F489487

General Info

Members Datasets Scaffolds Average Seq Length
1071 406 2142 133

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0162633|Ga0373946_0162633_34_516
Length 160
Sequence LDLTSSGQDSGRSIHYAARRKHQDRGTAMTKELLWLTLTIILTGLMWVPYILDRIMVRGLMGAMANPSRKDKPQSEWAQRLYFAHTNAVENLIIFAPLVLILDAQGYSTPNTILACAVYFWARLAHAVVYTMGVPILRTLAFTVGFLAQIALVFAVFGKL

Samples

Sample ID Description Type Environment
1 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
9 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
10 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
120 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
121 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
122 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
228 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
229 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
232 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
268 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
269 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
270 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
271 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
272 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
292 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
403 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 6.91
Rhizosphere 91.69
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373946_0162633 3300035171 Bacteria 1049
2 2214544907 2209111006 Bacteria 44850
3 ARSoilYngRDRAFT_c00070 3300000042 Bacteria 16997
4 ARcpr5yngRDRAFT_c000043 3300000043 Bacteria 19987
5 ARSoilOldRDRAFT_c000047 3300000044 Bacteria 25691
6 ARCol0yngRDRAFT_1000027 3300000652 Bacteria 25707
7 JGI24737J22298_10001922 3300001990 Bacteria 7425
8 JGI24035J26624_1033123 3300002126 Unclassified 567
9 JGI26129J50193_1005822 3300003349 Unclassified 881
10 JGI26145J50221_1033792 3300003371 Bacteria 529
11 JGI25405J52794_10003919 3300003911 Bacteria 2636
12 Ga0065714_10267576 3300005288 Unclassified 745
13 Ga0065704_10072440 3300005289 Bacteria 8525
14 Ga0065712_10002336 3300005290 Bacteria 7780
15 Ga0065712_10072434 3300005290 Bacteria 4755
16 Ga0065715_10001032 3300005293 Bacteria 13924
17 Ga0065715_10002398 3300005293 Bacteria 6083
18 Ga0070658_10019414 3300005327 Bacteria 5444
19 Ga0070658_10284183 3300005327 Bacteria 1409
20 Ga0070676_10032919 3300005328 Bacteria 2972
21 Ga0070676_10662816 3300005328 Bacteria 758
22 Ga0070683_100053087 3300005329 Bacteria 3756
23 Ga0070683_100420172 3300005329 Bacteria 1275
24 Ga0070690_100024375 3300005330 Bacteria 3720
25 Ga0070690_100028881 3300005330 Bacteria 3437
26 Ga0070690_100167386 3300005330 Bacteria 1510
27 Ga0070670_100239964 3300005331 Bacteria 1578
28 Ga0070670_100285636 3300005331 Bacteria 1441
29 Ga0070670_101607530 3300005331 Unclassified 597
30 Ga0070677_10000677 3300005333 Bacteria 11415
31 Ga0068869_100283008 3300005334 Bacteria 1334
32 Ga0068869_100718018 3300005334 Bacteria 853
33 Ga0070666_10098868 3300005335 Bacteria 2009
34 Ga0070680_100009897 3300005336 Bacteria 7339
35 Ga0070680_100013833 3300005336 Bacteria 6295
36 Ga0070680_100020270 3300005336 Bacteria 5276
37 Ga0070680_100023290 3300005336 Bacteria 4938
38 Ga0070680_100026950 3300005336 Bacteria 4599
39 Ga0070680_100100236 3300005336 Bacteria 2404
40 Ga0070680_100485627 3300005336 Bacteria 1056
41 Ga0070680_100597644 3300005336 Bacteria 947
42 Ga0070682_100022819 3300005337 Bacteria 3711
43 Ga0070682_100128902 3300005337 Bacteria 1709
44 Ga0070682_100514128 3300005337 Bacteria 930
45 Ga0068868_100516961 3300005338 Bacteria 1048
46 Ga0070660_100002005 3300005339 Bacteria 14046
47 Ga0070660_100004632 3300005339 Bacteria 9521
48 Ga0070660_100041291 3300005339 Bacteria 3515
49 Ga0070660_100059038 3300005339 Bacteria 2975
50 Ga0070660_100059853 3300005339 Bacteria 2955
51 Ga0070660_100065885 3300005339 Bacteria 2819
52 Ga0070660_100486464 3300005339 Bacteria 1026
53 Ga0070689_100377583 3300005340 Bacteria 1194
54 Ga0070689_100468232 3300005340 Bacteria 1075
55 Ga0070687_100041535 3300005343 Bacteria 2325
56 Ga0070687_100111046 3300005343 Bacteria 1552
57 Ga0070687_100133143 3300005343 Bacteria 1438
58 Ga0070687_100248022 3300005343 Bacteria 1105
59 Ga0070687_100449661 3300005343 Bacteria 857
60 Ga0070661_100072176 3300005344 Bacteria 2540
61 Ga0070661_100364980 3300005344 Bacteria 1135
62 Ga0070661_100570855 3300005344 Bacteria 912
63 Ga0070692_10004569 3300005345 Bacteria 5795
64 Ga0070668_100119182 3300005347 Bacteria 2108
65 Ga0070668_100180093 3300005347 Bacteria 1726
66 Ga0070669_100016220 3300005353 Bacteria 5312
67 Ga0070675_100018511 3300005354 Bacteria 5546
68 Ga0070675_100140249 3300005354 Bacteria 2066
69 Ga0070671_100015777 3300005355 Bacteria 6104
70 Ga0070671_100459852 3300005355 Bacteria 1092
71 Ga0070671_100541485 3300005355 Bacteria 1003
72 Ga0070674_100028093 3300005356 Bacteria 3692
73 Ga0070674_100103022 3300005356 Bacteria 2083
74 Ga0070674_100293954 3300005356 Bacteria 1292
75 Ga0070673_100000255 3300005364 Bacteria 27161
76 Ga0070673_100298930 3300005364 Bacteria 1417
77 Ga0070688_100028065 3300005365 Bacteria 3356
78 Ga0070659_100960564 3300005366 Bacteria 749
79 Ga0070667_100017357 3300005367 Bacteria 5964
80 Ga0070667_100094283 3300005367 Bacteria 2579
81 Ga0070667_100276034 3300005367 Bacteria 1508
82 Ga0070667_100392722 3300005367 Bacteria 1262
83 Ga0070703_10008671 3300005406 Bacteria 2861
84 Ga0070709_10044618 3300005434 Bacteria 2746
85 Ga0070709_10167627 3300005434 Bacteria 1532
86 Ga0070714_100041120 3300005435 Bacteria 3899
87 Ga0070714_100045002 3300005435 Bacteria 3739
88 Ga0070714_100228879 3300005435 Bacteria 1712
89 Ga0070714_100267112 3300005435 Bacteria 1586
90 Ga0070714_101265039 3300005435 Bacteria 720
91 Ga0070713_100104840 3300005436 Bacteria 2455
92 Ga0070713_100144031 3300005436 Bacteria 2113
93 Ga0070713_100262538 3300005436 Bacteria 1578
94 Ga0070713_101498795 3300005436 Bacteria 654
95 Ga0070710_10131622 3300005437 Bacteria 1526
96 Ga0070701_10092619 3300005438 Bacteria 1659
97 Ga0070711_100032264 3300005439 Bacteria 3481
98 Ga0070711_100048815 3300005439 Bacteria 2896
99 Ga0070711_100080886 3300005439 Bacteria 2314
100 Ga0070711_100127304 3300005439 Bacteria 1892
101 Ga0070711_100186716 3300005439 Bacteria 1590
102 Ga0070711_100200657 3300005439 Bacteria 1539
103 Ga0070711_100958262 3300005439 Bacteria 732
104 Ga0070711_101481379 3300005439 Bacteria 592
105 Ga0070705_100035185 3300005440 Bacteria 2806
106 Ga0070705_100057750 3300005440 Bacteria 2290
107 Ga0070705_100116182 3300005440 Bacteria 1719
108 Ga0070705_100748054 3300005440 Bacteria 773
109 Ga0070700_100812943 3300005441 Bacteria 754
110 Ga0070694_100002689 3300005444 Bacteria 10536
111 Ga0070694_100769137 3300005444 Bacteria 788
112 Ga0070708_100486404 3300005445 Bacteria 1164
113 Ga0070663_100053406 3300005455 Bacteria 2884
114 Ga0070678_100479328 3300005456 Bacteria 1094
115 Ga0070678_100717645 3300005456 Bacteria 902
116 Ga0070678_101337458 3300005456 Bacteria 667
117 Ga0070662_100006353 3300005457 Bacteria 7612
118 Ga0070662_100190499 3300005457 Bacteria 1622
119 Ga0070662_100262622 3300005457 Bacteria 1391
120 Ga0070662_100533893 3300005457 Bacteria 981
121 Ga0070681_10030461 3300005458 Bacteria 5413
122 Ga0070681_10143539 3300005458 Bacteria 2317
123 Ga0070681_10176707 3300005458 Bacteria 2057
124 Ga0070681_10272939 3300005458 Bacteria 1602
125 Ga0070681_11407656 3300005458 Bacteria 621
126 Ga0070681_11408980 3300005458 Bacteria 621
127 Ga0068867_100298668 3300005459 Bacteria 1327
128 Ga0068867_102018976 3300005459 Bacteria 545
129 Ga0070685_10009552 3300005466 Bacteria 5016
130 Ga0070685_10033256 3300005466 Bacteria 2895
131 Ga0070699_101275724 3300005518 Unclassified 674
132 Ga0070699_101333816 3300005518 Bacteria 658
133 Ga0070679_100006208 3300005530 Bacteria 11131
134 Ga0070679_100038245 3300005530 Bacteria 4770
135 Ga0070679_100135759 3300005530 Bacteria 2441
136 Ga0070679_100141809 3300005530 Bacteria 2382
137 Ga0070679_100309344 3300005530 Bacteria 1530
138 Ga0070679_100463540 3300005530 Bacteria 1212
139 Ga0070679_100967421 3300005530 Bacteria 795
140 Ga0070684_100013666 3300005535 Bacteria 6552
141 Ga0070684_100036747 3300005535 Bacteria 4197
142 Ga0070684_100061157 3300005535 Bacteria 3296
143 Ga0070684_100420727 3300005535 Bacteria 1233
144 Ga0070697_100342282 3300005536 Bacteria 1291
145 Ga0068853_100088369 3300005539 Bacteria 2721
146 Ga0068853_101203413 3300005539 Bacteria 731
147 Ga0070686_100007712 3300005544 Bacteria 6016
148 Ga0070686_100010718 3300005544 Bacteria 5181
149 Ga0070686_100362408 3300005544 Bacteria 1092
150 Ga0070686_101245662 3300005544 Bacteria 619
151 Ga0070695_100022979 3300005545 Bacteria 3827
152 Ga0070695_100092809 3300005545 Bacteria 2019
153 Ga0070696_100019739 3300005546 Bacteria 4567
154 Ga0070696_100047338 3300005546 Bacteria 2983
155 Ga0070696_100047966 3300005546 Bacteria 2964
156 Ga0070696_100117942 3300005546 Bacteria 1918
157 Ga0070693_100009300 3300005547 Bacteria 4884
158 Ga0070693_100121597 3300005547 Bacteria 1620
159 Ga0070693_100125414 3300005547 Bacteria 1598
160 Ga0070704_100002044 3300005549 Bacteria 11185
161 Ga0070704_100010230 3300005549 Bacteria 5705
162 Ga0070704_102126807 3300005549 Bacteria 521
163 Ga0068855_100038030 3300005563 Bacteria 5720
164 Ga0068855_100219705 3300005563 Bacteria 2131
165 Ga0068855_100269713 3300005563 Bacteria 1893
166 Ga0070664_100411669 3300005564 Bacteria 1237
167 Ga0070664_100808148 3300005564 Unclassified 877
168 Ga0068857_100120265 3300005577 Bacteria 2364
169 Ga0068857_100250051 3300005577 Bacteria 1625
170 Ga0068854_100096026 3300005578 Bacteria 2214
171 Ga0068854_101634436 3300005578 Bacteria 588
172 Ga0068856_100213107 3300005614 Bacteria 1947
173 Ga0068856_100223126 3300005614 Bacteria 1900
174 Ga0068856_100512498 3300005614 Bacteria 1220
175 Ga0068856_100578881 3300005614 Bacteria 1144
176 Ga0068856_100655776 3300005614 Bacteria 1070
177 Ga0070702_100031250 3300005615 Bacteria 2911
178 Ga0070702_100401407 3300005615 Bacteria 981
179 Ga0068852_100014845 3300005616 Bacteria 6018
180 Ga0068852_100143760 3300005616 Bacteria 2210
181 Ga0068852_101290022 3300005616 Bacteria 752
182 Ga0068852_101471827 3300005616 Bacteria 703
183 Ga0068859_100011201 3300005617 Bacteria 9016
184 Ga0068859_100060897 3300005617 Bacteria 3803
185 Ga0068866_10004084 3300005718 Bacteria 5990
186 Ga0068866_10149670 3300005718 Bacteria 1350
187 Ga0068861_100012446 3300005719 Bacteria 5936
188 Ga0068861_101181174 3300005719 Bacteria 739
189 Ga0068851_10419441 3300005834 Bacteria 790
190 Ga0068870_10682419 3300005840 Unclassified 707
191 Ga0068858_100089734 3300005842 Bacteria 2860
192 Ga0068858_100742742 3300005842 Bacteria 956
193 Ga0068860_100079707 3300005843 Bacteria 3114
194 Ga0068860_100096697 3300005843 Bacteria 2815
195 Ga0068860_100099546 3300005843 Bacteria 2773
196 Ga0068860_102070090 3300005843 Bacteria 590
197 Ga0068862_100002658 3300005844 Bacteria 15723
198 Ga0068862_100245568 3300005844 Bacteria 1629
199 Ga0068862_101232422 3300005844 Bacteria 747
200 Ga0081455_10000009 3300005937 Bacteria 249885
201 Ga0081455_10007711 3300005937 Bacteria 11291
202 Ga0081455_10680515 3300005937 Unclassified 658
203 Ga0081540_1027731 3300005983 Bacteria 3200
204 Ga0070717_10048664 3300006028 Bacteria 3478
205 Ga0070717_10106660 3300006028 Bacteria 2385
206 Ga0075432_10008112 3300006058 Bacteria 3582
207 Ga0075432_10042732 3300006058 Bacteria 1587
208 Ga0075432_10054797 3300006058 Bacteria 1412
209 Ga0070715_10291194 3300006163 Bacteria 870
210 Ga0070715_10407091 3300006163 Bacteria 758
211 Ga0070716_100186803 3300006173 Bacteria 1366
212 Ga0070712_100159477 3300006175 Bacteria 1741
213 Ga0070712_100169264 3300006175 Bacteria 1694
214 Ga0070712_100467989 3300006175 Bacteria 1052
215 Ga0070712_100620393 3300006175 Bacteria 917
216 Ga0070712_100794227 3300006175 Bacteria 812
217 Ga0075427_10001451 3300006194 Bacteria 3042
218 Ga0097621_100057274 3300006237 Bacteria 3186
219 Ga0097621_100135984 3300006237 Bacteria 2096
220 Ga0097621_101789411 3300006237 Bacteria 585
221 Ga0075370_10913201 3300006353 Bacteria 537
222 Ga0068871_100024571 3300006358 Bacteria 4674
223 Ga0075428_100015961 3300006844 Bacteria 8311
224 Ga0075430_100002634 3300006846 Bacteria 14981
225 Ga0075431_100003630 3300006847 Bacteria 14954
226 Ga0075433_10000215 3300006852 Bacteria 32818
227 Ga0075433_10235105 3300006852 Bacteria 1627
228 Ga0075434_100001991 3300006871 Bacteria 17721
229 Ga0075434_100059088 3300006871 Bacteria 3812
230 Ga0075429_100002688 3300006880 Bacteria 14973
231 Ga0075429_100924060 3300006880 Bacteria 763
232 Ga0068865_100810042 3300006881 Bacteria 808
233 Ga0075436_100184815 3300006914 Bacteria 1474
234 Ga0075436_100264850 3300006914 Bacteria 1226
235 Ga0097620_100011201 3300006931 Bacteria 9016
236 Ga0097620_100060901 3300006931 Bacteria 3803
237 Ga0075435_100007981 3300007076 Bacteria 7576
238 Ga0075435_100066715 3300007076 Bacteria 2929
239 Ga0075435_100218531 3300007076 Bacteria 1618
240 Ga0075435_101134762 3300007076 Bacteria 683
241 Ga0105251_10056491 3300009011 Bacteria 1858
242 Ga0105251_10099896 3300009011 Bacteria 1326
243 Ga0105240_10066233 3300009093 Bacteria 4482
244 Ga0105240_10650210 3300009093 Bacteria 1156
245 Ga0105240_10926383 3300009093 Bacteria 936
246 Ga0105240_11091847 3300009093 Unclassified 849
247 Ga0111539_10001588 3300009094 Bacteria 30267
248 Ga0111539_10008998 3300009094 Bacteria 12639
249 Ga0111539_10104213 3300009094 Bacteria 3328
250 Ga0111539_11555143 3300009094 Bacteria 767
251 Ga0105245_10095625 3300009098 Bacteria 2741
252 Ga0105245_10261154 3300009098 Bacteria 1685
253 Ga0105247_10013175 3300009101 Bacteria 4961
254 Ga0105247_10078238 3300009101 Bacteria 2080
255 Ga0105247_10106779 3300009101 Bacteria 1797
256 Ga0105247_10185323 3300009101 Bacteria 1391
257 Ga0105247_10264520 3300009101 Bacteria 1180
258 Ga0114129_10008124 3300009147 Bacteria 14957
259 Ga0114129_10008445 3300009147 Bacteria 14672
260 Ga0105243_10137800 3300009148 Bacteria 2078
261 Ga0105243_10412734 3300009148 Bacteria 1257
262 Ga0105243_11222977 3300009148 Bacteria 765
263 Ga0105241_10012702 3300009174 Bacteria 6180
264 Ga0105241_10059957 3300009174 Bacteria 2927
265 Ga0105241_10128270 3300009174 Bacteria 2050
266 Ga0105242_10004424 3300009176 Bacteria 10926
267 Ga0105242_10213652 3300009176 Bacteria 1720
268 Ga0105242_11161773 3300009176 Bacteria 789
269 Ga0105248_10010513 3300009177 Bacteria 10193
270 Ga0105248_10098855 3300009177 Bacteria 3288
271 Ga0105248_10965915 3300009177 Bacteria 962
272 Ga0105237_10014708 3300009545 Bacteria 8171
273 Ga0105237_10032544 3300009545 Bacteria 5279
274 Ga0105237_10075611 3300009545 Bacteria 3359
275 Ga0105238_10042664 3300009551 Bacteria 4592
276 Ga0105238_10128853 3300009551 Bacteria 2509
277 Ga0105238_10134227 3300009551 Bacteria 2453
278 Ga0105238_12620923 3300009551 Bacteria 540
279 Ga0105249_10007257 3300009553 Bacteria 9668
280 Ga0105249_10063203 3300009553 Bacteria 3400
281 Ga0105239_10352838 3300010375 Bacteria 1661
282 Ga0105239_11088212 3300010375 Bacteria 920
283 Ga0105246_10086388 3300011119 Bacteria 2249
284 Ga0105246_10144787 3300011119 Bacteria 1792
285 Ga0157342_1006506 3300012507 Bacteria 1108
286 Ga0157316_1086012 3300012510 Unclassified 500
287 Ga0157326_1005229 3300012513 Bacteria 1368
288 Ga0157338_1002982 3300012515 Bacteria 1371
289 Ga0157373_10041889 3300013100 Bacteria 3275
290 Ga0157371_10030517 3300013102 Bacteria 3889
291 Ga0157371_10050502 3300013102 Bacteria 2956
292 Ga0157371_10067753 3300013102 Bacteria 2526
293 Ga0157371_10699682 3300013102 Bacteria 759
294 Ga0157370_10103404 3300013104 Bacteria 2666
295 Ga0157370_10630457 3300013104 Bacteria 980
296 Ga0157369_10299762 3300013105 Bacteria 1672
297 Ga0157369_10435835 3300013105 Bacteria 1358
298 Ga0157369_10792375 3300013105 Bacteria 974
299 Ga0157374_10010431 3300013296 Bacteria 7988
300 Ga0157374_10377691 3300013296 Bacteria 1411
301 Ga0157374_10392179 3300013296 Bacteria 1384
302 Ga0157374_12774910 3300013296 Unclassified 517
303 Ga0157378_10013910 3300013297 Bacteria 7039
304 Ga0157378_10208723 3300013297 Bacteria 1851
305 Ga0157378_10211096 3300013297 Bacteria 1841
306 Ga0157378_10298705 3300013297 Bacteria 1558
307 Ga0163162_10135662 3300013306 Bacteria 2571
308 Ga0163162_10179571 3300013306 Bacteria 2243
309 Ga0157372_10079573 3300013307 Bacteria 3707
310 Ga0157372_10273554 3300013307 Bacteria 1963
311 Ga0157372_10499287 3300013307 Bacteria 1419
312 Ga0157375_10032055 3300013308 Bacteria 4979
313 Ga0157375_10249621 3300013308 Bacteria 1935
314 Ga0157375_10849761 3300013308 Bacteria 1059
315 Ga0163163_10012423 3300014325 Bacteria 7758
316 Ga0163163_10013602 3300014325 Bacteria 7452
317 Ga0157380_10042945 3300014326 Bacteria 3537
318 Ga0157377_10000240 3300014745 Bacteria 27908
319 Ga0157377_10051480 3300014745 Bacteria 2323
320 Ga0157379_10005177 3300014968 Bacteria 11201
321 Ga0157379_10080639 3300014968 Bacteria 2915
322 Ga0157379_10090623 3300014968 Bacteria 2743
323 Ga0157379_11062064 3300014968 Bacteria 774
324 Ga0157379_11755730 3300014968 Bacteria 609
325 Ga0157376_10003312 3300014969 Bacteria 11094
326 Ga0157376_10083195 3300014969 Bacteria 2752
327 Ga0157376_10801883 3300014969 Bacteria 954
328 Ga0157376_11050228 3300014969 Bacteria 839
329 Ga0163161_10194928 3300017792 Bacteria 1559
330 Ga0163161_10318552 3300017792 Bacteria 1229
331 Ga0206353_10912259 3300020082 Bacteria 756
332 Ga0213876_10099297 3300021384 Bacteria 1543
333 Ga0213876_10135708 3300021384 Bacteria 1309
334 Ga0207666_1002040 3300025271 Bacteria 2415
335 Ga0207697_10004957 3300025315 Bacteria 6274
336 Ga0207653_10003884 3300025885 Bacteria 4698
337 Ga0207692_10011972 3300025898 Bacteria 3713
338 Ga0207692_10016281 3300025898 Bacteria 3288
339 Ga0207692_10066772 3300025898 Bacteria 1881
340 Ga0207692_10248956 3300025898 Bacteria 1064
341 Ga0207642_10014306 3300025899 Bacteria 2924
342 Ga0207710_10026649 3300025900 Bacteria 2499
343 Ga0207710_10069084 3300025900 Bacteria 1617
344 Ga0207688_10019028 3300025901 Bacteria 3737
345 Ga0207680_10727632 3300025903 Bacteria 711
346 Ga0207647_10037802 3300025904 Bacteria 3057
347 Ga0207685_10023862 3300025905 Bacteria 2088
348 Ga0207699_10004579 3300025906 Bacteria 6605
349 Ga0207699_10005624 3300025906 Bacteria 6015
350 Ga0207699_10105731 3300025906 Bacteria 1795
351 Ga0207699_10147340 3300025906 Bacteria 1553
352 Ga0207645_10048112 3300025907 Bacteria 2722
353 Ga0207645_10443135 3300025907 Bacteria 876
354 Ga0207645_10744116 3300025907 Unclassified 667
355 Ga0207654_10221302 3300025911 Bacteria 1256
356 Ga0207707_10007972 3300025912 Bacteria 9204
357 Ga0207707_10015798 3300025912 Bacteria 6581
358 Ga0207707_10074155 3300025912 Bacteria 2968
359 Ga0207707_10200543 3300025912 Bacteria 1740
360 Ga0207707_10229861 3300025912 Unclassified 1614
361 Ga0207695_10142546 3300025913 Bacteria 2343
362 Ga0207695_10604817 3300025913 Bacteria 977
363 Ga0207671_10042353 3300025914 Bacteria 3370
364 Ga0207671_10347525 3300025914 Bacteria 1176
365 Ga0207693_10027515 3300025915 Bacteria 4495
366 Ga0207693_10180346 3300025915 Bacteria 1662
367 Ga0207693_10210845 3300025915 Bacteria 1527
368 Ga0207693_10284603 3300025915 Bacteria 1295
369 Ga0207693_10653159 3300025915 Bacteria 817
370 Ga0207663_10016764 3300025916 Bacteria 4070
371 Ga0207663_10060759 3300025916 Bacteria 2396
372 Ga0207663_10066265 3300025916 Bacteria 2311
373 Ga0207663_10204796 3300025916 Bacteria 1426
374 Ga0207663_10433102 3300025916 Bacteria 1011
375 Ga0207663_10587971 3300025916 Bacteria 874
376 Ga0207663_10887062 3300025916 Bacteria 713
377 Ga0207663_11355244 3300025916 Unclassified 573
378 Ga0207660_10025258 3300025917 Bacteria 4031
379 Ga0207660_10031041 3300025917 Bacteria 3676
380 Ga0207660_10038443 3300025917 Bacteria 3341
381 Ga0207660_10243304 3300025917 Bacteria 1418
382 Ga0207660_10254838 3300025917 Bacteria 1386
383 Ga0207660_10584368 3300025917 Bacteria 909
384 Ga0207662_10008126 3300025918 Bacteria 5735
385 Ga0207662_10010377 3300025918 Bacteria 5142
386 Ga0207662_10104243 3300025918 Bacteria 1761
387 Ga0207662_10136862 3300025918 Bacteria 1548
388 Ga0207657_10013699 3300025919 Bacteria 7942
389 Ga0207657_10024313 3300025919 Bacteria 5615
390 Ga0207657_10037506 3300025919 Bacteria 4326
391 Ga0207657_10038255 3300025919 Bacteria 4274
392 Ga0207657_10233000 3300025919 Bacteria 1472
393 Ga0207657_10350272 3300025919 Bacteria 1165
394 Ga0207649_10260613 3300025920 Bacteria 1253
395 Ga0207649_10755619 3300025920 Unclassified 757
396 Ga0207652_10021283 3300025921 Bacteria 5352
397 Ga0207652_10021687 3300025921 Bacteria 5303
398 Ga0207652_10088833 3300025921 Bacteria 2712
399 Ga0207652_10335404 3300025921 Bacteria 1365
400 Ga0207652_10869977 3300025921 Bacteria 797
401 Ga0207646_10416498 3300025922 Bacteria 1213
402 Ga0207681_10067102 3300025923 Bacteria 2486
403 Ga0207694_10598258 3300025924 Bacteria 927
404 Ga0207650_10032643 3300025925 Bacteria 3766
405 Ga0207650_10089960 3300025925 Bacteria 2344
406 Ga0207650_10228704 3300025925 Bacteria 1499
407 Ga0207659_10055540 3300025926 Bacteria 2833
408 Ga0207687_10159028 3300025927 Bacteria 1732
409 Ga0207700_10002272 3300025928 Bacteria 11029
410 Ga0207700_10246304 3300025928 Bacteria 1525
411 Ga0207700_10298168 3300025928 Bacteria 1391
412 Ga0207664_10083642 3300025929 Bacteria 2602
413 Ga0207664_10085037 3300025929 Bacteria 2581
414 Ga0207664_10092615 3300025929 Bacteria 2481
415 Ga0207664_10345365 3300025929 Bacteria 1316
416 Ga0207644_10014800 3300025931 Bacteria 5229
417 Ga0207644_10561439 3300025931 Bacteria 945
418 Ga0207690_10198092 3300025932 Bacteria 1523
419 Ga0207690_11186755 3300025932 Bacteria 637
420 Ga0207706_10012224 3300025933 Bacteria 7823
421 Ga0207706_10040156 3300025933 Bacteria 4147
422 Ga0207706_10355946 3300025933 Bacteria 1272
423 Ga0207706_10914411 3300025933 Bacteria 740
424 Ga0207686_10032361 3300025934 Bacteria 3112
425 Ga0207686_10242797 3300025934 Bacteria 1312
426 Ga0207709_10160658 3300025935 Bacteria 1567
427 Ga0207709_10262764 3300025935 Bacteria 1266
428 Ga0207709_10922031 3300025935 Bacteria 711
429 Ga0207670_10219884 3300025936 Bacteria 1453
430 Ga0207670_11001045 3300025936 Bacteria 703
431 Ga0207669_10188652 3300025937 Bacteria 1485
432 Ga0207669_10255890 3300025937 Bacteria 1306
433 Ga0207669_10426675 3300025937 Bacteria 1045
434 Ga0207704_10055382 3300025938 Bacteria 2423
435 Ga0207704_10363737 3300025938 Bacteria 1130
436 Ga0207665_10001471 3300025939 Bacteria 15845
437 Ga0207665_10084415 3300025939 Bacteria 2191
438 Ga0207691_10168625 3300025940 Bacteria 1918
439 Ga0207691_10204014 3300025940 Bacteria 1720
440 Ga0207691_10279728 3300025940 Bacteria 1436
441 Ga0207711_10053237 3300025941 Bacteria 3471
442 Ga0207711_10076219 3300025941 Bacteria 2920
443 Ga0207711_10941853 3300025941 Bacteria 802
444 Ga0207689_10199835 3300025942 Bacteria 1650
445 Ga0207689_10290770 3300025942 Bacteria 1353
446 Ga0207661_10152218 3300025944 Bacteria 2000
447 Ga0207661_10244868 3300025944 Bacteria 1592
448 Ga0207679_10345753 3300025945 Bacteria 1295
449 Ga0207679_10659465 3300025945 Unclassified 947
450 Ga0207679_10762004 3300025945 Bacteria 881
451 Ga0207667_10130869 3300025949 Bacteria 2584
452 Ga0207667_10539762 3300025949 Bacteria 1180
453 Ga0207667_10551166 3300025949 Bacteria 1166
454 Ga0207667_11088897 3300025949 Bacteria 783
455 Ga0207667_11896952 3300025949 Bacteria 558
456 Ga0207651_10019390 3300025960 Bacteria 4075
457 Ga0207651_10914355 3300025960 Bacteria 782
458 Ga0207712_10809637 3300025961 Bacteria 824
459 Ga0207668_10407432 3300025972 Bacteria 1151
460 Ga0207640_10549423 3300025981 Bacteria 970
461 Ga0207640_11746005 3300025981 Bacteria 562
462 Ga0207658_10151064 3300025986 Bacteria 1892
463 Ga0207658_10182302 3300025986 Bacteria 1739
464 Ga0207658_10322345 3300025986 Bacteria 1338
465 Ga0207658_10846736 3300025986 Unclassified 831
466 Ga0207703_10177361 3300026035 Bacteria 1878
467 Ga0207703_10697962 3300026035 Bacteria 965
468 Ga0207639_10426935 3300026041 Bacteria 1199
469 Ga0207639_10702978 3300026041 Bacteria 938
470 Ga0207639_11333068 3300026041 Bacteria 673
471 Ga0207678_10013090 3300026067 Bacteria 7278
472 Ga0207678_10037906 3300026067 Bacteria 4191
473 Ga0207708_10005734 3300026075 Bacteria 9178
474 Ga0207708_10655696 3300026075 Bacteria 894
475 Ga0207702_10161179 3300026078 Bacteria 2048
476 Ga0207702_10446922 3300026078 Bacteria 1254
477 Ga0207702_11127662 3300026078 Unclassified 778
478 Ga0207702_11131617 3300026078 Bacteria 777
479 Ga0207648_10013903 3300026089 Bacteria 7465
480 Ga0207648_10078303 3300026089 Bacteria 2883
481 Ga0207676_10221629 3300026095 Bacteria 1685
482 Ga0207676_10292169 3300026095 Bacteria 1484
483 Ga0207676_10330084 3300026095 Bacteria 1403
484 Ga0207674_10115242 3300026116 Bacteria 2659
485 Ga0207675_100026434 3300026118 Bacteria 5403
486 Ga0207675_100044811 3300026118 Bacteria 4133
487 Ga0207675_100649183 3300026118 Bacteria 1061
488 Ga0207683_10000637 3300026121 Bacteria 32050
489 Ga0207683_10003484 3300026121 Bacteria 13733
490 Ga0207683_10221944 3300026121 Bacteria 1722
491 Ga0207683_10701901 3300026121 Bacteria 938
492 Ga0207698_10099642 3300026142 Bacteria 2404
493 Ga0207698_10141023 3300026142 Bacteria 2077
494 Ga0207698_10954587 3300026142 Bacteria 867
495 Ga0207698_11144337 3300026142 Bacteria 792
496 Ga0209969_1029322 3300027360 Bacteria 838
497 Ga0209982_1063422 3300027552 Bacteria 602
498 Ga0210002_1018275 3300027617 Bacteria 1120
499 Ga0209966_1002882 3300027695 Bacteria 2884
500 Ga0209998_10001644 3300027717 Bacteria 5349
501 Ga0209998_10002534 3300027717 Bacteria 4160
502 Ga0209813_10184459 3300027866 Bacteria 765
503 Ga0209974_10011146 3300027876 Bacteria 3024
504 Ga0209974_10032112 3300027876 Bacteria 1740
505 Ga0207428_10000216 3300027907 Bacteria 79777
506 Ga0207428_10003413 3300027907 Bacteria 15431
507 Ga0207428_10441756 3300027907 Bacteria 949
508 Ga0268266_10073574 3300028379 Bacteria 2965
509 Ga0268264_10021057 3300028381 Bacteria 5329
510 Ga0268264_10035058 3300028381 Bacteria 4131
511 Ga0268264_10266637 3300028381 Bacteria 1598
512 Ga0265337_1006048 3300028556 Bacteria 4719
513 Ga0265338_10019445 3300028800 Bacteria 7205
514 Ga0265338_10370517 3300028800 Bacteria 1026
515 Ga0265324_10057089 3300029957 Bacteria 1337
516 Ga0265330_10009349 3300031235 Bacteria 4660
517 Ga0265332_10193662 3300031238 Bacteria 846
518 Ga0265325_10000048 3300031241 Bacteria 82899
519 Ga0265325_10002795 3300031241 Bacteria 11656
520 Ga0265340_10294916 3300031247 Bacteria 719
521 Ga0265339_10092760 3300031249 Bacteria 1580
522 Ga0265339_10253327 3300031249 Bacteria 851
523 Ga0265339_10422707 3300031249 Bacteria 621
524 Ga0265316_10304513 3300031344 Bacteria 1160
525 Ga0307408_101593076 3300031548 Bacteria 620
526 Ga0265313_10001040 3300031595 Bacteria 26998
527 Ga0265313_10062629 3300031595 Bacteria 1737
528 Ga0265313_10072518 3300031595 Bacteria 1582
529 Ga0265313_10104320 3300031595 Bacteria 1254
530 Ga0265314_10012970 3300031711 Bacteria 6767
531 Ga0265314_10013779 3300031711 Bacteria 6514
532 Ga0265314_10107338 3300031711 Bacteria 1782
533 Ga0265342_10001167 3300031712 Bacteria 25007
534 Ga0265342_10038412 3300031712 Bacteria 2916
535 Ga0307416_101348522 3300032002 Bacteria 819
536 Ga0307416_101488664 3300032002 Bacteria 783
537 Ga0373930_0000195 3300034816 Bacteria 7365
538 Ga0373948_0000184 3300034817 Bacteria 7132
539 Ga0373948_0002050 3300034817 Bacteria 2916
540 Ga0373948_0080489 3300034817 Bacteria 742
541 Ga0373958_0000536 3300034819 Bacteria 4730
542 Ga0373958_0017470 3300034819 Bacteria 1290
543 Ga0373958_0112284 3300034819 Bacteria 650
544 Ga0373938_0000244 3300034957 Bacteria 8511
545 Ga0373938_0003184 3300034957 Bacteria 2667
546 Ga0373926_0238562 3300035083 Bacteria 703
547 Ga0373928_0000913 3300035084 Bacteria 5780
548 Ga0373928_0015463 3300035084 Bacteria 1554
549 Ga0373928_0030076 3300035084 Bacteria 1198
550 Ga0373929_0000485 3300035085 Bacteria 7622
551 Ga0373934_0056483 3300035086 Bacteria 1561
552 Ga0373940_0003410 3300035088 Bacteria 3242
553 Ga0373944_0003351 3300035089 Bacteria 4129
554 Ga0373944_0129726 3300035089 Bacteria 875
555 Ga0373949_0001916 3300035090 Bacteria 5616
556 Ga0373951_0000488 3300035091 Bacteria 11307
557 Ga0373951_0006475 3300035091 Bacteria 2679
558 Ga0373951_0009239 3300035091 Bacteria 2221
559 Ga0373951_0013143 3300035091 Bacteria 1861
560 Ga0373952_0013828 3300035092 Bacteria 1607
561 Ga0373952_0014806 3300035092 Bacteria 1566
562 Ga0373923_0006436 3300035111 Bacteria 4061
563 Ga0373923_0037821 3300035111 Bacteria 1975
564 Ga0373923_0053042 3300035111 Bacteria 1705
565 Ga0373923_0152950 3300035111 Bacteria 1049
566 Ga0373923_0277459 3300035111 Unclassified 789
567 Ga0373932_0000474 3300035112 Bacteria 12323
568 Ga0373932_0010986 3300035112 Bacteria 2203
569 Ga0373936_0001095 3300035113 Bacteria 9709
570 Ga0373936_0423109 3300035113 Bacteria 613
571 Ga0373939_0003026 3300035114 Bacteria 3947
572 Ga0373939_0009971 3300035114 Bacteria 2364
573 Ga0373939_0036871 3300035114 Bacteria 1449
574 Ga0373941_0000598 3300035115 Bacteria 7310
575 Ga0373941_0001282 3300035115 Bacteria 5289
576 Ga0373941_0031575 3300035115 Bacteria 1579
577 Ga0373945_0004964 3300035116 Bacteria 4239
578 Ga0373945_0064074 3300035116 Bacteria 1377
579 Ga0373953_0045167 3300035117 Bacteria 1764
580 Ga0373953_0329677 3300035117 Unclassified 668
581 Ga0373954_0001049 3300035118 Bacteria 10992
582 Ga0373954_0007478 3300035118 Bacteria 4781
583 Ga0373954_0022383 3300035118 Bacteria 2866
584 Ga0373954_0145592 3300035118 Bacteria 1156
585 Ga0373956_0012907 3300035119 Bacteria 3470
586 Ga0373956_0027704 3300035119 Bacteria 2462
587 Ga0373956_0225722 3300035119 Bacteria 889
588 Ga0373957_0048717 3300035120 Bacteria 1615
589 Ga0373957_0105672 3300035120 Bacteria 1130
590 Ga0373957_0184433 3300035120 Bacteria 866
591 Ga0373960_0002102 3300035121 Bacteria 4484
592 Ga0373960_0010943 3300035121 Bacteria 2224
593 Ga0373960_0140885 3300035121 Bacteria 816
594 Ga0373943_0007130 3300035170 Bacteria 5015
595 Ga0373943_0308913 3300035170 Bacteria 899
596 Ga0373943_0430409 3300035170 Unclassified 764
597 Ga0373946_0162920 3300035171 Bacteria 1048
598 Ga0373946_0202778 3300035171 Bacteria 951
599 Ga0373955_0002451 3300035172 Bacteria 8100
600 Ga0373955_0004483 3300035172 Bacteria 6182
601 Ga0373955_0028546 3300035172 Bacteria 2893
602 Ga0373955_0038348 3300035172 Bacteria 2552
603 Ga0373955_0374197 3300035172 Unclassified 864
604 Ga0373942_0012221 3300035207 Bacteria 2047
605 Ga0373961_0010502 3300035241 Bacteria 2282
606 Ga0373961_0044103 3300035241 Bacteria 1299
607 Ga0373962_0001456 3300035242 Bacteria 5597
608 Ga0373924_0012343 3300035410 Bacteria 3190
609 Ga0373924_0053727 3300035410 Bacteria 1674
610 Ga0373931_0006069 3300035691 Bacteria 5628
611 Ga0373931_0058742 3300035691 Bacteria 2067
612 Ga0373931_0078670 3300035691 Bacteria 1815
613 Ga0373931_0202490 3300035691 Bacteria 1186
614 Ga0373935_0047238 3300035692 Bacteria 2721
615 Ga0373935_0154529 3300035692 Bacteria 1559
616 Ga0373935_0217937 3300035692 Bacteria 1325
617 Ga0373927_0004039 3300035695 Bacteria 10376
618 Ga0373927_0236385 3300035695 Bacteria 1200
619 Ga0373933_0004781 3300035724 Bacteria 7402
620 Ga0373933_0006526 3300035724 Bacteria 6354
621 Ga0373933_0012091 3300035724 Bacteria 4766
622 Ga0373933_0072025 3300035724 Bacteria 2104
623 Ga0373947_0006399 3300035725 Bacteria 6844
624 Ga0373947_0073431 3300035725 Bacteria 2102
625 Ga0373947_0322930 3300035725 Bacteria 1032
626 Ga0373937_0001398 3300036401 Bacteria 20148
627 Ga0373937_0005069 3300036401 Bacteria 11213
628 Ga0373937_0020720 3300036401 Bacteria 5897
629 Ga0373937_0040141 3300036401 Bacteria 4266
630 Ga0373925_0011839 3300037068 Bacteria 6312
631 Ga0373925_0014118 3300037068 Bacteria 5781
632 Ga0373925_0076162 3300037068 Bacteria 2543
633 Ga0373925_0101464 3300037068 Bacteria 2212
634 Ga0373925_1293294 3300037068 Bacteria 598
635 Ga0436365_0078382 3300039437 Bacteria 11270
636 Ga0436365_0274005 3300039437 Bacteria 1927
637 Ga0436365_1041486 3300039437 Bacteria 4052
638 Ga0436360_0486235 3300039438 Bacteria 544
639 Ga0436361_0180502 3300039447 Bacteria 897
640 Ga0436361_0891923 3300039447 Bacteria 586
641 Ga0436363_0783221 3300039450 Bacteria 3216
642 Ga0436362_0716023 3300039453 Bacteria 892
643 Ga0439448_0011374 3300042005 Bacteria 2653
644 Ga0439448_0086178 3300042005 Bacteria 1058
645 Ga0439455_0025023 3300042012 Unclassified 1448
646 Ga0439463_027721 3300042016 Bacteria 1427
647 Ga0439463_075937 3300042016 Unclassified 862
648 Ga0439444_0155412 3300042437 Bacteria 555
649 Ga0439464_0043449 3300042439 Bacteria 1285
650 Ga0451577_0379689 3300042876 Bacteria 1282
651 Ga0453683_0663487 3300044673 Unclassified 682
652 Ga0466963_0886681 3300044694 Bacteria 629
653 Ga0466957_0272386 3300044842 Bacteria 1131
654 Ga0451576_0013929 3300045051 Bacteria 8979
655 Ga0466967_2175979 3300045976 Bacteria 551
656 Ga0495617_171132 3300046452 Bacteria 686
657 Ga0495592_0013463 3300046454 Bacteria 6223
658 Ga0495592_0033058 3300046454 Bacteria 3902
659 Ga0495592_0113605 3300046454 Bacteria 1913
660 Ga0495592_0190898 3300046454 Bacteria 1389
661 Ga0495592_0453515 3300046454 Unclassified 803
662 Ga0495603_0005357 3300046455 Bacteria 7649
663 Ga0495603_0050431 3300046455 Bacteria 2475
664 Ga0495603_0232151 3300046455 Bacteria 1063
665 Ga0495629_0059841 3300046459 Bacteria 2662
666 Ga0495629_0119732 3300046459 Bacteria 1834
667 Ga0495641_0091367 3300046461 Bacteria 1360
668 Ga0495641_0091740 3300046461 Bacteria 1357
669 Ga0495651_0003153 3300046462 Bacteria 12701
670 Ga0495651_0012826 3300046462 Bacteria 6472
671 Ga0495653_0001202 3300046463 Bacteria 20094
672 Ga0495653_0009980 3300046463 Bacteria 7766
673 Ga0495580_0004568 3300046472 Bacteria 11617
674 Ga0495580_0227886 3300046472 Bacteria 1280
675 Ga0495580_0327189 3300046472 Unclassified 1041
676 Ga0495582_0065925 3300046473 Bacteria 2001
677 Ga0495639_0002223 3300046475 Bacteria 8536
678 Ga0495662_0002421 3300046476 Bacteria 9371
679 Ga0495662_0021180 3300046476 Bacteria 3144
680 Ga0495664_0008194 3300046477 Bacteria 5818
681 Ga0495664_0009168 3300046477 Bacteria 5531
682 Ga0495664_0016181 3300046477 Bacteria 4247
683 Ga0495584_0013126 3300046491 Bacteria 4226
684 Ga0495584_0119623 3300046491 Bacteria 1334
685 Ga0495584_0136805 3300046491 Bacteria 1244
686 Ga0495585_0000995 3300046492 Bacteria 23693
687 Ga0495594_0003519 3300046499 Bacteria 8068
688 Ga0495594_0046647 3300046499 Bacteria 2380
689 Ga0495607_0013487 3300046501 Bacteria 5354
690 Ga0495608_0000363 3300046511 Bacteria 31688
691 Ga0495608_0095348 3300046511 Bacteria 1922
692 Ga0495608_0919995 3300046511 Bacteria 511
693 Ga0495618_0001897 3300046514 Bacteria 13753
694 Ga0495618_0009777 3300046514 Bacteria 5796
695 Ga0495628_0001606 3300046516 Bacteria 20730
696 Ga0495628_0012443 3300046516 Bacteria 7177
697 Ga0495628_0305453 3300046516 Bacteria 1177
698 Ga0495628_0661419 3300046516 Bacteria 741
699 Ga0495630_0131028 3300046517 Bacteria 1904
700 Ga0495630_0768066 3300046517 Bacteria 736
701 Ga0495644_0002021 3300046523 Bacteria 8158
702 Ga0495663_0026199 3300046525 Bacteria 1706
703 Ga0495666_0164251 3300046526 Bacteria 1029
704 Ga0495652_0002586 3300046529 Bacteria 18522
705 Ga0495652_0052019 3300046529 Bacteria 3494
706 Ga0495652_0328679 3300046529 Bacteria 1102
707 Ga0495652_0362400 3300046529 Bacteria 1036
708 Ga0495652_1006363 3300046529 Bacteria 545
709 Ga0495640_0009382 3300046533 Bacteria 7620
710 Ga0495640_0023798 3300046533 Bacteria 4456
711 Ga0495640_0091974 3300046533 Bacteria 2001
712 Ga0495640_0100025 3300046533 Bacteria 1904
713 Ga0495640_0950387 3300046533 Bacteria 508
714 Ga0495586_0167057 3300046535 Bacteria 1242
715 Ga0495587_0003533 3300046536 Bacteria 10409
716 Ga0495587_0008605 3300046536 Bacteria 6560
717 Ga0495587_0206520 3300046536 Bacteria 1110
718 Ga0495587_0251534 3300046536 Bacteria 993
719 Ga0495609_0080934 3300046538 Bacteria 1420
720 Ga0495609_0205501 3300046538 Bacteria 822
721 Ga0495645_0032742 3300046543 Bacteria 3792
722 Ga0495645_0451690 3300046543 Bacteria 810
723 Ga0495645_0743485 3300046543 Bacteria 592
724 Ga0495622_0020475 3300046557 Bacteria 3079
725 Ga0495622_0043097 3300046557 Bacteria 2098
726 Ga0495622_0227494 3300046557 Unclassified 825
727 Ga0495633_0009135 3300046558 Bacteria 5502
728 Ga0495667_0001863 3300046559 Bacteria 13986
729 Ga0495667_0002910 3300046559 Bacteria 11494
730 Ga0495667_0012561 3300046559 Bacteria 5743
731 Ga0495667_0019111 3300046559 Bacteria 4625
732 Ga0495667_0069747 3300046559 Bacteria 2294
733 Ga0495667_0165497 3300046559 Bacteria 1421
734 Ga0495656_0011054 3300046615 Bacteria 3303
735 Ga0495634_0023444 3300046642 Bacteria 4338
736 Ga0495634_0114050 3300046642 Bacteria 1735
737 Ga0495634_0257703 3300046642 Bacteria 1065
738 Ga0495634_0415384 3300046642 Bacteria 797
739 Ga0495611_0550340 3300046648 Bacteria 523
740 Ga0495635_0000730 3300046663 Bacteria 21233
741 Ga0495635_0030540 3300046663 Bacteria 3744
742 Ga0495635_0041243 3300046663 Bacteria 3189
743 Ga0495635_0088565 3300046663 Bacteria 2118
744 Ga0495635_0135391 3300046663 Bacteria 1679
745 Ga0495659_0002692 3300046664 Bacteria 5717
746 Ga0495588_0001656 3300046674 Bacteria 9523
747 Ga0495657_0044286 3300046675 Bacteria 3028
748 Ga0495657_0045003 3300046675 Bacteria 2997
749 Ga0495657_0052229 3300046675 Bacteria 2741
750 Ga0495599_0003607 3300046678 Bacteria 9079
751 Ga0495599_0033518 3300046678 Bacteria 3227
752 Ga0495599_0498860 3300046678 Bacteria 717
753 Ga0495623_0002343 3300046679 Bacteria 12621
754 Ga0495623_0435271 3300046679 Bacteria 700
755 Ga0495623_0558491 3300046679 Unclassified 598
756 Ga0495646_0042319 3300046680 Bacteria 2795
757 Ga0495646_0053119 3300046680 Bacteria 2444
758 Ga0495647_0000967 3300046681 Bacteria 8697
759 Ga0495647_0033610 3300046681 Bacteria 1917
760 Ga0495647_0349899 3300046681 Bacteria 672
761 Ga0495658_0002102 3300046683 Bacteria 10107
762 Ga0495658_0174362 3300046683 Bacteria 1332
763 Ga0495613_0012394 3300046689 Bacteria 6335
764 Ga0495613_0082103 3300046689 Bacteria 2341
765 Ga0495613_0242328 3300046689 Bacteria 1260
766 Ga0495613_0267584 3300046689 Bacteria 1189
767 Ga0495624_0067799 3300046690 Bacteria 2225
768 Ga0495624_0070412 3300046690 Bacteria 2177
769 Ga0495624_0250181 3300046690 Unclassified 1072
770 Ga0495600_0000703 3300046809 Bacteria 17538
771 Ga0495600_0061545 3300046809 Bacteria 2452
772 Ga0495600_0082623 3300046809 Bacteria 2096
773 Ga0495600_0170384 3300046809 Bacteria 1405
774 Ga0495600_0387519 3300046809 Unclassified 871
775 Ga0495600_0608940 3300046809 Bacteria 663
776 Ga0495581_0059282 3300047315 Bacteria 2212
777 Ga0495581_0077256 3300047315 Bacteria 1926
778 Ga0495581_0438989 3300047315 Unclassified 761
779 Ga0495604_0001606 3300047317 Bacteria 18631
780 Ga0495604_0017676 3300047317 Bacteria 5707
781 Ga0495604_0033728 3300047317 Bacteria 4052
782 Ga0495604_0072048 3300047317 Bacteria 2612
783 Ga0495674_0008713 3300047319 Bacteria 9648
784 Ga0495674_0008815 3300047319 Bacteria 9592
785 Ga0495674_0085519 3300047319 Bacteria 2701
786 Ga0495674_0101934 3300047319 Bacteria 2441
787 Ga0495674_0387766 3300047319 Bacteria 1129
788 Ga0495676_0234102 3300047321 Bacteria 1260
789 Ga0495676_0316850 3300047321 Bacteria 1048
790 Ga0495676_0460952 3300047321 Bacteria 838
791 Ga0495680_0003233 3300047322 Bacteria 16170
792 Ga0495680_0012545 3300047322 Bacteria 7451
793 Ga0495680_0023301 3300047322 Bacteria 5149
794 Ga0495680_0136433 3300047322 Bacteria 1798
795 Ga0495680_0204334 3300047322 Bacteria 1416
796 Ga0495680_0492068 3300047322 Unclassified 834
797 Ga0495675_0002258 3300047444 Bacteria 11506
798 Ga0495675_0020910 3300047444 Bacteria 4165
799 Ga0495675_0136683 3300047444 Bacteria 1521
800 Ga0495675_0356515 3300047444 Bacteria 859
801 Ga0495677_0029496 3300047445 Bacteria 1995
802 Ga0495677_0130107 3300047445 Bacteria 963
803 Ga0495684_0000749 3300047471 Bacteria 26152
804 Ga0495684_0147471 3300047471 Bacteria 1761
805 Ga0495684_0343079 3300047471 Bacteria 1062
806 Ga0495684_0535854 3300047471 Bacteria 799
807 Ga0495684_0597452 3300047471 Bacteria 745
808 Ga0495593_0028750 3300047673 Bacteria 3052
809 Ga0495593_0236985 3300047673 Bacteria 914
810 Ga0495602_0006328 3300048088 Bacteria 12420
811 Ga0495602_0018809 3300048088 Bacteria 6881
812 Ga0495602_0050105 3300048088 Bacteria 3735
813 Ga0495602_0308040 3300048088 Bacteria 1157
814 Ga0495614_0175714 3300048089 Unclassified 962
815 Ga0496100_0032026 3300048903 Bacteria 3273
816 Ga0496100_0190751 3300048903 Bacteria 1488
817 Ga0496100_0599216 3300048903 Bacteria 855
818 Ga0496101_0024419 3300048904 Bacteria 4183
819 Ga0496101_0033791 3300048904 Bacteria 3609
820 Ga0496101_0054158 3300048904 Bacteria 2896
821 Ga0496101_0107992 3300048904 Bacteria 2092
822 Ga0496101_0251885 3300048904 Bacteria 1376
823 Ga0496101_0621902 3300048904 Bacteria 854
824 Ga0496101_0623432 3300048904 Bacteria 852
825 Ga0496102_0017443 3300048905 Bacteria 6289
826 Ga0496102_0052687 3300048905 Bacteria 3708
827 Ga0496102_0125349 3300048905 Bacteria 2400
828 Ga0496102_0142734 3300048905 Bacteria 2246
829 Ga0496102_0204308 3300048905 Bacteria 1862
830 Ga0496102_0210331 3300048905 Bacteria 1834
831 Ga0496102_0972969 3300048905 Bacteria 769
832 Ga0496102_1468756 3300048905 Bacteria 600
833 Ga0496103_0044329 3300048906 Bacteria 2740
834 Ga0496103_0098323 3300048906 Bacteria 1850
835 Ga0496103_0121012 3300048906 Bacteria 1667
836 Ga0496103_0316085 3300048906 Bacteria 1004
837 Ga0496104_0001904 3300048907 Bacteria 18078
838 Ga0496104_0013010 3300048907 Bacteria 7493
839 Ga0496104_0084737 3300048907 Bacteria 3024
840 Ga0496104_0159692 3300048907 Bacteria 2162
841 Ga0496104_0196151 3300048907 Bacteria 1931
842 Ga0496104_0209351 3300048907 Bacteria 1862
843 Ga0496104_0515962 3300048907 Bacteria 1106
844 Ga0496104_0549804 3300048907 Bacteria 1065
845 Ga0496105_0002041 3300048908 Bacteria 14603
846 Ga0496105_0021534 3300048908 Bacteria 5216
847 Ga0496106_0010397 3300048909 Bacteria 6876
848 Ga0496106_0011583 3300048909 Bacteria 6517
849 Ga0496106_0063855 3300048909 Bacteria 2799
850 Ga0496106_0188841 3300048909 Bacteria 1637
851 Ga0496106_0668654 3300048909 Bacteria 829
852 Ga0496107_0008549 3300048910 Bacteria 7084
853 Ga0496107_0028132 3300048910 Bacteria 3994
854 Ga0496107_0116088 3300048910 Bacteria 1970
855 Ga0496107_0139696 3300048910 Bacteria 1790
856 Ga0496107_0373942 3300048910 Bacteria 1060
857 Ga0496108_0013021 3300048911 Bacteria 6776
858 Ga0496108_0019320 3300048911 Bacteria 5595
859 Ga0496108_0033824 3300048911 Bacteria 4246
860 Ga0496108_0857521 3300048911 Bacteria 781
861 Ga0496109_0023038 3300048912 Bacteria 5522
862 Ga0496109_0029705 3300048912 Bacteria 4897
863 Ga0496109_0158598 3300048912 Bacteria 2119
864 Ga0496109_0163060 3300048912 Bacteria 2089
865 Ga0496109_0776515 3300048912 Bacteria 896
866 Ga0496110_0116236 3300048913 Bacteria 2408
867 Ga0496110_1051692 3300048913 Unclassified 722
868 Ga0496110_1358607 3300048913 Bacteria 620
869 Ga0496111_0009938 3300048914 Bacteria 6362
870 Ga0496111_0030686 3300048914 Bacteria 3823
871 Ga0496111_0195562 3300048914 Bacteria 1503
872 Ga0496111_0226342 3300048914 Bacteria 1389
873 Ga0496111_0630867 3300048914 Bacteria 783
874 Ga0496112_0000520 3300048915 Bacteria 26242
875 Ga0496112_0525294 3300048915 Bacteria 1118
876 Ga0496112_1497682 3300048915 Bacteria 589
877 Ga0496113_0043070 3300048916 Bacteria 3338
878 Ga0496113_0325365 3300048916 Bacteria 1233
879 Ga0496113_1153236 3300048916 Bacteria 606
880 Ga0496114_0055845 3300048917 Bacteria 3294
881 Ga0496114_0088502 3300048917 Bacteria 2626
882 Ga0496114_0764433 3300048917 Bacteria 844
883 Ga0496115_0040684 3300048918 Bacteria 3696
884 Ga0496115_0096831 3300048918 Bacteria 2416
885 Ga0496115_0113903 3300048918 Bacteria 2222
886 Ga0496115_0114999 3300048918 Bacteria 2212
887 Ga0496115_0474907 3300048918 Bacteria 1007
888 Ga0496115_1051472 3300048918 Bacteria 620
889 Ga0496119_0320688 3300048922 Bacteria 759
890 Ga0501031_0123896 3300049568 Bacteria 1688
891 Ga0501032_0045575 3300049569 Bacteria 2965
892 Ga0501032_0059269 3300049569 Bacteria 2569
893 Ga0501032_0089571 3300049569 Bacteria 2042
894 Ga0501032_0288193 3300049569 Bacteria 1062
895 Ga0501033_0054944 3300049570 Bacteria 2944
896 Ga0501033_0076233 3300049570 Bacteria 2461
897 Ga0501034_0000211 3300049571 Bacteria 110858
898 Ga0501034_0003250 3300049571 Bacteria 18591
899 Ga0501034_0011273 3300049571 Bacteria 9278
900 Ga0501034_0114986 3300049571 Bacteria 2679
901 Ga0501034_0119188 3300049571 Bacteria 2625
902 Ga0501034_0214617 3300049571 Bacteria 1879
903 Ga0501034_0398319 3300049571 Bacteria 1300
904 Ga0501034_0467470 3300049571 Bacteria 1177
905 Ga0501034_1169737 3300049571 Bacteria 648
906 Ga0501034_1203019 3300049571 Bacteria 636
907 Ga0501036_0012016 3300049572 Bacteria 7177
908 Ga0501036_0050002 3300049572 Bacteria 3540
909 Ga0501036_0455716 3300049572 Bacteria 1065
910 Ga0501036_0620044 3300049572 Bacteria 896
911 Ga0501037_0002596 3300049573 Bacteria 13040
912 Ga0501037_0040990 3300049573 Bacteria 3406
913 Ga0501037_0057305 3300049573 Bacteria 2844
914 Ga0501037_0500297 3300049573 Bacteria 824
915 Ga0501037_0781313 3300049573 Bacteria 631
916 Ga0501038_0206825 3300049574 Bacteria 1572
917 Ga0501038_0582875 3300049574 Bacteria 848
918 Ga0501039_0020522 3300049575 Bacteria 5063
919 Ga0501039_0437018 3300049575 Bacteria 1028
920 Ga0501039_0726494 3300049575 Bacteria 776
921 Ga0501040_0662657 3300049576 Bacteria 754
922 Ga0501042_0180698 3300049578 Bacteria 1522
923 Ga0501043_0061902 3300049579 Bacteria 2938
924 Ga0501043_0229418 3300049579 Bacteria 1434
925 Ga0501043_0319393 3300049579 Bacteria 1184
926 Ga0501043_0369987 3300049579 Bacteria 1086
927 Ga0501043_0512022 3300049579 Bacteria 895
928 Ga0501046_0119499 3300049580 Bacteria 2006
929 Ga0501046_0121205 3300049580 Bacteria 1989
930 Ga0501046_0174145 3300049580 Bacteria 1613
931 Ga0501046_0270306 3300049580 Bacteria 1247
932 Ga0501046_0571493 3300049580 Bacteria 804
933 Ga0501047_0000010 3300049581 Bacteria 429357
934 Ga0501047_0076895 3300049581 Bacteria 3212
935 Ga0501047_0149451 3300049581 Bacteria 2212
936 Ga0501047_0184993 3300049581 Bacteria 1949
937 Ga0501047_0210335 3300049581 Bacteria 1804
938 Ga0501047_0325019 3300049581 Bacteria 1377
939 Ga0501047_0395446 3300049581 Bacteria 1215
940 Ga0501048_0000784 3300049582 Bacteria 23265
941 Ga0501048_0194801 3300049582 Bacteria 1436
942 Ga0501048_0329887 3300049582 Bacteria 1087
943 Ga0501067_0016880 3300049583 Bacteria 4033
944 Ga0501067_0044997 3300049583 Bacteria 2452
945 Ga0501068_0012136 3300049584 Bacteria 4873
946 Ga0501068_0027868 3300049584 Bacteria 3338
947 Ga0501068_0092452 3300049584 Bacteria 1867
948 Ga0501068_1044995 3300049584 Bacteria 539
949 Ga0501069_0021060 3300049585 Bacteria 3536
950 Ga0501069_0030179 3300049585 Bacteria 2976
951 Ga0501069_0183300 3300049585 Bacteria 1210
952 Ga0501069_0424322 3300049585 Bacteria 788
953 Ga0501070_0012798 3300049586 Bacteria 7072
954 Ga0501070_0036167 3300049586 Bacteria 4124
955 Ga0501070_0077077 3300049586 Bacteria 2759
956 Ga0501070_0080055 3300049586 Bacteria 2703
957 Ga0501070_0157256 3300049586 Bacteria 1874
958 Ga0501070_0174968 3300049586 Bacteria 1767
959 Ga0501070_0407204 3300049586 Bacteria 1099
960 Ga0501070_0425188 3300049586 Bacteria 1072
961 Ga0501070_0488897 3300049586 Bacteria 989
962 Ga0501071_0101832 3300049587 Bacteria 2117
963 Ga0501071_0616289 3300049587 Bacteria 834
964 Ga0501072_0023227 3300049588 Bacteria 4816
965 Ga0501072_0161503 3300049588 Bacteria 1787
966 Ga0501072_0256878 3300049588 Bacteria 1391
967 Ga0501072_0541175 3300049588 Bacteria 920
968 Ga0501073_0011704 3300049589 Bacteria 6405
969 Ga0501073_0026355 3300049589 Bacteria 4166
970 Ga0501073_0063098 3300049589 Bacteria 2584
971 Ga0501073_0200807 3300049589 Bacteria 1379
972 Ga0501073_0590934 3300049589 Bacteria 767
973 Ga0501073_0880959 3300049589 Bacteria 616
974 Ga0501074_0015467 3300049590 Bacteria 5546
975 Ga0501074_0026995 3300049590 Bacteria 4160
976 Ga0501074_0188316 3300049590 Bacteria 1471
977 Ga0501074_0210681 3300049590 Bacteria 1384
978 Ga0501074_1043945 3300049590 Bacteria 574
979 Ga0501075_0151608 3300049591 Bacteria 1767
980 Ga0501076_0210029 3300049592 Bacteria 1590
981 Ga0501076_1351611 3300049592 Bacteria 586
982 Ga0501077_0023345 3300049593 Bacteria 3922
983 Ga0501077_0259530 3300049593 Bacteria 1105
984 Ga0501079_0001490 3300049741 Bacteria 16573
985 Ga0501079_0705058 3300049741 Bacteria 794
986 Ga0501080_0090573 3300049742 Bacteria 2841
987 Ga0501080_0124247 3300049742 Bacteria 2390
988 Ga0501080_0125376 3300049742 Bacteria 2378
989 Ga0501080_0151953 3300049742 Bacteria 2140
990 Ga0501080_0376510 3300049742 Bacteria 1279
991 Ga0501080_0795918 3300049742 Bacteria 829
992 Ga0501081_0338156 3300049743 Bacteria 1108
993 Ga0501083_0009626 3300049744 Bacteria 6827
994 Ga0501083_0129901 3300049744 Bacteria 1651
995 Ga0501083_0374712 3300049744 Bacteria 926
996 Ga0501035_0002108 3300049822 Bacteria 19783
997 Ga0501035_0025158 3300049822 Bacteria 5457
998 Ga0501035_0257687 3300049822 Bacteria 1479
999 Ga0501035_0398980 3300049822 Bacteria 1144
1000 Ga0501035_0584438 3300049822 Bacteria 912
1001 Ga0501035_0904897 3300049822 Bacteria 699
1002 Ga0501044_0086065 3300049823 Bacteria 3175
1003 Ga0501044_0422395 3300049823 Bacteria 1243
1004 Ga0501044_0689648 3300049823 Bacteria 907
1005 Ga0501045_0549322 3300049824 Bacteria 857
1006 Ga0501045_0600342 3300049824 Bacteria 815
1007 nmdc:mga03n38_471280_c1 3300050490 Bacteria 701
1008 nmdc:mga06z11_11064_c1 3300050494 Bacteria 3874
1009 nmdc:mga06z11_622479_c1 3300050494 Bacteria 657
1010 nmdc:mga05p37_3652_c1 3300050507 Bacteria 17997
1011 nmdc:mga05p37_5580_c1 3300050507 Bacteria 14793
1012 nmdc:mga09592_1558720_c1 3300050508 Bacteria 536
1013 nmdc:mga09592_714_c1 3300050508 Bacteria 25508
1014 nmdc:mga0qj67_1449_c1 3300050509 Bacteria 16619
1015 nmdc:mga06r32_1863_c1 3300050510 Bacteria 18774
1016 nmdc:mga08y16_1194501_c1 3300050511 Bacteria 732
1017 nmdc:mga08y16_1350709_c1 3300050511 Bacteria 678
1018 nmdc:mga08y16_3547_c1 3300050511 Bacteria 16202
1019 nmdc:mga08y16_3652_c1 3300050511 Bacteria 16005
1020 nmdc:mga0n895_20971_c1 3300050512 Bacteria 6104
1021 nmdc:mga0n895_4615_c1 3300050512 Bacteria 11357
1022 nmdc:mga0n895_54609_c1 3300050512 Bacteria 3930
1023 nmdc:mga0n895_63874_c1 3300050512 Bacteria 3641
1024 nmdc:mga0rr50_1014913_c1 3300050513 Unclassified 707
1025 nmdc:mga0rr50_117189_c1 3300050513 Bacteria 2115
1026 nmdc:mga0rr50_253059_c1 3300050513 Bacteria 1463
1027 nmdc:mga0rr50_33356_c1 3300050513 Bacteria 3677
1028 nmdc:mga0rr50_510044_c1 3300050513 Bacteria 1023
1029 nmdc:mga08x19_104028_c1 3300050514 Bacteria 1886
1030 nmdc:mga08x19_938391_c1 3300050514 Unclassified 615
1031 nmdc:mga0a205_17847_c1 3300050515 Bacteria 6659
1032 nmdc:mga0a205_2116_c1 3300050515 Bacteria 17419
1033 Ga0495601_0003041 3300053077 Bacteria 9559
1034 Ga0495601_0016804 3300053077 Bacteria 4438
1035 Ga0495601_0018616 3300053077 Bacteria 4227
1036 Ga0495601_0029013 3300053077 Bacteria 3429
1037 Ga0495601_0032983 3300053077 Bacteria 3225
1038 Ga0495601_0146683 3300053077 Bacteria 1540
1039 Ga0495612_0006375 3300053078 Bacteria 4857
1040 Ga0495612_0016428 3300053078 Bacteria 2966
1041 Ga0495612_0018815 3300053078 Bacteria 2765
1042 Ga0495612_0041646 3300053078 Bacteria 1873
1043 Ga0495612_0119603 3300053078 Bacteria 1132
1044 Ga0495612_0234324 3300053078 Bacteria 814
1045 Ga0495612_0408857 3300053078 Bacteria 617
1046 Ga0495595_0000337 3300053084 Bacteria 18087
1047 Ga0495595_0000525 3300053084 Bacteria 14621
1048 Ga0495595_0016453 3300053084 Bacteria 3164
1049 Ga0495595_0072786 3300053084 Bacteria 1627
1050 Ga0495595_0091400 3300053084 Bacteria 1460
1051 Ga0495595_0180254 3300053084 Unclassified 1047
1052 Ga0495595_0207116 3300053084 Bacteria 977
1053 Ga0495619_0000043 3300053085 Bacteria 109865
1054 Ga0495619_0000333 3300053085 Bacteria 33042
1055 Ga0495619_0000405 3300053085 Bacteria 29348
1056 Ga0495619_0006520 3300053085 Bacteria 7387
1057 Ga0495619_0006915 3300053085 Bacteria 7172
1058 Ga0495619_0009776 3300053085 Bacteria 6048
1059 Ga0495619_0012577 3300053085 Bacteria 5328
1060 Ga0495619_0016850 3300053085 Bacteria 4627
1061 Ga0500651_0045526 3300053093 Bacteria 2760
1062 Ga0500641_0001180 3300053096 Bacteria 9311
1063 Ga0500655_018226 3300053133 Unclassified 1303
1064 Ga0501084_0223084 3300054114 Bacteria 1590
1065 Ga0501082_0059799 3300060353 Bacteria 3283
1066 Ga0501082_0459592 3300060353 Bacteria 1112
1067 Ga0501082_0476869 3300060353 Bacteria 1090
1068 Ga0501082_0885052 3300060353 Bacteria 781
1069 Ga0501082_1592165 3300060353 Bacteria 570
1070 Ga0501082_1605047 3300060353 Bacteria 568
1071 Ga0530510_0194729 3300061734 Bacteria 1505
1072 Ga0373946_0162633
1073 2214544907
1074 ARSoilYngRDRAFT_c00070
1075 ARcpr5yngRDRAFT_c000043
1076 ARSoilOldRDRAFT_c000047
1077 ARCol0yngRDRAFT_1000027
1078 JGI24737J22298_10001922
1079 JGI24035J26624_1033123
1080 JGI26129J50193_1005822
1081 JGI26145J50221_1033792
1082 JGI25405J52794_10003919
1083 Ga0065714_10267576
1084 Ga0065704_10072440
1085 Ga0065712_10002336
1086 Ga0065712_10072434
1087 Ga0065715_10001032
1088 Ga0065715_10002398
1089 Ga0070658_10019414
1090 Ga0070658_10284183
1091 Ga0070676_10032919
1092 Ga0070676_10662816
1093 Ga0070683_100053087
1094 Ga0070683_100420172
1095 Ga0070690_100024375
1096 Ga0070690_100028881
1097 Ga0070690_100167386
1098 Ga0070670_100239964
1099 Ga0070670_100285636
1100 Ga0070670_101607530
1101 Ga0070677_10000677
1102 Ga0068869_100283008
1103 Ga0068869_100718018
1104 Ga0070666_10098868
1105 Ga0070680_100009897
1106 Ga0070680_100013833
1107 Ga0070680_100020270
1108 Ga0070680_100023290
1109 Ga0070680_100026950
1110 Ga0070680_100100236
1111 Ga0070680_100485627
1112 Ga0070680_100597644
1113 Ga0070682_100022819
1114 Ga0070682_100128902
1115 Ga0070682_100514128
1116 Ga0068868_100516961
1117 Ga0070660_100002005
1118 Ga0070660_100004632
1119 Ga0070660_100041291
1120 Ga0070660_100059038
1121 Ga0070660_100059853
1122 Ga0070660_100065885
1123 Ga0070660_100486464
1124 Ga0070689_100377583
1125 Ga0070689_100468232
1126 Ga0070687_100041535
1127 Ga0070687_100111046
1128 Ga0070687_100133143
1129 Ga0070687_100248022
1130 Ga0070687_100449661
1131 Ga0070661_100072176
1132 Ga0070661_100364980
1133 Ga0070661_100570855
1134 Ga0070692_10004569
1135 Ga0070668_100119182
1136 Ga0070668_100180093
1137 Ga0070669_100016220
1138 Ga0070675_100018511
1139 Ga0070675_100140249
1140 Ga0070671_100015777
1141 Ga0070671_100459852
1142 Ga0070671_100541485
1143 Ga0070674_100028093
1144 Ga0070674_100103022
1145 Ga0070674_100293954
1146 Ga0070673_100000255
1147 Ga0070673_100298930
1148 Ga0070688_100028065
1149 Ga0070659_100960564
1150 Ga0070667_100017357
1151 Ga0070667_100094283
1152 Ga0070667_100276034
1153 Ga0070667_100392722
1154 Ga0070703_10008671
1155 Ga0070709_10044618
1156 Ga0070709_10167627
1157 Ga0070714_100041120
1158 Ga0070714_100045002
1159 Ga0070714_100228879
1160 Ga0070714_100267112
1161 Ga0070714_101265039
1162 Ga0070713_100104840
1163 Ga0070713_100144031
1164 Ga0070713_100262538
1165 Ga0070713_101498795
1166 Ga0070710_10131622
1167 Ga0070701_10092619
1168 Ga0070711_100032264
1169 Ga0070711_100048815
1170 Ga0070711_100080886
1171 Ga0070711_100127304
1172 Ga0070711_100186716
1173 Ga0070711_100200657
1174 Ga0070711_100958262
1175 Ga0070711_101481379
1176 Ga0070705_100035185
1177 Ga0070705_100057750
1178 Ga0070705_100116182
1179 Ga0070705_100748054
1180 Ga0070700_100812943
1181 Ga0070694_100002689
1182 Ga0070694_100769137
1183 Ga0070708_100486404
1184 Ga0070663_100053406
1185 Ga0070678_100479328
1186 Ga0070678_100717645
1187 Ga0070678_101337458
1188 Ga0070662_100006353
1189 Ga0070662_100190499
1190 Ga0070662_100262622
1191 Ga0070662_100533893
1192 Ga0070681_10030461
1193 Ga0070681_10143539
1194 Ga0070681_10176707
1195 Ga0070681_10272939
1196 Ga0070681_11407656
1197 Ga0070681_11408980
1198 Ga0068867_100298668
1199 Ga0068867_102018976
1200 Ga0070685_10009552
1201 Ga0070685_10033256
1202 Ga0070699_101275724
1203 Ga0070699_101333816
1204 Ga0070679_100006208
1205 Ga0070679_100038245
1206 Ga0070679_100135759
1207 Ga0070679_100141809
1208 Ga0070679_100309344
1209 Ga0070679_100463540
1210 Ga0070679_100967421
1211 Ga0070684_100013666
1212 Ga0070684_100036747
1213 Ga0070684_100061157
1214 Ga0070684_100420727
1215 Ga0070697_100342282
1216 Ga0068853_100088369
1217 Ga0068853_101203413
1218 Ga0070686_100007712
1219 Ga0070686_100010718
1220 Ga0070686_100362408
1221 Ga0070686_101245662
1222 Ga0070695_100022979
1223 Ga0070695_100092809
1224 Ga0070696_100019739
1225 Ga0070696_100047338
1226 Ga0070696_100047966
1227 Ga0070696_100117942
1228 Ga0070693_100009300
1229 Ga0070693_100121597
1230 Ga0070693_100125414
1231 Ga0070704_100002044
1232 Ga0070704_100010230
1233 Ga0070704_102126807
1234 Ga0068855_100038030
1235 Ga0068855_100219705
1236 Ga0068855_100269713
1237 Ga0070664_100411669
1238 Ga0070664_100808148
1239 Ga0068857_100120265
1240 Ga0068857_100250051
1241 Ga0068854_100096026
1242 Ga0068854_101634436
1243 Ga0068856_100213107
1244 Ga0068856_100223126
1245 Ga0068856_100512498
1246 Ga0068856_100578881
1247 Ga0068856_100655776
1248 Ga0070702_100031250
1249 Ga0070702_100401407
1250 Ga0068852_100014845
1251 Ga0068852_100143760
1252 Ga0068852_101290022
1253 Ga0068852_101471827
1254 Ga0068859_100011201
1255 Ga0068859_100060897
1256 Ga0068866_10004084
1257 Ga0068866_10149670
1258 Ga0068861_100012446
1259 Ga0068861_101181174
1260 Ga0068851_10419441
1261 Ga0068870_10682419
1262 Ga0068858_100089734
1263 Ga0068858_100742742
1264 Ga0068860_100079707
1265 Ga0068860_100096697
1266 Ga0068860_100099546
1267 Ga0068860_102070090
1268 Ga0068862_100002658
1269 Ga0068862_100245568
1270 Ga0068862_101232422
1271 Ga0081455_10000009
1272 Ga0081455_10007711
1273 Ga0081455_10680515
1274 Ga0081540_1027731
1275 Ga0070717_10048664
1276 Ga0070717_10106660
1277 Ga0075432_10008112
1278 Ga0075432_10042732
1279 Ga0075432_10054797
1280 Ga0070715_10291194
1281 Ga0070715_10407091
1282 Ga0070716_100186803
1283 Ga0070712_100159477
1284 Ga0070712_100169264
1285 Ga0070712_100467989
1286 Ga0070712_100620393
1287 Ga0070712_100794227
1288 Ga0075427_10001451
1289 Ga0097621_100057274
1290 Ga0097621_100135984
1291 Ga0097621_101789411
1292 Ga0075370_10913201
1293 Ga0068871_100024571
1294 Ga0075428_100015961
1295 Ga0075430_100002634
1296 Ga0075431_100003630
1297 Ga0075433_10000215
1298 Ga0075433_10235105
1299 Ga0075434_100001991
1300 Ga0075434_100059088
1301 Ga0075429_100002688
1302 Ga0075429_100924060
1303 Ga0068865_100810042
1304 Ga0075436_100184815
1305 Ga0075436_100264850
1306 Ga0097620_100011201
1307 Ga0097620_100060901
1308 Ga0075435_100007981
1309 Ga0075435_100066715
1310 Ga0075435_100218531
1311 Ga0075435_101134762
1312 Ga0105251_10056491
1313 Ga0105251_10099896
1314 Ga0105240_10066233
1315 Ga0105240_10650210
1316 Ga0105240_10926383
1317 Ga0105240_11091847
1318 Ga0111539_10001588
1319 Ga0111539_10008998
1320 Ga0111539_10104213
1321 Ga0111539_11555143
1322 Ga0105245_10095625
1323 Ga0105245_10261154
1324 Ga0105247_10013175
1325 Ga0105247_10078238
1326 Ga0105247_10106779
1327 Ga0105247_10185323
1328 Ga0105247_10264520
1329 Ga0114129_10008124
1330 Ga0114129_10008445
1331 Ga0105243_10137800
1332 Ga0105243_10412734
1333 Ga0105243_11222977
1334 Ga0105241_10012702
1335 Ga0105241_10059957
1336 Ga0105241_10128270
1337 Ga0105242_10004424
1338 Ga0105242_10213652
1339 Ga0105242_11161773
1340 Ga0105248_10010513
1341 Ga0105248_10098855
1342 Ga0105248_10965915
1343 Ga0105237_10014708
1344 Ga0105237_10032544
1345 Ga0105237_10075611
1346 Ga0105238_10042664
1347 Ga0105238_10128853
1348 Ga0105238_10134227
1349 Ga0105238_12620923
1350 Ga0105249_10007257
1351 Ga0105249_10063203
1352 Ga0105239_10352838
1353 Ga0105239_11088212
1354 Ga0105246_10086388
1355 Ga0105246_10144787
1356 Ga0157342_1006506
1357 Ga0157316_1086012
1358 Ga0157326_1005229
1359 Ga0157338_1002982
1360 Ga0157373_10041889
1361 Ga0157371_10030517
1362 Ga0157371_10050502
1363 Ga0157371_10067753
1364 Ga0157371_10699682
1365 Ga0157370_10103404
1366 Ga0157370_10630457
1367 Ga0157369_10299762
1368 Ga0157369_10435835
1369 Ga0157369_10792375
1370 Ga0157374_10010431
1371 Ga0157374_10377691
1372 Ga0157374_10392179
1373 Ga0157374_12774910
1374 Ga0157378_10013910
1375 Ga0157378_10208723
1376 Ga0157378_10211096
1377 Ga0157378_10298705
1378 Ga0163162_10135662
1379 Ga0163162_10179571
1380 Ga0157372_10079573
1381 Ga0157372_10273554
1382 Ga0157372_10499287
1383 Ga0157375_10032055
1384 Ga0157375_10249621
1385 Ga0157375_10849761
1386 Ga0163163_10012423
1387 Ga0163163_10013602
1388 Ga0157380_10042945
1389 Ga0157377_10000240
1390 Ga0157377_10051480
1391 Ga0157379_10005177
1392 Ga0157379_10080639
1393 Ga0157379_10090623
1394 Ga0157379_11062064
1395 Ga0157379_11755730
1396 Ga0157376_10003312
1397 Ga0157376_10083195
1398 Ga0157376_10801883
1399 Ga0157376_11050228
1400 Ga0163161_10194928
1401 Ga0163161_10318552
1402 Ga0206353_10912259
1403 Ga0213876_10099297
1404 Ga0213876_10135708
1405 Ga0207666_1002040
1406 Ga0207697_10004957
1407 Ga0207653_10003884
1408 Ga0207692_10011972
1409 Ga0207692_10016281
1410 Ga0207692_10066772
1411 Ga0207692_10248956
1412 Ga0207642_10014306
1413 Ga0207710_10026649
1414 Ga0207710_10069084
1415 Ga0207688_10019028
1416 Ga0207680_10727632
1417 Ga0207647_10037802
1418 Ga0207685_10023862
1419 Ga0207699_10004579
1420 Ga0207699_10005624
1421 Ga0207699_10105731
1422 Ga0207699_10147340
1423 Ga0207645_10048112
1424 Ga0207645_10443135
1425 Ga0207645_10744116
1426 Ga0207654_10221302
1427 Ga0207707_10007972
1428 Ga0207707_10015798
1429 Ga0207707_10074155
1430 Ga0207707_10200543
1431 Ga0207707_10229861
1432 Ga0207695_10142546
1433 Ga0207695_10604817
1434 Ga0207671_10042353
1435 Ga0207671_10347525
1436 Ga0207693_10027515
1437 Ga0207693_10180346
1438 Ga0207693_10210845
1439 Ga0207693_10284603
1440 Ga0207693_10653159
1441 Ga0207663_10016764
1442 Ga0207663_10060759
1443 Ga0207663_10066265
1444 Ga0207663_10204796
1445 Ga0207663_10433102
1446 Ga0207663_10587971
1447 Ga0207663_10887062
1448 Ga0207663_11355244
1449 Ga0207660_10025258
1450 Ga0207660_10031041
1451 Ga0207660_10038443
1452 Ga0207660_10243304
1453 Ga0207660_10254838
1454 Ga0207660_10584368
1455 Ga0207662_10008126
1456 Ga0207662_10010377
1457 Ga0207662_10104243
1458 Ga0207662_10136862
1459 Ga0207657_10013699
1460 Ga0207657_10024313
1461 Ga0207657_10037506
1462 Ga0207657_10038255
1463 Ga0207657_10233000
1464 Ga0207657_10350272
1465 Ga0207649_10260613
1466 Ga0207649_10755619
1467 Ga0207652_10021283
1468 Ga0207652_10021687
1469 Ga0207652_10088833
1470 Ga0207652_10335404
1471 Ga0207652_10869977
1472 Ga0207646_10416498
1473 Ga0207681_10067102
1474 Ga0207694_10598258
1475 Ga0207650_10032643
1476 Ga0207650_10089960
1477 Ga0207650_10228704
1478 Ga0207659_10055540
1479 Ga0207687_10159028
1480 Ga0207700_10002272
1481 Ga0207700_10246304
1482 Ga0207700_10298168
1483 Ga0207664_10083642
1484 Ga0207664_10085037
1485 Ga0207664_10092615
1486 Ga0207664_10345365
1487 Ga0207644_10014800
1488 Ga0207644_10561439
1489 Ga0207690_10198092
1490 Ga0207690_11186755
1491 Ga0207706_10012224
1492 Ga0207706_10040156
1493 Ga0207706_10355946
1494 Ga0207706_10914411
1495 Ga0207686_10032361
1496 Ga0207686_10242797
1497 Ga0207709_10160658
1498 Ga0207709_10262764
1499 Ga0207709_10922031
1500 Ga0207670_10219884
1501 Ga0207670_11001045
1502 Ga0207669_10188652
1503 Ga0207669_10255890
1504 Ga0207669_10426675
1505 Ga0207704_10055382
1506 Ga0207704_10363737
1507 Ga0207665_10001471
1508 Ga0207665_10084415
1509 Ga0207691_10168625
1510 Ga0207691_10204014
1511 Ga0207691_10279728
1512 Ga0207711_10053237
1513 Ga0207711_10076219
1514 Ga0207711_10941853
1515 Ga0207689_10199835
1516 Ga0207689_10290770
1517 Ga0207661_10152218
1518 Ga0207661_10244868
1519 Ga0207679_10345753
1520 Ga0207679_10659465
1521 Ga0207679_10762004
1522 Ga0207667_10130869
1523 Ga0207667_10539762
1524 Ga0207667_10551166
1525 Ga0207667_11088897
1526 Ga0207667_11896952
1527 Ga0207651_10019390
1528 Ga0207651_10914355
1529 Ga0207712_10809637
1530 Ga0207668_10407432
1531 Ga0207640_10549423
1532 Ga0207640_11746005
1533 Ga0207658_10151064
1534 Ga0207658_10182302
1535 Ga0207658_10322345
1536 Ga0207658_10846736
1537 Ga0207703_10177361
1538 Ga0207703_10697962
1539 Ga0207639_10426935
1540 Ga0207639_10702978
1541 Ga0207639_11333068
1542 Ga0207678_10013090
1543 Ga0207678_10037906
1544 Ga0207708_10005734
1545 Ga0207708_10655696
1546 Ga0207702_10161179
1547 Ga0207702_10446922
1548 Ga0207702_11127662
1549 Ga0207702_11131617
1550 Ga0207648_10013903
1551 Ga0207648_10078303
1552 Ga0207676_10221629
1553 Ga0207676_10292169
1554 Ga0207676_10330084
1555 Ga0207674_10115242
1556 Ga0207675_100026434
1557 Ga0207675_100044811
1558 Ga0207675_100649183
1559 Ga0207683_10000637
1560 Ga0207683_10003484
1561 Ga0207683_10221944
1562 Ga0207683_10701901
1563 Ga0207698_10099642
1564 Ga0207698_10141023
1565 Ga0207698_10954587
1566 Ga0207698_11144337
1567 Ga0209969_1029322
1568 Ga0209982_1063422
1569 Ga0210002_1018275
1570 Ga0209966_1002882
1571 Ga0209998_10001644
1572 Ga0209998_10002534
1573 Ga0209813_10184459
1574 Ga0209974_10011146
1575 Ga0209974_10032112
1576 Ga0207428_10000216
1577 Ga0207428_10003413
1578 Ga0207428_10441756
1579 Ga0268266_10073574
1580 Ga0268264_10021057
1581 Ga0268264_10035058
1582 Ga0268264_10266637
1583 Ga0265337_1006048
1584 Ga0265338_10019445
1585 Ga0265338_10370517
1586 Ga0265324_10057089
1587 Ga0265330_10009349
1588 Ga0265332_10193662
1589 Ga0265325_10000048
1590 Ga0265325_10002795
1591 Ga0265340_10294916
1592 Ga0265339_10092760
1593 Ga0265339_10253327
1594 Ga0265339_10422707
1595 Ga0265316_10304513
1596 Ga0307408_101593076
1597 Ga0265313_10001040
1598 Ga0265313_10062629
1599 Ga0265313_10072518
1600 Ga0265313_10104320
1601 Ga0265314_10012970
1602 Ga0265314_10013779
1603 Ga0265314_10107338
1604 Ga0265342_10001167
1605 Ga0265342_10038412
1606 Ga0307416_101348522
1607 Ga0307416_101488664
1608 Ga0373930_0000195
1609 Ga0373948_0000184
1610 Ga0373948_0002050
1611 Ga0373948_0080489
1612 Ga0373958_0000536
1613 Ga0373958_0017470
1614 Ga0373958_0112284
1615 Ga0373938_0000244
1616 Ga0373938_0003184
1617 Ga0373926_0238562
1618 Ga0373928_0000913
1619 Ga0373928_0015463
1620 Ga0373928_0030076
1621 Ga0373929_0000485
1622 Ga0373934_0056483
1623 Ga0373940_0003410
1624 Ga0373944_0003351
1625 Ga0373944_0129726
1626 Ga0373949_0001916
1627 Ga0373951_0000488
1628 Ga0373951_0006475
1629 Ga0373951_0009239
1630 Ga0373951_0013143
1631 Ga0373952_0013828
1632 Ga0373952_0014806
1633 Ga0373923_0006436
1634 Ga0373923_0037821
1635 Ga0373923_0053042
1636 Ga0373923_0152950
1637 Ga0373923_0277459
1638 Ga0373932_0000474
1639 Ga0373932_0010986
1640 Ga0373936_0001095
1641 Ga0373936_0423109
1642 Ga0373939_0003026
1643 Ga0373939_0009971
1644 Ga0373939_0036871
1645 Ga0373941_0000598
1646 Ga0373941_0001282
1647 Ga0373941_0031575
1648 Ga0373945_0004964
1649 Ga0373945_0064074
1650 Ga0373953_0045167
1651 Ga0373953_0329677
1652 Ga0373954_0001049
1653 Ga0373954_0007478
1654 Ga0373954_0022383
1655 Ga0373954_0145592
1656 Ga0373956_0012907
1657 Ga0373956_0027704
1658 Ga0373956_0225722
1659 Ga0373957_0048717
1660 Ga0373957_0105672
1661 Ga0373957_0184433
1662 Ga0373960_0002102
1663 Ga0373960_0010943
1664 Ga0373960_0140885
1665 Ga0373943_0007130
1666 Ga0373943_0308913
1667 Ga0373943_0430409
1668 Ga0373946_0162920
1669 Ga0373946_0202778
1670 Ga0373955_0002451
1671 Ga0373955_0004483
1672 Ga0373955_0028546
1673 Ga0373955_0038348
1674 Ga0373955_0374197
1675 Ga0373942_0012221
1676 Ga0373961_0010502
1677 Ga0373961_0044103
1678 Ga0373962_0001456
1679 Ga0373924_0012343
1680 Ga0373924_0053727
1681 Ga0373931_0006069
1682 Ga0373931_0058742
1683 Ga0373931_0078670
1684 Ga0373931_0202490
1685 Ga0373935_0047238
1686 Ga0373935_0154529
1687 Ga0373935_0217937
1688 Ga0373927_0004039
1689 Ga0373927_0236385
1690 Ga0373933_0004781
1691 Ga0373933_0006526
1692 Ga0373933_0012091
1693 Ga0373933_0072025
1694 Ga0373947_0006399
1695 Ga0373947_0073431
1696 Ga0373947_0322930
1697 Ga0373937_0001398
1698 Ga0373937_0005069
1699 Ga0373937_0020720
1700 Ga0373937_0040141
1701 Ga0373925_0011839
1702 Ga0373925_0014118
1703 Ga0373925_0076162
1704 Ga0373925_0101464
1705 Ga0373925_1293294
1706 Ga0436365_0078382
1707 Ga0436365_0274005
1708 Ga0436365_1041486
1709 Ga0436360_0486235
1710 Ga0436361_0180502
1711 Ga0436361_0891923
1712 Ga0436363_0783221
1713 Ga0436362_0716023
1714 Ga0439448_0011374
1715 Ga0439448_0086178
1716 Ga0439455_0025023
1717 Ga0439463_027721
1718 Ga0439463_075937
1719 Ga0439444_0155412
1720 Ga0439464_0043449
1721 Ga0451577_0379689
1722 Ga0453683_0663487
1723 Ga0466963_0886681
1724 Ga0466957_0272386
1725 Ga0451576_0013929
1726 Ga0466967_2175979
1727 Ga0495617_171132
1728 Ga0495592_0013463
1729 Ga0495592_0033058
1730 Ga0495592_0113605
1731 Ga0495592_0190898
1732 Ga0495592_0453515
1733 Ga0495603_0005357
1734 Ga0495603_0050431
1735 Ga0495603_0232151
1736 Ga0495629_0059841
1737 Ga0495629_0119732
1738 Ga0495641_0091367
1739 Ga0495641_0091740
1740 Ga0495651_0003153
1741 Ga0495651_0012826
1742 Ga0495653_0001202
1743 Ga0495653_0009980
1744 Ga0495580_0004568
1745 Ga0495580_0227886
1746 Ga0495580_0327189
1747 Ga0495582_0065925
1748 Ga0495639_0002223
1749 Ga0495662_0002421
1750 Ga0495662_0021180
1751 Ga0495664_0008194
1752 Ga0495664_0009168
1753 Ga0495664_0016181
1754 Ga0495584_0013126
1755 Ga0495584_0119623
1756 Ga0495584_0136805
1757 Ga0495585_0000995
1758 Ga0495594_0003519
1759 Ga0495594_0046647
1760 Ga0495607_0013487
1761 Ga0495608_0000363
1762 Ga0495608_0095348
1763 Ga0495608_0919995
1764 Ga0495618_0001897
1765 Ga0495618_0009777
1766 Ga0495628_0001606
1767 Ga0495628_0012443
1768 Ga0495628_0305453
1769 Ga0495628_0661419
1770 Ga0495630_0131028
1771 Ga0495630_0768066
1772 Ga0495644_0002021
1773 Ga0495663_0026199
1774 Ga0495666_0164251
1775 Ga0495652_0002586
1776 Ga0495652_0052019
1777 Ga0495652_0328679
1778 Ga0495652_0362400
1779 Ga0495652_1006363
1780 Ga0495640_0009382
1781 Ga0495640_0023798
1782 Ga0495640_0091974
1783 Ga0495640_0100025
1784 Ga0495640_0950387
1785 Ga0495586_0167057
1786 Ga0495587_0003533
1787 Ga0495587_0008605
1788 Ga0495587_0206520
1789 Ga0495587_0251534
1790 Ga0495609_0080934
1791 Ga0495609_0205501
1792 Ga0495645_0032742
1793 Ga0495645_0451690
1794 Ga0495645_0743485
1795 Ga0495622_0020475
1796 Ga0495622_0043097
1797 Ga0495622_0227494
1798 Ga0495633_0009135
1799 Ga0495667_0001863
1800 Ga0495667_0002910
1801 Ga0495667_0012561
1802 Ga0495667_0019111
1803 Ga0495667_0069747
1804 Ga0495667_0165497
1805 Ga0495656_0011054
1806 Ga0495634_0023444
1807 Ga0495634_0114050
1808 Ga0495634_0257703
1809 Ga0495634_0415384
1810 Ga0495611_0550340
1811 Ga0495635_0000730
1812 Ga0495635_0030540
1813 Ga0495635_0041243
1814 Ga0495635_0088565
1815 Ga0495635_0135391
1816 Ga0495659_0002692
1817 Ga0495588_0001656
1818 Ga0495657_0044286
1819 Ga0495657_0045003
1820 Ga0495657_0052229
1821 Ga0495599_0003607
1822 Ga0495599_0033518
1823 Ga0495599_0498860
1824 Ga0495623_0002343
1825 Ga0495623_0435271
1826 Ga0495623_0558491
1827 Ga0495646_0042319
1828 Ga0495646_0053119
1829 Ga0495647_0000967
1830 Ga0495647_0033610
1831 Ga0495647_0349899
1832 Ga0495658_0002102
1833 Ga0495658_0174362
1834 Ga0495613_0012394
1835 Ga0495613_0082103
1836 Ga0495613_0242328
1837 Ga0495613_0267584
1838 Ga0495624_0067799
1839 Ga0495624_0070412
1840 Ga0495624_0250181
1841 Ga0495600_0000703
1842 Ga0495600_0061545
1843 Ga0495600_0082623
1844 Ga0495600_0170384
1845 Ga0495600_0387519
1846 Ga0495600_0608940
1847 Ga0495581_0059282
1848 Ga0495581_0077256
1849 Ga0495581_0438989
1850 Ga0495604_0001606
1851 Ga0495604_0017676
1852 Ga0495604_0033728
1853 Ga0495604_0072048
1854 Ga0495674_0008713
1855 Ga0495674_0008815
1856 Ga0495674_0085519
1857 Ga0495674_0101934
1858 Ga0495674_0387766
1859 Ga0495676_0234102
1860 Ga0495676_0316850
1861 Ga0495676_0460952
1862 Ga0495680_0003233
1863 Ga0495680_0012545
1864 Ga0495680_0023301
1865 Ga0495680_0136433
1866 Ga0495680_0204334
1867 Ga0495680_0492068
1868 Ga0495675_0002258
1869 Ga0495675_0020910
1870 Ga0495675_0136683
1871 Ga0495675_0356515
1872 Ga0495677_0029496
1873 Ga0495677_0130107
1874 Ga0495684_0000749
1875 Ga0495684_0147471
1876 Ga0495684_0343079
1877 Ga0495684_0535854
1878 Ga0495684_0597452
1879 Ga0495593_0028750
1880 Ga0495593_0236985
1881 Ga0495602_0006328
1882 Ga0495602_0018809
1883 Ga0495602_0050105
1884 Ga0495602_0308040
1885 Ga0495614_0175714
1886 Ga0496100_0032026
1887 Ga0496100_0190751
1888 Ga0496100_0599216
1889 Ga0496101_0024419
1890 Ga0496101_0033791
1891 Ga0496101_0054158
1892 Ga0496101_0107992
1893 Ga0496101_0251885
1894 Ga0496101_0621902
1895 Ga0496101_0623432
1896 Ga0496102_0017443
1897 Ga0496102_0052687
1898 Ga0496102_0125349
1899 Ga0496102_0142734
1900 Ga0496102_0204308
1901 Ga0496102_0210331
1902 Ga0496102_0972969
1903 Ga0496102_1468756
1904 Ga0496103_0044329
1905 Ga0496103_0098323
1906 Ga0496103_0121012
1907 Ga0496103_0316085
1908 Ga0496104_0001904
1909 Ga0496104_0013010
1910 Ga0496104_0084737
1911 Ga0496104_0159692
1912 Ga0496104_0196151
1913 Ga0496104_0209351
1914 Ga0496104_0515962
1915 Ga0496104_0549804
1916 Ga0496105_0002041
1917 Ga0496105_0021534
1918 Ga0496106_0010397
1919 Ga0496106_0011583
1920 Ga0496106_0063855
1921 Ga0496106_0188841
1922 Ga0496106_0668654
1923 Ga0496107_0008549
1924 Ga0496107_0028132
1925 Ga0496107_0116088
1926 Ga0496107_0139696
1927 Ga0496107_0373942
1928 Ga0496108_0013021
1929 Ga0496108_0019320
1930 Ga0496108_0033824
1931 Ga0496108_0857521
1932 Ga0496109_0023038
1933 Ga0496109_0029705
1934 Ga0496109_0158598
1935 Ga0496109_0163060
1936 Ga0496109_0776515
1937 Ga0496110_0116236
1938 Ga0496110_1051692
1939 Ga0496110_1358607
1940 Ga0496111_0009938
1941 Ga0496111_0030686
1942 Ga0496111_0195562
1943 Ga0496111_0226342
1944 Ga0496111_0630867
1945 Ga0496112_0000520
1946 Ga0496112_0525294
1947 Ga0496112_1497682
1948 Ga0496113_0043070
1949 Ga0496113_0325365
1950 Ga0496113_1153236
1951 Ga0496114_0055845
1952 Ga0496114_0088502
1953 Ga0496114_0764433
1954 Ga0496115_0040684
1955 Ga0496115_0096831
1956 Ga0496115_0113903
1957 Ga0496115_0114999
1958 Ga0496115_0474907
1959 Ga0496115_1051472
1960 Ga0496119_0320688
1961 Ga0501031_0123896
1962 Ga0501032_0045575
1963 Ga0501032_0059269
1964 Ga0501032_0089571
1965 Ga0501032_0288193
1966 Ga0501033_0054944
1967 Ga0501033_0076233
1968 Ga0501034_0000211
1969 Ga0501034_0003250
1970 Ga0501034_0011273
1971 Ga0501034_0114986
1972 Ga0501034_0119188
1973 Ga0501034_0214617
1974 Ga0501034_0398319
1975 Ga0501034_0467470
1976 Ga0501034_1169737
1977 Ga0501034_1203019
1978 Ga0501036_0012016
1979 Ga0501036_0050002
1980 Ga0501036_0455716
1981 Ga0501036_0620044
1982 Ga0501037_0002596
1983 Ga0501037_0040990
1984 Ga0501037_0057305
1985 Ga0501037_0500297
1986 Ga0501037_0781313
1987 Ga0501038_0206825
1988 Ga0501038_0582875
1989 Ga0501039_0020522
1990 Ga0501039_0437018
1991 Ga0501039_0726494
1992 Ga0501040_0662657
1993 Ga0501042_0180698
1994 Ga0501043_0061902
1995 Ga0501043_0229418
1996 Ga0501043_0319393
1997 Ga0501043_0369987
1998 Ga0501043_0512022
1999 Ga0501046_0119499
2000 Ga0501046_0121205
2001 Ga0501046_0174145
2002 Ga0501046_0270306
2003 Ga0501046_0571493
2004 Ga0501047_0000010
2005 Ga0501047_0076895
2006 Ga0501047_0149451
2007 Ga0501047_0184993
2008 Ga0501047_0210335
2009 Ga0501047_0325019
2010 Ga0501047_0395446
2011 Ga0501048_0000784
2012 Ga0501048_0194801
2013 Ga0501048_0329887
2014 Ga0501067_0016880
2015 Ga0501067_0044997
2016 Ga0501068_0012136
2017 Ga0501068_0027868
2018 Ga0501068_0092452
2019 Ga0501068_1044995
2020 Ga0501069_0021060
2021 Ga0501069_0030179
2022 Ga0501069_0183300
2023 Ga0501069_0424322
2024 Ga0501070_0012798
2025 Ga0501070_0036167
2026 Ga0501070_0077077
2027 Ga0501070_0080055
2028 Ga0501070_0157256
2029 Ga0501070_0174968
2030 Ga0501070_0407204
2031 Ga0501070_0425188
2032 Ga0501070_0488897
2033 Ga0501071_0101832
2034 Ga0501071_0616289
2035 Ga0501072_0023227
2036 Ga0501072_0161503
2037 Ga0501072_0256878
2038 Ga0501072_0541175
2039 Ga0501073_0011704
2040 Ga0501073_0026355
2041 Ga0501073_0063098
2042 Ga0501073_0200807
2043 Ga0501073_0590934
2044 Ga0501073_0880959
2045 Ga0501074_0015467
2046 Ga0501074_0026995
2047 Ga0501074_0188316
2048 Ga0501074_0210681
2049 Ga0501074_1043945
2050 Ga0501075_0151608
2051 Ga0501076_0210029
2052 Ga0501076_1351611
2053 Ga0501077_0023345
2054 Ga0501077_0259530
2055 Ga0501079_0001490
2056 Ga0501079_0705058
2057 Ga0501080_0090573
2058 Ga0501080_0124247
2059 Ga0501080_0125376
2060 Ga0501080_0151953
2061 Ga0501080_0376510
2062 Ga0501080_0795918
2063 Ga0501081_0338156
2064 Ga0501083_0009626
2065 Ga0501083_0129901
2066 Ga0501083_0374712
2067 Ga0501035_0002108
2068 Ga0501035_0025158
2069 Ga0501035_0257687
2070 Ga0501035_0398980
2071 Ga0501035_0584438
2072 Ga0501035_0904897
2073 Ga0501044_0086065
2074 Ga0501044_0422395
2075 Ga0501044_0689648
2076 Ga0501045_0549322
2077 Ga0501045_0600342
2078 nmdc:mga03n38_471280_c1
2079 nmdc:mga06z11_11064_c1
2080 nmdc:mga06z11_622479_c1
2081 nmdc:mga05p37_3652_c1
2082 nmdc:mga05p37_5580_c1
2083 nmdc:mga09592_1558720_c1
2084 nmdc:mga09592_714_c1
2085 nmdc:mga0qj67_1449_c1
2086 nmdc:mga06r32_1863_c1
2087 nmdc:mga08y16_1194501_c1
2088 nmdc:mga08y16_1350709_c1
2089 nmdc:mga08y16_3547_c1
2090 nmdc:mga08y16_3652_c1
2091 nmdc:mga0n895_20971_c1
2092 nmdc:mga0n895_4615_c1
2093 nmdc:mga0n895_54609_c1
2094 nmdc:mga0n895_63874_c1
2095 nmdc:mga0rr50_1014913_c1
2096 nmdc:mga0rr50_117189_c1
2097 nmdc:mga0rr50_253059_c1
2098 nmdc:mga0rr50_33356_c1
2099 nmdc:mga0rr50_510044_c1
2100 nmdc:mga08x19_104028_c1
2101 nmdc:mga08x19_938391_c1
2102 nmdc:mga0a205_17847_c1
2103 nmdc:mga0a205_2116_c1
2104 Ga0495601_0003041
2105 Ga0495601_0016804
2106 Ga0495601_0018616
2107 Ga0495601_0029013
2108 Ga0495601_0032983
2109 Ga0495601_0146683
2110 Ga0495612_0006375
2111 Ga0495612_0016428
2112 Ga0495612_0018815
2113 Ga0495612_0041646
2114 Ga0495612_0119603
2115 Ga0495612_0234324
2116 Ga0495612_0408857
2117 Ga0495595_0000337
2118 Ga0495595_0000525
2119 Ga0495595_0016453
2120 Ga0495595_0072786
2121 Ga0495595_0091400
2122 Ga0495595_0180254
2123 Ga0495595_0207116
2124 Ga0495619_0000043
2125 Ga0495619_0000333
2126 Ga0495619_0000405
2127 Ga0495619_0006520
2128 Ga0495619_0006915
2129 Ga0495619_0009776
2130 Ga0495619_0012577
2131 Ga0495619_0016850
2132 Ga0500651_0045526
2133 Ga0500641_0001180
2134 Ga0500655_018226
2135 Ga0501084_0223084
2136 Ga0501082_0059799
2137 Ga0501082_0459592
2138 Ga0501082_0476869
2139 Ga0501082_0885052
2140 Ga0501082_1592165
2141 Ga0501082_1605047
2142 Ga0530510_0194729

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

32

158

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.818 3 131
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.7958 3 131
4j7t-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.7591 3 131
6ssr-assembly1.cif.gz_A crystal structure of human microsomal glutathione s-transferase 2 at 3.8 angstroms resolution 0.7581 3 131
4jc7-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.7575 3 131
ID Description Score Start End Superfamily
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8343 3 131 1.20.120.550
af_Q9JHF3_7_153_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8235 3 131 1.20.120.550
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8159 3 131 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8109 3 131 1.20.120.550
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8027 3 131 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A533JAF3-F1-model_v4 deleted 1 45 132
AF-A0A7S7Z5G2-F1-model_v4 MAPEG family protein 0.9965 1 132 GO:0016020
AF-A0A161QMW4-F1-model_v4 MAPEG family protein 0.9961 1 129 GO:0016020
AF-A0A2M8R4K8-F1-model_v4 MAPEG family protein 0.9953 1 132 GO:0016020
AF-A0A5S4X384-F1-model_v4 MAPEG family protein 0.995 1 132 GO:0016020

Map