197_1000003
1102 JGI25160J50197_1000041
1103 JGI25160J50197_1003209
1104 JGI25160J50197_1003874
1105 JGI25160J50197_1007018
1106 JGI25161J50226_1000002
1107 JGI25161J50226_1000143
1108 JGI25161J50226_1003758
1109 JGI25161J50226_1008273
1110 Ga0055526_1004376
1111 Ga0055526_1007684
1112 Ga0055526_1008179
1113 Ga0055526_1011225
1114 Ga0055524_1002097
1115 Ga0055524_1005057
1116 Ga0055524_1016872
1117 Ga0055524_1040211
1118 Ga0055524_1046174
1119 Ga0055536_1007049
1120 Ga0055536_1016218
1121 Ga0055528_1000604
1122 Ga0055528_1002124
1123 Ga0055528_1003474
1124 Ga0055530_10011416
1125 Ga0055540_1010291
1126 Ga0055540_1010872
1127 Ga0055540_1016520
1128 Ga0055531_10001158
1129 Ga0055531_10011190
1130 Ga0058692_1000711
1131 Ga0058692_1002517
1132 Ga0058692_1008627
1133 Ga0055543_1000008
1134 Ga0055543_1000158
1135 Ga0055543_1000263
1136 Ga0055543_1002646
1137 Ga0065165_1000031
1138 Ga0065165_1000084
1139 Ga0065165_1008370
1140 Ga0065704_10094625
1141 Ga0070670_100000429
1142 Ga0070666_10274361
1143 Ga0070668_100060783
1144 Ga0070669_100022788
1145 Ga0070669_100308064
1146 Ga0070671_100025725
1147 Ga0070667_100417451
1148 Ga0070662_100519098
1149 Ga0070672_100435188
1150 Ga0068855_100032285
1151 Ga0068856_100033613
1152 Ga0075365_10000706
1153 Ga0075365_10002708
1154 Ga0075365_10003528
1155 Ga0075368_10002386
1156 Ga0075364_10000235
1157 Ga0075364_10021986
1158 Ga0075362_10004342
1159 Ga0075362_10051921
1160 Ga0075367_10035139
1161 Ga0075367_10255791
1162 Ga0075369_10004459
1163 Ga0075369_10023653
1164 Ga0075369_10037884
1165 Ga0075369_10040257
1166 Ga0075370_10099949
1167 Ga0075370_10134048
1168 Ga0079104_1002099
1169 Ga0099826_10011459
1170 Ga0099826_10061402
1171 Ga0105251_10009601
1172 Ga0105250_10106232
1173 Ga0105240_10000460
1174 Ga0105248_10021903
1175 Ga0105248_10703875
1176 Ga0105237_10000814
1177 Ga0105249_10050573
1178 Ga0123340_1012051
1179 Ga0123341_1000040
1180 Ga0123341_1022045
1181 Ga0123341_1043603
1182 Ga0123342_1010304
1183 Ga0105239_10000961
1184 Ga0105246_10227785
1185 Ga0105246_10443463
1186 Ga0157319_1000713
1187 Ga0157373_10031417
1188 Ga0157373_10049612
1189 Ga0157371_10000004
1190 Ga0157371_10302916
1191 Ga0157370_10000185
1192 Ga0157370_10000952
1193 Ga0157370_10021550
1194 Ga0157370_10231053
1195 Ga0157369_10014549
1196 Ga0157369_10038500
1197 Ga0157369_10410052
1198 Ga0171463_1001
1199 Ga0163163_10308531
1200 Ga0182008_10010273
1201 Ga0182007_10003032
1202 Ga0182005_1001269
1203 Ga0183363_1032
1204 Ga0214544_1000012
1205 Ga0214542_1000011
1206 Ga0214543_1000004
1207 Ga0214543_1000259
1208 Ga0228711_1000019
1209 Ga0228710_1000022
1210 Ga0209435_100011
1211 Ga0209436_100051
1212 Ga0209437_100056
1213 Ga0209437_100196
1214 Ga0209437_108739
1215 Ga0207425_1000012
1216 Ga0207425_1001591
1217 Ga0207425_1011920
1218 Ga0209646_1000024
1219 Ga0209646_1009783
1220 Ga0209646_1014562
1221 Ga0209026_1000030
1222 Ga0209677_101356
1223 Ga0209759_1000011
1224 Ga0209759_1017932
1225 Ga0209129_1000081
1226 Ga0209129_1000982
1227 Ga0209129_1000989
1228 Ga0209129_1001354
1229 Ga0209129_1001463
1230 Ga0209129_1001626
1231 Ga0209129_1001904
1232 Ga0209129_1029031
1233 Ga0209233_1000037
1234 Ga0209233_1000071
1235 Ga0209233_1002018
1236 Ga0209565_1028241
1237 Ga0209455_1023551
1238 Ga0209673_1000015
1239 Ga0209673_1000704
1240 Ga0209673_1000999
1241 Ga0209673_1003255
1242 Ga0209673_1004004
1243 Ga0209673_1057944
1244 Ga0209130_1000002
1245 Ga0209130_1000005
1246 Ga0209130_1000088
1247 Ga0209130_1016676
1248 Ga0209676_1006985
1249 Ga0209676_1012033
1250 Ga0209025_1000024
1251 Ga0209025_1000037
1252 Ga0209025_1000060
1253 Ga0209025_1000295
1254 Ga0209025_1001006
1255 Ga0209025_1004005
1256 Ga0209025_1004161
1257 Ga0209025_1008048
1258 Ga0209025_1008685
1259 Ga0209025_1016641
1260 Ga0209025_1024533
1261 Ga0209564_1000093
1262 Ga0209564_1000382
1263 Ga0209564_1000576
1264 Ga0209564_1000811
1265 Ga0209564_1007365
1266 Ga0209564_1008452
1267 Ga0209758_1000046
1268 Ga0209758_1000349
1269 Ga0209758_1000575
1270 Ga0209758_1000810
1271 Ga0209758_1003540
1272 Ga0209758_1003807
1273 Ga0209758_1019380
1274 Ga0209050_1001493
1275 Ga0209050_1011099
1276 Ga0209256_1000027
1277 Ga0209256_1000646
1278 Ga0209256_1001165
1279 Ga0209256_1004480
1280 Ga0209256_1007277
1281 Ga0209256_1011923
1282 Ga0209256_1055446
1283 Ga0207426_1000012
1284 Ga0207426_1000013
1285 Ga0207426_1000015
1286 Ga0207426_1000063
1287 Ga0207426_1000172
1288 Ga0207426_1004643
1289 Ga0209051_1002797
1290 Ga0209051_1003520
1291 Ga0209051_1005151
1292 Ga0209051_1008947
1293 Ga0209257_1000598
1294 Ga0209257_1012590
1295 Ga0209257_1033745
1296 Ga0207680_10426635
1297 Ga0207695_10000036
1298 Ga0207671_10000517
1299 Ga0207650_10000391
1300 Ga0207644_10168192
1301 Ga0207711_10064708
1302 Ga0207711_10776751
1303 Ga0207667_10031210
1304 Ga0207712_10341718
1305 Ga0207668_10221747
1306 Ga0207658_10074415
1307 Ga0207658_10280443
1308 Ga0207702_10024802
1309 Ga0209281_1000200
1310 Ga0209281_1000227
1311 Ga0209281_1000488
1312 Ga0209371_1000009
1313 Ga0209371_1000315
1314 Ga0209371_1000812
1315 Ga0209282_1000042
1316 Ga0209282_1003287
1317 Ga0209282_1088566
1318 Ga0209813_10000319
1319 Ga0268266_10035955
1320 Ga0268266_10048948
1321 Ga0307515_10000121
1322 Ga0307515_10001439
1323 Ga0307515_10021464
1324 Ga0268256_1000010
1325 Ga0268256_1001455
1326 Ga0268256_1002157
1327 Ga0316181_1189898
1328 Ga0307513_10031494
1329 Ga0307405_10300981
1330 Ga0307410_10465669
1331 Ga0307406_10087397
1332 Ga0307406_10090297
1333 Ga0307412_10001886
1334 Ga0315914_1000009
1335 Ga0307409_100335718
1336 Ga0307416_100555729
1337 Ga0307414_10248017
1338 Ga0307414_10467597
1339 Ga0315913_1000015
1340 Ga0315915_1000013
1341 Ga0373935_0026244
1342 Ga0373927_0000086
1343 Ga0373925_0001218
1344 Ga0395905_0006471
1345 Ga0395905_0083916
1346 Ga0439436_0007534
1347 Ga0439436_0008049
1348 Ga0439436_0031469
1349 Ga0439439_0039213
1350 Ga0439465_0006265
1351 Ga0439465_0082470
1352 Ga0451787_590894
1353 Ga0451789_0321844
1354 Ga0451797_0172901
1355 Ga0451798_0416552
1356 Ga0451804_0691989
1357 Ga0451839_0165476
1358 Ga0451841_0303195
1359 Ga0451845_0532907
1360 Ga0451843_0506256
1361 Ga0451855_0418294
1362 Ga0451853_1034512
1363 Ga0439432_059599
1364 Ga0439449_0032835
1365 Ga0439449_0047055
1366 Ga0439449_0066520
1367 Ga0450910_032056
1368 Ga0466968_0067192
1369 Ga0495592_0088318
1370 Ga0495638_0000788
1371 Ga0495638_0094795
1372 Ga0495638_0113697
1373 Ga0495651_0038428
1374 Ga0495605_0002202
1375 Ga0495662_0026278
1376 Ga0495584_0130526
1377 Ga0495596_0075155
1378 Ga0495607_0081215
1379 Ga0495583_0006566
1380 Ga0495606_0002855
1381 Ga0495606_0014709
1382 Ga0495606_0024724
1383 Ga0495610_0001051
1384 Ga0495610_0009369
1385 Ga0495610_0040442
1386 Ga0495620_0015428
1387 Ga0495620_0100353
1388 Ga0495631_0001806
1389 Ga0495631_0073518
1390 Ga0495632_0000817
1391 Ga0495632_0027857
1392 Ga0495632_0125937
1393 Ga0495643_0071509
1394 Ga0495652_0116192
1395 Ga0495654_0000321
1396 Ga0495587_0032692
1397 Ga0495633_0031716
1398 Ga0495633_0064503
1399 Ga0495633_0113103
1400 Ga0495668_0091020
1401 Ga0495625_0003290
1402 Ga0495625_0019916
1403 Ga0495588_0000488
1404 Ga0495657_0027002
1405 Ga0495670_0296756
1406 Ga0495671_0158315
1407 Ga0495671_0175189
1408 Ga0495600_0052667
1409 Ga0495604_0015489
1410 Ga0495672_0144173
1411 Ga0495683_0130950
1412 Ga0495683_0236451
1413 Ga0495687_046991
1414 Ga0495686_0000458
1415 Ga0495686_0008978
1416 Ga0495686_0032498
1417 Ga0495686_0207051
1418 Ga0496100_0247022
1419 Ga0496103_0074026
1420 Ga0496104_0089636
1421 Ga0496106_0000986
1422 Ga0496106_0058720
1423 Ga0496106_0702246
1424 Ga0496110_0492428
1425 Ga0496111_0002979
1426 Ga0496116_0000100
1427 Ga0496116_0008021
1428 Ga0496116_0008831
1429 Ga0496116_0009409
1430 Ga0496116_0012698
1431 Ga0496116_0026966
1432 Ga0496116_0029292
1433 Ga0496116_0053685
1434 Ga0496117_0000002
1435 Ga0496117_0001409
1436 Ga0496117_0005803
1437 Ga0496117_0007589
1438 Ga0496117_0049744
1439 Ga0496117_0126219
1440 Ga0496118_0001173
1441 Ga0496118_0002665
1442 Ga0496118_0020543
1443 Ga0496118_0022298
1444 Ga0496118_0039260
1445 Ga0496119_0012345
1446 Ga0496119_0016464
1447 Ga0496119_0021287
1448 Ga0496119_0050150
1449 Ga0496119_0103760
1450 Ga0496120_0000021
1451 Ga0496120_0006668
1452 Ga0496120_0007520
1453 Ga0496120_0063178
1454 Ga0496121_0000001
1455 Ga0496121_0001709
1456 Ga0496121_0005304
1457 Ga0496121_0009812
1458 Ga0496121_0024590
1459 Ga0496121_0030081
1460 Ga0496121_0053733
1461 Ga0496121_0128768
1462 Ga0496122_0000001
1463 Ga0496122_0000009
1464 Ga0496122_0000147
1465 Ga0496122_0002139
1466 Ga0496122_0009578
1467 Ga0496122_0033440
1468 Ga0496122_0040826
1469 Ga0496122_0158534
1470 Ga0496122_0191956
1471 Ga0496123_0000001
1472 Ga0496123_0000020
1473 Ga0496123_0000158
1474 Ga0496123_0005678
1475 Ga0496123_0006344
1476 Ga0496123_0011116
1477 Ga0496123_0031916
1478 Ga0496123_0032274
1479 Ga0496123_0077162
1480 Ga0496123_0093754
1481 Ga0496124_0000063
1482 Ga0496124_0000551
1483 Ga0496124_0000801
1484 Ga0496124_0010835
1485 Ga0496124_0012087
1486 Ga0496124_0012285
1487 Ga0496124_0022893
1488 Ga0496124_0073712
1489 Ga0496124_0153849
1490 Ga0496124_0302527
1491 Ga0496124_0344621
1492 Ga0496125_0000001
1493 Ga0496125_0000981
1494 Ga0496125_0009950
1495 Ga0496125_0027312
1496 Ga0496125_0046819
1497 Ga0496125_0351579
1498 Ga0496126_0000094
1499 Ga0496126_0000195
1500 Ga0496126_0002865
1501 Ga0496126_0024745
1502 Ga0496126_0037195
1503 Ga0501300_006771
1504 Ga0501031_0026988
1505 Ga0501032_0015645
1506 Ga0501032_0098662
1507 Ga0501033_0000396
1508 Ga0501033_0067127
1509 Ga0501034_0559400
1510 Ga0501037_0004951
1511 Ga0501037_0071387
1512 Ga0501038_0059768
1513 Ga0501038_0098982
1514 Ga0501040_0114766
1515 Ga0501043_0013294
1516 Ga0501043_0013895
1517 Ga0501047_0032799
1518 Ga0501047_0042433
1519 Ga0501083_0048280
1520 Ga0501280_009240
1521 Ga0501280_012633
1522 Ga0501035_0000647
1523 Ga0501035_0034240
1524 Ga0501035_0165335
1525 Ga0501044_0094256
1526 Ga0501045_0105927
1527 nmdc:mga03683_6227_c1
1528 nmdc:mga00v17_2508_c1
1529 nmdc:mga00v17_39_c1
1530 nmdc:mga00v17_453_c1
1531 nmdc:mga0yw44_164_c1
1532 nmdc:mga0yw44_3246_c1
1533 nmdc:mga0k408_161130_c1
1534 nmdc:mga0k408_45175_c1
1535 nmdc:mga07m45_15052_c1
1536 nmdc:mga07m45_19454_c1
1537 nmdc:mga0sz30_153_c1
1538 nmdc:mga0sz30_20113_c1
1539 nmdc:mga0sz30_44091_c1
1540 Ga0495619_0069770
1541 Ga0500578_0060522
1542 Ga0500578_0180404
1543 Ga0500560_004045
1544 Ga0500569_095945
1545 Ga0500594_0056631
1546 Ga0500608_035540
1547 Ga0500618_000119
1548 Ga0500618_000359
1549 Ga0500618_005102
1550 Ga0500618_023878
1551 Ga0500658_0011500
1552 Ga0500658_0034992
1553 Ga0500559_0009400
1554 Ga0500568_0000972
1555 Ga0500568_0006879
1556 Ga0500573_0032566
1557 Ga0500573_0040733
1558 Ga0500590_001432
1559 Ga0500604_0032344
1560 Ga0500616_0001605
1561 Ga0500616_0003072
1562 Ga0500622_0002052
1563 Ga0500622_0003666
1564 Ga0500622_0125217
1565 Ga0500624_000586
1566 Ga0500624_012781
1567 Ga0500627_0057833
1568 Ga0500633_0090065
1569 Ga0500634_0000819
1570 Ga0500636_0000010
1571 2509106992
1572 2509375052
1573 2509388491
1574 2509444041
1575 2510131362
1576 2510303602
1577 2510839770
1578 2510897716
1579 2511134819
1580 2511171558
1581 2511184737
1582 2511195298
1583 2511500474
1584 2512531938
1585 2512972736
1586 2513570580
1587 2513580266
1588 2513585450
1589 2513596682
1590 2513602875
1591 2513616699
1592 2513634199
1593 2513713242
1594 2513864905
1595 2513885612
1596 2513907358
1597 2513910301
1598 2513929811
1599 2513986165
1600 2513996714
1601 2514005127
1602 2514020298
1603 2515110315
1604 2515607676
1605 2515634523
1606 2515643748
1607 2515657146
1608 2515743353
1609 2516204387
1610 2516891807
1611 2517039000
1612 2517079266
1613 2517093195
1614 2517409464
1615 2517568605
1616 2520378918
1617 2524450579
1618 2524458309
1619 2530647873
1620 2535515044
1621 2537872740
1622 2551675622
1623 2551684062
1624 2551691831
1625 2551700468
1626 2551712190
1627 2551721041
1628 2551726754
1629 2551734459
1630 2551740131
1631 2554246577
1632 2558866056
1633 2558866652
1634 2559293805
1635 2561466845
1636 2585164948
1637 2585203621
1638 2585223709
1639 2585229767
1640 2585255967
1641 2585265324
1642 2585273885
1643 2585280186
1644 2585326033
1645 2585330202
1646 2585385542
1647 2585391958
1648 2585398602
1649 2585529317
1650 2585533563
1651 2585539631
1652 2585545695
1653 2585553152
1654 2585560061
1655 2585819248
1656 2585837588
1657 2585844154
1658 2585900736
1659 2585905759
1660 2585994349
1661 2585998807
1662 2587979125
1663 2599332962
1664 2599419241
1665 2599606060
1666 2599719602
1667 2600191400
1668 2600374657
1669 2601609222
1670 2601745997
1671 2616297063
1672 2616310267
1673 2616553352
1674 2617380315
1675 2643806235
1676 2643812864
1677 2643856369
1678 2643921206
1679 2644004846
1680 2644047181
1681 2644070161
1682 2644103297
1683 2644144236
1684 2644190523
1685 2644199552
1686 2644206758
1687 2644241598
1688 2644297688
1689 2644306227
1690 2644330476
1691 2644377497
1692 2644420923
1693 2644454446
1694 2644479970
1695 2644492296
1696 2644496805
1697 2644519281
1698 2644542777
1699 2644611838
1700 2644650406
1701 2644655941
1702 2644671913
1703 2644692384
1704 2657681848
1705 2671113716
1706 2692317305
1707 2719179515
1708 2719384071
1709 2719663862
1710 2719730185
1711 2720490281
1712 2720611658
1713 2720618507
1714 2720629915
1715 2720773610
1716 2721145608
1717 2721157125
1718 2721162487
1719 2721397841
1720 2722838657
1721 2723025281
1722 2723558866
1723 2723565436
1724 2724036651
1725 2724042941
1726 2724088217
1727 2724102701
1728 2724108597
1729 2725948940
1730 2730106217
1731 2730162752
1732 2730296757
1733 2738801293
1734 2738948300
1735 2739037021
1736 2753461296
1737 2766066619
1738 2776912017
1739 2778179662
1740 2792582970
1741 2792623857
1742 2792629763
1743 2792638096
1744 2793283862
1745 2793295262
1746 2793316384
1747 2793323386
1748 2793326220
1749 2793334280
1750 2793341860
1751 2793348197
1752 2793355737
1753 2793361566
1754 2793364622
1755 2802720362
1756 2802726182
1757 2802731654
1758 2802739405
1759 2802742547
1760 2802749252
1761 2804750868
1762 2805929317
1763 2805932424
1764 2806047597
1765 2806055016
1766 2806062082
1767 2806067192
1768 2806076513
1769 2808986420
1770 2819245270
1771 2819556550
1772 2819608463
1773 2819640568
1774 2819686271
1775 2821123583
1776 2837651907
1777 2838020230
1778 2838025749
1779 2838029346
1780 2838037075
1781 2838044483
1782 2838051554
1783 2838064029
1784 2838071056
1785 2838075322
1786 2838663748
1787 2838672449
1788 2838677278
1789 2838680530
1790 2838691637
1791 2838695437
1792 2838703809
1793 2838708814
1794 2838716166
1795 2838720034
1796 2838726918
1797 2838733879
1798 2838739383
1799 2838747057
1800 2841843281
1801 2841846966
1802 2841856198
1803 2841860506
1804 2841866867
1805 2842079951
1806 2842112155
1807 2842120569
1808 2842127005
1809 2842132171
1810 2842143063
1811 2842148399
1812 2842152660
1813 2842161986
1814 2842169638
1815 2842172411
1816 2842176279
1817 2842185828
1818 2842189273
1819 2842192831
1820 2842202900
1821 2842207006
1822 2842213587
1823 2842218849
1824 2842224795
1825 2842235356
1826 2842238225
1827 2842248189
1828 2842253465
1829 2842262217
1830 2842268816
1831 2842276610
1832 2842280301
1833 2842286783
1834 2842293612
1835 2842299505
1836 2842306556
1837 2842312676
1838 2842322459
1839 2842343129
1840 2842360932
1841 2842367146
1842 2842370993
1843 2842380009
1844 2842387080
1845 2842399193
1846 2842403664
1847 2842410634
1848 2842417280
1849 2842424671
1850 2842432984
1851 2842439289
1852 2842445918
1853 2842451901
1854 2842467104
1855 2842473868
1856 2842476224
1857 2842487689
1858 2842492515
1859 2842500095
1860 2842502874
1861 2842509150
1862 2842517291
1863 2842521645
1864 2842923270
1865 2844165196
1866 2844456046
1867 2847417627
1868 2848992432
1869 2850079928
1870 2852388423
1871 2854898216
1872 2854919898
1873 2855831723
1874 2855839947
1875 2855874585
1876 2857521699
1877 2857531147
1878 2858803920
1879 2891374987
1880 2896391604
1881 2899792571
1882 2899805355
1883 2899847840
1884 2913298041
1885 2913313358
1886 2915980735
1887 2915987720
1888 2915998252
1889 2916002796
1890 2916011053
1891 2916015473
1892 2916022114
1893 2916031082
1894 2916041246
1895 2916045620
1896 2916053775
1897 2916057354
1898 2916063698
1899 2916071741
1900 2916081834
1901 2919101405
1902 2919116369
1903 2919166864
1904 2919172141
1905 2919408745
1906 2920763445
1907 2920823319
1908 2921204739
1909 2921209304
1910 2921242056
1911 2921248868
1912 2921257207
1913 2921263898
1914 2921266429
1915 2921283148
1916 2921290606
1917 2923557091
1918 2924150570
1919 2924156553
1920 2924163445
1921 2924170381
1922 2924178004
1923 2924181821
1924 2924190754
1925 2924200017
1926 2924202640
1927 2924209099
1928 2924218834
1929 2924222315
1930 2924234998
1931 2926757323
1932 2926761539
1933 2929138859
1934 2933007305
1935 2933015104
1936 2933573625
1937 2933587483
1938 2933594511
1939 2933601855
1940 2935895961
1941 2935907219
1942 2936368983
1943 2936378401
1944 2936383687
1945 2936997882
1946 2937009269
1947 2937014835
1948 2937022421
1949 2937028771
1950 2937034577
1951 2937041262
1952 2937047542
1953 2937051218
1954 2937062613
1955 2937068313
1956 2937073022
1957 2937078789
1958 2937089075
1959 2937096876
1960 2937103498
1961 2937111523
1962 2937114725
1963 2937125613
1964 2937132383
1965 2941500769
1966 2957382105
1967 2957388555
1968 2957394018
1969 2957396091
1970 2957408212
1971 2957412065
1972 2957422062
1973 2957423268
1974 2957434040
1975 2957442590
1976 2957447176
1977 2957452433
1978 2957462774
1979 2957466266
1980 2957477861
1981 2957479735
1982 2957486202
1983 2957496083
1984 2957500545
1985 2957507318
1986 2960584936
1987 2960594718
1988 2960598287
1989 2960610835
1990 2960616881
1991 2960621648
1992 2960630927
1993 2960637505
1994 2960643514
1995 2960647964
1996 2960658341
1997 2960660460
1998 2960672305
1999 2960680288
2000 2960686563
2001 2960690275
2002 2960698872
2003 2964613053
2004 2964616499
2005 2964624140
2006 2964632756
2007 2964636560
2008 2964643739
2009 2964650283
2010 2964663655
2011 2964664939
2012 2964675009
2013 2964683340
2014 2964686965
2015 2964692267
2016 2964700505
2017 2964709927
2018 2964713188
2019 2964721784
2020 2967667625
2021 2967673640
2022 2967684909
2023 2967691477
2024 2967695021
2025 2967702971
2026 2967707327
2027 2967714615
2028 2967722510
2029 2967730510
2030 2967740739
2031 2967748230
2032 2967755004
2033 2967761846
2034 2967763618
2035 2967772985
2036 2967782512
2037 2970022824
2038 2970030531
2039 2970036993
2040 2970045441
2041 2970054856
2042 2970060896
2043 2970064014
2044 2970073973
2045 2970082322
2046 2970088502
2047 2970091335
2048 2970097598
2049 2970108348
2050 2970115639
2051 2970118613
2052 2970124343
2053 2970131519
2054 2970136487
2055 2970148492
2056 2970151753
2057 2970157463
2058 2970170189
2059 2970175707
2060 2970181947
2061 2970191741
2062 2970192820
2063 2977519575
2064 2977529182
2065 2977535813
2066 2977542077
2067 2977549513
2068 2977553629
2069 2977559414
2070 2977566936
2071 2977574560
2072 2977580389
2073 2978973280
2074 2979093171
2075 2979099442
2076 2979105141
2077 2984513000
2078 2984520635
2079 2984539929
2080 2984591561
2081 2984602119
2082 2989351463
2083 2989772739
2084 2989777370
2085 2996888460
2086 2996893379
2087 3003931900
2088 3005411177
2089 3005422863
2090 3005446128
2091 3005452787
2092 639646594
2093 643824491
2094 648740857
2095 650738994
2096 8003572628
2097 8003992399
2098 8003999728
2099 8005247442
2100 8005263424
2101 8005278782
2102 8005289064
2103 8005291138
2104 8005301495
2105 8005309249
2106 8005321601
2107 8005322987
2108 8005377489
2109 8005387352
2110 8005400070
2111 8005432876
2112 8005460954
2113 8005484893
2114 8005498606
2115 8005543716
2116 8005560567
2117 8005563975
2118 8005576866
2119 8005619798
2120 8005628370
2121 8005649587
2122 8005660336
2123 8005670017
2124 8005685170
2125 8005690211
2126 8005699309
2127 8018133066
2128 8018153033
2129 8018168968
2130 8018178856
2131 8023684296
2132 8024480221
2133 8024491466
2134 8024501658
2135 8046770757
2136 8049293425
2137 8054559262
2138 8055433461
2139 8056375579
2140 8056385893
2141 8056878991
2142 8057577781
2143 8057875993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00813

FliP

FliP family

53

247

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h72-assembly2.cif.gz_E structure of the periplasmic domain of flip 0.7132 127 191
5h72-assembly2.cif.gz_E structure of the periplasmic domain of flip 0.6874 127 191
6s3s-assembly1.cif.gz_E structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.6476 69 251
4nb5-assembly1.cif.gz_C crystal structure of a transcriptional regulator 0.6439 172 249
6s3s-assembly1.cif.gz_E structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.6226 69 251
ID Description Score Start End Superfamily
af_G5EF26_216_316_1.20.81.10 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain 0.6584 148 251 1.20.81.10
af_G5EF26_216_316_1.20.81.10 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain 0.6111 148 251 1.20.81.10
af_Q58514_1_192_1.20.1050.20 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;STAT transcription factor, all-alpha domain 0.5325 130 250 1.20.1050.20
af_Q5T5P2_704_823_1.20.58.1540 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Actin interacting protein 3, C-terminal domain 0.4603 151 251 1.20.58.1540
af_Q9SRL5_51_253_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.4512 129 249 1.20.1260.10
ID Description Score Start End GO Terms
AF-Q3HWF8-F1-model_v4 Flagellar biosynthetic protein FliP 0.8016 96 235 GO:0005886
GO:0009306
GO:0009425
GO:0044781
AF-A0A4Q2LCN4-F1-model_v4 deleted 0.7945 81 219
AF-A0A4Q2LCN4-F1-model_v4 deleted 0.7893 81 219
AF-A0A359KBB0-F1-model_v4 Flagellar biosynthetic protein FliP 0.7891 77 216 GO:0005886
GO:0009306
GO:0009425
GO:0044781
AF-Q3HWF8-F1-model_v4 Flagellar biosynthetic protein FliP 0.7862 96 235 GO:0005886
GO:0009306
GO:0009425
GO:0044781

Map