F489487
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1071 | 406 | 2142 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300035171|Ga0373946_0162633|Ga0373946_0162633_34_516 |
| Length | 160 |
| Sequence | LDLTSSGQDSGRSIHYAARRKHQDRGTAMTKELLWLTLTIILTGLMWVPYILDRIMVRGLMGAMANPSRKDKPQSEWAQRLYFAHTNAVENLIIFAPLVLILDAQGYSTPNTILACAVYFWARLAHAVVYTMGVPILRTLAFTVGFLAQIALVFAVFGKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 9 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 10 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 120 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 121 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 122 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 219 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 231 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 265 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 266 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 267 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 268 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 269 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 270 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 271 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 272 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 275 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 354 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 402 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 403 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 404 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 6.91 |
| Rhizosphere | 91.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373946_0162633 | 3300035171 | Bacteria | 1049 |
| 2 | 2214544907 | 2209111006 | Bacteria | 44850 |
| 3 | ARSoilYngRDRAFT_c00070 | 3300000042 | Bacteria | 16997 |
| 4 | ARcpr5yngRDRAFT_c000043 | 3300000043 | Bacteria | 19987 |
| 5 | ARSoilOldRDRAFT_c000047 | 3300000044 | Bacteria | 25691 |
| 6 | ARCol0yngRDRAFT_1000027 | 3300000652 | Bacteria | 25707 |
| 7 | JGI24737J22298_10001922 | 3300001990 | Bacteria | 7425 |
| 8 | JGI24035J26624_1033123 | 3300002126 | Unclassified | 567 |
| 9 | JGI26129J50193_1005822 | 3300003349 | Unclassified | 881 |
| 10 | JGI26145J50221_1033792 | 3300003371 | Bacteria | 529 |
| 11 | JGI25405J52794_10003919 | 3300003911 | Bacteria | 2636 |
| 12 | Ga0065714_10267576 | 3300005288 | Unclassified | 745 |
| 13 | Ga0065704_10072440 | 3300005289 | Bacteria | 8525 |
| 14 | Ga0065712_10002336 | 3300005290 | Bacteria | 7780 |
| 15 | Ga0065712_10072434 | 3300005290 | Bacteria | 4755 |
| 16 | Ga0065715_10001032 | 3300005293 | Bacteria | 13924 |
| 17 | Ga0065715_10002398 | 3300005293 | Bacteria | 6083 |
| 18 | Ga0070658_10019414 | 3300005327 | Bacteria | 5444 |
| 19 | Ga0070658_10284183 | 3300005327 | Bacteria | 1409 |
| 20 | Ga0070676_10032919 | 3300005328 | Bacteria | 2972 |
| 21 | Ga0070676_10662816 | 3300005328 | Bacteria | 758 |
| 22 | Ga0070683_100053087 | 3300005329 | Bacteria | 3756 |
| 23 | Ga0070683_100420172 | 3300005329 | Bacteria | 1275 |
| 24 | Ga0070690_100024375 | 3300005330 | Bacteria | 3720 |
| 25 | Ga0070690_100028881 | 3300005330 | Bacteria | 3437 |
| 26 | Ga0070690_100167386 | 3300005330 | Bacteria | 1510 |
| 27 | Ga0070670_100239964 | 3300005331 | Bacteria | 1578 |
| 28 | Ga0070670_100285636 | 3300005331 | Bacteria | 1441 |
| 29 | Ga0070670_101607530 | 3300005331 | Unclassified | 597 |
| 30 | Ga0070677_10000677 | 3300005333 | Bacteria | 11415 |
| 31 | Ga0068869_100283008 | 3300005334 | Bacteria | 1334 |
| 32 | Ga0068869_100718018 | 3300005334 | Bacteria | 853 |
| 33 | Ga0070666_10098868 | 3300005335 | Bacteria | 2009 |
| 34 | Ga0070680_100009897 | 3300005336 | Bacteria | 7339 |
| 35 | Ga0070680_100013833 | 3300005336 | Bacteria | 6295 |
| 36 | Ga0070680_100020270 | 3300005336 | Bacteria | 5276 |
| 37 | Ga0070680_100023290 | 3300005336 | Bacteria | 4938 |
| 38 | Ga0070680_100026950 | 3300005336 | Bacteria | 4599 |
| 39 | Ga0070680_100100236 | 3300005336 | Bacteria | 2404 |
| 40 | Ga0070680_100485627 | 3300005336 | Bacteria | 1056 |
| 41 | Ga0070680_100597644 | 3300005336 | Bacteria | 947 |
| 42 | Ga0070682_100022819 | 3300005337 | Bacteria | 3711 |
| 43 | Ga0070682_100128902 | 3300005337 | Bacteria | 1709 |
| 44 | Ga0070682_100514128 | 3300005337 | Bacteria | 930 |
| 45 | Ga0068868_100516961 | 3300005338 | Bacteria | 1048 |
| 46 | Ga0070660_100002005 | 3300005339 | Bacteria | 14046 |
| 47 | Ga0070660_100004632 | 3300005339 | Bacteria | 9521 |
| 48 | Ga0070660_100041291 | 3300005339 | Bacteria | 3515 |
| 49 | Ga0070660_100059038 | 3300005339 | Bacteria | 2975 |
| 50 | Ga0070660_100059853 | 3300005339 | Bacteria | 2955 |
| 51 | Ga0070660_100065885 | 3300005339 | Bacteria | 2819 |
| 52 | Ga0070660_100486464 | 3300005339 | Bacteria | 1026 |
| 53 | Ga0070689_100377583 | 3300005340 | Bacteria | 1194 |
| 54 | Ga0070689_100468232 | 3300005340 | Bacteria | 1075 |
| 55 | Ga0070687_100041535 | 3300005343 | Bacteria | 2325 |
| 56 | Ga0070687_100111046 | 3300005343 | Bacteria | 1552 |
| 57 | Ga0070687_100133143 | 3300005343 | Bacteria | 1438 |
| 58 | Ga0070687_100248022 | 3300005343 | Bacteria | 1105 |
| 59 | Ga0070687_100449661 | 3300005343 | Bacteria | 857 |
| 60 | Ga0070661_100072176 | 3300005344 | Bacteria | 2540 |
| 61 | Ga0070661_100364980 | 3300005344 | Bacteria | 1135 |
| 62 | Ga0070661_100570855 | 3300005344 | Bacteria | 912 |
| 63 | Ga0070692_10004569 | 3300005345 | Bacteria | 5795 |
| 64 | Ga0070668_100119182 | 3300005347 | Bacteria | 2108 |
| 65 | Ga0070668_100180093 | 3300005347 | Bacteria | 1726 |
| 66 | Ga0070669_100016220 | 3300005353 | Bacteria | 5312 |
| 67 | Ga0070675_100018511 | 3300005354 | Bacteria | 5546 |
| 68 | Ga0070675_100140249 | 3300005354 | Bacteria | 2066 |
| 69 | Ga0070671_100015777 | 3300005355 | Bacteria | 6104 |
| 70 | Ga0070671_100459852 | 3300005355 | Bacteria | 1092 |
| 71 | Ga0070671_100541485 | 3300005355 | Bacteria | 1003 |
| 72 | Ga0070674_100028093 | 3300005356 | Bacteria | 3692 |
| 73 | Ga0070674_100103022 | 3300005356 | Bacteria | 2083 |
| 74 | Ga0070674_100293954 | 3300005356 | Bacteria | 1292 |
| 75 | Ga0070673_100000255 | 3300005364 | Bacteria | 27161 |
| 76 | Ga0070673_100298930 | 3300005364 | Bacteria | 1417 |
| 77 | Ga0070688_100028065 | 3300005365 | Bacteria | 3356 |
| 78 | Ga0070659_100960564 | 3300005366 | Bacteria | 749 |
| 79 | Ga0070667_100017357 | 3300005367 | Bacteria | 5964 |
| 80 | Ga0070667_100094283 | 3300005367 | Bacteria | 2579 |
| 81 | Ga0070667_100276034 | 3300005367 | Bacteria | 1508 |
| 82 | Ga0070667_100392722 | 3300005367 | Bacteria | 1262 |
| 83 | Ga0070703_10008671 | 3300005406 | Bacteria | 2861 |
| 84 | Ga0070709_10044618 | 3300005434 | Bacteria | 2746 |
| 85 | Ga0070709_10167627 | 3300005434 | Bacteria | 1532 |
| 86 | Ga0070714_100041120 | 3300005435 | Bacteria | 3899 |
| 87 | Ga0070714_100045002 | 3300005435 | Bacteria | 3739 |
| 88 | Ga0070714_100228879 | 3300005435 | Bacteria | 1712 |
| 89 | Ga0070714_100267112 | 3300005435 | Bacteria | 1586 |
| 90 | Ga0070714_101265039 | 3300005435 | Bacteria | 720 |
| 91 | Ga0070713_100104840 | 3300005436 | Bacteria | 2455 |
| 92 | Ga0070713_100144031 | 3300005436 | Bacteria | 2113 |
| 93 | Ga0070713_100262538 | 3300005436 | Bacteria | 1578 |
| 94 | Ga0070713_101498795 | 3300005436 | Bacteria | 654 |
| 95 | Ga0070710_10131622 | 3300005437 | Bacteria | 1526 |
| 96 | Ga0070701_10092619 | 3300005438 | Bacteria | 1659 |
| 97 | Ga0070711_100032264 | 3300005439 | Bacteria | 3481 |
| 98 | Ga0070711_100048815 | 3300005439 | Bacteria | 2896 |
| 99 | Ga0070711_100080886 | 3300005439 | Bacteria | 2314 |
| 100 | Ga0070711_100127304 | 3300005439 | Bacteria | 1892 |
| 101 | Ga0070711_100186716 | 3300005439 | Bacteria | 1590 |
| 102 | Ga0070711_100200657 | 3300005439 | Bacteria | 1539 |
| 103 | Ga0070711_100958262 | 3300005439 | Bacteria | 732 |
| 104 | Ga0070711_101481379 | 3300005439 | Bacteria | 592 |
| 105 | Ga0070705_100035185 | 3300005440 | Bacteria | 2806 |
| 106 | Ga0070705_100057750 | 3300005440 | Bacteria | 2290 |
| 107 | Ga0070705_100116182 | 3300005440 | Bacteria | 1719 |
| 108 | Ga0070705_100748054 | 3300005440 | Bacteria | 773 |
| 109 | Ga0070700_100812943 | 3300005441 | Bacteria | 754 |
| 110 | Ga0070694_100002689 | 3300005444 | Bacteria | 10536 |
| 111 | Ga0070694_100769137 | 3300005444 | Bacteria | 788 |
| 112 | Ga0070708_100486404 | 3300005445 | Bacteria | 1164 |
| 113 | Ga0070663_100053406 | 3300005455 | Bacteria | 2884 |
| 114 | Ga0070678_100479328 | 3300005456 | Bacteria | 1094 |
| 115 | Ga0070678_100717645 | 3300005456 | Bacteria | 902 |
| 116 | Ga0070678_101337458 | 3300005456 | Bacteria | 667 |
| 117 | Ga0070662_100006353 | 3300005457 | Bacteria | 7612 |
| 118 | Ga0070662_100190499 | 3300005457 | Bacteria | 1622 |
| 119 | Ga0070662_100262622 | 3300005457 | Bacteria | 1391 |
| 120 | Ga0070662_100533893 | 3300005457 | Bacteria | 981 |
| 121 | Ga0070681_10030461 | 3300005458 | Bacteria | 5413 |
| 122 | Ga0070681_10143539 | 3300005458 | Bacteria | 2317 |
| 123 | Ga0070681_10176707 | 3300005458 | Bacteria | 2057 |
| 124 | Ga0070681_10272939 | 3300005458 | Bacteria | 1602 |
| 125 | Ga0070681_11407656 | 3300005458 | Bacteria | 621 |
| 126 | Ga0070681_11408980 | 3300005458 | Bacteria | 621 |
| 127 | Ga0068867_100298668 | 3300005459 | Bacteria | 1327 |
| 128 | Ga0068867_102018976 | 3300005459 | Bacteria | 545 |
| 129 | Ga0070685_10009552 | 3300005466 | Bacteria | 5016 |
| 130 | Ga0070685_10033256 | 3300005466 | Bacteria | 2895 |
| 131 | Ga0070699_101275724 | 3300005518 | Unclassified | 674 |
| 132 | Ga0070699_101333816 | 3300005518 | Bacteria | 658 |
| 133 | Ga0070679_100006208 | 3300005530 | Bacteria | 11131 |
| 134 | Ga0070679_100038245 | 3300005530 | Bacteria | 4770 |
| 135 | Ga0070679_100135759 | 3300005530 | Bacteria | 2441 |
| 136 | Ga0070679_100141809 | 3300005530 | Bacteria | 2382 |
| 137 | Ga0070679_100309344 | 3300005530 | Bacteria | 1530 |
| 138 | Ga0070679_100463540 | 3300005530 | Bacteria | 1212 |
| 139 | Ga0070679_100967421 | 3300005530 | Bacteria | 795 |
| 140 | Ga0070684_100013666 | 3300005535 | Bacteria | 6552 |
| 141 | Ga0070684_100036747 | 3300005535 | Bacteria | 4197 |
| 142 | Ga0070684_100061157 | 3300005535 | Bacteria | 3296 |
| 143 | Ga0070684_100420727 | 3300005535 | Bacteria | 1233 |
| 144 | Ga0070697_100342282 | 3300005536 | Bacteria | 1291 |
| 145 | Ga0068853_100088369 | 3300005539 | Bacteria | 2721 |
| 146 | Ga0068853_101203413 | 3300005539 | Bacteria | 731 |
| 147 | Ga0070686_100007712 | 3300005544 | Bacteria | 6016 |
| 148 | Ga0070686_100010718 | 3300005544 | Bacteria | 5181 |
| 149 | Ga0070686_100362408 | 3300005544 | Bacteria | 1092 |
| 150 | Ga0070686_101245662 | 3300005544 | Bacteria | 619 |
| 151 | Ga0070695_100022979 | 3300005545 | Bacteria | 3827 |
| 152 | Ga0070695_100092809 | 3300005545 | Bacteria | 2019 |
| 153 | Ga0070696_100019739 | 3300005546 | Bacteria | 4567 |
| 154 | Ga0070696_100047338 | 3300005546 | Bacteria | 2983 |
| 155 | Ga0070696_100047966 | 3300005546 | Bacteria | 2964 |
| 156 | Ga0070696_100117942 | 3300005546 | Bacteria | 1918 |
| 157 | Ga0070693_100009300 | 3300005547 | Bacteria | 4884 |
| 158 | Ga0070693_100121597 | 3300005547 | Bacteria | 1620 |
| 159 | Ga0070693_100125414 | 3300005547 | Bacteria | 1598 |
| 160 | Ga0070704_100002044 | 3300005549 | Bacteria | 11185 |
| 161 | Ga0070704_100010230 | 3300005549 | Bacteria | 5705 |
| 162 | Ga0070704_102126807 | 3300005549 | Bacteria | 521 |
| 163 | Ga0068855_100038030 | 3300005563 | Bacteria | 5720 |
| 164 | Ga0068855_100219705 | 3300005563 | Bacteria | 2131 |
| 165 | Ga0068855_100269713 | 3300005563 | Bacteria | 1893 |
| 166 | Ga0070664_100411669 | 3300005564 | Bacteria | 1237 |
| 167 | Ga0070664_100808148 | 3300005564 | Unclassified | 877 |
| 168 | Ga0068857_100120265 | 3300005577 | Bacteria | 2364 |
| 169 | Ga0068857_100250051 | 3300005577 | Bacteria | 1625 |
| 170 | Ga0068854_100096026 | 3300005578 | Bacteria | 2214 |
| 171 | Ga0068854_101634436 | 3300005578 | Bacteria | 588 |
| 172 | Ga0068856_100213107 | 3300005614 | Bacteria | 1947 |
| 173 | Ga0068856_100223126 | 3300005614 | Bacteria | 1900 |
| 174 | Ga0068856_100512498 | 3300005614 | Bacteria | 1220 |
| 175 | Ga0068856_100578881 | 3300005614 | Bacteria | 1144 |
| 176 | Ga0068856_100655776 | 3300005614 | Bacteria | 1070 |
| 177 | Ga0070702_100031250 | 3300005615 | Bacteria | 2911 |
| 178 | Ga0070702_100401407 | 3300005615 | Bacteria | 981 |
| 179 | Ga0068852_100014845 | 3300005616 | Bacteria | 6018 |
| 180 | Ga0068852_100143760 | 3300005616 | Bacteria | 2210 |
| 181 | Ga0068852_101290022 | 3300005616 | Bacteria | 752 |
| 182 | Ga0068852_101471827 | 3300005616 | Bacteria | 703 |
| 183 | Ga0068859_100011201 | 3300005617 | Bacteria | 9016 |
| 184 | Ga0068859_100060897 | 3300005617 | Bacteria | 3803 |
| 185 | Ga0068866_10004084 | 3300005718 | Bacteria | 5990 |
| 186 | Ga0068866_10149670 | 3300005718 | Bacteria | 1350 |
| 187 | Ga0068861_100012446 | 3300005719 | Bacteria | 5936 |
| 188 | Ga0068861_101181174 | 3300005719 | Bacteria | 739 |
| 189 | Ga0068851_10419441 | 3300005834 | Bacteria | 790 |
| 190 | Ga0068870_10682419 | 3300005840 | Unclassified | 707 |
| 191 | Ga0068858_100089734 | 3300005842 | Bacteria | 2860 |
| 192 | Ga0068858_100742742 | 3300005842 | Bacteria | 956 |
| 193 | Ga0068860_100079707 | 3300005843 | Bacteria | 3114 |
| 194 | Ga0068860_100096697 | 3300005843 | Bacteria | 2815 |
| 195 | Ga0068860_100099546 | 3300005843 | Bacteria | 2773 |
| 196 | Ga0068860_102070090 | 3300005843 | Bacteria | 590 |
| 197 | Ga0068862_100002658 | 3300005844 | Bacteria | 15723 |
| 198 | Ga0068862_100245568 | 3300005844 | Bacteria | 1629 |
| 199 | Ga0068862_101232422 | 3300005844 | Bacteria | 747 |
| 200 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 201 | Ga0081455_10007711 | 3300005937 | Bacteria | 11291 |
| 202 | Ga0081455_10680515 | 3300005937 | Unclassified | 658 |
| 203 | Ga0081540_1027731 | 3300005983 | Bacteria | 3200 |
| 204 | Ga0070717_10048664 | 3300006028 | Bacteria | 3478 |
| 205 | Ga0070717_10106660 | 3300006028 | Bacteria | 2385 |
| 206 | Ga0075432_10008112 | 3300006058 | Bacteria | 3582 |
| 207 | Ga0075432_10042732 | 3300006058 | Bacteria | 1587 |
| 208 | Ga0075432_10054797 | 3300006058 | Bacteria | 1412 |
| 209 | Ga0070715_10291194 | 3300006163 | Bacteria | 870 |
| 210 | Ga0070715_10407091 | 3300006163 | Bacteria | 758 |
| 211 | Ga0070716_100186803 | 3300006173 | Bacteria | 1366 |
| 212 | Ga0070712_100159477 | 3300006175 | Bacteria | 1741 |
| 213 | Ga0070712_100169264 | 3300006175 | Bacteria | 1694 |
| 214 | Ga0070712_100467989 | 3300006175 | Bacteria | 1052 |
| 215 | Ga0070712_100620393 | 3300006175 | Bacteria | 917 |
| 216 | Ga0070712_100794227 | 3300006175 | Bacteria | 812 |
| 217 | Ga0075427_10001451 | 3300006194 | Bacteria | 3042 |
| 218 | Ga0097621_100057274 | 3300006237 | Bacteria | 3186 |
| 219 | Ga0097621_100135984 | 3300006237 | Bacteria | 2096 |
| 220 | Ga0097621_101789411 | 3300006237 | Bacteria | 585 |
| 221 | Ga0075370_10913201 | 3300006353 | Bacteria | 537 |
| 222 | Ga0068871_100024571 | 3300006358 | Bacteria | 4674 |
| 223 | Ga0075428_100015961 | 3300006844 | Bacteria | 8311 |
| 224 | Ga0075430_100002634 | 3300006846 | Bacteria | 14981 |
| 225 | Ga0075431_100003630 | 3300006847 | Bacteria | 14954 |
| 226 | Ga0075433_10000215 | 3300006852 | Bacteria | 32818 |
| 227 | Ga0075433_10235105 | 3300006852 | Bacteria | 1627 |
| 228 | Ga0075434_100001991 | 3300006871 | Bacteria | 17721 |
| 229 | Ga0075434_100059088 | 3300006871 | Bacteria | 3812 |
| 230 | Ga0075429_100002688 | 3300006880 | Bacteria | 14973 |
| 231 | Ga0075429_100924060 | 3300006880 | Bacteria | 763 |
| 232 | Ga0068865_100810042 | 3300006881 | Bacteria | 808 |
| 233 | Ga0075436_100184815 | 3300006914 | Bacteria | 1474 |
| 234 | Ga0075436_100264850 | 3300006914 | Bacteria | 1226 |
| 235 | Ga0097620_100011201 | 3300006931 | Bacteria | 9016 |
| 236 | Ga0097620_100060901 | 3300006931 | Bacteria | 3803 |
| 237 | Ga0075435_100007981 | 3300007076 | Bacteria | 7576 |
| 238 | Ga0075435_100066715 | 3300007076 | Bacteria | 2929 |
| 239 | Ga0075435_100218531 | 3300007076 | Bacteria | 1618 |
| 240 | Ga0075435_101134762 | 3300007076 | Bacteria | 683 |
| 241 | Ga0105251_10056491 | 3300009011 | Bacteria | 1858 |
| 242 | Ga0105251_10099896 | 3300009011 | Bacteria | 1326 |
| 243 | Ga0105240_10066233 | 3300009093 | Bacteria | 4482 |
| 244 | Ga0105240_10650210 | 3300009093 | Bacteria | 1156 |
| 245 | Ga0105240_10926383 | 3300009093 | Bacteria | 936 |
| 246 | Ga0105240_11091847 | 3300009093 | Unclassified | 849 |
| 247 | Ga0111539_10001588 | 3300009094 | Bacteria | 30267 |
| 248 | Ga0111539_10008998 | 3300009094 | Bacteria | 12639 |
| 249 | Ga0111539_10104213 | 3300009094 | Bacteria | 3328 |
| 250 | Ga0111539_11555143 | 3300009094 | Bacteria | 767 |
| 251 | Ga0105245_10095625 | 3300009098 | Bacteria | 2741 |
| 252 | Ga0105245_10261154 | 3300009098 | Bacteria | 1685 |
| 253 | Ga0105247_10013175 | 3300009101 | Bacteria | 4961 |
| 254 | Ga0105247_10078238 | 3300009101 | Bacteria | 2080 |
| 255 | Ga0105247_10106779 | 3300009101 | Bacteria | 1797 |
| 256 | Ga0105247_10185323 | 3300009101 | Bacteria | 1391 |
| 257 | Ga0105247_10264520 | 3300009101 | Bacteria | 1180 |
| 258 | Ga0114129_10008124 | 3300009147 | Bacteria | 14957 |
| 259 | Ga0114129_10008445 | 3300009147 | Bacteria | 14672 |
| 260 | Ga0105243_10137800 | 3300009148 | Bacteria | 2078 |
| 261 | Ga0105243_10412734 | 3300009148 | Bacteria | 1257 |
| 262 | Ga0105243_11222977 | 3300009148 | Bacteria | 765 |
| 263 | Ga0105241_10012702 | 3300009174 | Bacteria | 6180 |
| 264 | Ga0105241_10059957 | 3300009174 | Bacteria | 2927 |
| 265 | Ga0105241_10128270 | 3300009174 | Bacteria | 2050 |
| 266 | Ga0105242_10004424 | 3300009176 | Bacteria | 10926 |
| 267 | Ga0105242_10213652 | 3300009176 | Bacteria | 1720 |
| 268 | Ga0105242_11161773 | 3300009176 | Bacteria | 789 |
| 269 | Ga0105248_10010513 | 3300009177 | Bacteria | 10193 |
| 270 | Ga0105248_10098855 | 3300009177 | Bacteria | 3288 |
| 271 | Ga0105248_10965915 | 3300009177 | Bacteria | 962 |
| 272 | Ga0105237_10014708 | 3300009545 | Bacteria | 8171 |
| 273 | Ga0105237_10032544 | 3300009545 | Bacteria | 5279 |
| 274 | Ga0105237_10075611 | 3300009545 | Bacteria | 3359 |
| 275 | Ga0105238_10042664 | 3300009551 | Bacteria | 4592 |
| 276 | Ga0105238_10128853 | 3300009551 | Bacteria | 2509 |
| 277 | Ga0105238_10134227 | 3300009551 | Bacteria | 2453 |
| 278 | Ga0105238_12620923 | 3300009551 | Bacteria | 540 |
| 279 | Ga0105249_10007257 | 3300009553 | Bacteria | 9668 |
| 280 | Ga0105249_10063203 | 3300009553 | Bacteria | 3400 |
| 281 | Ga0105239_10352838 | 3300010375 | Bacteria | 1661 |
| 282 | Ga0105239_11088212 | 3300010375 | Bacteria | 920 |
| 283 | Ga0105246_10086388 | 3300011119 | Bacteria | 2249 |
| 284 | Ga0105246_10144787 | 3300011119 | Bacteria | 1792 |
| 285 | Ga0157342_1006506 | 3300012507 | Bacteria | 1108 |
| 286 | Ga0157316_1086012 | 3300012510 | Unclassified | 500 |
| 287 | Ga0157326_1005229 | 3300012513 | Bacteria | 1368 |
| 288 | Ga0157338_1002982 | 3300012515 | Bacteria | 1371 |
| 289 | Ga0157373_10041889 | 3300013100 | Bacteria | 3275 |
| 290 | Ga0157371_10030517 | 3300013102 | Bacteria | 3889 |
| 291 | Ga0157371_10050502 | 3300013102 | Bacteria | 2956 |
| 292 | Ga0157371_10067753 | 3300013102 | Bacteria | 2526 |
| 293 | Ga0157371_10699682 | 3300013102 | Bacteria | 759 |
| 294 | Ga0157370_10103404 | 3300013104 | Bacteria | 2666 |
| 295 | Ga0157370_10630457 | 3300013104 | Bacteria | 980 |
| 296 | Ga0157369_10299762 | 3300013105 | Bacteria | 1672 |
| 297 | Ga0157369_10435835 | 3300013105 | Bacteria | 1358 |
| 298 | Ga0157369_10792375 | 3300013105 | Bacteria | 974 |
| 299 | Ga0157374_10010431 | 3300013296 | Bacteria | 7988 |
| 300 | Ga0157374_10377691 | 3300013296 | Bacteria | 1411 |
| 301 | Ga0157374_10392179 | 3300013296 | Bacteria | 1384 |
| 302 | Ga0157374_12774910 | 3300013296 | Unclassified | 517 |
| 303 | Ga0157378_10013910 | 3300013297 | Bacteria | 7039 |
| 304 | Ga0157378_10208723 | 3300013297 | Bacteria | 1851 |
| 305 | Ga0157378_10211096 | 3300013297 | Bacteria | 1841 |
| 306 | Ga0157378_10298705 | 3300013297 | Bacteria | 1558 |
| 307 | Ga0163162_10135662 | 3300013306 | Bacteria | 2571 |
| 308 | Ga0163162_10179571 | 3300013306 | Bacteria | 2243 |
| 309 | Ga0157372_10079573 | 3300013307 | Bacteria | 3707 |
| 310 | Ga0157372_10273554 | 3300013307 | Bacteria | 1963 |
| 311 | Ga0157372_10499287 | 3300013307 | Bacteria | 1419 |
| 312 | Ga0157375_10032055 | 3300013308 | Bacteria | 4979 |
| 313 | Ga0157375_10249621 | 3300013308 | Bacteria | 1935 |
| 314 | Ga0157375_10849761 | 3300013308 | Bacteria | 1059 |
| 315 | Ga0163163_10012423 | 3300014325 | Bacteria | 7758 |
| 316 | Ga0163163_10013602 | 3300014325 | Bacteria | 7452 |
| 317 | Ga0157380_10042945 | 3300014326 | Bacteria | 3537 |
| 318 | Ga0157377_10000240 | 3300014745 | Bacteria | 27908 |
| 319 | Ga0157377_10051480 | 3300014745 | Bacteria | 2323 |
| 320 | Ga0157379_10005177 | 3300014968 | Bacteria | 11201 |
| 321 | Ga0157379_10080639 | 3300014968 | Bacteria | 2915 |
| 322 | Ga0157379_10090623 | 3300014968 | Bacteria | 2743 |
| 323 | Ga0157379_11062064 | 3300014968 | Bacteria | 774 |
| 324 | Ga0157379_11755730 | 3300014968 | Bacteria | 609 |
| 325 | Ga0157376_10003312 | 3300014969 | Bacteria | 11094 |
| 326 | Ga0157376_10083195 | 3300014969 | Bacteria | 2752 |
| 327 | Ga0157376_10801883 | 3300014969 | Bacteria | 954 |
| 328 | Ga0157376_11050228 | 3300014969 | Bacteria | 839 |
| 329 | Ga0163161_10194928 | 3300017792 | Bacteria | 1559 |
| 330 | Ga0163161_10318552 | 3300017792 | Bacteria | 1229 |
| 331 | Ga0206353_10912259 | 3300020082 | Bacteria | 756 |
| 332 | Ga0213876_10099297 | 3300021384 | Bacteria | 1543 |
| 333 | Ga0213876_10135708 | 3300021384 | Bacteria | 1309 |
| 334 | Ga0207666_1002040 | 3300025271 | Bacteria | 2415 |
| 335 | Ga0207697_10004957 | 3300025315 | Bacteria | 6274 |
| 336 | Ga0207653_10003884 | 3300025885 | Bacteria | 4698 |
| 337 | Ga0207692_10011972 | 3300025898 | Bacteria | 3713 |
| 338 | Ga0207692_10016281 | 3300025898 | Bacteria | 3288 |
| 339 | Ga0207692_10066772 | 3300025898 | Bacteria | 1881 |
| 340 | Ga0207692_10248956 | 3300025898 | Bacteria | 1064 |
| 341 | Ga0207642_10014306 | 3300025899 | Bacteria | 2924 |
| 342 | Ga0207710_10026649 | 3300025900 | Bacteria | 2499 |
| 343 | Ga0207710_10069084 | 3300025900 | Bacteria | 1617 |
| 344 | Ga0207688_10019028 | 3300025901 | Bacteria | 3737 |
| 345 | Ga0207680_10727632 | 3300025903 | Bacteria | 711 |
| 346 | Ga0207647_10037802 | 3300025904 | Bacteria | 3057 |
| 347 | Ga0207685_10023862 | 3300025905 | Bacteria | 2088 |
| 348 | Ga0207699_10004579 | 3300025906 | Bacteria | 6605 |
| 349 | Ga0207699_10005624 | 3300025906 | Bacteria | 6015 |
| 350 | Ga0207699_10105731 | 3300025906 | Bacteria | 1795 |
| 351 | Ga0207699_10147340 | 3300025906 | Bacteria | 1553 |
| 352 | Ga0207645_10048112 | 3300025907 | Bacteria | 2722 |
| 353 | Ga0207645_10443135 | 3300025907 | Bacteria | 876 |
| 354 | Ga0207645_10744116 | 3300025907 | Unclassified | 667 |
| 355 | Ga0207654_10221302 | 3300025911 | Bacteria | 1256 |
| 356 | Ga0207707_10007972 | 3300025912 | Bacteria | 9204 |
| 357 | Ga0207707_10015798 | 3300025912 | Bacteria | 6581 |
| 358 | Ga0207707_10074155 | 3300025912 | Bacteria | 2968 |
| 359 | Ga0207707_10200543 | 3300025912 | Bacteria | 1740 |
| 360 | Ga0207707_10229861 | 3300025912 | Unclassified | 1614 |
| 361 | Ga0207695_10142546 | 3300025913 | Bacteria | 2343 |
| 362 | Ga0207695_10604817 | 3300025913 | Bacteria | 977 |
| 363 | Ga0207671_10042353 | 3300025914 | Bacteria | 3370 |
| 364 | Ga0207671_10347525 | 3300025914 | Bacteria | 1176 |
| 365 | Ga0207693_10027515 | 3300025915 | Bacteria | 4495 |
| 366 | Ga0207693_10180346 | 3300025915 | Bacteria | 1662 |
| 367 | Ga0207693_10210845 | 3300025915 | Bacteria | 1527 |
| 368 | Ga0207693_10284603 | 3300025915 | Bacteria | 1295 |
| 369 | Ga0207693_10653159 | 3300025915 | Bacteria | 817 |
| 370 | Ga0207663_10016764 | 3300025916 | Bacteria | 4070 |
| 371 | Ga0207663_10060759 | 3300025916 | Bacteria | 2396 |
| 372 | Ga0207663_10066265 | 3300025916 | Bacteria | 2311 |
| 373 | Ga0207663_10204796 | 3300025916 | Bacteria | 1426 |
| 374 | Ga0207663_10433102 | 3300025916 | Bacteria | 1011 |
| 375 | Ga0207663_10587971 | 3300025916 | Bacteria | 874 |
| 376 | Ga0207663_10887062 | 3300025916 | Bacteria | 713 |
| 377 | Ga0207663_11355244 | 3300025916 | Unclassified | 573 |
| 378 | Ga0207660_10025258 | 3300025917 | Bacteria | 4031 |
| 379 | Ga0207660_10031041 | 3300025917 | Bacteria | 3676 |
| 380 | Ga0207660_10038443 | 3300025917 | Bacteria | 3341 |
| 381 | Ga0207660_10243304 | 3300025917 | Bacteria | 1418 |
| 382 | Ga0207660_10254838 | 3300025917 | Bacteria | 1386 |
| 383 | Ga0207660_10584368 | 3300025917 | Bacteria | 909 |
| 384 | Ga0207662_10008126 | 3300025918 | Bacteria | 5735 |
| 385 | Ga0207662_10010377 | 3300025918 | Bacteria | 5142 |
| 386 | Ga0207662_10104243 | 3300025918 | Bacteria | 1761 |
| 387 | Ga0207662_10136862 | 3300025918 | Bacteria | 1548 |
| 388 | Ga0207657_10013699 | 3300025919 | Bacteria | 7942 |
| 389 | Ga0207657_10024313 | 3300025919 | Bacteria | 5615 |
| 390 | Ga0207657_10037506 | 3300025919 | Bacteria | 4326 |
| 391 | Ga0207657_10038255 | 3300025919 | Bacteria | 4274 |
| 392 | Ga0207657_10233000 | 3300025919 | Bacteria | 1472 |
| 393 | Ga0207657_10350272 | 3300025919 | Bacteria | 1165 |
| 394 | Ga0207649_10260613 | 3300025920 | Bacteria | 1253 |
| 395 | Ga0207649_10755619 | 3300025920 | Unclassified | 757 |
| 396 | Ga0207652_10021283 | 3300025921 | Bacteria | 5352 |
| 397 | Ga0207652_10021687 | 3300025921 | Bacteria | 5303 |
| 398 | Ga0207652_10088833 | 3300025921 | Bacteria | 2712 |
| 399 | Ga0207652_10335404 | 3300025921 | Bacteria | 1365 |
| 400 | Ga0207652_10869977 | 3300025921 | Bacteria | 797 |
| 401 | Ga0207646_10416498 | 3300025922 | Bacteria | 1213 |
| 402 | Ga0207681_10067102 | 3300025923 | Bacteria | 2486 |
| 403 | Ga0207694_10598258 | 3300025924 | Bacteria | 927 |
| 404 | Ga0207650_10032643 | 3300025925 | Bacteria | 3766 |
| 405 | Ga0207650_10089960 | 3300025925 | Bacteria | 2344 |
| 406 | Ga0207650_10228704 | 3300025925 | Bacteria | 1499 |
| 407 | Ga0207659_10055540 | 3300025926 | Bacteria | 2833 |
| 408 | Ga0207687_10159028 | 3300025927 | Bacteria | 1732 |
| 409 | Ga0207700_10002272 | 3300025928 | Bacteria | 11029 |
| 410 | Ga0207700_10246304 | 3300025928 | Bacteria | 1525 |
| 411 | Ga0207700_10298168 | 3300025928 | Bacteria | 1391 |
| 412 | Ga0207664_10083642 | 3300025929 | Bacteria | 2602 |
| 413 | Ga0207664_10085037 | 3300025929 | Bacteria | 2581 |
| 414 | Ga0207664_10092615 | 3300025929 | Bacteria | 2481 |
| 415 | Ga0207664_10345365 | 3300025929 | Bacteria | 1316 |
| 416 | Ga0207644_10014800 | 3300025931 | Bacteria | 5229 |
| 417 | Ga0207644_10561439 | 3300025931 | Bacteria | 945 |
| 418 | Ga0207690_10198092 | 3300025932 | Bacteria | 1523 |
| 419 | Ga0207690_11186755 | 3300025932 | Bacteria | 637 |
| 420 | Ga0207706_10012224 | 3300025933 | Bacteria | 7823 |
| 421 | Ga0207706_10040156 | 3300025933 | Bacteria | 4147 |
| 422 | Ga0207706_10355946 | 3300025933 | Bacteria | 1272 |
| 423 | Ga0207706_10914411 | 3300025933 | Bacteria | 740 |
| 424 | Ga0207686_10032361 | 3300025934 | Bacteria | 3112 |
| 425 | Ga0207686_10242797 | 3300025934 | Bacteria | 1312 |
| 426 | Ga0207709_10160658 | 3300025935 | Bacteria | 1567 |
| 427 | Ga0207709_10262764 | 3300025935 | Bacteria | 1266 |
| 428 | Ga0207709_10922031 | 3300025935 | Bacteria | 711 |
| 429 | Ga0207670_10219884 | 3300025936 | Bacteria | 1453 |
| 430 | Ga0207670_11001045 | 3300025936 | Bacteria | 703 |
| 431 | Ga0207669_10188652 | 3300025937 | Bacteria | 1485 |
| 432 | Ga0207669_10255890 | 3300025937 | Bacteria | 1306 |
| 433 | Ga0207669_10426675 | 3300025937 | Bacteria | 1045 |
| 434 | Ga0207704_10055382 | 3300025938 | Bacteria | 2423 |
| 435 | Ga0207704_10363737 | 3300025938 | Bacteria | 1130 |
| 436 | Ga0207665_10001471 | 3300025939 | Bacteria | 15845 |
| 437 | Ga0207665_10084415 | 3300025939 | Bacteria | 2191 |
| 438 | Ga0207691_10168625 | 3300025940 | Bacteria | 1918 |
| 439 | Ga0207691_10204014 | 3300025940 | Bacteria | 1720 |
| 440 | Ga0207691_10279728 | 3300025940 | Bacteria | 1436 |
| 441 | Ga0207711_10053237 | 3300025941 | Bacteria | 3471 |
| 442 | Ga0207711_10076219 | 3300025941 | Bacteria | 2920 |
| 443 | Ga0207711_10941853 | 3300025941 | Bacteria | 802 |
| 444 | Ga0207689_10199835 | 3300025942 | Bacteria | 1650 |
| 445 | Ga0207689_10290770 | 3300025942 | Bacteria | 1353 |
| 446 | Ga0207661_10152218 | 3300025944 | Bacteria | 2000 |
| 447 | Ga0207661_10244868 | 3300025944 | Bacteria | 1592 |
| 448 | Ga0207679_10345753 | 3300025945 | Bacteria | 1295 |
| 449 | Ga0207679_10659465 | 3300025945 | Unclassified | 947 |
| 450 | Ga0207679_10762004 | 3300025945 | Bacteria | 881 |
| 451 | Ga0207667_10130869 | 3300025949 | Bacteria | 2584 |
| 452 | Ga0207667_10539762 | 3300025949 | Bacteria | 1180 |
| 453 | Ga0207667_10551166 | 3300025949 | Bacteria | 1166 |
| 454 | Ga0207667_11088897 | 3300025949 | Bacteria | 783 |
| 455 | Ga0207667_11896952 | 3300025949 | Bacteria | 558 |
| 456 | Ga0207651_10019390 | 3300025960 | Bacteria | 4075 |
| 457 | Ga0207651_10914355 | 3300025960 | Bacteria | 782 |
| 458 | Ga0207712_10809637 | 3300025961 | Bacteria | 824 |
| 459 | Ga0207668_10407432 | 3300025972 | Bacteria | 1151 |
| 460 | Ga0207640_10549423 | 3300025981 | Bacteria | 970 |
| 461 | Ga0207640_11746005 | 3300025981 | Bacteria | 562 |
| 462 | Ga0207658_10151064 | 3300025986 | Bacteria | 1892 |
| 463 | Ga0207658_10182302 | 3300025986 | Bacteria | 1739 |
| 464 | Ga0207658_10322345 | 3300025986 | Bacteria | 1338 |
| 465 | Ga0207658_10846736 | 3300025986 | Unclassified | 831 |
| 466 | Ga0207703_10177361 | 3300026035 | Bacteria | 1878 |
| 467 | Ga0207703_10697962 | 3300026035 | Bacteria | 965 |
| 468 | Ga0207639_10426935 | 3300026041 | Bacteria | 1199 |
| 469 | Ga0207639_10702978 | 3300026041 | Bacteria | 938 |
| 470 | Ga0207639_11333068 | 3300026041 | Bacteria | 673 |
| 471 | Ga0207678_10013090 | 3300026067 | Bacteria | 7278 |
| 472 | Ga0207678_10037906 | 3300026067 | Bacteria | 4191 |
| 473 | Ga0207708_10005734 | 3300026075 | Bacteria | 9178 |
| 474 | Ga0207708_10655696 | 3300026075 | Bacteria | 894 |
| 475 | Ga0207702_10161179 | 3300026078 | Bacteria | 2048 |
| 476 | Ga0207702_10446922 | 3300026078 | Bacteria | 1254 |
| 477 | Ga0207702_11127662 | 3300026078 | Unclassified | 778 |
| 478 | Ga0207702_11131617 | 3300026078 | Bacteria | 777 |
| 479 | Ga0207648_10013903 | 3300026089 | Bacteria | 7465 |
| 480 | Ga0207648_10078303 | 3300026089 | Bacteria | 2883 |
| 481 | Ga0207676_10221629 | 3300026095 | Bacteria | 1685 |
| 482 | Ga0207676_10292169 | 3300026095 | Bacteria | 1484 |
| 483 | Ga0207676_10330084 | 3300026095 | Bacteria | 1403 |
| 484 | Ga0207674_10115242 | 3300026116 | Bacteria | 2659 |
| 485 | Ga0207675_100026434 | 3300026118 | Bacteria | 5403 |
| 486 | Ga0207675_100044811 | 3300026118 | Bacteria | 4133 |
| 487 | Ga0207675_100649183 | 3300026118 | Bacteria | 1061 |
| 488 | Ga0207683_10000637 | 3300026121 | Bacteria | 32050 |
| 489 | Ga0207683_10003484 | 3300026121 | Bacteria | 13733 |
| 490 | Ga0207683_10221944 | 3300026121 | Bacteria | 1722 |
| 491 | Ga0207683_10701901 | 3300026121 | Bacteria | 938 |
| 492 | Ga0207698_10099642 | 3300026142 | Bacteria | 2404 |
| 493 | Ga0207698_10141023 | 3300026142 | Bacteria | 2077 |
| 494 | Ga0207698_10954587 | 3300026142 | Bacteria | 867 |
| 495 | Ga0207698_11144337 | 3300026142 | Bacteria | 792 |
| 496 | Ga0209969_1029322 | 3300027360 | Bacteria | 838 |
| 497 | Ga0209982_1063422 | 3300027552 | Bacteria | 602 |
| 498 | Ga0210002_1018275 | 3300027617 | Bacteria | 1120 |
| 499 | Ga0209966_1002882 | 3300027695 | Bacteria | 2884 |
| 500 | Ga0209998_10001644 | 3300027717 | Bacteria | 5349 |
| 501 | Ga0209998_10002534 | 3300027717 | Bacteria | 4160 |
| 502 | Ga0209813_10184459 | 3300027866 | Bacteria | 765 |
| 503 | Ga0209974_10011146 | 3300027876 | Bacteria | 3024 |
| 504 | Ga0209974_10032112 | 3300027876 | Bacteria | 1740 |
| 505 | Ga0207428_10000216 | 3300027907 | Bacteria | 79777 |
| 506 | Ga0207428_10003413 | 3300027907 | Bacteria | 15431 |
| 507 | Ga0207428_10441756 | 3300027907 | Bacteria | 949 |
| 508 | Ga0268266_10073574 | 3300028379 | Bacteria | 2965 |
| 509 | Ga0268264_10021057 | 3300028381 | Bacteria | 5329 |
| 510 | Ga0268264_10035058 | 3300028381 | Bacteria | 4131 |
| 511 | Ga0268264_10266637 | 3300028381 | Bacteria | 1598 |
| 512 | Ga0265337_1006048 | 3300028556 | Bacteria | 4719 |
| 513 | Ga0265338_10019445 | 3300028800 | Bacteria | 7205 |
| 514 | Ga0265338_10370517 | 3300028800 | Bacteria | 1026 |
| 515 | Ga0265324_10057089 | 3300029957 | Bacteria | 1337 |
| 516 | Ga0265330_10009349 | 3300031235 | Bacteria | 4660 |
| 517 | Ga0265332_10193662 | 3300031238 | Bacteria | 846 |
| 518 | Ga0265325_10000048 | 3300031241 | Bacteria | 82899 |
| 519 | Ga0265325_10002795 | 3300031241 | Bacteria | 11656 |
| 520 | Ga0265340_10294916 | 3300031247 | Bacteria | 719 |
| 521 | Ga0265339_10092760 | 3300031249 | Bacteria | 1580 |
| 522 | Ga0265339_10253327 | 3300031249 | Bacteria | 851 |
| 523 | Ga0265339_10422707 | 3300031249 | Bacteria | 621 |
| 524 | Ga0265316_10304513 | 3300031344 | Bacteria | 1160 |
| 525 | Ga0307408_101593076 | 3300031548 | Bacteria | 620 |
| 526 | Ga0265313_10001040 | 3300031595 | Bacteria | 26998 |
| 527 | Ga0265313_10062629 | 3300031595 | Bacteria | 1737 |
| 528 | Ga0265313_10072518 | 3300031595 | Bacteria | 1582 |
| 529 | Ga0265313_10104320 | 3300031595 | Bacteria | 1254 |
| 530 | Ga0265314_10012970 | 3300031711 | Bacteria | 6767 |
| 531 | Ga0265314_10013779 | 3300031711 | Bacteria | 6514 |
| 532 | Ga0265314_10107338 | 3300031711 | Bacteria | 1782 |
| 533 | Ga0265342_10001167 | 3300031712 | Bacteria | 25007 |
| 534 | Ga0265342_10038412 | 3300031712 | Bacteria | 2916 |
| 535 | Ga0307416_101348522 | 3300032002 | Bacteria | 819 |
| 536 | Ga0307416_101488664 | 3300032002 | Bacteria | 783 |
| 537 | Ga0373930_0000195 | 3300034816 | Bacteria | 7365 |
| 538 | Ga0373948_0000184 | 3300034817 | Bacteria | 7132 |
| 539 | Ga0373948_0002050 | 3300034817 | Bacteria | 2916 |
| 540 | Ga0373948_0080489 | 3300034817 | Bacteria | 742 |
| 541 | Ga0373958_0000536 | 3300034819 | Bacteria | 4730 |
| 542 | Ga0373958_0017470 | 3300034819 | Bacteria | 1290 |
| 543 | Ga0373958_0112284 | 3300034819 | Bacteria | 650 |
| 544 | Ga0373938_0000244 | 3300034957 | Bacteria | 8511 |
| 545 | Ga0373938_0003184 | 3300034957 | Bacteria | 2667 |
| 546 | Ga0373926_0238562 | 3300035083 | Bacteria | 703 |
| 547 | Ga0373928_0000913 | 3300035084 | Bacteria | 5780 |
| 548 | Ga0373928_0015463 | 3300035084 | Bacteria | 1554 |
| 549 | Ga0373928_0030076 | 3300035084 | Bacteria | 1198 |
| 550 | Ga0373929_0000485 | 3300035085 | Bacteria | 7622 |
| 551 | Ga0373934_0056483 | 3300035086 | Bacteria | 1561 |
| 552 | Ga0373940_0003410 | 3300035088 | Bacteria | 3242 |
| 553 | Ga0373944_0003351 | 3300035089 | Bacteria | 4129 |
| 554 | Ga0373944_0129726 | 3300035089 | Bacteria | 875 |
| 555 | Ga0373949_0001916 | 3300035090 | Bacteria | 5616 |
| 556 | Ga0373951_0000488 | 3300035091 | Bacteria | 11307 |
| 557 | Ga0373951_0006475 | 3300035091 | Bacteria | 2679 |
| 558 | Ga0373951_0009239 | 3300035091 | Bacteria | 2221 |
| 559 | Ga0373951_0013143 | 3300035091 | Bacteria | 1861 |
| 560 | Ga0373952_0013828 | 3300035092 | Bacteria | 1607 |
| 561 | Ga0373952_0014806 | 3300035092 | Bacteria | 1566 |
| 562 | Ga0373923_0006436 | 3300035111 | Bacteria | 4061 |
| 563 | Ga0373923_0037821 | 3300035111 | Bacteria | 1975 |
| 564 | Ga0373923_0053042 | 3300035111 | Bacteria | 1705 |
| 565 | Ga0373923_0152950 | 3300035111 | Bacteria | 1049 |
| 566 | Ga0373923_0277459 | 3300035111 | Unclassified | 789 |
| 567 | Ga0373932_0000474 | 3300035112 | Bacteria | 12323 |
| 568 | Ga0373932_0010986 | 3300035112 | Bacteria | 2203 |
| 569 | Ga0373936_0001095 | 3300035113 | Bacteria | 9709 |
| 570 | Ga0373936_0423109 | 3300035113 | Bacteria | 613 |
| 571 | Ga0373939_0003026 | 3300035114 | Bacteria | 3947 |
| 572 | Ga0373939_0009971 | 3300035114 | Bacteria | 2364 |
| 573 | Ga0373939_0036871 | 3300035114 | Bacteria | 1449 |
| 574 | Ga0373941_0000598 | 3300035115 | Bacteria | 7310 |
| 575 | Ga0373941_0001282 | 3300035115 | Bacteria | 5289 |
| 576 | Ga0373941_0031575 | 3300035115 | Bacteria | 1579 |
| 577 | Ga0373945_0004964 | 3300035116 | Bacteria | 4239 |
| 578 | Ga0373945_0064074 | 3300035116 | Bacteria | 1377 |
| 579 | Ga0373953_0045167 | 3300035117 | Bacteria | 1764 |
| 580 | Ga0373953_0329677 | 3300035117 | Unclassified | 668 |
| 581 | Ga0373954_0001049 | 3300035118 | Bacteria | 10992 |
| 582 | Ga0373954_0007478 | 3300035118 | Bacteria | 4781 |
| 583 | Ga0373954_0022383 | 3300035118 | Bacteria | 2866 |
| 584 | Ga0373954_0145592 | 3300035118 | Bacteria | 1156 |
| 585 | Ga0373956_0012907 | 3300035119 | Bacteria | 3470 |
| 586 | Ga0373956_0027704 | 3300035119 | Bacteria | 2462 |
| 587 | Ga0373956_0225722 | 3300035119 | Bacteria | 889 |
| 588 | Ga0373957_0048717 | 3300035120 | Bacteria | 1615 |
| 589 | Ga0373957_0105672 | 3300035120 | Bacteria | 1130 |
| 590 | Ga0373957_0184433 | 3300035120 | Bacteria | 866 |
| 591 | Ga0373960_0002102 | 3300035121 | Bacteria | 4484 |
| 592 | Ga0373960_0010943 | 3300035121 | Bacteria | 2224 |
| 593 | Ga0373960_0140885 | 3300035121 | Bacteria | 816 |
| 594 | Ga0373943_0007130 | 3300035170 | Bacteria | 5015 |
| 595 | Ga0373943_0308913 | 3300035170 | Bacteria | 899 |
| 596 | Ga0373943_0430409 | 3300035170 | Unclassified | 764 |
| 597 | Ga0373946_0162920 | 3300035171 | Bacteria | 1048 |
| 598 | Ga0373946_0202778 | 3300035171 | Bacteria | 951 |
| 599 | Ga0373955_0002451 | 3300035172 | Bacteria | 8100 |
| 600 | Ga0373955_0004483 | 3300035172 | Bacteria | 6182 |
| 601 | Ga0373955_0028546 | 3300035172 | Bacteria | 2893 |
| 602 | Ga0373955_0038348 | 3300035172 | Bacteria | 2552 |
| 603 | Ga0373955_0374197 | 3300035172 | Unclassified | 864 |
| 604 | Ga0373942_0012221 | 3300035207 | Bacteria | 2047 |
| 605 | Ga0373961_0010502 | 3300035241 | Bacteria | 2282 |
| 606 | Ga0373961_0044103 | 3300035241 | Bacteria | 1299 |
| 607 | Ga0373962_0001456 | 3300035242 | Bacteria | 5597 |
| 608 | Ga0373924_0012343 | 3300035410 | Bacteria | 3190 |
| 609 | Ga0373924_0053727 | 3300035410 | Bacteria | 1674 |
| 610 | Ga0373931_0006069 | 3300035691 | Bacteria | 5628 |
| 611 | Ga0373931_0058742 | 3300035691 | Bacteria | 2067 |
| 612 | Ga0373931_0078670 | 3300035691 | Bacteria | 1815 |
| 613 | Ga0373931_0202490 | 3300035691 | Bacteria | 1186 |
| 614 | Ga0373935_0047238 | 3300035692 | Bacteria | 2721 |
| 615 | Ga0373935_0154529 | 3300035692 | Bacteria | 1559 |
| 616 | Ga0373935_0217937 | 3300035692 | Bacteria | 1325 |
| 617 | Ga0373927_0004039 | 3300035695 | Bacteria | 10376 |
| 618 | Ga0373927_0236385 | 3300035695 | Bacteria | 1200 |
| 619 | Ga0373933_0004781 | 3300035724 | Bacteria | 7402 |
| 620 | Ga0373933_0006526 | 3300035724 | Bacteria | 6354 |
| 621 | Ga0373933_0012091 | 3300035724 | Bacteria | 4766 |
| 622 | Ga0373933_0072025 | 3300035724 | Bacteria | 2104 |
| 623 | Ga0373947_0006399 | 3300035725 | Bacteria | 6844 |
| 624 | Ga0373947_0073431 | 3300035725 | Bacteria | 2102 |
| 625 | Ga0373947_0322930 | 3300035725 | Bacteria | 1032 |
| 626 | Ga0373937_0001398 | 3300036401 | Bacteria | 20148 |
| 627 | Ga0373937_0005069 | 3300036401 | Bacteria | 11213 |
| 628 | Ga0373937_0020720 | 3300036401 | Bacteria | 5897 |
| 629 | Ga0373937_0040141 | 3300036401 | Bacteria | 4266 |
| 630 | Ga0373925_0011839 | 3300037068 | Bacteria | 6312 |
| 631 | Ga0373925_0014118 | 3300037068 | Bacteria | 5781 |
| 632 | Ga0373925_0076162 | 3300037068 | Bacteria | 2543 |
| 633 | Ga0373925_0101464 | 3300037068 | Bacteria | 2212 |
| 634 | Ga0373925_1293294 | 3300037068 | Bacteria | 598 |
| 635 | Ga0436365_0078382 | 3300039437 | Bacteria | 11270 |
| 636 | Ga0436365_0274005 | 3300039437 | Bacteria | 1927 |
| 637 | Ga0436365_1041486 | 3300039437 | Bacteria | 4052 |
| 638 | Ga0436360_0486235 | 3300039438 | Bacteria | 544 |
| 639 | Ga0436361_0180502 | 3300039447 | Bacteria | 897 |
| 640 | Ga0436361_0891923 | 3300039447 | Bacteria | 586 |
| 641 | Ga0436363_0783221 | 3300039450 | Bacteria | 3216 |
| 642 | Ga0436362_0716023 | 3300039453 | Bacteria | 892 |
| 643 | Ga0439448_0011374 | 3300042005 | Bacteria | 2653 |
| 644 | Ga0439448_0086178 | 3300042005 | Bacteria | 1058 |
| 645 | Ga0439455_0025023 | 3300042012 | Unclassified | 1448 |
| 646 | Ga0439463_027721 | 3300042016 | Bacteria | 1427 |
| 647 | Ga0439463_075937 | 3300042016 | Unclassified | 862 |
| 648 | Ga0439444_0155412 | 3300042437 | Bacteria | 555 |
| 649 | Ga0439464_0043449 | 3300042439 | Bacteria | 1285 |
| 650 | Ga0451577_0379689 | 3300042876 | Bacteria | 1282 |
| 651 | Ga0453683_0663487 | 3300044673 | Unclassified | 682 |
| 652 | Ga0466963_0886681 | 3300044694 | Bacteria | 629 |
| 653 | Ga0466957_0272386 | 3300044842 | Bacteria | 1131 |
| 654 | Ga0451576_0013929 | 3300045051 | Bacteria | 8979 |
| 655 | Ga0466967_2175979 | 3300045976 | Bacteria | 551 |
| 656 | Ga0495617_171132 | 3300046452 | Bacteria | 686 |
| 657 | Ga0495592_0013463 | 3300046454 | Bacteria | 6223 |
| 658 | Ga0495592_0033058 | 3300046454 | Bacteria | 3902 |
| 659 | Ga0495592_0113605 | 3300046454 | Bacteria | 1913 |
| 660 | Ga0495592_0190898 | 3300046454 | Bacteria | 1389 |
| 661 | Ga0495592_0453515 | 3300046454 | Unclassified | 803 |
| 662 | Ga0495603_0005357 | 3300046455 | Bacteria | 7649 |
| 663 | Ga0495603_0050431 | 3300046455 | Bacteria | 2475 |
| 664 | Ga0495603_0232151 | 3300046455 | Bacteria | 1063 |
| 665 | Ga0495629_0059841 | 3300046459 | Bacteria | 2662 |
| 666 | Ga0495629_0119732 | 3300046459 | Bacteria | 1834 |
| 667 | Ga0495641_0091367 | 3300046461 | Bacteria | 1360 |
| 668 | Ga0495641_0091740 | 3300046461 | Bacteria | 1357 |
| 669 | Ga0495651_0003153 | 3300046462 | Bacteria | 12701 |
| 670 | Ga0495651_0012826 | 3300046462 | Bacteria | 6472 |
| 671 | Ga0495653_0001202 | 3300046463 | Bacteria | 20094 |
| 672 | Ga0495653_0009980 | 3300046463 | Bacteria | 7766 |
| 673 | Ga0495580_0004568 | 3300046472 | Bacteria | 11617 |
| 674 | Ga0495580_0227886 | 3300046472 | Bacteria | 1280 |
| 675 | Ga0495580_0327189 | 3300046472 | Unclassified | 1041 |
| 676 | Ga0495582_0065925 | 3300046473 | Bacteria | 2001 |
| 677 | Ga0495639_0002223 | 3300046475 | Bacteria | 8536 |
| 678 | Ga0495662_0002421 | 3300046476 | Bacteria | 9371 |
| 679 | Ga0495662_0021180 | 3300046476 | Bacteria | 3144 |
| 680 | Ga0495664_0008194 | 3300046477 | Bacteria | 5818 |
| 681 | Ga0495664_0009168 | 3300046477 | Bacteria | 5531 |
| 682 | Ga0495664_0016181 | 3300046477 | Bacteria | 4247 |
| 683 | Ga0495584_0013126 | 3300046491 | Bacteria | 4226 |
| 684 | Ga0495584_0119623 | 3300046491 | Bacteria | 1334 |
| 685 | Ga0495584_0136805 | 3300046491 | Bacteria | 1244 |
| 686 | Ga0495585_0000995 | 3300046492 | Bacteria | 23693 |
| 687 | Ga0495594_0003519 | 3300046499 | Bacteria | 8068 |
| 688 | Ga0495594_0046647 | 3300046499 | Bacteria | 2380 |
| 689 | Ga0495607_0013487 | 3300046501 | Bacteria | 5354 |
| 690 | Ga0495608_0000363 | 3300046511 | Bacteria | 31688 |
| 691 | Ga0495608_0095348 | 3300046511 | Bacteria | 1922 |
| 692 | Ga0495608_0919995 | 3300046511 | Bacteria | 511 |
| 693 | Ga0495618_0001897 | 3300046514 | Bacteria | 13753 |
| 694 | Ga0495618_0009777 | 3300046514 | Bacteria | 5796 |
| 695 | Ga0495628_0001606 | 3300046516 | Bacteria | 20730 |
| 696 | Ga0495628_0012443 | 3300046516 | Bacteria | 7177 |
| 697 | Ga0495628_0305453 | 3300046516 | Bacteria | 1177 |
| 698 | Ga0495628_0661419 | 3300046516 | Bacteria | 741 |
| 699 | Ga0495630_0131028 | 3300046517 | Bacteria | 1904 |
| 700 | Ga0495630_0768066 | 3300046517 | Bacteria | 736 |
| 701 | Ga0495644_0002021 | 3300046523 | Bacteria | 8158 |
| 702 | Ga0495663_0026199 | 3300046525 | Bacteria | 1706 |
| 703 | Ga0495666_0164251 | 3300046526 | Bacteria | 1029 |
| 704 | Ga0495652_0002586 | 3300046529 | Bacteria | 18522 |
| 705 | Ga0495652_0052019 | 3300046529 | Bacteria | 3494 |
| 706 | Ga0495652_0328679 | 3300046529 | Bacteria | 1102 |
| 707 | Ga0495652_0362400 | 3300046529 | Bacteria | 1036 |
| 708 | Ga0495652_1006363 | 3300046529 | Bacteria | 545 |
| 709 | Ga0495640_0009382 | 3300046533 | Bacteria | 7620 |
| 710 | Ga0495640_0023798 | 3300046533 | Bacteria | 4456 |
| 711 | Ga0495640_0091974 | 3300046533 | Bacteria | 2001 |
| 712 | Ga0495640_0100025 | 3300046533 | Bacteria | 1904 |
| 713 | Ga0495640_0950387 | 3300046533 | Bacteria | 508 |
| 714 | Ga0495586_0167057 | 3300046535 | Bacteria | 1242 |
| 715 | Ga0495587_0003533 | 3300046536 | Bacteria | 10409 |
| 716 | Ga0495587_0008605 | 3300046536 | Bacteria | 6560 |
| 717 | Ga0495587_0206520 | 3300046536 | Bacteria | 1110 |
| 718 | Ga0495587_0251534 | 3300046536 | Bacteria | 993 |
| 719 | Ga0495609_0080934 | 3300046538 | Bacteria | 1420 |
| 720 | Ga0495609_0205501 | 3300046538 | Bacteria | 822 |
| 721 | Ga0495645_0032742 | 3300046543 | Bacteria | 3792 |
| 722 | Ga0495645_0451690 | 3300046543 | Bacteria | 810 |
| 723 | Ga0495645_0743485 | 3300046543 | Bacteria | 592 |
| 724 | Ga0495622_0020475 | 3300046557 | Bacteria | 3079 |
| 725 | Ga0495622_0043097 | 3300046557 | Bacteria | 2098 |
| 726 | Ga0495622_0227494 | 3300046557 | Unclassified | 825 |
| 727 | Ga0495633_0009135 | 3300046558 | Bacteria | 5502 |
| 728 | Ga0495667_0001863 | 3300046559 | Bacteria | 13986 |
| 729 | Ga0495667_0002910 | 3300046559 | Bacteria | 11494 |
| 730 | Ga0495667_0012561 | 3300046559 | Bacteria | 5743 |
| 731 | Ga0495667_0019111 | 3300046559 | Bacteria | 4625 |
| 732 | Ga0495667_0069747 | 3300046559 | Bacteria | 2294 |
| 733 | Ga0495667_0165497 | 3300046559 | Bacteria | 1421 |
| 734 | Ga0495656_0011054 | 3300046615 | Bacteria | 3303 |
| 735 | Ga0495634_0023444 | 3300046642 | Bacteria | 4338 |
| 736 | Ga0495634_0114050 | 3300046642 | Bacteria | 1735 |
| 737 | Ga0495634_0257703 | 3300046642 | Bacteria | 1065 |
| 738 | Ga0495634_0415384 | 3300046642 | Bacteria | 797 |
| 739 | Ga0495611_0550340 | 3300046648 | Bacteria | 523 |
| 740 | Ga0495635_0000730 | 3300046663 | Bacteria | 21233 |
| 741 | Ga0495635_0030540 | 3300046663 | Bacteria | 3744 |
| 742 | Ga0495635_0041243 | 3300046663 | Bacteria | 3189 |
| 743 | Ga0495635_0088565 | 3300046663 | Bacteria | 2118 |
| 744 | Ga0495635_0135391 | 3300046663 | Bacteria | 1679 |
| 745 | Ga0495659_0002692 | 3300046664 | Bacteria | 5717 |
| 746 | Ga0495588_0001656 | 3300046674 | Bacteria | 9523 |
| 747 | Ga0495657_0044286 | 3300046675 | Bacteria | 3028 |
| 748 | Ga0495657_0045003 | 3300046675 | Bacteria | 2997 |
| 749 | Ga0495657_0052229 | 3300046675 | Bacteria | 2741 |
| 750 | Ga0495599_0003607 | 3300046678 | Bacteria | 9079 |
| 751 | Ga0495599_0033518 | 3300046678 | Bacteria | 3227 |
| 752 | Ga0495599_0498860 | 3300046678 | Bacteria | 717 |
| 753 | Ga0495623_0002343 | 3300046679 | Bacteria | 12621 |
| 754 | Ga0495623_0435271 | 3300046679 | Bacteria | 700 |
| 755 | Ga0495623_0558491 | 3300046679 | Unclassified | 598 |
| 756 | Ga0495646_0042319 | 3300046680 | Bacteria | 2795 |
| 757 | Ga0495646_0053119 | 3300046680 | Bacteria | 2444 |
| 758 | Ga0495647_0000967 | 3300046681 | Bacteria | 8697 |
| 759 | Ga0495647_0033610 | 3300046681 | Bacteria | 1917 |
| 760 | Ga0495647_0349899 | 3300046681 | Bacteria | 672 |
| 761 | Ga0495658_0002102 | 3300046683 | Bacteria | 10107 |
| 762 | Ga0495658_0174362 | 3300046683 | Bacteria | 1332 |
| 763 | Ga0495613_0012394 | 3300046689 | Bacteria | 6335 |
| 764 | Ga0495613_0082103 | 3300046689 | Bacteria | 2341 |
| 765 | Ga0495613_0242328 | 3300046689 | Bacteria | 1260 |
| 766 | Ga0495613_0267584 | 3300046689 | Bacteria | 1189 |
| 767 | Ga0495624_0067799 | 3300046690 | Bacteria | 2225 |
| 768 | Ga0495624_0070412 | 3300046690 | Bacteria | 2177 |
| 769 | Ga0495624_0250181 | 3300046690 | Unclassified | 1072 |
| 770 | Ga0495600_0000703 | 3300046809 | Bacteria | 17538 |
| 771 | Ga0495600_0061545 | 3300046809 | Bacteria | 2452 |
| 772 | Ga0495600_0082623 | 3300046809 | Bacteria | 2096 |
| 773 | Ga0495600_0170384 | 3300046809 | Bacteria | 1405 |
| 774 | Ga0495600_0387519 | 3300046809 | Unclassified | 871 |
| 775 | Ga0495600_0608940 | 3300046809 | Bacteria | 663 |
| 776 | Ga0495581_0059282 | 3300047315 | Bacteria | 2212 |
| 777 | Ga0495581_0077256 | 3300047315 | Bacteria | 1926 |
| 778 | Ga0495581_0438989 | 3300047315 | Unclassified | 761 |
| 779 | Ga0495604_0001606 | 3300047317 | Bacteria | 18631 |
| 780 | Ga0495604_0017676 | 3300047317 | Bacteria | 5707 |
| 781 | Ga0495604_0033728 | 3300047317 | Bacteria | 4052 |
| 782 | Ga0495604_0072048 | 3300047317 | Bacteria | 2612 |
| 783 | Ga0495674_0008713 | 3300047319 | Bacteria | 9648 |
| 784 | Ga0495674_0008815 | 3300047319 | Bacteria | 9592 |
| 785 | Ga0495674_0085519 | 3300047319 | Bacteria | 2701 |
| 786 | Ga0495674_0101934 | 3300047319 | Bacteria | 2441 |
| 787 | Ga0495674_0387766 | 3300047319 | Bacteria | 1129 |
| 788 | Ga0495676_0234102 | 3300047321 | Bacteria | 1260 |
| 789 | Ga0495676_0316850 | 3300047321 | Bacteria | 1048 |
| 790 | Ga0495676_0460952 | 3300047321 | Bacteria | 838 |
| 791 | Ga0495680_0003233 | 3300047322 | Bacteria | 16170 |
| 792 | Ga0495680_0012545 | 3300047322 | Bacteria | 7451 |
| 793 | Ga0495680_0023301 | 3300047322 | Bacteria | 5149 |
| 794 | Ga0495680_0136433 | 3300047322 | Bacteria | 1798 |
| 795 | Ga0495680_0204334 | 3300047322 | Bacteria | 1416 |
| 796 | Ga0495680_0492068 | 3300047322 | Unclassified | 834 |
| 797 | Ga0495675_0002258 | 3300047444 | Bacteria | 11506 |
| 798 | Ga0495675_0020910 | 3300047444 | Bacteria | 4165 |
| 799 | Ga0495675_0136683 | 3300047444 | Bacteria | 1521 |
| 800 | Ga0495675_0356515 | 3300047444 | Bacteria | 859 |
| 801 | Ga0495677_0029496 | 3300047445 | Bacteria | 1995 |
| 802 | Ga0495677_0130107 | 3300047445 | Bacteria | 963 |
| 803 | Ga0495684_0000749 | 3300047471 | Bacteria | 26152 |
| 804 | Ga0495684_0147471 | 3300047471 | Bacteria | 1761 |
| 805 | Ga0495684_0343079 | 3300047471 | Bacteria | 1062 |
| 806 | Ga0495684_0535854 | 3300047471 | Bacteria | 799 |
| 807 | Ga0495684_0597452 | 3300047471 | Bacteria | 745 |
| 808 | Ga0495593_0028750 | 3300047673 | Bacteria | 3052 |
| 809 | Ga0495593_0236985 | 3300047673 | Bacteria | 914 |
| 810 | Ga0495602_0006328 | 3300048088 | Bacteria | 12420 |
| 811 | Ga0495602_0018809 | 3300048088 | Bacteria | 6881 |
| 812 | Ga0495602_0050105 | 3300048088 | Bacteria | 3735 |
| 813 | Ga0495602_0308040 | 3300048088 | Bacteria | 1157 |
| 814 | Ga0495614_0175714 | 3300048089 | Unclassified | 962 |
| 815 | Ga0496100_0032026 | 3300048903 | Bacteria | 3273 |
| 816 | Ga0496100_0190751 | 3300048903 | Bacteria | 1488 |
| 817 | Ga0496100_0599216 | 3300048903 | Bacteria | 855 |
| 818 | Ga0496101_0024419 | 3300048904 | Bacteria | 4183 |
| 819 | Ga0496101_0033791 | 3300048904 | Bacteria | 3609 |
| 820 | Ga0496101_0054158 | 3300048904 | Bacteria | 2896 |
| 821 | Ga0496101_0107992 | 3300048904 | Bacteria | 2092 |
| 822 | Ga0496101_0251885 | 3300048904 | Bacteria | 1376 |
| 823 | Ga0496101_0621902 | 3300048904 | Bacteria | 854 |
| 824 | Ga0496101_0623432 | 3300048904 | Bacteria | 852 |
| 825 | Ga0496102_0017443 | 3300048905 | Bacteria | 6289 |
| 826 | Ga0496102_0052687 | 3300048905 | Bacteria | 3708 |
| 827 | Ga0496102_0125349 | 3300048905 | Bacteria | 2400 |
| 828 | Ga0496102_0142734 | 3300048905 | Bacteria | 2246 |
| 829 | Ga0496102_0204308 | 3300048905 | Bacteria | 1862 |
| 830 | Ga0496102_0210331 | 3300048905 | Bacteria | 1834 |
| 831 | Ga0496102_0972969 | 3300048905 | Bacteria | 769 |
| 832 | Ga0496102_1468756 | 3300048905 | Bacteria | 600 |
| 833 | Ga0496103_0044329 | 3300048906 | Bacteria | 2740 |
| 834 | Ga0496103_0098323 | 3300048906 | Bacteria | 1850 |
| 835 | Ga0496103_0121012 | 3300048906 | Bacteria | 1667 |
| 836 | Ga0496103_0316085 | 3300048906 | Bacteria | 1004 |
| 837 | Ga0496104_0001904 | 3300048907 | Bacteria | 18078 |
| 838 | Ga0496104_0013010 | 3300048907 | Bacteria | 7493 |
| 839 | Ga0496104_0084737 | 3300048907 | Bacteria | 3024 |
| 840 | Ga0496104_0159692 | 3300048907 | Bacteria | 2162 |
| 841 | Ga0496104_0196151 | 3300048907 | Bacteria | 1931 |
| 842 | Ga0496104_0209351 | 3300048907 | Bacteria | 1862 |
| 843 | Ga0496104_0515962 | 3300048907 | Bacteria | 1106 |
| 844 | Ga0496104_0549804 | 3300048907 | Bacteria | 1065 |
| 845 | Ga0496105_0002041 | 3300048908 | Bacteria | 14603 |
| 846 | Ga0496105_0021534 | 3300048908 | Bacteria | 5216 |
| 847 | Ga0496106_0010397 | 3300048909 | Bacteria | 6876 |
| 848 | Ga0496106_0011583 | 3300048909 | Bacteria | 6517 |
| 849 | Ga0496106_0063855 | 3300048909 | Bacteria | 2799 |
| 850 | Ga0496106_0188841 | 3300048909 | Bacteria | 1637 |
| 851 | Ga0496106_0668654 | 3300048909 | Bacteria | 829 |
| 852 | Ga0496107_0008549 | 3300048910 | Bacteria | 7084 |
| 853 | Ga0496107_0028132 | 3300048910 | Bacteria | 3994 |
| 854 | Ga0496107_0116088 | 3300048910 | Bacteria | 1970 |
| 855 | Ga0496107_0139696 | 3300048910 | Bacteria | 1790 |
| 856 | Ga0496107_0373942 | 3300048910 | Bacteria | 1060 |
| 857 | Ga0496108_0013021 | 3300048911 | Bacteria | 6776 |
| 858 | Ga0496108_0019320 | 3300048911 | Bacteria | 5595 |
| 859 | Ga0496108_0033824 | 3300048911 | Bacteria | 4246 |
| 860 | Ga0496108_0857521 | 3300048911 | Bacteria | 781 |
| 861 | Ga0496109_0023038 | 3300048912 | Bacteria | 5522 |
| 862 | Ga0496109_0029705 | 3300048912 | Bacteria | 4897 |
| 863 | Ga0496109_0158598 | 3300048912 | Bacteria | 2119 |
| 864 | Ga0496109_0163060 | 3300048912 | Bacteria | 2089 |
| 865 | Ga0496109_0776515 | 3300048912 | Bacteria | 896 |
| 866 | Ga0496110_0116236 | 3300048913 | Bacteria | 2408 |
| 867 | Ga0496110_1051692 | 3300048913 | Unclassified | 722 |
| 868 | Ga0496110_1358607 | 3300048913 | Bacteria | 620 |
| 869 | Ga0496111_0009938 | 3300048914 | Bacteria | 6362 |
| 870 | Ga0496111_0030686 | 3300048914 | Bacteria | 3823 |
| 871 | Ga0496111_0195562 | 3300048914 | Bacteria | 1503 |
| 872 | Ga0496111_0226342 | 3300048914 | Bacteria | 1389 |
| 873 | Ga0496111_0630867 | 3300048914 | Bacteria | 783 |
| 874 | Ga0496112_0000520 | 3300048915 | Bacteria | 26242 |
| 875 | Ga0496112_0525294 | 3300048915 | Bacteria | 1118 |
| 876 | Ga0496112_1497682 | 3300048915 | Bacteria | 589 |
| 877 | Ga0496113_0043070 | 3300048916 | Bacteria | 3338 |
| 878 | Ga0496113_0325365 | 3300048916 | Bacteria | 1233 |
| 879 | Ga0496113_1153236 | 3300048916 | Bacteria | 606 |
| 880 | Ga0496114_0055845 | 3300048917 | Bacteria | 3294 |
| 881 | Ga0496114_0088502 | 3300048917 | Bacteria | 2626 |
| 882 | Ga0496114_0764433 | 3300048917 | Bacteria | 844 |
| 883 | Ga0496115_0040684 | 3300048918 | Bacteria | 3696 |
| 884 | Ga0496115_0096831 | 3300048918 | Bacteria | 2416 |
| 885 | Ga0496115_0113903 | 3300048918 | Bacteria | 2222 |
| 886 | Ga0496115_0114999 | 3300048918 | Bacteria | 2212 |
| 887 | Ga0496115_0474907 | 3300048918 | Bacteria | 1007 |
| 888 | Ga0496115_1051472 | 3300048918 | Bacteria | 620 |
| 889 | Ga0496119_0320688 | 3300048922 | Bacteria | 759 |
| 890 | Ga0501031_0123896 | 3300049568 | Bacteria | 1688 |
| 891 | Ga0501032_0045575 | 3300049569 | Bacteria | 2965 |
| 892 | Ga0501032_0059269 | 3300049569 | Bacteria | 2569 |
| 893 | Ga0501032_0089571 | 3300049569 | Bacteria | 2042 |
| 894 | Ga0501032_0288193 | 3300049569 | Bacteria | 1062 |
| 895 | Ga0501033_0054944 | 3300049570 | Bacteria | 2944 |
| 896 | Ga0501033_0076233 | 3300049570 | Bacteria | 2461 |
| 897 | Ga0501034_0000211 | 3300049571 | Bacteria | 110858 |
| 898 | Ga0501034_0003250 | 3300049571 | Bacteria | 18591 |
| 899 | Ga0501034_0011273 | 3300049571 | Bacteria | 9278 |
| 900 | Ga0501034_0114986 | 3300049571 | Bacteria | 2679 |
| 901 | Ga0501034_0119188 | 3300049571 | Bacteria | 2625 |
| 902 | Ga0501034_0214617 | 3300049571 | Bacteria | 1879 |
| 903 | Ga0501034_0398319 | 3300049571 | Bacteria | 1300 |
| 904 | Ga0501034_0467470 | 3300049571 | Bacteria | 1177 |
| 905 | Ga0501034_1169737 | 3300049571 | Bacteria | 648 |
| 906 | Ga0501034_1203019 | 3300049571 | Bacteria | 636 |
| 907 | Ga0501036_0012016 | 3300049572 | Bacteria | 7177 |
| 908 | Ga0501036_0050002 | 3300049572 | Bacteria | 3540 |
| 909 | Ga0501036_0455716 | 3300049572 | Bacteria | 1065 |
| 910 | Ga0501036_0620044 | 3300049572 | Bacteria | 896 |
| 911 | Ga0501037_0002596 | 3300049573 | Bacteria | 13040 |
| 912 | Ga0501037_0040990 | 3300049573 | Bacteria | 3406 |
| 913 | Ga0501037_0057305 | 3300049573 | Bacteria | 2844 |
| 914 | Ga0501037_0500297 | 3300049573 | Bacteria | 824 |
| 915 | Ga0501037_0781313 | 3300049573 | Bacteria | 631 |
| 916 | Ga0501038_0206825 | 3300049574 | Bacteria | 1572 |
| 917 | Ga0501038_0582875 | 3300049574 | Bacteria | 848 |
| 918 | Ga0501039_0020522 | 3300049575 | Bacteria | 5063 |
| 919 | Ga0501039_0437018 | 3300049575 | Bacteria | 1028 |
| 920 | Ga0501039_0726494 | 3300049575 | Bacteria | 776 |
| 921 | Ga0501040_0662657 | 3300049576 | Bacteria | 754 |
| 922 | Ga0501042_0180698 | 3300049578 | Bacteria | 1522 |
| 923 | Ga0501043_0061902 | 3300049579 | Bacteria | 2938 |
| 924 | Ga0501043_0229418 | 3300049579 | Bacteria | 1434 |
| 925 | Ga0501043_0319393 | 3300049579 | Bacteria | 1184 |
| 926 | Ga0501043_0369987 | 3300049579 | Bacteria | 1086 |
| 927 | Ga0501043_0512022 | 3300049579 | Bacteria | 895 |
| 928 | Ga0501046_0119499 | 3300049580 | Bacteria | 2006 |
| 929 | Ga0501046_0121205 | 3300049580 | Bacteria | 1989 |
| 930 | Ga0501046_0174145 | 3300049580 | Bacteria | 1613 |
| 931 | Ga0501046_0270306 | 3300049580 | Bacteria | 1247 |
| 932 | Ga0501046_0571493 | 3300049580 | Bacteria | 804 |
| 933 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 934 | Ga0501047_0076895 | 3300049581 | Bacteria | 3212 |
| 935 | Ga0501047_0149451 | 3300049581 | Bacteria | 2212 |
| 936 | Ga0501047_0184993 | 3300049581 | Bacteria | 1949 |
| 937 | Ga0501047_0210335 | 3300049581 | Bacteria | 1804 |
| 938 | Ga0501047_0325019 | 3300049581 | Bacteria | 1377 |
| 939 | Ga0501047_0395446 | 3300049581 | Bacteria | 1215 |
| 940 | Ga0501048_0000784 | 3300049582 | Bacteria | 23265 |
| 941 | Ga0501048_0194801 | 3300049582 | Bacteria | 1436 |
| 942 | Ga0501048_0329887 | 3300049582 | Bacteria | 1087 |
| 943 | Ga0501067_0016880 | 3300049583 | Bacteria | 4033 |
| 944 | Ga0501067_0044997 | 3300049583 | Bacteria | 2452 |
| 945 | Ga0501068_0012136 | 3300049584 | Bacteria | 4873 |
| 946 | Ga0501068_0027868 | 3300049584 | Bacteria | 3338 |
| 947 | Ga0501068_0092452 | 3300049584 | Bacteria | 1867 |
| 948 | Ga0501068_1044995 | 3300049584 | Bacteria | 539 |
| 949 | Ga0501069_0021060 | 3300049585 | Bacteria | 3536 |
| 950 | Ga0501069_0030179 | 3300049585 | Bacteria | 2976 |
| 951 | Ga0501069_0183300 | 3300049585 | Bacteria | 1210 |
| 952 | Ga0501069_0424322 | 3300049585 | Bacteria | 788 |
| 953 | Ga0501070_0012798 | 3300049586 | Bacteria | 7072 |
| 954 | Ga0501070_0036167 | 3300049586 | Bacteria | 4124 |
| 955 | Ga0501070_0077077 | 3300049586 | Bacteria | 2759 |
| 956 | Ga0501070_0080055 | 3300049586 | Bacteria | 2703 |
| 957 | Ga0501070_0157256 | 3300049586 | Bacteria | 1874 |
| 958 | Ga0501070_0174968 | 3300049586 | Bacteria | 1767 |
| 959 | Ga0501070_0407204 | 3300049586 | Bacteria | 1099 |
| 960 | Ga0501070_0425188 | 3300049586 | Bacteria | 1072 |
| 961 | Ga0501070_0488897 | 3300049586 | Bacteria | 989 |
| 962 | Ga0501071_0101832 | 3300049587 | Bacteria | 2117 |
| 963 | Ga0501071_0616289 | 3300049587 | Bacteria | 834 |
| 964 | Ga0501072_0023227 | 3300049588 | Bacteria | 4816 |
| 965 | Ga0501072_0161503 | 3300049588 | Bacteria | 1787 |
| 966 | Ga0501072_0256878 | 3300049588 | Bacteria | 1391 |
| 967 | Ga0501072_0541175 | 3300049588 | Bacteria | 920 |
| 968 | Ga0501073_0011704 | 3300049589 | Bacteria | 6405 |
| 969 | Ga0501073_0026355 | 3300049589 | Bacteria | 4166 |
| 970 | Ga0501073_0063098 | 3300049589 | Bacteria | 2584 |
| 971 | Ga0501073_0200807 | 3300049589 | Bacteria | 1379 |
| 972 | Ga0501073_0590934 | 3300049589 | Bacteria | 767 |
| 973 | Ga0501073_0880959 | 3300049589 | Bacteria | 616 |
| 974 | Ga0501074_0015467 | 3300049590 | Bacteria | 5546 |
| 975 | Ga0501074_0026995 | 3300049590 | Bacteria | 4160 |
| 976 | Ga0501074_0188316 | 3300049590 | Bacteria | 1471 |
| 977 | Ga0501074_0210681 | 3300049590 | Bacteria | 1384 |
| 978 | Ga0501074_1043945 | 3300049590 | Bacteria | 574 |
| 979 | Ga0501075_0151608 | 3300049591 | Bacteria | 1767 |
| 980 | Ga0501076_0210029 | 3300049592 | Bacteria | 1590 |
| 981 | Ga0501076_1351611 | 3300049592 | Bacteria | 586 |
| 982 | Ga0501077_0023345 | 3300049593 | Bacteria | 3922 |
| 983 | Ga0501077_0259530 | 3300049593 | Bacteria | 1105 |
| 984 | Ga0501079_0001490 | 3300049741 | Bacteria | 16573 |
| 985 | Ga0501079_0705058 | 3300049741 | Bacteria | 794 |
| 986 | Ga0501080_0090573 | 3300049742 | Bacteria | 2841 |
| 987 | Ga0501080_0124247 | 3300049742 | Bacteria | 2390 |
| 988 | Ga0501080_0125376 | 3300049742 | Bacteria | 2378 |
| 989 | Ga0501080_0151953 | 3300049742 | Bacteria | 2140 |
| 990 | Ga0501080_0376510 | 3300049742 | Bacteria | 1279 |
| 991 | Ga0501080_0795918 | 3300049742 | Bacteria | 829 |
| 992 | Ga0501081_0338156 | 3300049743 | Bacteria | 1108 |
| 993 | Ga0501083_0009626 | 3300049744 | Bacteria | 6827 |
| 994 | Ga0501083_0129901 | 3300049744 | Bacteria | 1651 |
| 995 | Ga0501083_0374712 | 3300049744 | Bacteria | 926 |
| 996 | Ga0501035_0002108 | 3300049822 | Bacteria | 19783 |
| 997 | Ga0501035_0025158 | 3300049822 | Bacteria | 5457 |
| 998 | Ga0501035_0257687 | 3300049822 | Bacteria | 1479 |
| 999 | Ga0501035_0398980 | 3300049822 | Bacteria | 1144 |
| 1000 | Ga0501035_0584438 | 3300049822 | Bacteria | 912 |
| 1001 | Ga0501035_0904897 | 3300049822 | Bacteria | 699 |
| 1002 | Ga0501044_0086065 | 3300049823 | Bacteria | 3175 |
| 1003 | Ga0501044_0422395 | 3300049823 | Bacteria | 1243 |
| 1004 | Ga0501044_0689648 | 3300049823 | Bacteria | 907 |
| 1005 | Ga0501045_0549322 | 3300049824 | Bacteria | 857 |
| 1006 | Ga0501045_0600342 | 3300049824 | Bacteria | 815 |
| 1007 | nmdc:mga03n38_471280_c1 | 3300050490 | Bacteria | 701 |
| 1008 | nmdc:mga06z11_11064_c1 | 3300050494 | Bacteria | 3874 |
| 1009 | nmdc:mga06z11_622479_c1 | 3300050494 | Bacteria | 657 |
| 1010 | nmdc:mga05p37_3652_c1 | 3300050507 | Bacteria | 17997 |
| 1011 | nmdc:mga05p37_5580_c1 | 3300050507 | Bacteria | 14793 |
| 1012 | nmdc:mga09592_1558720_c1 | 3300050508 | Bacteria | 536 |
| 1013 | nmdc:mga09592_714_c1 | 3300050508 | Bacteria | 25508 |
| 1014 | nmdc:mga0qj67_1449_c1 | 3300050509 | Bacteria | 16619 |
| 1015 | nmdc:mga06r32_1863_c1 | 3300050510 | Bacteria | 18774 |
| 1016 | nmdc:mga08y16_1194501_c1 | 3300050511 | Bacteria | 732 |
| 1017 | nmdc:mga08y16_1350709_c1 | 3300050511 | Bacteria | 678 |
| 1018 | nmdc:mga08y16_3547_c1 | 3300050511 | Bacteria | 16202 |
| 1019 | nmdc:mga08y16_3652_c1 | 3300050511 | Bacteria | 16005 |
| 1020 | nmdc:mga0n895_20971_c1 | 3300050512 | Bacteria | 6104 |
| 1021 | nmdc:mga0n895_4615_c1 | 3300050512 | Bacteria | 11357 |
| 1022 | nmdc:mga0n895_54609_c1 | 3300050512 | Bacteria | 3930 |
| 1023 | nmdc:mga0n895_63874_c1 | 3300050512 | Bacteria | 3641 |
| 1024 | nmdc:mga0rr50_1014913_c1 | 3300050513 | Unclassified | 707 |
| 1025 | nmdc:mga0rr50_117189_c1 | 3300050513 | Bacteria | 2115 |
| 1026 | nmdc:mga0rr50_253059_c1 | 3300050513 | Bacteria | 1463 |
| 1027 | nmdc:mga0rr50_33356_c1 | 3300050513 | Bacteria | 3677 |
| 1028 | nmdc:mga0rr50_510044_c1 | 3300050513 | Bacteria | 1023 |
| 1029 | nmdc:mga08x19_104028_c1 | 3300050514 | Bacteria | 1886 |
| 1030 | nmdc:mga08x19_938391_c1 | 3300050514 | Unclassified | 615 |
| 1031 | nmdc:mga0a205_17847_c1 | 3300050515 | Bacteria | 6659 |
| 1032 | nmdc:mga0a205_2116_c1 | 3300050515 | Bacteria | 17419 |
| 1033 | Ga0495601_0003041 | 3300053077 | Bacteria | 9559 |
| 1034 | Ga0495601_0016804 | 3300053077 | Bacteria | 4438 |
| 1035 | Ga0495601_0018616 | 3300053077 | Bacteria | 4227 |
| 1036 | Ga0495601_0029013 | 3300053077 | Bacteria | 3429 |
| 1037 | Ga0495601_0032983 | 3300053077 | Bacteria | 3225 |
| 1038 | Ga0495601_0146683 | 3300053077 | Bacteria | 1540 |
| 1039 | Ga0495612_0006375 | 3300053078 | Bacteria | 4857 |
| 1040 | Ga0495612_0016428 | 3300053078 | Bacteria | 2966 |
| 1041 | Ga0495612_0018815 | 3300053078 | Bacteria | 2765 |
| 1042 | Ga0495612_0041646 | 3300053078 | Bacteria | 1873 |
| 1043 | Ga0495612_0119603 | 3300053078 | Bacteria | 1132 |
| 1044 | Ga0495612_0234324 | 3300053078 | Bacteria | 814 |
| 1045 | Ga0495612_0408857 | 3300053078 | Bacteria | 617 |
| 1046 | Ga0495595_0000337 | 3300053084 | Bacteria | 18087 |
| 1047 | Ga0495595_0000525 | 3300053084 | Bacteria | 14621 |
| 1048 | Ga0495595_0016453 | 3300053084 | Bacteria | 3164 |
| 1049 | Ga0495595_0072786 | 3300053084 | Bacteria | 1627 |
| 1050 | Ga0495595_0091400 | 3300053084 | Bacteria | 1460 |
| 1051 | Ga0495595_0180254 | 3300053084 | Unclassified | 1047 |
| 1052 | Ga0495595_0207116 | 3300053084 | Bacteria | 977 |
| 1053 | Ga0495619_0000043 | 3300053085 | Bacteria | 109865 |
| 1054 | Ga0495619_0000333 | 3300053085 | Bacteria | 33042 |
| 1055 | Ga0495619_0000405 | 3300053085 | Bacteria | 29348 |
| 1056 | Ga0495619_0006520 | 3300053085 | Bacteria | 7387 |
| 1057 | Ga0495619_0006915 | 3300053085 | Bacteria | 7172 |
| 1058 | Ga0495619_0009776 | 3300053085 | Bacteria | 6048 |
| 1059 | Ga0495619_0012577 | 3300053085 | Bacteria | 5328 |
| 1060 | Ga0495619_0016850 | 3300053085 | Bacteria | 4627 |
| 1061 | Ga0500651_0045526 | 3300053093 | Bacteria | 2760 |
| 1062 | Ga0500641_0001180 | 3300053096 | Bacteria | 9311 |
| 1063 | Ga0500655_018226 | 3300053133 | Unclassified | 1303 |
| 1064 | Ga0501084_0223084 | 3300054114 | Bacteria | 1590 |
| 1065 | Ga0501082_0059799 | 3300060353 | Bacteria | 3283 |
| 1066 | Ga0501082_0459592 | 3300060353 | Bacteria | 1112 |
| 1067 | Ga0501082_0476869 | 3300060353 | Bacteria | 1090 |
| 1068 | Ga0501082_0885052 | 3300060353 | Bacteria | 781 |
| 1069 | Ga0501082_1592165 | 3300060353 | Bacteria | 570 |
| 1070 | Ga0501082_1605047 | 3300060353 | Bacteria | 568 |
| 1071 | Ga0530510_0194729 | 3300061734 | Bacteria | 1505 |
| 1072 | Ga0373946_0162633 | |||
| 1073 | 2214544907 | |||
| 1074 | ARSoilYngRDRAFT_c00070 | |||
| 1075 | ARcpr5yngRDRAFT_c000043 | |||
| 1076 | ARSoilOldRDRAFT_c000047 | |||
| 1077 | ARCol0yngRDRAFT_1000027 | |||
| 1078 | JGI24737J22298_10001922 | |||
| 1079 | JGI24035J26624_1033123 | |||
| 1080 | JGI26129J50193_1005822 | |||
| 1081 | JGI26145J50221_1033792 | |||
| 1082 | JGI25405J52794_10003919 | |||
| 1083 | Ga0065714_10267576 | |||
| 1084 | Ga0065704_10072440 | |||
| 1085 | Ga0065712_10002336 | |||
| 1086 | Ga0065712_10072434 | |||
| 1087 | Ga0065715_10001032 | |||
| 1088 | Ga0065715_10002398 | |||
| 1089 | Ga0070658_10019414 | |||
| 1090 | Ga0070658_10284183 | |||
| 1091 | Ga0070676_10032919 | |||
| 1092 | Ga0070676_10662816 | |||
| 1093 | Ga0070683_100053087 | |||
| 1094 | Ga0070683_100420172 | |||
| 1095 | Ga0070690_100024375 | |||
| 1096 | Ga0070690_100028881 | |||
| 1097 | Ga0070690_100167386 | |||
| 1098 | Ga0070670_100239964 | |||
| 1099 | Ga0070670_100285636 | |||
| 1100 | Ga0070670_101607530 | |||
| 1101 | Ga0070677_10000677 | |||
| 1102 | Ga0068869_100283008 | |||
| 1103 | Ga0068869_100718018 | |||
| 1104 | Ga0070666_10098868 | |||
| 1105 | Ga0070680_100009897 | |||
| 1106 | Ga0070680_100013833 | |||
| 1107 | Ga0070680_100020270 | |||
| 1108 | Ga0070680_100023290 | |||
| 1109 | Ga0070680_100026950 | |||
| 1110 | Ga0070680_100100236 | |||
| 1111 | Ga0070680_100485627 | |||
| 1112 | Ga0070680_100597644 | |||
| 1113 | Ga0070682_100022819 | |||
| 1114 | Ga0070682_100128902 | |||
| 1115 | Ga0070682_100514128 | |||
| 1116 | Ga0068868_100516961 | |||
| 1117 | Ga0070660_100002005 | |||
| 1118 | Ga0070660_100004632 | |||
| 1119 | Ga0070660_100041291 | |||
| 1120 | Ga0070660_100059038 | |||
| 1121 | Ga0070660_100059853 | |||
| 1122 | Ga0070660_100065885 | |||
| 1123 | Ga0070660_100486464 | |||
| 1124 | Ga0070689_100377583 | |||
| 1125 | Ga0070689_100468232 | |||
| 1126 | Ga0070687_100041535 | |||
| 1127 | Ga0070687_100111046 | |||
| 1128 | Ga0070687_100133143 | |||
| 1129 | Ga0070687_100248022 | |||
| 1130 | Ga0070687_100449661 | |||
| 1131 | Ga0070661_100072176 | |||
| 1132 | Ga0070661_100364980 | |||
| 1133 | Ga0070661_100570855 | |||
| 1134 | Ga0070692_10004569 | |||
| 1135 | Ga0070668_100119182 | |||
| 1136 | Ga0070668_100180093 | |||
| 1137 | Ga0070669_100016220 | |||
| 1138 | Ga0070675_100018511 | |||
| 1139 | Ga0070675_100140249 | |||
| 1140 | Ga0070671_100015777 | |||
| 1141 | Ga0070671_100459852 | |||
| 1142 | Ga0070671_100541485 | |||
| 1143 | Ga0070674_100028093 | |||
| 1144 | Ga0070674_100103022 | |||
| 1145 | Ga0070674_100293954 | |||
| 1146 | Ga0070673_100000255 | |||
| 1147 | Ga0070673_100298930 | |||
| 1148 | Ga0070688_100028065 | |||
| 1149 | Ga0070659_100960564 | |||
| 1150 | Ga0070667_100017357 | |||
| 1151 | Ga0070667_100094283 | |||
| 1152 | Ga0070667_100276034 | |||
| 1153 | Ga0070667_100392722 | |||
| 1154 | Ga0070703_10008671 | |||
| 1155 | Ga0070709_10044618 | |||
| 1156 | Ga0070709_10167627 | |||
| 1157 | Ga0070714_100041120 | |||
| 1158 | Ga0070714_100045002 | |||
| 1159 | Ga0070714_100228879 | |||
| 1160 | Ga0070714_100267112 | |||
| 1161 | Ga0070714_101265039 | |||
| 1162 | Ga0070713_100104840 | |||
| 1163 | Ga0070713_100144031 | |||
| 1164 | Ga0070713_100262538 | |||
| 1165 | Ga0070713_101498795 | |||
| 1166 | Ga0070710_10131622 | |||
| 1167 | Ga0070701_10092619 | |||
| 1168 | Ga0070711_100032264 | |||
| 1169 | Ga0070711_100048815 | |||
| 1170 | Ga0070711_100080886 | |||
| 1171 | Ga0070711_100127304 | |||
| 1172 | Ga0070711_100186716 | |||
| 1173 | Ga0070711_100200657 | |||
| 1174 | Ga0070711_100958262 | |||
| 1175 | Ga0070711_101481379 | |||
| 1176 | Ga0070705_100035185 | |||
| 1177 | Ga0070705_100057750 | |||
| 1178 | Ga0070705_100116182 | |||
| 1179 | Ga0070705_100748054 | |||
| 1180 | Ga0070700_100812943 | |||
| 1181 | Ga0070694_100002689 | |||
| 1182 | Ga0070694_100769137 | |||
| 1183 | Ga0070708_100486404 | |||
| 1184 | Ga0070663_100053406 | |||
| 1185 | Ga0070678_100479328 | |||
| 1186 | Ga0070678_100717645 | |||
| 1187 | Ga0070678_101337458 | |||
| 1188 | Ga0070662_100006353 | |||
| 1189 | Ga0070662_100190499 | |||
| 1190 | Ga0070662_100262622 | |||
| 1191 | Ga0070662_100533893 | |||
| 1192 | Ga0070681_10030461 | |||
| 1193 | Ga0070681_10143539 | |||
| 1194 | Ga0070681_10176707 | |||
| 1195 | Ga0070681_10272939 | |||
| 1196 | Ga0070681_11407656 | |||
| 1197 | Ga0070681_11408980 | |||
| 1198 | Ga0068867_100298668 | |||
| 1199 | Ga0068867_102018976 | |||
| 1200 | Ga0070685_10009552 | |||
| 1201 | Ga0070685_10033256 | |||
| 1202 | Ga0070699_101275724 | |||
| 1203 | Ga0070699_101333816 | |||
| 1204 | Ga0070679_100006208 | |||
| 1205 | Ga0070679_100038245 | |||
| 1206 | Ga0070679_100135759 | |||
| 1207 | Ga0070679_100141809 | |||
| 1208 | Ga0070679_100309344 | |||
| 1209 | Ga0070679_100463540 | |||
| 1210 | Ga0070679_100967421 | |||
| 1211 | Ga0070684_100013666 | |||
| 1212 | Ga0070684_100036747 | |||
| 1213 | Ga0070684_100061157 | |||
| 1214 | Ga0070684_100420727 | |||
| 1215 | Ga0070697_100342282 | |||
| 1216 | Ga0068853_100088369 | |||
| 1217 | Ga0068853_101203413 | |||
| 1218 | Ga0070686_100007712 | |||
| 1219 | Ga0070686_100010718 | |||
| 1220 | Ga0070686_100362408 | |||
| 1221 | Ga0070686_101245662 | |||
| 1222 | Ga0070695_100022979 | |||
| 1223 | Ga0070695_100092809 | |||
| 1224 | Ga0070696_100019739 | |||
| 1225 | Ga0070696_100047338 | |||
| 1226 | Ga0070696_100047966 | |||
| 1227 | Ga0070696_100117942 | |||
| 1228 | Ga0070693_100009300 | |||
| 1229 | Ga0070693_100121597 | |||
| 1230 | Ga0070693_100125414 | |||
| 1231 | Ga0070704_100002044 | |||
| 1232 | Ga0070704_100010230 | |||
| 1233 | Ga0070704_102126807 | |||
| 1234 | Ga0068855_100038030 | |||
| 1235 | Ga0068855_100219705 | |||
| 1236 | Ga0068855_100269713 | |||
| 1237 | Ga0070664_100411669 | |||
| 1238 | Ga0070664_100808148 | |||
| 1239 | Ga0068857_100120265 | |||
| 1240 | Ga0068857_100250051 | |||
| 1241 | Ga0068854_100096026 | |||
| 1242 | Ga0068854_101634436 | |||
| 1243 | Ga0068856_100213107 | |||
| 1244 | Ga0068856_100223126 | |||
| 1245 | Ga0068856_100512498 | |||
| 1246 | Ga0068856_100578881 | |||
| 1247 | Ga0068856_100655776 | |||
| 1248 | Ga0070702_100031250 | |||
| 1249 | Ga0070702_100401407 | |||
| 1250 | Ga0068852_100014845 | |||
| 1251 | Ga0068852_100143760 | |||
| 1252 | Ga0068852_101290022 | |||
| 1253 | Ga0068852_101471827 | |||
| 1254 | Ga0068859_100011201 | |||
| 1255 | Ga0068859_100060897 | |||
| 1256 | Ga0068866_10004084 | |||
| 1257 | Ga0068866_10149670 | |||
| 1258 | Ga0068861_100012446 | |||
| 1259 | Ga0068861_101181174 | |||
| 1260 | Ga0068851_10419441 | |||
| 1261 | Ga0068870_10682419 | |||
| 1262 | Ga0068858_100089734 | |||
| 1263 | Ga0068858_100742742 | |||
| 1264 | Ga0068860_100079707 | |||
| 1265 | Ga0068860_100096697 | |||
| 1266 | Ga0068860_100099546 | |||
| 1267 | Ga0068860_102070090 | |||
| 1268 | Ga0068862_100002658 | |||
| 1269 | Ga0068862_100245568 | |||
| 1270 | Ga0068862_101232422 | |||
| 1271 | Ga0081455_10000009 | |||
| 1272 | Ga0081455_10007711 | |||
| 1273 | Ga0081455_10680515 | |||
| 1274 | Ga0081540_1027731 | |||
| 1275 | Ga0070717_10048664 | |||
| 1276 | Ga0070717_10106660 | |||
| 1277 | Ga0075432_10008112 | |||
| 1278 | Ga0075432_10042732 | |||
| 1279 | Ga0075432_10054797 | |||
| 1280 | Ga0070715_10291194 | |||
| 1281 | Ga0070715_10407091 | |||
| 1282 | Ga0070716_100186803 | |||
| 1283 | Ga0070712_100159477 | |||
| 1284 | Ga0070712_100169264 | |||
| 1285 | Ga0070712_100467989 | |||
| 1286 | Ga0070712_100620393 | |||
| 1287 | Ga0070712_100794227 | |||
| 1288 | Ga0075427_10001451 | |||
| 1289 | Ga0097621_100057274 | |||
| 1290 | Ga0097621_100135984 | |||
| 1291 | Ga0097621_101789411 | |||
| 1292 | Ga0075370_10913201 | |||
| 1293 | Ga0068871_100024571 | |||
| 1294 | Ga0075428_100015961 | |||
| 1295 | Ga0075430_100002634 | |||
| 1296 | Ga0075431_100003630 | |||
| 1297 | Ga0075433_10000215 | |||
| 1298 | Ga0075433_10235105 | |||
| 1299 | Ga0075434_100001991 | |||
| 1300 | Ga0075434_100059088 | |||
| 1301 | Ga0075429_100002688 | |||
| 1302 | Ga0075429_100924060 | |||
| 1303 | Ga0068865_100810042 | |||
| 1304 | Ga0075436_100184815 | |||
| 1305 | Ga0075436_100264850 | |||
| 1306 | Ga0097620_100011201 | |||
| 1307 | Ga0097620_100060901 | |||
| 1308 | Ga0075435_100007981 | |||
| 1309 | Ga0075435_100066715 | |||
| 1310 | Ga0075435_100218531 | |||
| 1311 | Ga0075435_101134762 | |||
| 1312 | Ga0105251_10056491 | |||
| 1313 | Ga0105251_10099896 | |||
| 1314 | Ga0105240_10066233 | |||
| 1315 | Ga0105240_10650210 | |||
| 1316 | Ga0105240_10926383 | |||
| 1317 | Ga0105240_11091847 | |||
| 1318 | Ga0111539_10001588 | |||
| 1319 | Ga0111539_10008998 | |||
| 1320 | Ga0111539_10104213 | |||
| 1321 | Ga0111539_11555143 | |||
| 1322 | Ga0105245_10095625 | |||
| 1323 | Ga0105245_10261154 | |||
| 1324 | Ga0105247_10013175 | |||
| 1325 | Ga0105247_10078238 | |||
| 1326 | Ga0105247_10106779 | |||
| 1327 | Ga0105247_10185323 | |||
| 1328 | Ga0105247_10264520 | |||
| 1329 | Ga0114129_10008124 | |||
| 1330 | Ga0114129_10008445 | |||
| 1331 | Ga0105243_10137800 | |||
| 1332 | Ga0105243_10412734 | |||
| 1333 | Ga0105243_11222977 | |||
| 1334 | Ga0105241_10012702 | |||
| 1335 | Ga0105241_10059957 | |||
| 1336 | Ga0105241_10128270 | |||
| 1337 | Ga0105242_10004424 | |||
| 1338 | Ga0105242_10213652 | |||
| 1339 | Ga0105242_11161773 | |||
| 1340 | Ga0105248_10010513 | |||
| 1341 | Ga0105248_10098855 | |||
| 1342 | Ga0105248_10965915 | |||
| 1343 | Ga0105237_10014708 | |||
| 1344 | Ga0105237_10032544 | |||
| 1345 | Ga0105237_10075611 | |||
| 1346 | Ga0105238_10042664 | |||
| 1347 | Ga0105238_10128853 | |||
| 1348 | Ga0105238_10134227 | |||
| 1349 | Ga0105238_12620923 | |||
| 1350 | Ga0105249_10007257 | |||
| 1351 | Ga0105249_10063203 | |||
| 1352 | Ga0105239_10352838 | |||
| 1353 | Ga0105239_11088212 | |||
| 1354 | Ga0105246_10086388 | |||
| 1355 | Ga0105246_10144787 | |||
| 1356 | Ga0157342_1006506 | |||
| 1357 | Ga0157316_1086012 | |||
| 1358 | Ga0157326_1005229 | |||
| 1359 | Ga0157338_1002982 | |||
| 1360 | Ga0157373_10041889 | |||
| 1361 | Ga0157371_10030517 | |||
| 1362 | Ga0157371_10050502 | |||
| 1363 | Ga0157371_10067753 | |||
| 1364 | Ga0157371_10699682 | |||
| 1365 | Ga0157370_10103404 | |||
| 1366 | Ga0157370_10630457 | |||
| 1367 | Ga0157369_10299762 | |||
| 1368 | Ga0157369_10435835 | |||
| 1369 | Ga0157369_10792375 | |||
| 1370 | Ga0157374_10010431 | |||
| 1371 | Ga0157374_10377691 | |||
| 1372 | Ga0157374_10392179 | |||
| 1373 | Ga0157374_12774910 | |||
| 1374 | Ga0157378_10013910 | |||
| 1375 | Ga0157378_10208723 | |||
| 1376 | Ga0157378_10211096 | |||
| 1377 | Ga0157378_10298705 | |||
| 1378 | Ga0163162_10135662 | |||
| 1379 | Ga0163162_10179571 | |||
| 1380 | Ga0157372_10079573 | |||
| 1381 | Ga0157372_10273554 | |||
| 1382 | Ga0157372_10499287 | |||
| 1383 | Ga0157375_10032055 | |||
| 1384 | Ga0157375_10249621 | |||
| 1385 | Ga0157375_10849761 | |||
| 1386 | Ga0163163_10012423 | |||
| 1387 | Ga0163163_10013602 | |||
| 1388 | Ga0157380_10042945 | |||
| 1389 | Ga0157377_10000240 | |||
| 1390 | Ga0157377_10051480 | |||
| 1391 | Ga0157379_10005177 | |||
| 1392 | Ga0157379_10080639 | |||
| 1393 | Ga0157379_10090623 | |||
| 1394 | Ga0157379_11062064 | |||
| 1395 | Ga0157379_11755730 | |||
| 1396 | Ga0157376_10003312 | |||
| 1397 | Ga0157376_10083195 | |||
| 1398 | Ga0157376_10801883 | |||
| 1399 | Ga0157376_11050228 | |||
| 1400 | Ga0163161_10194928 | |||
| 1401 | Ga0163161_10318552 | |||
| 1402 | Ga0206353_10912259 | |||
| 1403 | Ga0213876_10099297 | |||
| 1404 | Ga0213876_10135708 | |||
| 1405 | Ga0207666_1002040 | |||
| 1406 | Ga0207697_10004957 | |||
| 1407 | Ga0207653_10003884 | |||
| 1408 | Ga0207692_10011972 | |||
| 1409 | Ga0207692_10016281 | |||
| 1410 | Ga0207692_10066772 | |||
| 1411 | Ga0207692_10248956 | |||
| 1412 | Ga0207642_10014306 | |||
| 1413 | Ga0207710_10026649 | |||
| 1414 | Ga0207710_10069084 | |||
| 1415 | Ga0207688_10019028 | |||
| 1416 | Ga0207680_10727632 | |||
| 1417 | Ga0207647_10037802 | |||
| 1418 | Ga0207685_10023862 | |||
| 1419 | Ga0207699_10004579 | |||
| 1420 | Ga0207699_10005624 | |||
| 1421 | Ga0207699_10105731 | |||
| 1422 | Ga0207699_10147340 | |||
| 1423 | Ga0207645_10048112 | |||
| 1424 | Ga0207645_10443135 | |||
| 1425 | Ga0207645_10744116 | |||
| 1426 | Ga0207654_10221302 | |||
| 1427 | Ga0207707_10007972 | |||
| 1428 | Ga0207707_10015798 | |||
| 1429 | Ga0207707_10074155 | |||
| 1430 | Ga0207707_10200543 | |||
| 1431 | Ga0207707_10229861 | |||
| 1432 | Ga0207695_10142546 | |||
| 1433 | Ga0207695_10604817 | |||
| 1434 | Ga0207671_10042353 | |||
| 1435 | Ga0207671_10347525 | |||
| 1436 | Ga0207693_10027515 | |||
| 1437 | Ga0207693_10180346 | |||
| 1438 | Ga0207693_10210845 | |||
| 1439 | Ga0207693_10284603 | |||
| 1440 | Ga0207693_10653159 | |||
| 1441 | Ga0207663_10016764 | |||
| 1442 | Ga0207663_10060759 | |||
| 1443 | Ga0207663_10066265 | |||
| 1444 | Ga0207663_10204796 | |||
| 1445 | Ga0207663_10433102 | |||
| 1446 | Ga0207663_10587971 | |||
| 1447 | Ga0207663_10887062 | |||
| 1448 | Ga0207663_11355244 | |||
| 1449 | Ga0207660_10025258 | |||
| 1450 | Ga0207660_10031041 | |||
| 1451 | Ga0207660_10038443 | |||
| 1452 | Ga0207660_10243304 | |||
| 1453 | Ga0207660_10254838 | |||
| 1454 | Ga0207660_10584368 | |||
| 1455 | Ga0207662_10008126 | |||
| 1456 | Ga0207662_10010377 | |||
| 1457 | Ga0207662_10104243 | |||
| 1458 | Ga0207662_10136862 | |||
| 1459 | Ga0207657_10013699 | |||
| 1460 | Ga0207657_10024313 | |||
| 1461 | Ga0207657_10037506 | |||
| 1462 | Ga0207657_10038255 | |||
| 1463 | Ga0207657_10233000 | |||
| 1464 | Ga0207657_10350272 | |||
| 1465 | Ga0207649_10260613 | |||
| 1466 | Ga0207649_10755619 | |||
| 1467 | Ga0207652_10021283 | |||
| 1468 | Ga0207652_10021687 | |||
| 1469 | Ga0207652_10088833 | |||
| 1470 | Ga0207652_10335404 | |||
| 1471 | Ga0207652_10869977 | |||
| 1472 | Ga0207646_10416498 | |||
| 1473 | Ga0207681_10067102 | |||
| 1474 | Ga0207694_10598258 | |||
| 1475 | Ga0207650_10032643 | |||
| 1476 | Ga0207650_10089960 | |||
| 1477 | Ga0207650_10228704 | |||
| 1478 | Ga0207659_10055540 | |||
| 1479 | Ga0207687_10159028 | |||
| 1480 | Ga0207700_10002272 | |||
| 1481 | Ga0207700_10246304 | |||
| 1482 | Ga0207700_10298168 | |||
| 1483 | Ga0207664_10083642 | |||
| 1484 | Ga0207664_10085037 | |||
| 1485 | Ga0207664_10092615 | |||
| 1486 | Ga0207664_10345365 | |||
| 1487 | Ga0207644_10014800 | |||
| 1488 | Ga0207644_10561439 | |||
| 1489 | Ga0207690_10198092 | |||
| 1490 | Ga0207690_11186755 | |||
| 1491 | Ga0207706_10012224 | |||
| 1492 | Ga0207706_10040156 | |||
| 1493 | Ga0207706_10355946 | |||
| 1494 | Ga0207706_10914411 | |||
| 1495 | Ga0207686_10032361 | |||
| 1496 | Ga0207686_10242797 | |||
| 1497 | Ga0207709_10160658 | |||
| 1498 | Ga0207709_10262764 | |||
| 1499 | Ga0207709_10922031 | |||
| 1500 | Ga0207670_10219884 | |||
| 1501 | Ga0207670_11001045 | |||
| 1502 | Ga0207669_10188652 | |||
| 1503 | Ga0207669_10255890 | |||
| 1504 | Ga0207669_10426675 | |||
| 1505 | Ga0207704_10055382 | |||
| 1506 | Ga0207704_10363737 | |||
| 1507 | Ga0207665_10001471 | |||
| 1508 | Ga0207665_10084415 | |||
| 1509 | Ga0207691_10168625 | |||
| 1510 | Ga0207691_10204014 | |||
| 1511 | Ga0207691_10279728 | |||
| 1512 | Ga0207711_10053237 | |||
| 1513 | Ga0207711_10076219 | |||
| 1514 | Ga0207711_10941853 | |||
| 1515 | Ga0207689_10199835 | |||
| 1516 | Ga0207689_10290770 | |||
| 1517 | Ga0207661_10152218 | |||
| 1518 | Ga0207661_10244868 | |||
| 1519 | Ga0207679_10345753 | |||
| 1520 | Ga0207679_10659465 | |||
| 1521 | Ga0207679_10762004 | |||
| 1522 | Ga0207667_10130869 | |||
| 1523 | Ga0207667_10539762 | |||
| 1524 | Ga0207667_10551166 | |||
| 1525 | Ga0207667_11088897 | |||
| 1526 | Ga0207667_11896952 | |||
| 1527 | Ga0207651_10019390 | |||
| 1528 | Ga0207651_10914355 | |||
| 1529 | Ga0207712_10809637 | |||
| 1530 | Ga0207668_10407432 | |||
| 1531 | Ga0207640_10549423 | |||
| 1532 | Ga0207640_11746005 | |||
| 1533 | Ga0207658_10151064 | |||
| 1534 | Ga0207658_10182302 | |||
| 1535 | Ga0207658_10322345 | |||
| 1536 | Ga0207658_10846736 | |||
| 1537 | Ga0207703_10177361 | |||
| 1538 | Ga0207703_10697962 | |||
| 1539 | Ga0207639_10426935 | |||
| 1540 | Ga0207639_10702978 | |||
| 1541 | Ga0207639_11333068 | |||
| 1542 | Ga0207678_10013090 | |||
| 1543 | Ga0207678_10037906 | |||
| 1544 | Ga0207708_10005734 | |||
| 1545 | Ga0207708_10655696 | |||
| 1546 | Ga0207702_10161179 | |||
| 1547 | Ga0207702_10446922 | |||
| 1548 | Ga0207702_11127662 | |||
| 1549 | Ga0207702_11131617 | |||
| 1550 | Ga0207648_10013903 | |||
| 1551 | Ga0207648_10078303 | |||
| 1552 | Ga0207676_10221629 | |||
| 1553 | Ga0207676_10292169 | |||
| 1554 | Ga0207676_10330084 | |||
| 1555 | Ga0207674_10115242 | |||
| 1556 | Ga0207675_100026434 | |||
| 1557 | Ga0207675_100044811 | |||
| 1558 | Ga0207675_100649183 | |||
| 1559 | Ga0207683_10000637 | |||
| 1560 | Ga0207683_10003484 | |||
| 1561 | Ga0207683_10221944 | |||
| 1562 | Ga0207683_10701901 | |||
| 1563 | Ga0207698_10099642 | |||
| 1564 | Ga0207698_10141023 | |||
| 1565 | Ga0207698_10954587 | |||
| 1566 | Ga0207698_11144337 | |||
| 1567 | Ga0209969_1029322 | |||
| 1568 | Ga0209982_1063422 | |||
| 1569 | Ga0210002_1018275 | |||
| 1570 | Ga0209966_1002882 | |||
| 1571 | Ga0209998_10001644 | |||
| 1572 | Ga0209998_10002534 | |||
| 1573 | Ga0209813_10184459 | |||
| 1574 | Ga0209974_10011146 | |||
| 1575 | Ga0209974_10032112 | |||
| 1576 | Ga0207428_10000216 | |||
| 1577 | Ga0207428_10003413 | |||
| 1578 | Ga0207428_10441756 | |||
| 1579 | Ga0268266_10073574 | |||
| 1580 | Ga0268264_10021057 | |||
| 1581 | Ga0268264_10035058 | |||
| 1582 | Ga0268264_10266637 | |||
| 1583 | Ga0265337_1006048 | |||
| 1584 | Ga0265338_10019445 | |||
| 1585 | Ga0265338_10370517 | |||
| 1586 | Ga0265324_10057089 | |||
| 1587 | Ga0265330_10009349 | |||
| 1588 | Ga0265332_10193662 | |||
| 1589 | Ga0265325_10000048 | |||
| 1590 | Ga0265325_10002795 | |||
| 1591 | Ga0265340_10294916 | |||
| 1592 | Ga0265339_10092760 | |||
| 1593 | Ga0265339_10253327 | |||
| 1594 | Ga0265339_10422707 | |||
| 1595 | Ga0265316_10304513 | |||
| 1596 | Ga0307408_101593076 | |||
| 1597 | Ga0265313_10001040 | |||
| 1598 | Ga0265313_10062629 | |||
| 1599 | Ga0265313_10072518 | |||
| 1600 | Ga0265313_10104320 | |||
| 1601 | Ga0265314_10012970 | |||
| 1602 | Ga0265314_10013779 | |||
| 1603 | Ga0265314_10107338 | |||
| 1604 | Ga0265342_10001167 | |||
| 1605 | Ga0265342_10038412 | |||
| 1606 | Ga0307416_101348522 | |||
| 1607 | Ga0307416_101488664 | |||
| 1608 | Ga0373930_0000195 | |||
| 1609 | Ga0373948_0000184 | |||
| 1610 | Ga0373948_0002050 | |||
| 1611 | Ga0373948_0080489 | |||
| 1612 | Ga0373958_0000536 | |||
| 1613 | Ga0373958_0017470 | |||
| 1614 | Ga0373958_0112284 | |||
| 1615 | Ga0373938_0000244 | |||
| 1616 | Ga0373938_0003184 | |||
| 1617 | Ga0373926_0238562 | |||
| 1618 | Ga0373928_0000913 | |||
| 1619 | Ga0373928_0015463 | |||
| 1620 | Ga0373928_0030076 | |||
| 1621 | Ga0373929_0000485 | |||
| 1622 | Ga0373934_0056483 | |||
| 1623 | Ga0373940_0003410 | |||
| 1624 | Ga0373944_0003351 | |||
| 1625 | Ga0373944_0129726 | |||
| 1626 | Ga0373949_0001916 | |||
| 1627 | Ga0373951_0000488 | |||
| 1628 | Ga0373951_0006475 | |||
| 1629 | Ga0373951_0009239 | |||
| 1630 | Ga0373951_0013143 | |||
| 1631 | Ga0373952_0013828 | |||
| 1632 | Ga0373952_0014806 | |||
| 1633 | Ga0373923_0006436 | |||
| 1634 | Ga0373923_0037821 | |||
| 1635 | Ga0373923_0053042 | |||
| 1636 | Ga0373923_0152950 | |||
| 1637 | Ga0373923_0277459 | |||
| 1638 | Ga0373932_0000474 | |||
| 1639 | Ga0373932_0010986 | |||
| 1640 | Ga0373936_0001095 | |||
| 1641 | Ga0373936_0423109 | |||
| 1642 | Ga0373939_0003026 | |||
| 1643 | Ga0373939_0009971 | |||
| 1644 | Ga0373939_0036871 | |||
| 1645 | Ga0373941_0000598 | |||
| 1646 | Ga0373941_0001282 | |||
| 1647 | Ga0373941_0031575 | |||
| 1648 | Ga0373945_0004964 | |||
| 1649 | Ga0373945_0064074 | |||
| 1650 | Ga0373953_0045167 | |||
| 1651 | Ga0373953_0329677 | |||
| 1652 | Ga0373954_0001049 | |||
| 1653 | Ga0373954_0007478 | |||
| 1654 | Ga0373954_0022383 | |||
| 1655 | Ga0373954_0145592 | |||
| 1656 | Ga0373956_0012907 | |||
| 1657 | Ga0373956_0027704 | |||
| 1658 | Ga0373956_0225722 | |||
| 1659 | Ga0373957_0048717 | |||
| 1660 | Ga0373957_0105672 | |||
| 1661 | Ga0373957_0184433 | |||
| 1662 | Ga0373960_0002102 | |||
| 1663 | Ga0373960_0010943 | |||
| 1664 | Ga0373960_0140885 | |||
| 1665 | Ga0373943_0007130 | |||
| 1666 | Ga0373943_0308913 | |||
| 1667 | Ga0373943_0430409 | |||
| 1668 | Ga0373946_0162920 | |||
| 1669 | Ga0373946_0202778 | |||
| 1670 | Ga0373955_0002451 | |||
| 1671 | Ga0373955_0004483 | |||
| 1672 | Ga0373955_0028546 | |||
| 1673 | Ga0373955_0038348 | |||
| 1674 | Ga0373955_0374197 | |||
| 1675 | Ga0373942_0012221 | |||
| 1676 | Ga0373961_0010502 | |||
| 1677 | Ga0373961_0044103 | |||
| 1678 | Ga0373962_0001456 | |||
| 1679 | Ga0373924_0012343 | |||
| 1680 | Ga0373924_0053727 | |||
| 1681 | Ga0373931_0006069 | |||
| 1682 | Ga0373931_0058742 | |||
| 1683 | Ga0373931_0078670 | |||
| 1684 | Ga0373931_0202490 | |||
| 1685 | Ga0373935_0047238 | |||
| 1686 | Ga0373935_0154529 | |||
| 1687 | Ga0373935_0217937 | |||
| 1688 | Ga0373927_0004039 | |||
| 1689 | Ga0373927_0236385 | |||
| 1690 | Ga0373933_0004781 | |||
| 1691 | Ga0373933_0006526 | |||
| 1692 | Ga0373933_0012091 | |||
| 1693 | Ga0373933_0072025 | |||
| 1694 | Ga0373947_0006399 | |||
| 1695 | Ga0373947_0073431 | |||
| 1696 | Ga0373947_0322930 | |||
| 1697 | Ga0373937_0001398 | |||
| 1698 | Ga0373937_0005069 | |||
| 1699 | Ga0373937_0020720 | |||
| 1700 | Ga0373937_0040141 | |||
| 1701 | Ga0373925_0011839 | |||
| 1702 | Ga0373925_0014118 | |||
| 1703 | Ga0373925_0076162 | |||
| 1704 | Ga0373925_0101464 | |||
| 1705 | Ga0373925_1293294 | |||
| 1706 | Ga0436365_0078382 | |||
| 1707 | Ga0436365_0274005 | |||
| 1708 | Ga0436365_1041486 | |||
| 1709 | Ga0436360_0486235 | |||
| 1710 | Ga0436361_0180502 | |||
| 1711 | Ga0436361_0891923 | |||
| 1712 | Ga0436363_0783221 | |||
| 1713 | Ga0436362_0716023 | |||
| 1714 | Ga0439448_0011374 | |||
| 1715 | Ga0439448_0086178 | |||
| 1716 | Ga0439455_0025023 | |||
| 1717 | Ga0439463_027721 | |||
| 1718 | Ga0439463_075937 | |||
| 1719 | Ga0439444_0155412 | |||
| 1720 | Ga0439464_0043449 | |||
| 1721 | Ga0451577_0379689 | |||
| 1722 | Ga0453683_0663487 | |||
| 1723 | Ga0466963_0886681 | |||
| 1724 | Ga0466957_0272386 | |||
| 1725 | Ga0451576_0013929 | |||
| 1726 | Ga0466967_2175979 | |||
| 1727 | Ga0495617_171132 | |||
| 1728 | Ga0495592_0013463 | |||
| 1729 | Ga0495592_0033058 | |||
| 1730 | Ga0495592_0113605 | |||
| 1731 | Ga0495592_0190898 | |||
| 1732 | Ga0495592_0453515 | |||
| 1733 | Ga0495603_0005357 | |||
| 1734 | Ga0495603_0050431 | |||
| 1735 | Ga0495603_0232151 | |||
| 1736 | Ga0495629_0059841 | |||
| 1737 | Ga0495629_0119732 | |||
| 1738 | Ga0495641_0091367 | |||
| 1739 | Ga0495641_0091740 | |||
| 1740 | Ga0495651_0003153 | |||
| 1741 | Ga0495651_0012826 | |||
| 1742 | Ga0495653_0001202 | |||
| 1743 | Ga0495653_0009980 | |||
| 1744 | Ga0495580_0004568 | |||
| 1745 | Ga0495580_0227886 | |||
| 1746 | Ga0495580_0327189 | |||
| 1747 | Ga0495582_0065925 | |||
| 1748 | Ga0495639_0002223 | |||
| 1749 | Ga0495662_0002421 | |||
| 1750 | Ga0495662_0021180 | |||
| 1751 | Ga0495664_0008194 | |||
| 1752 | Ga0495664_0009168 | |||
| 1753 | Ga0495664_0016181 | |||
| 1754 | Ga0495584_0013126 | |||
| 1755 | Ga0495584_0119623 | |||
| 1756 | Ga0495584_0136805 | |||
| 1757 | Ga0495585_0000995 | |||
| 1758 | Ga0495594_0003519 | |||
| 1759 | Ga0495594_0046647 | |||
| 1760 | Ga0495607_0013487 | |||
| 1761 | Ga0495608_0000363 | |||
| 1762 | Ga0495608_0095348 | |||
| 1763 | Ga0495608_0919995 | |||
| 1764 | Ga0495618_0001897 | |||
| 1765 | Ga0495618_0009777 | |||
| 1766 | Ga0495628_0001606 | |||
| 1767 | Ga0495628_0012443 | |||
| 1768 | Ga0495628_0305453 | |||
| 1769 | Ga0495628_0661419 | |||
| 1770 | Ga0495630_0131028 | |||
| 1771 | Ga0495630_0768066 | |||
| 1772 | Ga0495644_0002021 | |||
| 1773 | Ga0495663_0026199 | |||
| 1774 | Ga0495666_0164251 | |||
| 1775 | Ga0495652_0002586 | |||
| 1776 | Ga0495652_0052019 | |||
| 1777 | Ga0495652_0328679 | |||
| 1778 | Ga0495652_0362400 | |||
| 1779 | Ga0495652_1006363 | |||
| 1780 | Ga0495640_0009382 | |||
| 1781 | Ga0495640_0023798 | |||
| 1782 | Ga0495640_0091974 | |||
| 1783 | Ga0495640_0100025 | |||
| 1784 | Ga0495640_0950387 | |||
| 1785 | Ga0495586_0167057 | |||
| 1786 | Ga0495587_0003533 | |||
| 1787 | Ga0495587_0008605 | |||
| 1788 | Ga0495587_0206520 | |||
| 1789 | Ga0495587_0251534 | |||
| 1790 | Ga0495609_0080934 | |||
| 1791 | Ga0495609_0205501 | |||
| 1792 | Ga0495645_0032742 | |||
| 1793 | Ga0495645_0451690 | |||
| 1794 | Ga0495645_0743485 | |||
| 1795 | Ga0495622_0020475 | |||
| 1796 | Ga0495622_0043097 | |||
| 1797 | Ga0495622_0227494 | |||
| 1798 | Ga0495633_0009135 | |||
| 1799 | Ga0495667_0001863 | |||
| 1800 | Ga0495667_0002910 | |||
| 1801 | Ga0495667_0012561 | |||
| 1802 | Ga0495667_0019111 | |||
| 1803 | Ga0495667_0069747 | |||
| 1804 | Ga0495667_0165497 | |||
| 1805 | Ga0495656_0011054 | |||
| 1806 | Ga0495634_0023444 | |||
| 1807 | Ga0495634_0114050 | |||
| 1808 | Ga0495634_0257703 | |||
| 1809 | Ga0495634_0415384 | |||
| 1810 | Ga0495611_0550340 | |||
| 1811 | Ga0495635_0000730 | |||
| 1812 | Ga0495635_0030540 | |||
| 1813 | Ga0495635_0041243 | |||
| 1814 | Ga0495635_0088565 | |||
| 1815 | Ga0495635_0135391 | |||
| 1816 | Ga0495659_0002692 | |||
| 1817 | Ga0495588_0001656 | |||
| 1818 | Ga0495657_0044286 | |||
| 1819 | Ga0495657_0045003 | |||
| 1820 | Ga0495657_0052229 | |||
| 1821 | Ga0495599_0003607 | |||
| 1822 | Ga0495599_0033518 | |||
| 1823 | Ga0495599_0498860 | |||
| 1824 | Ga0495623_0002343 | |||
| 1825 | Ga0495623_0435271 | |||
| 1826 | Ga0495623_0558491 | |||
| 1827 | Ga0495646_0042319 | |||
| 1828 | Ga0495646_0053119 | |||
| 1829 | Ga0495647_0000967 | |||
| 1830 | Ga0495647_0033610 | |||
| 1831 | Ga0495647_0349899 | |||
| 1832 | Ga0495658_0002102 | |||
| 1833 | Ga0495658_0174362 | |||
| 1834 | Ga0495613_0012394 | |||
| 1835 | Ga0495613_0082103 | |||
| 1836 | Ga0495613_0242328 | |||
| 1837 | Ga0495613_0267584 | |||
| 1838 | Ga0495624_0067799 | |||
| 1839 | Ga0495624_0070412 | |||
| 1840 | Ga0495624_0250181 | |||
| 1841 | Ga0495600_0000703 | |||
| 1842 | Ga0495600_0061545 | |||
| 1843 | Ga0495600_0082623 | |||
| 1844 | Ga0495600_0170384 | |||
| 1845 | Ga0495600_0387519 | |||
| 1846 | Ga0495600_0608940 | |||
| 1847 | Ga0495581_0059282 | |||
| 1848 | Ga0495581_0077256 | |||
| 1849 | Ga0495581_0438989 | |||
| 1850 | Ga0495604_0001606 | |||
| 1851 | Ga0495604_0017676 | |||
| 1852 | Ga0495604_0033728 | |||
| 1853 | Ga0495604_0072048 | |||
| 1854 | Ga0495674_0008713 | |||
| 1855 | Ga0495674_0008815 | |||
| 1856 | Ga0495674_0085519 | |||
| 1857 | Ga0495674_0101934 | |||
| 1858 | Ga0495674_0387766 | |||
| 1859 | Ga0495676_0234102 | |||
| 1860 | Ga0495676_0316850 | |||
| 1861 | Ga0495676_0460952 | |||
| 1862 | Ga0495680_0003233 | |||
| 1863 | Ga0495680_0012545 | |||
| 1864 | Ga0495680_0023301 | |||
| 1865 | Ga0495680_0136433 | |||
| 1866 | Ga0495680_0204334 | |||
| 1867 | Ga0495680_0492068 | |||
| 1868 | Ga0495675_0002258 | |||
| 1869 | Ga0495675_0020910 | |||
| 1870 | Ga0495675_0136683 | |||
| 1871 | Ga0495675_0356515 | |||
| 1872 | Ga0495677_0029496 | |||
| 1873 | Ga0495677_0130107 | |||
| 1874 | Ga0495684_0000749 | |||
| 1875 | Ga0495684_0147471 | |||
| 1876 | Ga0495684_0343079 | |||
| 1877 | Ga0495684_0535854 | |||
| 1878 | Ga0495684_0597452 | |||
| 1879 | Ga0495593_0028750 | |||
| 1880 | Ga0495593_0236985 | |||
| 1881 | Ga0495602_0006328 | |||
| 1882 | Ga0495602_0018809 | |||
| 1883 | Ga0495602_0050105 | |||
| 1884 | Ga0495602_0308040 | |||
| 1885 | Ga0495614_0175714 | |||
| 1886 | Ga0496100_0032026 | |||
| 1887 | Ga0496100_0190751 | |||
| 1888 | Ga0496100_0599216 | |||
| 1889 | Ga0496101_0024419 | |||
| 1890 | Ga0496101_0033791 | |||
| 1891 | Ga0496101_0054158 | |||
| 1892 | Ga0496101_0107992 | |||
| 1893 | Ga0496101_0251885 | |||
| 1894 | Ga0496101_0621902 | |||
| 1895 | Ga0496101_0623432 | |||
| 1896 | Ga0496102_0017443 | |||
| 1897 | Ga0496102_0052687 | |||
| 1898 | Ga0496102_0125349 | |||
| 1899 | Ga0496102_0142734 | |||
| 1900 | Ga0496102_0204308 | |||
| 1901 | Ga0496102_0210331 | |||
| 1902 | Ga0496102_0972969 | |||
| 1903 | Ga0496102_1468756 | |||
| 1904 | Ga0496103_0044329 | |||
| 1905 | Ga0496103_0098323 | |||
| 1906 | Ga0496103_0121012 | |||
| 1907 | Ga0496103_0316085 | |||
| 1908 | Ga0496104_0001904 | |||
| 1909 | Ga0496104_0013010 | |||
| 1910 | Ga0496104_0084737 | |||
| 1911 | Ga0496104_0159692 | |||
| 1912 | Ga0496104_0196151 | |||
| 1913 | Ga0496104_0209351 | |||
| 1914 | Ga0496104_0515962 | |||
| 1915 | Ga0496104_0549804 | |||
| 1916 | Ga0496105_0002041 | |||
| 1917 | Ga0496105_0021534 | |||
| 1918 | Ga0496106_0010397 | |||
| 1919 | Ga0496106_0011583 | |||
| 1920 | Ga0496106_0063855 | |||
| 1921 | Ga0496106_0188841 | |||
| 1922 | Ga0496106_0668654 | |||
| 1923 | Ga0496107_0008549 | |||
| 1924 | Ga0496107_0028132 | |||
| 1925 | Ga0496107_0116088 | |||
| 1926 | Ga0496107_0139696 | |||
| 1927 | Ga0496107_0373942 | |||
| 1928 | Ga0496108_0013021 | |||
| 1929 | Ga0496108_0019320 | |||
| 1930 | Ga0496108_0033824 | |||
| 1931 | Ga0496108_0857521 | |||
| 1932 | Ga0496109_0023038 | |||
| 1933 | Ga0496109_0029705 | |||
| 1934 | Ga0496109_0158598 | |||
| 1935 | Ga0496109_0163060 | |||
| 1936 | Ga0496109_0776515 | |||
| 1937 | Ga0496110_0116236 | |||
| 1938 | Ga0496110_1051692 | |||
| 1939 | Ga0496110_1358607 | |||
| 1940 | Ga0496111_0009938 | |||
| 1941 | Ga0496111_0030686 | |||
| 1942 | Ga0496111_0195562 | |||
| 1943 | Ga0496111_0226342 | |||
| 1944 | Ga0496111_0630867 | |||
| 1945 | Ga0496112_0000520 | |||
| 1946 | Ga0496112_0525294 | |||
| 1947 | Ga0496112_1497682 | |||
| 1948 | Ga0496113_0043070 | |||
| 1949 | Ga0496113_0325365 | |||
| 1950 | Ga0496113_1153236 | |||
| 1951 | Ga0496114_0055845 | |||
| 1952 | Ga0496114_0088502 | |||
| 1953 | Ga0496114_0764433 | |||
| 1954 | Ga0496115_0040684 | |||
| 1955 | Ga0496115_0096831 | |||
| 1956 | Ga0496115_0113903 | |||
| 1957 | Ga0496115_0114999 | |||
| 1958 | Ga0496115_0474907 | |||
| 1959 | Ga0496115_1051472 | |||
| 1960 | Ga0496119_0320688 | |||
| 1961 | Ga0501031_0123896 | |||
| 1962 | Ga0501032_0045575 | |||
| 1963 | Ga0501032_0059269 | |||
| 1964 | Ga0501032_0089571 | |||
| 1965 | Ga0501032_0288193 | |||
| 1966 | Ga0501033_0054944 | |||
| 1967 | Ga0501033_0076233 | |||
| 1968 | Ga0501034_0000211 | |||
| 1969 | Ga0501034_0003250 | |||
| 1970 | Ga0501034_0011273 | |||
| 1971 | Ga0501034_0114986 | |||
| 1972 | Ga0501034_0119188 | |||
| 1973 | Ga0501034_0214617 | |||
| 1974 | Ga0501034_0398319 | |||
| 1975 | Ga0501034_0467470 | |||
| 1976 | Ga0501034_1169737 | |||
| 1977 | Ga0501034_1203019 | |||
| 1978 | Ga0501036_0012016 | |||
| 1979 | Ga0501036_0050002 | |||
| 1980 | Ga0501036_0455716 | |||
| 1981 | Ga0501036_0620044 | |||
| 1982 | Ga0501037_0002596 | |||
| 1983 | Ga0501037_0040990 | |||
| 1984 | Ga0501037_0057305 | |||
| 1985 | Ga0501037_0500297 | |||
| 1986 | Ga0501037_0781313 | |||
| 1987 | Ga0501038_0206825 | |||
| 1988 | Ga0501038_0582875 | |||
| 1989 | Ga0501039_0020522 | |||
| 1990 | Ga0501039_0437018 | |||
| 1991 | Ga0501039_0726494 | |||
| 1992 | Ga0501040_0662657 | |||
| 1993 | Ga0501042_0180698 | |||
| 1994 | Ga0501043_0061902 | |||
| 1995 | Ga0501043_0229418 | |||
| 1996 | Ga0501043_0319393 | |||
| 1997 | Ga0501043_0369987 | |||
| 1998 | Ga0501043_0512022 | |||
| 1999 | Ga0501046_0119499 | |||
| 2000 | Ga0501046_0121205 | |||
| 2001 | Ga0501046_0174145 | |||
| 2002 | Ga0501046_0270306 | |||
| 2003 | Ga0501046_0571493 | |||
| 2004 | Ga0501047_0000010 | |||
| 2005 | Ga0501047_0076895 | |||
| 2006 | Ga0501047_0149451 | |||
| 2007 | Ga0501047_0184993 | |||
| 2008 | Ga0501047_0210335 | |||
| 2009 | Ga0501047_0325019 | |||
| 2010 | Ga0501047_0395446 | |||
| 2011 | Ga0501048_0000784 | |||
| 2012 | Ga0501048_0194801 | |||
| 2013 | Ga0501048_0329887 | |||
| 2014 | Ga0501067_0016880 | |||
| 2015 | Ga0501067_0044997 | |||
| 2016 | Ga0501068_0012136 | |||
| 2017 | Ga0501068_0027868 | |||
| 2018 | Ga0501068_0092452 | |||
| 2019 | Ga0501068_1044995 | |||
| 2020 | Ga0501069_0021060 | |||
| 2021 | Ga0501069_0030179 | |||
| 2022 | Ga0501069_0183300 | |||
| 2023 | Ga0501069_0424322 | |||
| 2024 | Ga0501070_0012798 | |||
| 2025 | Ga0501070_0036167 | |||
| 2026 | Ga0501070_0077077 | |||
| 2027 | Ga0501070_0080055 | |||
| 2028 | Ga0501070_0157256 | |||
| 2029 | Ga0501070_0174968 | |||
| 2030 | Ga0501070_0407204 | |||
| 2031 | Ga0501070_0425188 | |||
| 2032 | Ga0501070_0488897 | |||
| 2033 | Ga0501071_0101832 | |||
| 2034 | Ga0501071_0616289 | |||
| 2035 | Ga0501072_0023227 | |||
| 2036 | Ga0501072_0161503 | |||
| 2037 | Ga0501072_0256878 | |||
| 2038 | Ga0501072_0541175 | |||
| 2039 | Ga0501073_0011704 | |||
| 2040 | Ga0501073_0026355 | |||
| 2041 | Ga0501073_0063098 | |||
| 2042 | Ga0501073_0200807 | |||
| 2043 | Ga0501073_0590934 | |||
| 2044 | Ga0501073_0880959 | |||
| 2045 | Ga0501074_0015467 | |||
| 2046 | Ga0501074_0026995 | |||
| 2047 | Ga0501074_0188316 | |||
| 2048 | Ga0501074_0210681 | |||
| 2049 | Ga0501074_1043945 | |||
| 2050 | Ga0501075_0151608 | |||
| 2051 | Ga0501076_0210029 | |||
| 2052 | Ga0501076_1351611 | |||
| 2053 | Ga0501077_0023345 | |||
| 2054 | Ga0501077_0259530 | |||
| 2055 | Ga0501079_0001490 | |||
| 2056 | Ga0501079_0705058 | |||
| 2057 | Ga0501080_0090573 | |||
| 2058 | Ga0501080_0124247 | |||
| 2059 | Ga0501080_0125376 | |||
| 2060 | Ga0501080_0151953 | |||
| 2061 | Ga0501080_0376510 | |||
| 2062 | Ga0501080_0795918 | |||
| 2063 | Ga0501081_0338156 | |||
| 2064 | Ga0501083_0009626 | |||
| 2065 | Ga0501083_0129901 | |||
| 2066 | Ga0501083_0374712 | |||
| 2067 | Ga0501035_0002108 | |||
| 2068 | Ga0501035_0025158 | |||
| 2069 | Ga0501035_0257687 | |||
| 2070 | Ga0501035_0398980 | |||
| 2071 | Ga0501035_0584438 | |||
| 2072 | Ga0501035_0904897 | |||
| 2073 | Ga0501044_0086065 | |||
| 2074 | Ga0501044_0422395 | |||
| 2075 | Ga0501044_0689648 | |||
| 2076 | Ga0501045_0549322 | |||
| 2077 | Ga0501045_0600342 | |||
| 2078 | nmdc:mga03n38_471280_c1 | |||
| 2079 | nmdc:mga06z11_11064_c1 | |||
| 2080 | nmdc:mga06z11_622479_c1 | |||
| 2081 | nmdc:mga05p37_3652_c1 | |||
| 2082 | nmdc:mga05p37_5580_c1 | |||
| 2083 | nmdc:mga09592_1558720_c1 | |||
| 2084 | nmdc:mga09592_714_c1 | |||
| 2085 | nmdc:mga0qj67_1449_c1 | |||
| 2086 | nmdc:mga06r32_1863_c1 | |||
| 2087 | nmdc:mga08y16_1194501_c1 | |||
| 2088 | nmdc:mga08y16_1350709_c1 | |||
| 2089 | nmdc:mga08y16_3547_c1 | |||
| 2090 | nmdc:mga08y16_3652_c1 | |||
| 2091 | nmdc:mga0n895_20971_c1 | |||
| 2092 | nmdc:mga0n895_4615_c1 | |||
| 2093 | nmdc:mga0n895_54609_c1 | |||
| 2094 | nmdc:mga0n895_63874_c1 | |||
| 2095 | nmdc:mga0rr50_1014913_c1 | |||
| 2096 | nmdc:mga0rr50_117189_c1 | |||
| 2097 | nmdc:mga0rr50_253059_c1 | |||
| 2098 | nmdc:mga0rr50_33356_c1 | |||
| 2099 | nmdc:mga0rr50_510044_c1 | |||
| 2100 | nmdc:mga08x19_104028_c1 | |||
| 2101 | nmdc:mga08x19_938391_c1 | |||
| 2102 | nmdc:mga0a205_17847_c1 | |||
| 2103 | nmdc:mga0a205_2116_c1 | |||
| 2104 | Ga0495601_0003041 | |||
| 2105 | Ga0495601_0016804 | |||
| 2106 | Ga0495601_0018616 | |||
| 2107 | Ga0495601_0029013 | |||
| 2108 | Ga0495601_0032983 | |||
| 2109 | Ga0495601_0146683 | |||
| 2110 | Ga0495612_0006375 | |||
| 2111 | Ga0495612_0016428 | |||
| 2112 | Ga0495612_0018815 | |||
| 2113 | Ga0495612_0041646 | |||
| 2114 | Ga0495612_0119603 | |||
| 2115 | Ga0495612_0234324 | |||
| 2116 | Ga0495612_0408857 | |||
| 2117 | Ga0495595_0000337 | |||
| 2118 | Ga0495595_0000525 | |||
| 2119 | Ga0495595_0016453 | |||
| 2120 | Ga0495595_0072786 | |||
| 2121 | Ga0495595_0091400 | |||
| 2122 | Ga0495595_0180254 | |||
| 2123 | Ga0495595_0207116 | |||
| 2124 | Ga0495619_0000043 | |||
| 2125 | Ga0495619_0000333 | |||
| 2126 | Ga0495619_0000405 | |||
| 2127 | Ga0495619_0006520 | |||
| 2128 | Ga0495619_0006915 | |||
| 2129 | Ga0495619_0009776 | |||
| 2130 | Ga0495619_0012577 | |||
| 2131 | Ga0495619_0016850 | |||
| 2132 | Ga0500651_0045526 | |||
| 2133 | Ga0500641_0001180 | |||
| 2134 | Ga0500655_018226 | |||
| 2135 | Ga0501084_0223084 | |||
| 2136 | Ga0501082_0059799 | |||
| 2137 | Ga0501082_0459592 | |||
| 2138 | Ga0501082_0476869 | |||
| 2139 | Ga0501082_0885052 | |||
| 2140 | Ga0501082_1592165 | |||
| 2141 | Ga0501082_1605047 | |||
| 2142 | Ga0530510_0194729 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bpm-assembly1.cif.gz_A | crystal structure of a human integral membrane enzyme | 0.818 | 3 | 131 |
| 4bpm-assembly1.cif.gz_A | crystal structure of a human integral membrane enzyme | 0.7958 | 3 | 131 |
| 4j7t-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.7591 | 3 | 131 |
| 6ssr-assembly1.cif.gz_A | crystal structure of human microsomal glutathione s-transferase 2 at 3.8 angstroms resolution | 0.7581 | 3 | 131 |
| 4jc7-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.7575 | 3 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P10620_2_155_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8343 | 3 | 131 | 1.20.120.550 |
| af_Q9JHF3_7_153_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8235 | 3 | 131 | 1.20.120.550 |
| 4wabA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8159 | 3 | 131 | 1.20.120.550 |
| af_P10620_2_155_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8109 | 3 | 131 | 1.20.120.550 |
| 4yl1A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8027 | 3 | 131 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533JAF3-F1-model_v4 | deleted | 1 | 45 | 132 |
|
| AF-A0A7S7Z5G2-F1-model_v4 | MAPEG family protein | 0.9965 | 1 | 132 |
GO:0016020
|
| AF-A0A161QMW4-F1-model_v4 | MAPEG family protein | 0.9961 | 1 | 129 |
GO:0016020
|
| AF-A0A2M8R4K8-F1-model_v4 | MAPEG family protein | 0.9953 | 1 | 132 |
GO:0016020
|
| AF-A0A5S4X384-F1-model_v4 | MAPEG family protein | 0.995 | 1 | 132 |
GO:0016020
|