F489489

General Info

Members Datasets Scaffolds Average Seq Length
1071 418 2142 282

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1051396|Ga0436360_1051396_11_928
Length 305
Sequence MSPIVSVNLPSPHTRPGGPRWSRMRPRLAITGAGGFLGRHLVRALRGADVEITLAVRDARRVAGFPGRFDVVELDLASPGPRAFDRLGRPDIVVHLAWGGLPNYRSMHHFETELPRHYAFLRDLVADGLKSVVVTGTCFEYGMQSGPLGEDLPCRPSSPYGLAKHALCRALEFLQATAPFDLVWARVFYVFGEGQAEQSLWSQLNRAVAEGRPRFEMSGGEQLRDFLPVTELAAYLAKLALIRRNLGAINVCSGRPQSVRGLVEGWIRQRGWSIELDLGRYPYPDYEPMAFWGTRDKLDAVLRLA

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
164 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
173 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
174 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
175 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
176 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
177 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
178 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
179 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
180 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
181 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
182 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
183 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
184 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
195 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
203 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
235 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
274 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
300 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
301 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
302 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
303 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
304 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
314 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
315 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
316 2511231004 Pseudomonas sp. GM102 Isolate Nodule
317 2511231006 Pseudomonas sp. GM17 Isolate Nodule
318 2511231007 Pseudomonas sp. GM18 Isolate Nodule
319 2511231008 Pseudomonas sp. GM21 Isolate Nodule
320 2511231010 Pseudomonas sp. GM25 Isolate Nodule
321 2511231011 Pseudomonas sp. GM30 Isolate Nodule
322 2511231016 Pseudomonas sp. GM50 Isolate Nodule
323 2511231018 Pseudomonas sp. GM60 Isolate Nodule
324 2511231020 Pseudomonas sp. GM74 Isolate Nodule
325 2511231022 Pseudomonas sp. GM79 Isolate Nodule
326 2511231023 Pseudomonas sp. GM80 Isolate Nodule
327 2511231031 Pseudomonas sp. GM16 Isolate Nodule
328 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
329 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
330 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
331 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
332 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
333 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
334 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
335 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
336 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
337 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
338 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
339 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
340 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
341 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
342 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
343 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
344 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
345 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
346 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
347 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
348 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
349 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
350 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
351 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
352 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
353 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
354 2643221718 Rhizobium sp. Root268 Isolate Unclassified
355 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
356 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
357 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
358 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
359 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
360 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
361 2734482264 Dyella sp. AD052 Isolate Unclassified
362 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
363 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
364 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
365 2765235841 Pseudomonas putida AA7 Isolate Unclassified
366 2773857670 Pseudomonas sp. 478 Isolate Unclassified
367 2773857673 Pseudomonas sp. 443 Isolate Unclassified
368 2784132063 Pseudomonas sp. 424 Isolate Unclassified
369 2784132072 Pseudomonas sp. 460 Isolate Unclassified
370 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
371 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
372 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
373 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
374 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
375 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
376 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
377 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
378 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
379 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
380 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
381 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
382 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
383 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
384 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
385 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
386 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
387 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
388 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
389 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
390 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
391 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
392 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
393 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
394 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
395 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
396 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
397 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
398 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
399 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
400 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
401 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
402 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
403 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
404 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
405 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
406 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
407 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
408 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
409 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
410 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
411 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
412 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
413 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
414 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
415 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
416 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
417 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
418 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.38
Metatranscriptomes 0
Isolates 9.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 1.96
Rhizoplane 2.99
Rhizosphere 82.35
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_1051396 3300039438 Bacteria 1307
2 MRS2a_Contig_523 2124908027 Bacteria 3119
3 MRS2a_Contig_9 2124908027 Bacteria 55585
4 SwRhRL2b_contig_2050723 2162886007 Bacteria 2951
5 MRS1b_contig_3223266 2162886011 Bacteria 2209
6 JGI25162J39368_1000037 3300002737 Bacteria 179339
7 JGI25163J39215_1000160 3300002771 Bacteria 26649
8 JGI25164J39214_1000020 3300002772 Bacteria 179339
9 JGI25165J46597_1000077 3300003214 Bacteria 179339
10 Ga0055536_1000041 3300003781 Bacteria 127266
11 Ga0055536_1000042 3300003781 Bacteria 125029
12 Ga0055536_1000441 3300003781 Bacteria 29203
13 Ga0055536_1000537 3300003781 Bacteria 26032
14 Ga0055530_10000063 3300003791 Bacteria 94619
15 Ga0055530_10000725 3300003791 Bacteria 27618
16 Ga0055540_1000501 3300003792 Bacteria 29848
17 Ga0055540_1000604 3300003792 Bacteria 25761
18 Ga0055531_10001274 3300003794 Bacteria 19001
19 Ga0065714_10000129 3300005288 Bacteria 12472
20 Ga0065714_10004405 3300005288 Bacteria 6412
21 Ga0065714_10004572 3300005288 Bacteria 6669
22 Ga0065704_10070547 3300005289 Bacteria 20984
23 Ga0065712_10000532 3300005290 Bacteria 15100
24 Ga0065715_10005656 3300005293 Bacteria 5768
25 Ga0070658_10139878 3300005327 Bacteria 2022
26 Ga0070658_10178264 3300005327 Bacteria 1788
27 Ga0070676_10011992 3300005328 Bacteria 4723
28 Ga0070676_10112682 3300005328 Bacteria 1696
29 Ga0070670_100002229 3300005331 Bacteria 15929
30 Ga0070670_100005687 3300005331 Bacteria 10530
31 Ga0070670_100024039 3300005331 Bacteria 5242
32 Ga0070670_100070010 3300005331 Bacteria 3011
33 Ga0070670_100273102 3300005331 Bacteria 1475
34 Ga0070677_10019981 3300005333 Bacteria 2434
35 Ga0070677_10023911 3300005333 Bacteria 2267
36 Ga0070677_10156006 3300005333 Bacteria 1067
37 Ga0068869_100039304 3300005334 Bacteria 3378
38 Ga0070666_10057619 3300005335 Bacteria 2625
39 Ga0068868_100066155 3300005338 Bacteria 2873
40 Ga0070661_100071883 3300005344 Bacteria 2546
41 Ga0070668_100001828 3300005347 Bacteria 15488
42 Ga0070669_100014691 3300005353 Bacteria 5573
43 Ga0070669_100029331 3300005353 Bacteria 3965
44 Ga0070669_100057759 3300005353 Bacteria 2847
45 Ga0070675_100007942 3300005354 Bacteria 8224
46 Ga0070675_100017439 3300005354 Bacteria 5705
47 Ga0070675_100063411 3300005354 Bacteria 3055
48 Ga0070675_100067337 3300005354 Bacteria 2963
49 Ga0070675_100093099 3300005354 Bacteria 2527
50 Ga0070675_100124059 3300005354 Bacteria 2196
51 Ga0070675_100298356 3300005354 Bacteria 1419
52 Ga0070671_100009709 3300005355 Bacteria 7732
53 Ga0070671_100030658 3300005355 Bacteria 4438
54 Ga0070671_100127077 3300005355 Bacteria 2147
55 Ga0070671_100152663 3300005355 Bacteria 1950
56 Ga0070674_100004695 3300005356 Bacteria 7810
57 Ga0070674_100373974 3300005356 Bacteria 1157
58 Ga0070673_100006275 3300005364 Bacteria 7712
59 Ga0070673_100067395 3300005364 Bacteria 2862
60 Ga0070659_100037609 3300005366 Bacteria 3774
61 Ga0070667_100012425 3300005367 Bacteria 7046
62 Ga0070667_100259701 3300005367 Bacteria 1555
63 Ga0070700_100043934 3300005441 Bacteria 2750
64 Ga0070678_100027482 3300005456 Bacteria 3863
65 Ga0070678_100144557 3300005456 Bacteria 1907
66 Ga0070678_100329309 3300005456 Bacteria 1307
67 Ga0070662_100002799 3300005457 Bacteria 10806
68 Ga0070662_100023071 3300005457 Bacteria 4270
69 Ga0070662_100041744 3300005457 Bacteria 3274
70 Ga0068867_100007420 3300005459 Bacteria 7754
71 Ga0068867_100009150 3300005459 Bacteria 6989
72 Ga0070684_100301644 3300005535 Bacteria 1470
73 Ga0070697_100082439 3300005536 Bacteria 2651
74 Ga0070672_100002981 3300005543 Bacteria 10904
75 Ga0070672_100005989 3300005543 Bacteria 8115
76 Ga0070696_100049229 3300005546 Bacteria 2927
77 Ga0070665_100140278 3300005548 Bacteria 2420
78 Ga0070665_100287230 3300005548 Bacteria 1647
79 Ga0068852_100066561 3300005616 Bacteria 3146
80 Ga0068852_100587130 3300005616 Bacteria 1117
81 Ga0068859_100040184 3300005617 Bacteria 4695
82 Ga0068864_100005858 3300005618 Bacteria 10072
83 Ga0068864_100072176 3300005618 Bacteria 3008
84 Ga0068866_10007584 3300005718 Bacteria 4549
85 Ga0068861_100004142 3300005719 Bacteria 9724
86 Ga0068851_10108670 3300005834 Bacteria 1479
87 Ga0068863_100003514 3300005841 Bacteria 15465
88 Ga0068863_100018571 3300005841 Bacteria 6654
89 Ga0068863_100105651 3300005841 Bacteria 2678
90 Ga0068858_100185585 3300005842 Bacteria 1964
91 Ga0068860_100036706 3300005843 Bacteria 4693
92 Ga0075364_10207418 3300006051 Bacteria 1329
93 Ga0075432_10000422 3300006058 Bacteria 12333
94 Ga0075432_10002595 3300006058 Bacteria 6032
95 Ga0075362_10081188 3300006177 Bacteria 1495
96 Ga0075369_10024983 3300006186 Bacteria 2481
97 Ga0075366_10013980 3300006195 Bacteria 4579
98 Ga0097621_100015345 3300006237 Bacteria 5762
99 Ga0097621_100069375 3300006237 Bacteria 2911
100 Ga0097621_100189366 3300006237 Bacteria 1781
101 Ga0068871_100001760 3300006358 Bacteria 14588
102 Ga0068871_100025548 3300006358 Bacteria 4597
103 Ga0075436_100033025 3300006914 Bacteria 3565
104 Ga0097620_100040185 3300006931 Bacteria 4695
105 Ga0079104_1003979 3300006946 Bacteria 6577
106 Ga0105251_10000060 3300009011 Bacteria 102799
107 Ga0105251_10000630 3300009011 Bacteria 32361
108 Ga0105251_10002026 3300009011 Bacteria 16435
109 Ga0105251_10004603 3300009011 Bacteria 9314
110 Ga0105251_10014831 3300009011 Bacteria 4284
111 Ga0105251_10039338 3300009011 Bacteria 2311
112 Ga0105251_10052192 3300009011 Bacteria 1947
113 Ga0105251_10083917 3300009011 Bacteria 1470
114 Ga0105244_10002159 3300009036 Bacteria 15083
115 Ga0105244_10002763 3300009036 Bacteria 13090
116 Ga0105244_10004488 3300009036 Bacteria 9585
117 Ga0105244_10018701 3300009036 Bacteria 3880
118 Ga0105244_10138646 3300009036 Bacteria 1171
119 Ga0105244_10151655 3300009036 Bacteria 1110
120 Ga0105250_10000979 3300009092 Bacteria 16634
121 Ga0105250_10001081 3300009092 Bacteria 15436
122 Ga0105250_10002986 3300009092 Bacteria 8213
123 Ga0105250_10007464 3300009092 Bacteria 4694
124 Ga0111539_10007100 3300009094 Bacteria 14354
125 Ga0105245_10020891 3300009098 Bacteria 5740
126 Ga0105243_10000162 3300009148 Bacteria 75904
127 Ga0105243_10022667 3300009148 Bacteria 4775
128 Ga0105248_10102314 3300009177 Bacteria 3229
129 Ga0105248_10647280 3300009177 Unclassified 1192
130 Ga0105246_10008116 3300011119 Bacteria 6444
131 Ga0157373_10001457 3300013100 Bacteria 18087
132 Ga0157373_10002764 3300013100 Bacteria 13273
133 Ga0157373_10008956 3300013100 Bacteria 7404
134 Ga0157373_10013196 3300013100 Bacteria 6064
135 Ga0157373_10014392 3300013100 Bacteria 5799
136 Ga0157371_10002880 3300013102 Bacteria 16085
137 Ga0157371_10003491 3300013102 Bacteria 14221
138 Ga0157371_10020080 3300013102 Bacteria 4920
139 Ga0157371_10070073 3300013102 Bacteria 2482
140 Ga0157370_10004442 3300013104 Bacteria 16069
141 Ga0157370_10008202 3300013104 Bacteria 11287
142 Ga0157370_10056197 3300013104 Bacteria 3746
143 Ga0157370_10086299 3300013104 Bacteria 2949
144 Ga0157370_10285461 3300013104 Bacteria 1525
145 Ga0157369_10008420 3300013105 Bacteria 11827
146 Ga0157369_10030650 3300013105 Bacteria 5931
147 Ga0157369_10293281 3300013105 Bacteria 1693
148 Ga0163162_10001271 3300013306 Bacteria 23584
149 Ga0163162_10004598 3300013306 Bacteria 13296
150 Ga0163162_10006558 3300013306 Bacteria 11276
151 Ga0163162_10018673 3300013306 Bacteria 6794
152 Ga0163162_10074928 3300013306 Bacteria 3444
153 Ga0163162_10095782 3300013306 Bacteria 3055
154 Ga0163162_10369762 3300013306 Bacteria 1567
155 Ga0163162_10506589 3300013306 Bacteria 1337
156 Ga0157372_10001365 3300013307 Bacteria 26415
157 Ga0157372_10182322 3300013307 Bacteria 2431
158 Ga0157375_10010475 3300013308 Bacteria 8160
159 Ga0157375_10046742 3300013308 Bacteria 4223
160 Ga0157375_10129766 3300013308 Bacteria 2639
161 Ga0157375_10231695 3300013308 Bacteria 2006
162 Ga0157375_10714532 3300013308 Bacteria 1155
163 Ga0157375_10738008 3300013308 Bacteria 1137
164 Ga0163163_10150092 3300014325 Bacteria 2375
165 Ga0163163_10179646 3300014325 Bacteria 2163
166 Ga0157380_10010808 3300014326 Bacteria 6581
167 Ga0157380_10040339 3300014326 Unclassified 3636
168 Ga0182008_10002027 3300014497 Bacteria 12993
169 Ga0182008_10004747 3300014497 Bacteria 7868
170 Ga0182008_10004863 3300014497 Bacteria 7762
171 Ga0182008_10006302 3300014497 Bacteria 6654
172 Ga0182008_10078408 3300014497 Bacteria 1625
173 Ga0157379_10009072 3300014968 Bacteria 8667
174 Ga0157376_10002090 3300014969 Bacteria 13430
175 Ga0157376_10003642 3300014969 Bacteria 10634
176 Ga0157376_10043120 3300014969 Bacteria 3701
177 Ga0182006_1001020 3300015261 Bacteria 18304
178 Ga0182006_1002669 3300015261 Bacteria 9601
179 Ga0182006_1055688 3300015261 Bacteria 1509
180 Ga0182007_10000729 3300015262 Bacteria 18597
181 Ga0182005_1003133 3300015265 Bacteria 5689
182 Ga0182005_1003396 3300015265 Bacteria 5417
183 Ga0182005_1018428 3300015265 Bacteria 1929
184 Ga0182005_1022877 3300015265 Bacteria 1710
185 Ga0182005_1023064 3300015265 Bacteria 1703
186 Ga0182005_1026198 3300015265 Bacteria 1591
187 Ga0163161_10002333 3300017792 Bacteria 13603
188 Ga0163161_10015126 3300017792 Bacteria 5378
189 Ga0163161_10021069 3300017792 Bacteria 4582
190 Ga0163161_10036517 3300017792 Bacteria 3519
191 Ga0163161_10040626 3300017792 Bacteria 3341
192 Ga0213876_10019248 3300021384 Bacteria 3606
193 Ga0209760_100053 3300025207 Bacteria 103438
194 Ga0209563_100535 3300025230 Bacteria 12790
195 Ga0207427_100001 3300025231 Bacteria 1410763
196 Ga0209437_100003 3300025233 Bacteria 1517827
197 Ga0209233_1000007 3300025261 Bacteria 1411234
198 Ga0209675_1002483 3300025291 Bacteria 9447
199 Ga0209676_1000016 3300025292 Bacteria 655561
200 Ga0209676_1000021 3300025292 Bacteria 609534
201 Ga0209676_1000033 3300025292 Bacteria 463236
202 Ga0209050_1000036 3300025298 Bacteria 423070
203 Ga0209050_1000107 3300025298 Bacteria 223303
204 Ga0209051_1000043 3300025303 Bacteria 305473
205 Ga0209051_1000474 3300025303 Bacteria 52139
206 Ga0209051_1047940 3300025303 Bacteria 1454
207 Ga0209257_1000098 3300025304 Bacteria 256390
208 Ga0209257_1015245 3300025304 Bacteria 3217
209 Ga0207697_10064968 3300025315 Bacteria 1522
210 Ga0207656_10069336 3300025321 Bacteria 1564
211 Ga0207696_1000101 3300025711 Bacteria 170899
212 Ga0207696_1000818 3300025711 Bacteria 20016
213 Ga0207696_1000979 3300025711 Bacteria 17265
214 Ga0207696_1002197 3300025711 Bacteria 9779
215 Ga0207655_1000402 3300025728 Bacteria 59961
216 Ga0207655_1001937 3300025728 Bacteria 17700
217 Ga0207655_1002976 3300025728 Bacteria 13005
218 Ga0207655_1008548 3300025728 Bacteria 6478
219 Ga0207655_1019806 3300025728 Bacteria 3494
220 Ga0207655_1026603 3300025728 Bacteria 2775
221 Ga0207655_1038191 3300025728 Bacteria 2103
222 Ga0207713_1000150 3300025735 Bacteria 105170
223 Ga0207713_1005386 3300025735 Bacteria 8024
224 Ga0207713_1006998 3300025735 Bacteria 6761
225 Ga0207713_1039279 3300025735 Bacteria 1998
226 Ga0207713_1040943 3300025735 Bacteria 1939
227 Ga0207682_10012514 3300025893 Bacteria 3311
228 Ga0207682_10017480 3300025893 Bacteria 2801
229 Ga0207682_10048593 3300025893 Bacteria 1749
230 Ga0207642_10033859 3300025899 Bacteria 2166
231 Ga0207688_10157340 3300025901 Bacteria 1345
232 Ga0207680_10064526 3300025903 Bacteria 2245
233 Ga0207680_10314395 3300025903 Bacteria 1094
234 Ga0207645_10004107 3300025907 Bacteria 10831
235 Ga0207643_10054378 3300025908 Bacteria 2275
236 Ga0207662_10044865 3300025918 Bacteria 2611
237 Ga0207649_10055026 3300025920 Bacteria 2479
238 Ga0207646_10002099 3300025922 Bacteria 23898
239 Ga0207681_10011566 3300025923 Bacteria 5422
240 Ga0207681_10024126 3300025923 Bacteria 3900
241 Ga0207650_10001201 3300025925 Bacteria 19013
242 Ga0207650_10002944 3300025925 Bacteria 11746
243 Ga0207650_10008268 3300025925 Bacteria 7104
244 Ga0207650_10042469 3300025925 Bacteria 3336
245 Ga0207650_10229608 3300025925 Bacteria 1496
246 Ga0207659_10017831 3300025926 Bacteria 4645
247 Ga0207659_10047638 3300025926 Bacteria 3033
248 Ga0207659_10056637 3300025926 Bacteria 2808
249 Ga0207659_10116093 3300025926 Bacteria 2043
250 Ga0207659_10153911 3300025926 Unclassified 1798
251 Ga0207644_10012599 3300025931 Bacteria 5620
252 Ga0207644_10160245 3300025931 Bacteria 1748
253 Ga0207690_10320643 3300025932 Bacteria 1218
254 Ga0207706_10008925 3300025933 Bacteria 9227
255 Ga0207706_10035537 3300025933 Bacteria 4429
256 Ga0207709_10000053 3300025935 Bacteria 225514
257 Ga0207709_10019377 3300025935 Bacteria 3825
258 Ga0207670_10067725 3300025936 Bacteria 2457
259 Ga0207669_10005768 3300025937 Bacteria 5591
260 Ga0207704_10172954 3300025938 Bacteria 1551
261 Ga0207691_10000964 3300025940 Bacteria 28552
262 Ga0207691_10025170 3300025940 Bacteria 5589
263 Ga0207691_10070219 3300025940 Bacteria 3163
264 Ga0207691_10118545 3300025940 Bacteria 2348
265 Ga0207711_10082130 3300025941 Bacteria 2816
266 Ga0207711_10196189 3300025941 Bacteria 1841
267 Ga0207689_10010069 3300025942 Bacteria 8148
268 Ga0207679_10421162 3300025945 Bacteria 1178
269 Ga0207651_10001048 3300025960 Bacteria 12244
270 Ga0207651_10055966 3300025960 Bacteria 2712
271 Ga0207712_10018024 3300025961 Bacteria 4594
272 Ga0207640_10284192 3300025981 Bacteria 1301
273 Ga0207658_10028783 3300025986 Bacteria 3916
274 Ga0207658_10080727 3300025986 Bacteria 2492
275 Ga0207677_10169222 3300026023 Bacteria 1707
276 Ga0207703_10039834 3300026035 Bacteria 3758
277 Ga0207639_10081823 3300026041 Bacteria 2558
278 Ga0207641_10007595 3300026088 Bacteria 9017
279 Ga0207641_10014579 3300026088 Bacteria 6444
280 Ga0207641_10133945 3300026088 Bacteria 2228
281 Ga0207648_10020407 3300026089 Bacteria 5966
282 Ga0207648_10034632 3300026089 Bacteria 4451
283 Ga0207648_10049136 3300026089 Bacteria 3693
284 Ga0207676_10121560 3300026095 Bacteria 2203
285 Ga0207674_10143439 3300026116 Bacteria 2347
286 Ga0207675_100006516 3300026118 Bacteria 11049
287 Ga0207683_10032674 3300026121 Bacteria 4520
288 Ga0207683_10048104 3300026121 Bacteria 3735
289 Ga0207683_10074060 3300026121 Bacteria 3013
290 Ga0207683_10190295 3300026121 Bacteria 1863
291 Ga0207698_10029360 3300026142 Bacteria 3938
292 Ga0209281_1004437 3300027111 Bacteria 4201
293 Ga0207428_10073217 3300027907 Bacteria 2688
294 Ga0207428_10080653 3300027907 Bacteria 2542
295 Ga0268266_10054016 3300028379 Bacteria 3452
296 Ga0268266_10149169 3300028379 Bacteria 2106
297 Ga0268266_10218183 3300028379 Bacteria 1752
298 Ga0268265_10062451 3300028380 Bacteria 2862
299 Ga0268264_10010901 3300028381 Bacteria 7510
300 Ga0307515_10000180 3300028794 Bacteria 156173
301 Ga0307515_10155775 3300028794 Bacteria 2359
302 Ga0265324_10000032 3300029957 Bacteria 125653
303 Ga0316181_1060393 3300030744 Bacteria 4243
304 Ga0265332_10000004 3300031238 Bacteria 426592
305 Ga0265331_10024250 3300031250 Bacteria 3071
306 Ga0307408_100002045 3300031548 Bacteria 14522
307 Ga0307408_100002790 3300031548 Bacteria 12127
308 Ga0307408_100021941 3300031548 Bacteria 4330
309 Ga0307408_100295151 3300031548 Bacteria 1355
310 Ga0307408_100499494 3300031548 Bacteria 1064
311 Ga0265314_10010534 3300031711 Bacteria 7698
312 Ga0307405_10001772 3300031731 Bacteria 9241
313 Ga0307405_10006846 3300031731 Bacteria 5651
314 Ga0307413_10022187 3300031824 Bacteria 3416
315 Ga0307406_10002886 3300031901 Bacteria 9361
316 Ga0307412_10001193 3300031911 Bacteria 14815
317 Ga0307412_10003158 3300031911 Bacteria 9150
318 Ga0307412_10007173 3300031911 Bacteria 6326
319 Ga0307412_10100642 3300031911 Bacteria 2043
320 Ga0307412_10632622 3300031911 Bacteria 910
321 Ga0307409_100000746 3300031995 Bacteria 14658
322 Ga0307416_100011193 3300032002 Bacteria 5963
323 Ga0307416_100062975 3300032002 Bacteria 3035
324 Ga0307416_100070403 3300032002 Bacteria 2900
325 Ga0307416_100180371 3300032002 Bacteria 1978
326 Ga0307414_10029301 3300032004 Bacteria 3581
327 Ga0307414_10068668 3300032004 Bacteria 2544
328 Ga0307411_10005587 3300032005 Bacteria 6195
329 Ga0307411_10189722 3300032005 Bacteria 1568
330 Ga0307510_10005583 3300033180 Bacteria 14990
331 Ga0373953_0062927 3300035117 Bacteria 1520
332 Ga0373937_0038014 3300036401 Bacteria 4387
333 Ga0373937_0057084 3300036401 Bacteria 3586
334 Ga0373937_0063401 3300036401 Bacteria 3399
335 Ga0436365_1450265 3300039437 Bacteria 5822
336 Ga0436363_1071075 3300039450 Bacteria 3782
337 Ga0439438_000562 3300041405 Bacteria 16896
338 Ga0439438_000735 3300041405 Bacteria 14715
339 Ga0439438_000802 3300041405 Bacteria 14035
340 Ga0439438_002175 3300041405 Bacteria 8448
341 Ga0439438_003910 3300041405 Bacteria 5864
342 Ga0439438_010537 3300041405 Bacteria 2917
343 Ga0439447_000425 3300041407 Bacteria 15732
344 Ga0439447_002399 3300041407 Bacteria 6847
345 Ga0439447_004257 3300041407 Bacteria 4960
346 Ga0439447_009600 3300041407 Bacteria 2921
347 Ga0439447_025666 3300041407 Bacteria 1516
348 Ga0439447_036537 3300041407 Bacteria 1213
349 Ga0439466_0000563 3300041411 Bacteria 13959
350 Ga0439466_0000841 3300041411 Bacteria 11679
351 Ga0439466_0005342 3300041411 Bacteria 4911
352 Ga0439466_0012552 3300041411 Bacteria 3118
353 Ga0439466_0013241 3300041411 Bacteria 3021
354 Ga0439466_0014195 3300041411 Bacteria 2904
355 Ga0439465_0011279 3300041413 Bacteria 2804
356 Ga0439465_0125953 3300041413 Bacteria 901
357 Ga0451795_1645496 3300041456 Bacteria 1533
358 Ga0451853_1460144 3300041512 Bacteria 1441
359 Ga0439431_0001457 3300041997 Bacteria 5221
360 Ga0439445_0005750 3300042004 Bacteria 2833
361 Ga0439445_0013812 3300042004 Bacteria 1958
362 Ga0439432_001707 3300042006 Bacteria 8217
363 Ga0439432_003625 3300042006 Bacteria 5714
364 Ga0439432_011449 3300042006 Bacteria 3057
365 Ga0439432_014115 3300042006 Bacteria 2706
366 Ga0439432_027166 3300042006 Bacteria 1870
367 Ga0439432_031711 3300042006 Bacteria 1707
368 Ga0439451_000102 3300042009 Bacteria 15228
369 Ga0439451_000661 3300042009 Bacteria 6532
370 Ga0439451_002603 3300042009 Bacteria 3666
371 Ga0439451_007124 3300042009 Bacteria 2285
372 Ga0439451_038558 3300042009 Bacteria 959
373 Ga0439452_000346 3300042010 Bacteria 28745
374 Ga0439452_001509 3300042010 Bacteria 9418
375 Ga0439452_002656 3300042010 Bacteria 6504
376 Ga0439452_003450 3300042010 Bacteria 5527
377 Ga0439452_004522 3300042010 Bacteria 4651
378 Ga0439452_006238 3300042010 Bacteria 3749
379 Ga0439452_007239 3300042010 Bacteria 3412
380 Ga0439456_000497 3300042013 Bacteria 8476
381 Ga0439456_000503 3300042013 Bacteria 8414
382 Ga0439456_001748 3300042013 Bacteria 4394
383 Ga0439456_005305 3300042013 Bacteria 2617
384 Ga0439456_005912 3300042013 Bacteria 2490
385 Ga0439456_019207 3300042013 Bacteria 1436
386 Ga0439456_037794 3300042013 Bacteria 1043
387 Ga0439463_000413 3300042016 Bacteria 11870
388 Ga0439463_002586 3300042016 Bacteria 4591
389 Ga0439463_006040 3300042016 Bacteria 3008
390 Ga0439463_026429 3300042016 Bacteria 1458
391 Ga0439463_036985 3300042016 Bacteria 1237
392 Ga0450911_000142 3300042115 Bacteria 29194
393 Ga0450911_001259 3300042115 Bacteria 6064
394 Ga0450911_004427 3300042115 Bacteria 2304
395 Ga0450890_000374 3300042127 Bacteria 6519
396 Ga0450891_000894 3300042129 Bacteria 3120
397 Ga0450900_000041 3300042136 Bacteria 5773
398 Ga0450902_002552 3300042137 Bacteria 2588
399 Ga0450902_006507 3300042137 Bacteria 1789
400 Ga0450903_004423 3300042138 Bacteria 2395
401 Ga0450903_006832 3300042138 Bacteria 1888
402 Ga0450903_007371 3300042138 Bacteria 1812
403 Ga0450903_012148 3300042138 Bacteria 1377
404 Ga0450904_001612 3300042139 Bacteria 3055
405 Ga0450905_000228 3300042142 Bacteria 6434
406 Ga0450905_011848 3300042142 Bacteria 1223
407 Ga0450889_006595 3300042144 Bacteria 1166
408 Ga0450906_000168 3300042145 Bacteria 12261
409 Ga0450907_006358 3300042146 Bacteria 1972
410 Ga0450907_010806 3300042146 Bacteria 1515
411 Ga0450910_000525 3300042147 Bacteria 4560
412 Ga0450910_003111 3300042147 Bacteria 2192
413 Ga0439446_0002357 3300042156 Bacteria 4522
414 Ga0439446_0011777 3300042156 Bacteria 2379
415 Ga0450908_002485 3300042184 Bacteria 3605
416 Ga0450909_000239 3300042185 Bacteria 6543
417 Ga0439434_0015160 3300042435 Bacteria 2297
418 Ga0439464_0016065 3300042439 Bacteria 2023
419 Ga0439460_0001455 3300042461 Bacteria 5591
420 Ga0439460_0001896 3300042461 Bacteria 4992
421 Ga0450918_004793 3300042531 Bacteria 2448
422 Ga0450893_0003582 3300042532 Bacteria 2447
423 Ga0450893_0004680 3300042532 Bacteria 2182
424 Ga0439440_0017354 3300042993 Bacteria 1584
425 Ga0453684_0116111 3300044712 Bacteria 3242
426 Ga0495617_000328 3300046452 Bacteria 26666
427 Ga0495617_010227 3300046452 Bacteria 3213
428 Ga0495617_018016 3300046452 Bacteria 2387
429 Ga0495617_020665 3300046452 Bacteria 2225
430 Ga0495617_031546 3300046452 Bacteria 1779
431 Ga0495627_001228 3300046453 Bacteria 15983
432 Ga0495627_003513 3300046453 Bacteria 6869
433 Ga0495627_004102 3300046453 Bacteria 6190
434 Ga0495627_004134 3300046453 Bacteria 6157
435 Ga0495627_010317 3300046453 Bacteria 3401
436 Ga0495627_030443 3300046453 Bacteria 1710
437 Ga0495592_0013417 3300046454 Bacteria 6234
438 Ga0495603_0000519 3300046455 Bacteria 21413
439 Ga0495603_0007925 3300046455 Bacteria 6408
440 Ga0495590_0002661 3300046457 Bacteria 7382
441 Ga0495590_0002663 3300046457 Bacteria 7379
442 Ga0495590_0003209 3300046457 Bacteria 6683
443 Ga0495590_0003906 3300046457 Bacteria 6064
444 Ga0495590_0029613 3300046457 Bacteria 1918
445 Ga0495591_000256 3300046458 Bacteria 50723
446 Ga0495591_001026 3300046458 Bacteria 18885
447 Ga0495591_001411 3300046458 Bacteria 14972
448 Ga0495591_002226 3300046458 Bacteria 11056
449 Ga0495591_003670 3300046458 Bacteria 7806
450 Ga0495591_019789 3300046458 Bacteria 2243
451 Ga0495591_021687 3300046458 Bacteria 2091
452 Ga0495591_026058 3300046458 Bacteria 1824
453 Ga0495591_044566 3300046458 Bacteria 1241
454 Ga0495629_0005998 3300046459 Bacteria 9035
455 Ga0495629_0106403 3300046459 Bacteria 1957
456 Ga0495629_0130859 3300046459 Bacteria 1748
457 Ga0495638_0000059 3300046460 Bacteria 191461
458 Ga0495638_0007805 3300046460 Bacteria 7641
459 Ga0495638_0008730 3300046460 Bacteria 7162
460 Ga0495638_0010285 3300046460 Bacteria 6507
461 Ga0495638_0044002 3300046460 Bacteria 2814
462 Ga0495638_0044050 3300046460 Bacteria 2812
463 Ga0495638_0070716 3300046460 Bacteria 2136
464 Ga0495638_0181745 3300046460 Bacteria 1199
465 Ga0495653_0003581 3300046463 Bacteria 12522
466 Ga0495653_0005114 3300046463 Bacteria 10644
467 Ga0495653_0015400 3300046463 Bacteria 6232
468 Ga0495653_0030146 3300046463 Bacteria 4323
469 Ga0495653_0202670 3300046463 Bacteria 1345
470 Ga0495653_0259776 3300046463 Bacteria 1149
471 Ga0495650_0001778 3300046471 Bacteria 19540
472 Ga0495650_0005113 3300046471 Bacteria 8668
473 Ga0495650_0007214 3300046471 Bacteria 6735
474 Ga0495650_0018563 3300046471 Bacteria 3450
475 Ga0495650_0021962 3300046471 Bacteria 3069
476 Ga0495605_0000032 3300046474 Bacteria 210550
477 Ga0495605_0000857 3300046474 Bacteria 21145
478 Ga0495605_0001277 3300046474 Bacteria 16686
479 Ga0495605_0001888 3300046474 Bacteria 13393
480 Ga0495605_0002198 3300046474 Bacteria 12184
481 Ga0495605_0002521 3300046474 Bacteria 11299
482 Ga0495605_0006105 3300046474 Bacteria 6950
483 Ga0495605_0007807 3300046474 Bacteria 6062
484 Ga0495605_0014566 3300046474 Bacteria 4301
485 Ga0495605_0018889 3300046474 Bacteria 3690
486 Ga0495605_0024838 3300046474 Bacteria 3130
487 Ga0495605_0036323 3300046474 Bacteria 2484
488 Ga0495605_0052299 3300046474 Bacteria 1985
489 Ga0495639_0000241 3300046475 Bacteria 27157
490 Ga0495639_0003322 3300046475 Bacteria 6970
491 Ga0495664_0159173 3300046477 Bacteria 1370
492 Ga0495664_0295119 3300046477 Bacteria 979
493 Ga0495584_0001923 3300046491 Bacteria 11941
494 Ga0495584_0002126 3300046491 Bacteria 11350
495 Ga0495584_0002304 3300046491 Bacteria 10892
496 Ga0495584_0003690 3300046491 Bacteria 8341
497 Ga0495584_0010843 3300046491 Bacteria 4677
498 Ga0495584_0019174 3300046491 Bacteria 3474
499 Ga0495584_0027976 3300046491 Bacteria 2856
500 Ga0495585_0001287 3300046492 Bacteria 19986
501 Ga0495585_0002592 3300046492 Bacteria 12784
502 Ga0495585_0009763 3300046492 Bacteria 5743
503 Ga0495585_0013045 3300046492 Bacteria 4875
504 Ga0495585_0035974 3300046492 Bacteria 2796
505 Ga0495585_0041146 3300046492 Bacteria 2592
506 Ga0495585_0041191 3300046492 Bacteria 2591
507 Ga0495594_0001279 3300046499 Bacteria 13157
508 Ga0495594_0007038 3300046499 Bacteria 5782
509 Ga0495594_0037845 3300046499 Bacteria 2633
510 Ga0495594_0039263 3300046499 Bacteria 2588
511 Ga0495596_0054128 3300046500 Bacteria 1570
512 Ga0495607_0000121 3300046501 Bacteria 82194
513 Ga0495607_0000563 3300046501 Bacteria 36192
514 Ga0495607_0001138 3300046501 Bacteria 24105
515 Ga0495607_0001754 3300046501 Bacteria 18561
516 Ga0495607_0002115 3300046501 Bacteria 16578
517 Ga0495607_0003276 3300046501 Bacteria 12455
518 Ga0495607_0006139 3300046501 Bacteria 8501
519 Ga0495607_0007248 3300046501 Bacteria 7698
520 Ga0495607_0007895 3300046501 Bacteria 7319
521 Ga0495607_0008577 3300046501 Bacteria 6979
522 Ga0495607_0008832 3300046501 Bacteria 6860
523 Ga0495607_0009002 3300046501 Bacteria 6789
524 Ga0495607_0009248 3300046501 Bacteria 6691
525 Ga0495607_0009800 3300046501 Bacteria 6469
526 Ga0495607_0011881 3300046501 Bacteria 5768
527 Ga0495607_0012597 3300046501 Bacteria 5573
528 Ga0495607_0025600 3300046501 Bacteria 3668
529 Ga0495607_0045804 3300046501 Bacteria 2570
530 Ga0495607_0074277 3300046501 Bacteria 1887
531 Ga0495583_0000052 3300046506 Bacteria 211902
532 Ga0495583_0001042 3300046506 Bacteria 31294
533 Ga0495583_0001955 3300046506 Bacteria 18959
534 Ga0495583_0043477 3300046506 Bacteria 2091
535 Ga0495583_0115354 3300046506 Bacteria 1135
536 Ga0495606_0001451 3300046507 Bacteria 31744
537 Ga0495606_0013096 3300046507 Bacteria 6587
538 Ga0495606_0025197 3300046507 Bacteria 4266
539 Ga0495606_0027499 3300046507 Bacteria 4031
540 Ga0495610_0000720 3300046512 Bacteria 31450
541 Ga0495610_0002376 3300046512 Bacteria 15885
542 Ga0495610_0019617 3300046512 Bacteria 3776
543 Ga0495610_0019910 3300046512 Bacteria 3740
544 Ga0495610_0031497 3300046512 Bacteria 2766
545 Ga0495610_0039683 3300046512 Bacteria 2378
546 Ga0495610_0073402 3300046512 Bacteria 1590
547 Ga0495610_0074105 3300046512 Bacteria 1580
548 Ga0495616_0000377 3300046513 Bacteria 34744
549 Ga0495616_0001708 3300046513 Bacteria 14982
550 Ga0495616_0002074 3300046513 Bacteria 13465
551 Ga0495616_0002254 3300046513 Bacteria 12909
552 Ga0495616_0006526 3300046513 Bacteria 7046
553 Ga0495616_0006718 3300046513 Bacteria 6938
554 Ga0495616_0008680 3300046513 Bacteria 5996
555 Ga0495616_0018577 3300046513 Bacteria 3813
556 Ga0495616_0019845 3300046513 Bacteria 3663
557 Ga0495616_0095736 3300046513 Bacteria 1399
558 Ga0495620_0000019 3300046515 Bacteria 150014
559 Ga0495620_0000338 3300046515 Bacteria 32631
560 Ga0495620_0005406 3300046515 Bacteria 7129
561 Ga0495620_0008361 3300046515 Bacteria 5560
562 Ga0495620_0020743 3300046515 Bacteria 3203
563 Ga0495620_0036333 3300046515 Bacteria 2205
564 Ga0495620_0040610 3300046515 Bacteria 2046
565 Ga0495628_0114971 3300046516 Bacteria 2067
566 Ga0495630_0045820 3300046517 Bacteria 3268
567 Ga0495631_0000638 3300046518 Bacteria 22896
568 Ga0495631_0002043 3300046518 Bacteria 11752
569 Ga0495631_0005944 3300046518 Bacteria 6349
570 Ga0495631_0006154 3300046518 Bacteria 6219
571 Ga0495631_0031299 3300046518 Bacteria 2408
572 Ga0495632_0001741 3300046519 Bacteria 17649
573 Ga0495632_0002607 3300046519 Bacteria 13584
574 Ga0495632_0003111 3300046519 Bacteria 12021
575 Ga0495632_0010529 3300046519 Bacteria 5465
576 Ga0495632_0031822 3300046519 Bacteria 2723
577 Ga0495632_0034404 3300046519 Bacteria 2593
578 Ga0495632_0047592 3300046519 Bacteria 2126
579 Ga0495637_0000428 3300046520 Bacteria 30739
580 Ga0495637_0000625 3300046520 Bacteria 24990
581 Ga0495637_0000898 3300046520 Bacteria 19215
582 Ga0495637_0001294 3300046520 Bacteria 15043
583 Ga0495637_0005171 3300046520 Bacteria 6683
584 Ga0495637_0005398 3300046520 Bacteria 6529
585 Ga0495637_0005684 3300046520 Bacteria 6326
586 Ga0495637_0006580 3300046520 Bacteria 5813
587 Ga0495637_0017508 3300046520 Bacteria 3337
588 Ga0495637_0019929 3300046520 Bacteria 3093
589 Ga0495637_0070533 3300046520 Bacteria 1411
590 Ga0495643_0002218 3300046522 Bacteria 15787
591 Ga0495643_0002334 3300046522 Bacteria 15240
592 Ga0495643_0002599 3300046522 Bacteria 14076
593 Ga0495643_0002768 3300046522 Bacteria 13410
594 Ga0495643_0008430 3300046522 Bacteria 6523
595 Ga0495643_0009655 3300046522 Bacteria 5977
596 Ga0495643_0058493 3300046522 Bacteria 2051
597 Ga0495644_0002414 3300046523 Bacteria 7452
598 Ga0495644_0003490 3300046523 Bacteria 6221
599 Ga0495644_0038159 3300046523 Bacteria 1812
600 Ga0495644_0059060 3300046523 Bacteria 1442
601 Ga0495648_0000997 3300046524 Bacteria 29079
602 Ga0495648_0002902 3300046524 Bacteria 15418
603 Ga0495648_0004415 3300046524 Bacteria 12017
604 Ga0495648_0005728 3300046524 Bacteria 10253
605 Ga0495648_0015869 3300046524 Bacteria 5445
606 Ga0495648_0017162 3300046524 Bacteria 5186
607 Ga0495648_0037432 3300046524 Bacteria 3117
608 Ga0495648_0044124 3300046524 Bacteria 2786
609 Ga0495648_0066505 3300046524 Bacteria 2113
610 Ga0495648_0073176 3300046524 Bacteria 1980
611 Ga0495648_0095192 3300046524 Bacteria 1657
612 Ga0495648_0115944 3300046524 Bacteria 1448
613 Ga0495666_0008015 3300046526 Bacteria 5291
614 Ga0495666_0033192 3300046526 Bacteria 2523
615 Ga0495666_0041523 3300046526 Bacteria 2227
616 Ga0495666_0046452 3300046526 Bacteria 2093
617 Ga0495666_0069736 3300046526 Bacteria 1672
618 Ga0495642_0000151 3300046528 Bacteria 40418
619 Ga0495642_0000506 3300046528 Bacteria 20118
620 Ga0495642_0001115 3300046528 Bacteria 12392
621 Ga0495654_0000663 3300046530 Bacteria 27117
622 Ga0495654_0000819 3300046530 Bacteria 23673
623 Ga0495654_0001683 3300046530 Bacteria 14893
624 Ga0495654_0004044 3300046530 Bacteria 8810
625 Ga0495654_0020931 3300046530 Bacteria 3406
626 Ga0495654_0024144 3300046530 Bacteria 3143
627 Ga0495654_0031806 3300046530 Bacteria 2677
628 Ga0495654_0033304 3300046530 Bacteria 2608
629 Ga0495654_0087861 3300046530 Bacteria 1446
630 Ga0495654_0110325 3300046530 Bacteria 1256
631 Ga0495587_0001556 3300046536 Bacteria 15262
632 Ga0495587_0004482 3300046536 Bacteria 9185
633 Ga0495587_0051964 3300046536 Bacteria 2420
634 Ga0495598_0021050 3300046537 Bacteria 1730
635 Ga0495609_0000032 3300046538 Bacteria 211021
636 Ga0495609_0001044 3300046538 Bacteria 19418
637 Ga0495609_0001602 3300046538 Bacteria 14792
638 Ga0495609_0003586 3300046538 Bacteria 8821
639 Ga0495609_0003790 3300046538 Bacteria 8511
640 Ga0495609_0004832 3300046538 Bacteria 7268
641 Ga0495609_0011106 3300046538 Bacteria 4299
642 Ga0495609_0019776 3300046538 Bacteria 3113
643 Ga0495609_0026373 3300046538 Bacteria 2661
644 Ga0495609_0029567 3300046538 Bacteria 2494
645 Ga0495609_0044311 3300046538 Bacteria 1996
646 Ga0495609_0092297 3300046538 Bacteria 1316
647 Ga0495597_0000852 3300046542 Bacteria 23978
648 Ga0495597_0003440 3300046542 Bacteria 9242
649 Ga0495597_0005741 3300046542 Bacteria 6520
650 Ga0495597_0037447 3300046542 Bacteria 2177
651 Ga0495597_0049710 3300046542 Bacteria 1852
652 Ga0495645_0013574 3300046543 Bacteria 5765
653 Ga0495645_0033134 3300046543 Bacteria 3769
654 Ga0495622_0000294 3300046557 Bacteria 37526
655 Ga0495622_0000418 3300046557 Bacteria 28124
656 Ga0495622_0010785 3300046557 Bacteria 4215
657 Ga0495622_0044666 3300046557 Bacteria 2059
658 Ga0495633_0000040 3300046558 Bacteria 177876
659 Ga0495633_0003735 3300046558 Bacteria 10021
660 Ga0495633_0007547 3300046558 Bacteria 6243
661 Ga0495633_0066898 3300046558 Bacteria 1678
662 Ga0495667_0227340 3300046559 Bacteria 1190
663 Ga0495656_0028388 3300046615 Bacteria 2244
664 Ga0495656_0059671 3300046615 Bacteria 1660
665 Ga0495668_0001353 3300046616 Bacteria 24063
666 Ga0495668_0032107 3300046616 Bacteria 2956
667 Ga0495668_0050697 3300046616 Bacteria 2299
668 Ga0495668_0096456 3300046616 Bacteria 1618
669 Ga0495634_0008936 3300046642 Bacteria 7418
670 Ga0495634_0010361 3300046642 Bacteria 6830
671 Ga0495611_0000001 3300046648 Bacteria 2628469
672 Ga0495611_0000027 3300046648 Bacteria 116663
673 Ga0495611_0000918 3300046648 Bacteria 15934
674 Ga0495611_0003256 3300046648 Bacteria 7178
675 Ga0495611_0003539 3300046648 Bacteria 6868
676 Ga0495611_0007338 3300046648 Bacteria 4680
677 Ga0495611_0019423 3300046648 Bacteria 2919
678 Ga0495611_0084838 3300046648 Bacteria 1460
679 Ga0495625_0000037 3300046660 Bacteria 219383
680 Ga0495625_0002110 3300046660 Bacteria 22195
681 Ga0495625_0004836 3300046660 Bacteria 12576
682 Ga0495625_0014674 3300046660 Bacteria 6240
683 Ga0495625_0017547 3300046660 Bacteria 5603
684 Ga0495625_0058085 3300046660 Bacteria 2749
685 Ga0495625_0058410 3300046660 Bacteria 2741
686 Ga0495625_0090300 3300046660 Bacteria 2119
687 Ga0495625_0101294 3300046660 Bacteria 1978
688 Ga0495625_0175066 3300046660 Bacteria 1430
689 Ga0495635_0009714 3300046663 Bacteria 6724
690 Ga0495635_0079253 3300046663 Bacteria 2248
691 Ga0495635_0086663 3300046663 Unclassified 2143
692 Ga0495635_0210353 3300046663 Bacteria 1317
693 Ga0495659_0000883 3300046664 Bacteria 10659
694 Ga0495659_0032182 3300046664 Bacteria 1834
695 Ga0495659_0035335 3300046664 Bacteria 1761
696 Ga0495661_0000037 3300046665 Bacteria 164234
697 Ga0495661_0003926 3300046665 Bacteria 10855
698 Ga0495661_0007526 3300046665 Bacteria 7591
699 Ga0495661_0010570 3300046665 Bacteria 6293
700 Ga0495661_0011316 3300046665 Bacteria 6054
701 Ga0495661_0011493 3300046665 Bacteria 6006
702 Ga0495661_0048213 3300046665 Bacteria 2589
703 Ga0495661_0059485 3300046665 Bacteria 2274
704 Ga0495661_0064341 3300046665 Bacteria 2164
705 Ga0495661_0088173 3300046665 Bacteria 1772
706 Ga0495588_0012636 3300046674 Bacteria 3996
707 Ga0495588_0018140 3300046674 Bacteria 3427
708 Ga0495588_0053688 3300046674 Bacteria 2078
709 Ga0495588_0102262 3300046674 Bacteria 1506
710 Ga0495588_0133269 3300046674 Bacteria 1311
711 Ga0495599_0380902 3300046678 Bacteria 842
712 Ga0495623_0009046 3300046679 Bacteria 6460
713 Ga0495646_0000953 3300046680 Bacteria 16510
714 Ga0495646_0059661 3300046680 Bacteria 2278
715 Ga0495646_0163730 3300046680 Bacteria 1230
716 Ga0495658_0031488 3300046683 Bacteria 2890
717 Ga0495669_0001725 3300046684 Bacteria 8942
718 Ga0495669_0003637 3300046684 Bacteria 6349
719 Ga0495613_0012226 3300046689 Bacteria 6379
720 Ga0495613_0032289 3300046689 Bacteria 3888
721 Ga0495613_0048129 3300046689 Bacteria 3148
722 Ga0495613_0066682 3300046689 Bacteria 2628
723 Ga0495624_0001882 3300046690 Bacteria 15976
724 Ga0495670_0000709 3300046691 Bacteria 15882
725 Ga0495670_0004374 3300046691 Bacteria 6927
726 Ga0495670_0005236 3300046691 Bacteria 6382
727 Ga0495670_0023737 3300046691 Bacteria 3027
728 Ga0495670_0032594 3300046691 Bacteria 2591
729 Ga0495670_0043751 3300046691 Bacteria 2235
730 Ga0495670_0050965 3300046691 Bacteria 2072
731 Ga0495670_0065327 3300046691 Bacteria 1834
732 Ga0495671_0001424 3300046692 Bacteria 16086
733 Ga0495671_0001841 3300046692 Bacteria 13642
734 Ga0495671_0002352 3300046692 Bacteria 12007
735 Ga0495671_0005900 3300046692 Bacteria 7127
736 Ga0495671_0012431 3300046692 Bacteria 4650
737 Ga0495671_0020650 3300046692 Bacteria 3468
738 Ga0495671_0021664 3300046692 Bacteria 3372
739 Ga0495671_0032052 3300046692 Bacteria 2684
740 Ga0495671_0040679 3300046692 Bacteria 2343
741 Ga0495671_0115570 3300046692 Bacteria 1310
742 Ga0495649_0002234 3300046694 Bacteria 13781
743 Ga0495649_0002275 3300046694 Bacteria 13644
744 Ga0495649_0005634 3300046694 Bacteria 7913
745 Ga0495649_0008096 3300046694 Bacteria 6343
746 Ga0495649_0009798 3300046694 Bacteria 5671
747 Ga0495649_0037996 3300046694 Bacteria 2642
748 Ga0495649_0067181 3300046694 Bacteria 1923
749 Ga0495589_0000263 3300046794 Bacteria 42994
750 Ga0495589_0000366 3300046794 Bacteria 35102
751 Ga0495589_0000858 3300046794 Bacteria 19063
752 Ga0495589_0002405 3300046794 Bacteria 10516
753 Ga0495589_0003745 3300046794 Bacteria 8185
754 Ga0495589_0004393 3300046794 Bacteria 7512
755 Ga0495589_0007845 3300046794 Bacteria 5587
756 Ga0495589_0008973 3300046794 Bacteria 5202
757 Ga0495600_0018471 3300046809 Bacteria 4443
758 Ga0495660_0002590 3300046810 Bacteria 11489
759 Ga0495660_0006354 3300046810 Bacteria 7001
760 Ga0495660_0007978 3300046810 Bacteria 6218
761 Ga0495660_0011063 3300046810 Bacteria 5240
762 Ga0495660_0016204 3300046810 Bacteria 4299
763 Ga0495660_0038082 3300046810 Bacteria 2675
764 Ga0495660_0051280 3300046810 Bacteria 2245
765 Ga0495660_0052074 3300046810 Bacteria 2225
766 Ga0495660_0084381 3300046810 Bacteria 1661
767 Ga0495660_0139464 3300046810 Bacteria 1208
768 Ga0495660_0156035 3300046810 Bacteria 1123
769 Ga0495581_0007326 3300047315 Bacteria 6383
770 Ga0495581_0022149 3300047315 Bacteria 3682
771 Ga0495604_0012312 3300047317 Bacteria 6799
772 Ga0495604_0015482 3300047317 Bacteria 6087
773 Ga0495604_0159090 3300047317 Bacteria 1597
774 Ga0495636_0000753 3300047318 Bacteria 11926
775 Ga0495636_0002077 3300047318 Bacteria 7690
776 Ga0495674_0021739 3300047319 Bacteria 5928
777 Ga0495672_0001393 3300047320 Bacteria 23788
778 Ga0495672_0001568 3300047320 Bacteria 22385
779 Ga0495672_0002587 3300047320 Bacteria 16424
780 Ga0495672_0002676 3300047320 Bacteria 16048
781 Ga0495672_0003479 3300047320 Bacteria 13465
782 Ga0495672_0003814 3300047320 Bacteria 12683
783 Ga0495672_0013604 3300047320 Bacteria 5604
784 Ga0495672_0013933 3300047320 Bacteria 5527
785 Ga0495676_0004271 3300047321 Bacteria 13039
786 Ga0495676_0015854 3300047321 Bacteria 6697
787 Ga0495680_0012930 3300047322 Bacteria 7314
788 Ga0495680_0015919 3300047322 Bacteria 6474
789 Ga0495680_0017679 3300047322 Bacteria 6076
790 Ga0495680_0022647 3300047322 Bacteria 5233
791 Ga0495683_0000011 3300047323 Bacteria 212053
792 Ga0495683_0000784 3300047323 Bacteria 22657
793 Ga0495683_0004075 3300047323 Bacteria 8371
794 Ga0495683_0005637 3300047323 Bacteria 6933
795 Ga0495683_0005732 3300047323 Bacteria 6848
796 Ga0495683_0006421 3300047323 Bacteria 6428
797 Ga0495683_0028039 3300047323 Bacteria 2878
798 Ga0495683_0031292 3300047323 Bacteria 2711
799 Ga0495683_0040156 3300047323 Bacteria 2364
800 Ga0495683_0040907 3300047323 Bacteria 2340
801 Ga0495683_0082517 3300047323 Bacteria 1566
802 Ga0495687_002112 3300047443 Bacteria 16655
803 Ga0495687_008543 3300047443 Bacteria 5852
804 Ga0495675_0013975 3300047444 Bacteria 5077
805 Ga0495675_0014655 3300047444 Bacteria 4953
806 Ga0495677_0000393 3300047445 Bacteria 18673
807 Ga0495679_000001 3300047446 Bacteria 1607568
808 Ga0495679_000176 3300047446 Bacteria 57881
809 Ga0495679_003695 3300047446 Bacteria 7288
810 Ga0495679_004059 3300047446 Bacteria 6866
811 Ga0495679_004736 3300047446 Bacteria 6176
812 Ga0495679_018686 3300047446 Bacteria 2454
813 Ga0495685_001024 3300047447 Bacteria 8524
814 Ga0495685_025697 3300047447 Bacteria 2026
815 Ga0495673_0000607 3300047469 Bacteria 35637
816 Ga0495673_0001083 3300047469 Bacteria 23778
817 Ga0495673_0001179 3300047469 Bacteria 22083
818 Ga0495673_0001247 3300047469 Bacteria 21037
819 Ga0495673_0002001 3300047469 Bacteria 14995
820 Ga0495673_0002223 3300047469 Bacteria 13941
821 Ga0495673_0006626 3300047469 Bacteria 6787
822 Ga0495673_0006858 3300047469 Bacteria 6640
823 Ga0495673_0007482 3300047469 Bacteria 6270
824 Ga0495673_0007539 3300047469 Bacteria 6234
825 Ga0495673_0019067 3300047469 Bacteria 3443
826 Ga0495673_0023705 3300047469 Bacteria 2979
827 Ga0495673_0023870 3300047469 Bacteria 2965
828 Ga0495673_0026076 3300047469 Bacteria 2799
829 Ga0495673_0031248 3300047469 Bacteria 2494
830 Ga0495673_0047147 3300047469 Bacteria 1905
831 Ga0495673_0059595 3300047469 Bacteria 1640
832 Ga0495673_0110398 3300047469 Bacteria 1100
833 Ga0495681_0000536 3300047470 Bacteria 29078
834 Ga0495681_0001815 3300047470 Bacteria 15694
835 Ga0495681_0041658 3300047470 Bacteria 2228
836 Ga0495681_0052239 3300047470 Bacteria 1918
837 Ga0495681_0059785 3300047470 Bacteria 1761
838 Ga0495681_0118806 3300047470 Bacteria 1136
839 Ga0495686_0004152 3300047472 Bacteria 12056
840 Ga0495686_0007204 3300047472 Bacteria 8376
841 Ga0495686_0012958 3300047472 Bacteria 5809
842 Ga0495686_0033662 3300047472 Bacteria 3307
843 Ga0495593_0003966 3300047673 Bacteria 8834
844 Ga0495593_0009549 3300047673 Bacteria 5629
845 Ga0495593_0013731 3300047673 Bacteria 4612
846 Ga0495602_0016910 3300048088 Bacteria 7319
847 Ga0495614_0083515 3300048089 Bacteria 1385
848 Ga0495626_0001557 3300048091 Bacteria 18006
849 Ga0495626_0002243 3300048091 Bacteria 13850
850 Ga0495626_0002531 3300048091 Bacteria 12566
851 Ga0495626_0005293 3300048091 Bacteria 7617
852 Ga0495626_0005902 3300048091 Bacteria 7050
853 Ga0495626_0006059 3300048091 Bacteria 6948
854 Ga0495626_0006581 3300048091 Bacteria 6588
855 Ga0495626_0008233 3300048091 Bacteria 5739
856 Ga0495626_0025111 3300048091 Bacteria 2916
857 Ga0495626_0103881 3300048091 Bacteria 1236
858 Ga0496100_0102358 3300048903 Bacteria 1976
859 Ga0496101_0062377 3300048904 Bacteria 2710
860 Ga0496102_0000604 3300048905 Bacteria 37459
861 Ga0496102_0104440 3300048905 Bacteria 2635
862 Ga0496103_0006912 3300048906 Bacteria 6777
863 Ga0496103_0102586 3300048906 Bacteria 1811
864 Ga0496108_0027022 3300048911 Bacteria 4736
865 Ga0496110_0006365 3300048913 Bacteria 9334
866 Ga0496110_0014430 3300048913 Bacteria 6560
867 Ga0496110_0045914 3300048913 Bacteria 3820
868 Ga0496110_0243113 3300048913 Bacteria 1638
869 Ga0496110_0492637 3300048913 Bacteria 1116
870 Ga0496116_0003029 3300048919 Bacteria 17013
871 Ga0496116_0004538 3300048919 Bacteria 13188
872 Ga0496116_0013152 3300048919 Bacteria 6697
873 Ga0496116_0013391 3300048919 Bacteria 6618
874 Ga0496116_0076126 3300048919 Bacteria 2103
875 Ga0496116_0149135 3300048919 Bacteria 1302
876 Ga0496117_0001815 3300048920 Bacteria 29016
877 Ga0496117_0015165 3300048920 Bacteria 6591
878 Ga0496117_0015909 3300048920 Bacteria 6373
879 Ga0496117_0016327 3300048920 Bacteria 6270
880 Ga0496117_0022217 3300048920 Bacteria 5093
881 Ga0496117_0042483 3300048920 Bacteria 3316
882 Ga0496117_0042485 3300048920 Bacteria 3316
883 Ga0496118_0002174 3300048921 Bacteria 27294
884 Ga0496118_0016288 3300048921 Bacteria 6826
885 Ga0496118_0018025 3300048921 Bacteria 6393
886 Ga0496118_0026191 3300048921 Bacteria 4974
887 Ga0496118_0072065 3300048921 Bacteria 2483
888 Ga0496118_0091257 3300048921 Bacteria 2095
889 Ga0496118_0108002 3300048921 Bacteria 1856
890 Ga0496118_0138970 3300048921 Bacteria 1544
891 Ga0496119_0013863 3300048922 Bacteria 6364
892 Ga0496119_0014255 3300048922 Bacteria 6240
893 Ga0496119_0071686 3300048922 Bacteria 2027
894 Ga0496120_0063200 3300048923 Bacteria 2060
895 Ga0496120_0108804 3300048923 Bacteria 1451
896 Ga0496121_0001008 3300048924 Bacteria 50302
897 Ga0496121_0002419 3300048924 Bacteria 28592
898 Ga0496121_0002497 3300048924 Bacteria 27960
899 Ga0496121_0018103 3300048924 Bacteria 7127
900 Ga0496121_0029665 3300048924 Bacteria 5049
901 Ga0496121_0092180 3300048924 Bacteria 2362
902 Ga0496121_0104954 3300048924 Bacteria 2169
903 Ga0496121_0158374 3300048924 Bacteria 1658
904 Ga0496121_0174369 3300048924 Bacteria 1558
905 Ga0496122_0000945 3300048925 Bacteria 52642
906 Ga0496122_0018845 3300048925 Bacteria 6343
907 Ga0496122_0019180 3300048925 Bacteria 6263
908 Ga0496122_0180157 3300048925 Bacteria 1261
909 Ga0496123_0000888 3300048926 Bacteria 47314
910 Ga0496123_0005883 3300048926 Bacteria 12128
911 Ga0496123_0050801 3300048926 Bacteria 2767
912 Ga0496123_0098019 3300048926 Bacteria 1715
913 Ga0496124_0002611 3300048927 Bacteria 23246
914 Ga0496124_0004905 3300048927 Bacteria 15378
915 Ga0496124_0010228 3300048927 Bacteria 9528
916 Ga0496124_0102260 3300048927 Bacteria 2319
917 Ga0496124_0114546 3300048927 Bacteria 2165
918 Ga0496124_0162257 3300048927 Bacteria 1740
919 Ga0496124_0185723 3300048927 Bacteria 1595
920 Ga0496125_0005661 3300048928 Bacteria 13790
921 Ga0496125_0007915 3300048928 Bacteria 11221
922 Ga0496125_0012895 3300048928 Bacteria 8255
923 Ga0496125_0018010 3300048928 Bacteria 6714
924 Ga0496125_0033034 3300048928 Bacteria 4586
925 Ga0496125_0061124 3300048928 Bacteria 3023
926 Ga0496125_0087911 3300048928 Bacteria 2345
927 Ga0496126_0002379 3300048929 Bacteria 25600
928 Ga0496126_0133150 3300048929 Bacteria 2146
929 Ga0496126_0167695 3300048929 Bacteria 1873
930 Ga0495678_000028 3300049459 Bacteria 220080
931 Ga0495678_000033 3300049459 Bacteria 211804
932 Ga0495678_000311 3300049459 Bacteria 52388
933 Ga0495678_002317 3300049459 Bacteria 13124
934 Ga0495678_002782 3300049459 Bacteria 11424
935 Ga0495678_003313 3300049459 Bacteria 10048
936 Ga0495678_004804 3300049459 Bacteria 7689
937 Ga0495678_005647 3300049459 Bacteria 6828
938 Ga0495678_008179 3300049459 Bacteria 5312
939 Ga0495678_041489 3300049459 Bacteria 1841
940 Ga0495678_046636 3300049459 Bacteria 1702
941 Ga0495678_057442 3300049459 Bacteria 1474
942 Ga0495682_0000072 3300049460 Bacteria 93119
943 Ga0495682_0000265 3300049460 Bacteria 41386
944 Ga0495682_0001293 3300049460 Bacteria 13941
945 Ga0495682_0002849 3300049460 Bacteria 7970
946 Ga0495682_0003811 3300049460 Bacteria 6628
947 Ga0495682_0017809 3300049460 Bacteria 2677
948 Ga0495682_0018489 3300049460 Bacteria 2624
949 Ga0495682_0019820 3300049460 Bacteria 2527
950 Ga0495682_0020861 3300049460 Bacteria 2457
951 Ga0495682_0041754 3300049460 Bacteria 1681
952 Ga0501222_000921 3300049662 Bacteria 4224
953 Ga0501241_000864 3300049758 Bacteria 6443
954 Ga0501269_002850 3300049766 Bacteria 2108
955 Ga0501226_000988 3300049853 Bacteria 3737
956 nmdc:mga03683_111520_c1 3300050489 Bacteria 1210
957 nmdc:mga00v17_147598_c1 3300050491 Bacteria 1510
958 nmdc:mga00v17_153323_c1 3300050491 Bacteria 1481
959 nmdc:mga0k408_78_c1 3300050493 Bacteria 45819
960 nmdc:mga08x19_70088_c1 3300050514 Bacteria 2284
961 nmdc:mga0sz30_6379_c1 3300050516 Bacteria 4378
962 Ga0495601_0038246 3300053077 Bacteria 3000
963 Ga0495612_0178938 3300053078 Bacteria 931
964 Ga0495619_0149469 3300053085 Bacteria 1611
965 Ga0495619_0336777 3300053085 Bacteria 1044
966 Ga0500643_000053 3300053087 Bacteria 142202
967 Ga0500555_000867 3300053103 Bacteria 10782
968 Ga0500586_003095 3300053145 Bacteria 3876
969 2511252423 2511231004 Bacteria 6669789
970 2511263984 2511231006 Bacteria 6794709
971 2511272029 2511231007 Bacteria 6306603
972 2511280489 2511231008 Bacteria 6624100
973 2511292052 2511231010 Bacteria 6373152
974 2511296747 2511231011 Bacteria 6149768
975 2511324466 2511231016 Bacteria 6704427
976 2511341429 2511231018 Bacteria 6436256
977 2511352289 2511231020 Bacteria 6115223
978 2511363612 2511231022 Bacteria 6719296
979 2511366544 2511231023 Bacteria 6808468
980 2511416363 2511231031 Bacteria 6558529
981 2511823530 2511231156 Bacteria 6845832
982 2512324956 2512047018 Bacteria 6663241
983 2514422866 2513237305 Bacteria 7293571
984 2583791081 2582580891 Bacteria 6800976
985 2585392061 2582581866 Bacteria 6859583
986 2597856774 2597489887 Bacteria 6666321
987 2599483797 2599185185 Bacteria 6652270
988 2599504026 2599185188 Bacteria 6164180
989 2599801443 2599185257 Bacteria 6492581
990 2599887679 2599185289 Bacteria 6778765
991 2599899842 2599185291 Bacteria 6775623
992 2599931982 2599185300 Bacteria 6062622
993 2599960419 2599185305 Bacteria 6748700
994 2599971532 2599185307 Bacteria 6194719
995 2599988021 2599185310 Bacteria 6014457
996 2600017541 2599185315 Bacteria 6771107
997 2600030336 2599185317 Bacteria 6435722
998 2600052365 2599185321 Bacteria 6764560
999 2600360768 2600254930 Bacteria 6431253
1000 2600365744 2600254931 Bacteria 6734225
1001 2601795427 2600255318 Bacteria 6383414
1002 2606075495 2603880185 Bacteria 6379190
1003 2606128593 2603880199 Bacteria 6377649
1004 2624493644 2623620446 Bacteria 6500345
1005 2644187228 2643221633 Bacteria 6733554
1006 2644206907 2643221637 Bacteria 5345260
1007 2644650555 2643221718 Bacteria 5345506
1008 2671090340 2667528170 Bacteria 6786960
1009 2671768392 2671180172 Bacteria 6495783
1010 2715751880 2713897148 Bacteria 5883533
1011 2715754929 2713897149 Bacteria 6506249
1012 2718633205 2718217725 Bacteria 5758958
1013 2723577651 2721755686 Bacteria 7343952
1014 2735835980 2734482264 Unclassified 5014763
1015 2739316102 2738543025 Bacteria 6600348
1016 2740995010 2740891818 Bacteria 6711283
1017 2743736202 2740892503 Bacteria 6855563
1018 2765582760 2765235841 Bacteria 6137024
1019 2774122805 2773857670 Bacteria 6407454
1020 2774137518 2773857673 Bacteria 6513460
1021 2784259872 2784132063 Bacteria 6262788
1022 2784315163 2784132072 Bacteria 6596533
1023 2794596258 2791355520 Bacteria 5948615
1024 2808931816 2808606377 Bacteria 6646337
1025 2808953936 2808606381 Bacteria 6646461
1026 2809216306 2808606445 Bacteria 6057339
1027 2819654083 2818991456 Bacteria 6123676
1028 2842832769 2842832357 Bacteria 5959113
1029 2842848143 2842843487 Bacteria 6004777
1030 2842854510 2842854478 Bacteria 6143501
1031 2844669106 2844665904 Bacteria 6817974
1032 2852658840 2852657418 Bacteria 6472974
1033 2860340093 2860339153 Bacteria 6846989
1034 2876398832 2876392853 Bacteria 6660880
1035 2878031367 2878029506 Bacteria 6418441
1036 2880232229 2880230671 Bacteria 6140320
1037 2881163045 2881161766 Bacteria 7127907
1038 2904521874 2904518522 Bacteria 6068986
1039 2904553271 2904550169 Bacteria 6221258
1040 2904665364 2904659560 Bacteria 6685615
1041 2919064163 2919063839 Bacteria 6302690
1042 2919386327 2919385768 Bacteria 5897293
1043 2919457181 2919456309 Bacteria 6586567
1044 2919481707 2919481497 Bacteria 6907839
1045 2919491397 2919487758 Bacteria 5929766
1046 2919702944 2919697872 Bacteria 6553725
1047 2923155216 2923153595 Bacteria 6870622
1048 2931400015 2931396565 Bacteria 7251677
1049 2961120364 2961114664 Bacteria 6680456
1050 2968116831 2968110612 Bacteria 6814636
1051 2969306148 2969304461 Bacteria 6601805
1052 2974292202 2974289157 Bacteria 6080362
1053 2984290822 2984286254 Bacteria 6702062
1054 2988733424 2988728565 Bacteria 6124362
1055 2998141538 2998139840 Bacteria 6073514
1056 3007614559 3007614139 Bacteria 6053559
1057 3007622416 3007619802 Bacteria 6411688
1058 3007722869 3007718800 Bacteria 5971527
1059 3007863222 3007861166 Bacteria 6045338
1060 8015689437 8015687852 Bacteria 6613826
1061 8019774155 8019769354 Bacteria 6924660
1062 8019780175 8019775933 Bacteria 6858656
1063 8029999210 8029995093 Bacteria 5990776
1064 8054931023 8054929484 Bacteria 5599761
1065 8055772571 8055770955 Bacteria 6827675
1066 8056141439 8056137416 Bacteria 6147080
1067 8056147404 8056143049 Bacteria 6307666
1068 8056156713 8056155041 Bacteria 6486948
1069 8056169448 8056166840 Bacteria 5820959
1070 8056175627 8056172158 Bacteria 6133900
1071 8057798999 8057798959 Bacteria 6713499
1072 Ga0436360_1051396
1073 MRS2a_Contig_523
1074 MRS2a_Contig_9
1075 SwRhRL2b_contig_2050723
1076 MRS1b_contig_3223266
1077 JGI25162J39368_1000037
1078 JGI25163J39215_1000160
1079 JGI25164J39214_1000020
1080 JGI25165J46597_1000077
1081 Ga0055536_1000041
1082 Ga0055536_1000042
1083 Ga0055536_1000441
1084 Ga0055536_1000537
1085 Ga0055530_10000063
1086 Ga0055530_10000725
1087 Ga0055540_1000501
1088 Ga0055540_1000604
1089 Ga0055531_10001274
1090 Ga0065714_10000129
1091 Ga0065714_10004405
1092 Ga0065714_10004572
1093 Ga0065704_10070547
1094 Ga0065712_10000532
1095 Ga0065715_10005656
1096 Ga0070658_10139878
1097 Ga0070658_10178264
1098 Ga0070676_10011992
1099 Ga0070676_10112682
1100 Ga0070670_100002229
1101 Ga0070670_100005687
1102 Ga0070670_100024039
1103 Ga0070670_100070010
1104 Ga0070670_100273102
1105 Ga0070677_10019981
1106 Ga0070677_10023911
1107 Ga0070677_10156006
1108 Ga0068869_100039304
1109 Ga0070666_10057619
1110 Ga0068868_100066155
1111 Ga0070661_100071883
1112 Ga0070668_100001828
1113 Ga0070669_100014691
1114 Ga0070669_100029331
1115 Ga0070669_100057759
1116 Ga0070675_100007942
1117 Ga0070675_100017439
1118 Ga0070675_100063411
1119 Ga0070675_100067337
1120 Ga0070675_100093099
1121 Ga0070675_100124059
1122 Ga0070675_100298356
1123 Ga0070671_100009709
1124 Ga0070671_100030658
1125 Ga0070671_100127077
1126 Ga0070671_100152663
1127 Ga0070674_100004695
1128 Ga0070674_100373974
1129 Ga0070673_100006275
1130 Ga0070673_100067395
1131 Ga0070659_100037609
1132 Ga0070667_100012425
1133 Ga0070667_100259701
1134 Ga0070700_100043934
1135 Ga0070678_100027482
1136 Ga0070678_100144557
1137 Ga0070678_100329309
1138 Ga0070662_100002799
1139 Ga0070662_100023071
1140 Ga0070662_100041744
1141 Ga0068867_100007420
1142 Ga0068867_100009150
1143 Ga0070684_100301644
1144 Ga0070697_100082439
1145 Ga0070672_100002981
1146 Ga0070672_100005989
1147 Ga0070696_100049229
1148 Ga0070665_100140278
1149 Ga0070665_100287230
1150 Ga0068852_100066561
1151 Ga0068852_100587130
1152 Ga0068859_100040184
1153 Ga0068864_100005858
1154 Ga0068864_100072176
1155 Ga0068866_10007584
1156 Ga0068861_100004142
1157 Ga0068851_10108670
1158 Ga0068863_100003514
1159 Ga0068863_100018571
1160 Ga0068863_100105651
1161 Ga0068858_100185585
1162 Ga0068860_100036706
1163 Ga0075364_10207418
1164 Ga0075432_10000422
1165 Ga0075432_10002595
1166 Ga0075362_10081188
1167 Ga0075369_10024983
1168 Ga0075366_10013980
1169 Ga0097621_100015345
1170 Ga0097621_100069375
1171 Ga0097621_100189366
1172 Ga0068871_100001760
1173 Ga0068871_100025548
1174 Ga0075436_100033025
1175 Ga0097620_100040185
1176 Ga0079104_1003979
1177 Ga0105251_10000060
1178 Ga0105251_10000630
1179 Ga0105251_10002026
1180 Ga0105251_10004603
1181 Ga0105251_10014831
1182 Ga0105251_10039338
1183 Ga0105251_10052192
1184 Ga0105251_10083917
1185 Ga0105244_10002159
1186 Ga0105244_10002763
1187 Ga0105244_10004488
1188 Ga0105244_10018701
1189 Ga0105244_10138646
1190 Ga0105244_10151655
1191 Ga0105250_10000979
1192 Ga0105250_10001081
1193 Ga0105250_10002986
1194 Ga0105250_10007464
1195 Ga0111539_10007100
1196 Ga0105245_10020891
1197 Ga0105243_10000162
1198 Ga0105243_10022667
1199 Ga0105248_10102314
1200 Ga0105248_10647280
1201 Ga0105246_10008116
1202 Ga0157373_10001457
1203 Ga0157373_10002764
1204 Ga0157373_10008956
1205 Ga0157373_10013196
1206 Ga0157373_10014392
1207 Ga0157371_10002880
1208 Ga0157371_10003491
1209 Ga0157371_10020080
1210 Ga0157371_10070073
1211 Ga0157370_10004442
1212 Ga0157370_10008202
1213 Ga0157370_10056197
1214 Ga0157370_10086299
1215 Ga0157370_10285461
1216 Ga0157369_10008420
1217 Ga0157369_10030650
1218 Ga0157369_10293281
1219 Ga0163162_10001271
1220 Ga0163162_10004598
1221 Ga0163162_10006558
1222 Ga0163162_10018673
1223 Ga0163162_10074928
1224 Ga0163162_10095782
1225 Ga0163162_10369762
1226 Ga0163162_10506589
1227 Ga0157372_10001365
1228 Ga0157372_10182322
1229 Ga0157375_10010475
1230 Ga0157375_10046742
1231 Ga0157375_10129766
1232 Ga0157375_10231695
1233 Ga0157375_10714532
1234 Ga0157375_10738008
1235 Ga0163163_10150092
1236 Ga0163163_10179646
1237 Ga0157380_10010808
1238 Ga0157380_10040339
1239 Ga0182008_10002027
1240 Ga0182008_10004747
1241 Ga0182008_10004863
1242 Ga0182008_10006302
1243 Ga0182008_10078408
1244 Ga0157379_10009072
1245 Ga0157376_10002090
1246 Ga0157376_10003642
1247 Ga0157376_10043120
1248 Ga0182006_1001020
1249 Ga0182006_1002669
1250 Ga0182006_1055688
1251 Ga0182007_10000729
1252 Ga0182005_1003133
1253 Ga0182005_1003396
1254 Ga0182005_1018428
1255 Ga0182005_1022877
1256 Ga0182005_1023064
1257 Ga0182005_1026198
1258 Ga0163161_10002333
1259 Ga0163161_10015126
1260 Ga0163161_10021069
1261 Ga0163161_10036517
1262 Ga0163161_10040626
1263 Ga0213876_10019248
1264 Ga0209760_100053
1265 Ga0209563_100535
1266 Ga0207427_100001
1267 Ga0209437_100003
1268 Ga0209233_1000007
1269 Ga0209675_1002483
1270 Ga0209676_1000016
1271 Ga0209676_1000021
1272 Ga0209676_1000033
1273 Ga0209050_1000036
1274 Ga0209050_1000107
1275 Ga0209051_1000043
1276 Ga0209051_1000474
1277 Ga0209051_1047940
1278 Ga0209257_1000098
1279 Ga0209257_1015245
1280 Ga0207697_10064968
1281 Ga0207656_10069336
1282 Ga0207696_1000101
1283 Ga0207696_1000818
1284 Ga0207696_1000979
1285 Ga0207696_1002197
1286 Ga0207655_1000402
1287 Ga0207655_1001937
1288 Ga0207655_1002976
1289 Ga0207655_1008548
1290 Ga0207655_1019806
1291 Ga0207655_1026603
1292 Ga0207655_1038191
1293 Ga0207713_1000150
1294 Ga0207713_1005386
1295 Ga0207713_1006998
1296 Ga0207713_1039279
1297 Ga0207713_1040943
1298 Ga0207682_10012514
1299 Ga0207682_10017480
1300 Ga0207682_10048593
1301 Ga0207642_10033859
1302 Ga0207688_10157340
1303 Ga0207680_10064526
1304 Ga0207680_10314395
1305 Ga0207645_10004107
1306 Ga0207643_10054378
1307 Ga0207662_10044865
1308 Ga0207649_10055026
1309 Ga0207646_10002099
1310 Ga0207681_10011566
1311 Ga0207681_10024126
1312 Ga0207650_10001201
1313 Ga0207650_10002944
1314 Ga0207650_10008268
1315 Ga0207650_10042469
1316 Ga0207650_10229608
1317 Ga0207659_10017831
1318 Ga0207659_10047638
1319 Ga0207659_10056637
1320 Ga0207659_10116093
1321 Ga0207659_10153911
1322 Ga0207644_10012599
1323 Ga0207644_10160245
1324 Ga0207690_10320643
1325 Ga0207706_10008925
1326 Ga0207706_10035537
1327 Ga0207709_10000053
1328 Ga0207709_10019377
1329 Ga0207670_10067725
1330 Ga0207669_10005768
1331 Ga0207704_10172954
1332 Ga0207691_10000964
1333 Ga0207691_10025170
1334 Ga0207691_10070219
1335 Ga0207691_10118545
1336 Ga0207711_10082130
1337 Ga0207711_10196189
1338 Ga0207689_10010069
1339 Ga0207679_10421162
1340 Ga0207651_10001048
1341 Ga0207651_10055966
1342 Ga0207712_10018024
1343 Ga0207640_10284192
1344 Ga0207658_10028783
1345 Ga0207658_10080727
1346 Ga0207677_10169222
1347 Ga0207703_10039834
1348 Ga0207639_10081823
1349 Ga0207641_10007595
1350 Ga0207641_10014579
1351 Ga0207641_10133945
1352 Ga0207648_10020407
1353 Ga0207648_10034632
1354 Ga0207648_10049136
1355 Ga0207676_10121560
1356 Ga0207674_10143439
1357 Ga0207675_100006516
1358 Ga0207683_10032674
1359 Ga0207683_10048104
1360 Ga0207683_10074060
1361 Ga0207683_10190295
1362 Ga0207698_10029360
1363 Ga0209281_1004437
1364 Ga0207428_10073217
1365 Ga0207428_10080653
1366 Ga0268266_10054016
1367 Ga0268266_10149169
1368 Ga0268266_10218183
1369 Ga0268265_10062451
1370 Ga0268264_10010901
1371 Ga0307515_10000180
1372 Ga0307515_10155775
1373 Ga0265324_10000032
1374 Ga0316181_1060393
1375 Ga0265332_10000004
1376 Ga0265331_10024250
1377 Ga0307408_100002045
1378 Ga0307408_100002790
1379 Ga0307408_100021941
1380 Ga0307408_100295151
1381 Ga0307408_100499494
1382 Ga0265314_10010534
1383 Ga0307405_10001772
1384 Ga0307405_10006846
1385 Ga0307413_10022187
1386 Ga0307406_10002886
1387 Ga0307412_10001193
1388 Ga0307412_10003158
1389 Ga0307412_10007173
1390 Ga0307412_10100642
1391 Ga0307412_10632622
1392 Ga0307409_100000746
1393 Ga0307416_100011193
1394 Ga0307416_100062975
1395 Ga0307416_100070403
1396 Ga0307416_100180371
1397 Ga0307414_10029301
1398 Ga0307414_10068668
1399 Ga0307411_10005587
1400 Ga0307411_10189722
1401 Ga0307510_10005583
1402 Ga0373953_0062927
1403 Ga0373937_0038014
1404 Ga0373937_0057084
1405 Ga0373937_0063401
1406 Ga0436365_1450265
1407 Ga0436363_1071075
1408 Ga0439438_000562
1409 Ga0439438_000735
1410 Ga0439438_000802
1411 Ga0439438_002175
1412 Ga0439438_003910
1413 Ga0439438_010537
1414 Ga0439447_000425
1415 Ga0439447_002399
1416 Ga0439447_004257
1417 Ga0439447_009600
1418 Ga0439447_025666
1419 Ga0439447_036537
1420 Ga0439466_0000563
1421 Ga0439466_0000841
1422 Ga0439466_0005342
1423 Ga0439466_0012552
1424 Ga0439466_0013241
1425 Ga0439466_0014195
1426 Ga0439465_0011279
1427 Ga0439465_0125953
1428 Ga0451795_1645496
1429 Ga0451853_1460144
1430 Ga0439431_0001457
1431 Ga0439445_0005750
1432 Ga0439445_0013812
1433 Ga0439432_001707
1434 Ga0439432_003625
1435 Ga0439432_011449
1436 Ga0439432_014115
1437 Ga0439432_027166
1438 Ga0439432_031711
1439 Ga0439451_000102
1440 Ga0439451_000661
1441 Ga0439451_002603
1442 Ga0439451_007124
1443 Ga0439451_038558
1444 Ga0439452_000346
1445 Ga0439452_001509
1446 Ga0439452_002656
1447 Ga0439452_003450
1448 Ga0439452_004522
1449 Ga0439452_006238
1450 Ga0439452_007239
1451 Ga0439456_000497
1452 Ga0439456_000503
1453 Ga0439456_001748
1454 Ga0439456_005305
1455 Ga0439456_005912
1456 Ga0439456_019207
1457 Ga0439456_037794
1458 Ga0439463_000413
1459 Ga0439463_002586
1460 Ga0439463_006040
1461 Ga0439463_026429
1462 Ga0439463_036985
1463 Ga0450911_000142
1464 Ga0450911_001259
1465 Ga0450911_004427
1466 Ga0450890_000374
1467 Ga0450891_000894
1468 Ga0450900_000041
1469 Ga0450902_002552
1470 Ga0450902_006507
1471 Ga0450903_004423
1472 Ga0450903_006832
1473 Ga0450903_007371
1474 Ga0450903_012148
1475 Ga0450904_001612
1476 Ga0450905_000228
1477 Ga0450905_011848
1478 Ga0450889_006595
1479 Ga0450906_000168
1480 Ga0450907_006358
1481 Ga0450907_010806
1482 Ga0450910_000525
1483 Ga0450910_003111
1484 Ga0439446_0002357
1485 Ga0439446_0011777
1486 Ga0450908_002485
1487 Ga0450909_000239
1488 Ga0439434_0015160
1489 Ga0439464_0016065
1490 Ga0439460_0001455
1491 Ga0439460_0001896
1492 Ga0450918_004793
1493 Ga0450893_0003582
1494 Ga0450893_0004680
1495 Ga0439440_0017354
1496 Ga0453684_0116111
1497 Ga0495617_000328
1498 Ga0495617_010227
1499 Ga0495617_018016
1500 Ga0495617_020665
1501 Ga0495617_031546
1502 Ga0495627_001228
1503 Ga0495627_003513
1504 Ga0495627_004102
1505 Ga0495627_004134
1506 Ga0495627_010317
1507 Ga0495627_030443
1508 Ga0495592_0013417
1509 Ga0495603_0000519
1510 Ga0495603_0007925
1511 Ga0495590_0002661
1512 Ga0495590_0002663
1513 Ga0495590_0003209
1514 Ga0495590_0003906
1515 Ga0495590_0029613
1516 Ga0495591_000256
1517 Ga0495591_001026
1518 Ga0495591_001411
1519 Ga0495591_002226
1520 Ga0495591_003670
1521 Ga0495591_019789
1522 Ga0495591_021687
1523 Ga0495591_026058
1524 Ga0495591_044566
1525 Ga0495629_0005998
1526 Ga0495629_0106403
1527 Ga0495629_0130859
1528 Ga0495638_0000059
1529 Ga0495638_0007805
1530 Ga0495638_0008730
1531 Ga0495638_0010285
1532 Ga0495638_0044002
1533 Ga0495638_0044050
1534 Ga0495638_0070716
1535 Ga0495638_0181745
1536 Ga0495653_0003581
1537 Ga0495653_0005114
1538 Ga0495653_0015400
1539 Ga0495653_0030146
1540 Ga0495653_0202670
1541 Ga0495653_0259776
1542 Ga0495650_0001778
1543 Ga0495650_0005113
1544 Ga0495650_0007214
1545 Ga0495650_0018563
1546 Ga0495650_0021962
1547 Ga0495605_0000032
1548 Ga0495605_0000857
1549 Ga0495605_0001277
1550 Ga0495605_0001888
1551 Ga0495605_0002198
1552 Ga0495605_0002521
1553 Ga0495605_0006105
1554 Ga0495605_0007807
1555 Ga0495605_0014566
1556 Ga0495605_0018889
1557 Ga0495605_0024838
1558 Ga0495605_0036323
1559 Ga0495605_0052299
1560 Ga0495639_0000241
1561 Ga0495639_0003322
1562 Ga0495664_0159173
1563 Ga0495664_0295119
1564 Ga0495584_0001923
1565 Ga0495584_0002126
1566 Ga0495584_0002304
1567 Ga0495584_0003690
1568 Ga0495584_0010843
1569 Ga0495584_0019174
1570 Ga0495584_0027976
1571 Ga0495585_0001287
1572 Ga0495585_0002592
1573 Ga0495585_0009763
1574 Ga0495585_0013045
1575 Ga0495585_0035974
1576 Ga0495585_0041146
1577 Ga0495585_0041191
1578 Ga0495594_0001279
1579 Ga0495594_0007038
1580 Ga0495594_0037845
1581 Ga0495594_0039263
1582 Ga0495596_0054128
1583 Ga0495607_0000121
1584 Ga0495607_0000563
1585 Ga0495607_0001138
1586 Ga0495607_0001754
1587 Ga0495607_0002115
1588 Ga0495607_0003276
1589 Ga0495607_0006139
1590 Ga0495607_0007248
1591 Ga0495607_0007895
1592 Ga0495607_0008577
1593 Ga0495607_0008832
1594 Ga0495607_0009002
1595 Ga0495607_0009248
1596 Ga0495607_0009800
1597 Ga0495607_0011881
1598 Ga0495607_0012597
1599 Ga0495607_0025600
1600 Ga0495607_0045804
1601 Ga0495607_0074277
1602 Ga0495583_0000052
1603 Ga0495583_0001042
1604 Ga0495583_0001955
1605 Ga0495583_0043477
1606 Ga0495583_0115354
1607 Ga0495606_0001451
1608 Ga0495606_0013096
1609 Ga0495606_0025197
1610 Ga0495606_0027499
1611 Ga0495610_0000720
1612 Ga0495610_0002376
1613 Ga0495610_0019617
1614 Ga0495610_0019910
1615 Ga0495610_0031497
1616 Ga0495610_0039683
1617 Ga0495610_0073402
1618 Ga0495610_0074105
1619 Ga0495616_0000377
1620 Ga0495616_0001708
1621 Ga0495616_0002074
1622 Ga0495616_0002254
1623 Ga0495616_0006526
1624 Ga0495616_0006718
1625 Ga0495616_0008680
1626 Ga0495616_0018577
1627 Ga0495616_0019845
1628 Ga0495616_0095736
1629 Ga0495620_0000019
1630 Ga0495620_0000338
1631 Ga0495620_0005406
1632 Ga0495620_0008361
1633 Ga0495620_0020743
1634 Ga0495620_0036333
1635 Ga0495620_0040610
1636 Ga0495628_0114971
1637 Ga0495630_0045820
1638 Ga0495631_0000638
1639 Ga0495631_0002043
1640 Ga0495631_0005944
1641 Ga0495631_0006154
1642 Ga0495631_0031299
1643 Ga0495632_0001741
1644 Ga0495632_0002607
1645 Ga0495632_0003111
1646 Ga0495632_0010529
1647 Ga0495632_0031822
1648 Ga0495632_0034404
1649 Ga0495632_0047592
1650 Ga0495637_0000428
1651 Ga0495637_0000625
1652 Ga0495637_0000898
1653 Ga0495637_0001294
1654 Ga0495637_0005171
1655 Ga0495637_0005398
1656 Ga0495637_0005684
1657 Ga0495637_0006580
1658 Ga0495637_0017508
1659 Ga0495637_0019929
1660 Ga0495637_0070533
1661 Ga0495643_0002218
1662 Ga0495643_0002334
1663 Ga0495643_0002599
1664 Ga0495643_0002768
1665 Ga0495643_0008430
1666 Ga0495643_0009655
1667 Ga0495643_0058493
1668 Ga0495644_0002414
1669 Ga0495644_0003490
1670 Ga0495644_0038159
1671 Ga0495644_0059060
1672 Ga0495648_0000997
1673 Ga0495648_0002902
1674 Ga0495648_0004415
1675 Ga0495648_0005728
1676 Ga0495648_0015869
1677 Ga0495648_0017162
1678 Ga0495648_0037432
1679 Ga0495648_0044124
1680 Ga0495648_0066505
1681 Ga0495648_0073176
1682 Ga0495648_0095192
1683 Ga0495648_0115944
1684 Ga0495666_0008015
1685 Ga0495666_0033192
1686 Ga0495666_0041523
1687 Ga0495666_0046452
1688 Ga0495666_0069736
1689 Ga0495642_0000151
1690 Ga0495642_0000506
1691 Ga0495642_0001115
1692 Ga0495654_0000663
1693 Ga0495654_0000819
1694 Ga0495654_0001683
1695 Ga0495654_0004044
1696 Ga0495654_0020931
1697 Ga0495654_0024144
1698 Ga0495654_0031806
1699 Ga0495654_0033304
1700 Ga0495654_0087861
1701 Ga0495654_0110325
1702 Ga0495587_0001556
1703 Ga0495587_0004482
1704 Ga0495587_0051964
1705 Ga0495598_0021050
1706 Ga0495609_0000032
1707 Ga0495609_0001044
1708 Ga0495609_0001602
1709 Ga0495609_0003586
1710 Ga0495609_0003790
1711 Ga0495609_0004832
1712 Ga0495609_0011106
1713 Ga0495609_0019776
1714 Ga0495609_0026373
1715 Ga0495609_0029567
1716 Ga0495609_0044311
1717 Ga0495609_0092297
1718 Ga0495597_0000852
1719 Ga0495597_0003440
1720 Ga0495597_0005741
1721 Ga0495597_0037447
1722 Ga0495597_0049710
1723 Ga0495645_0013574
1724 Ga0495645_0033134
1725 Ga0495622_0000294
1726 Ga0495622_0000418
1727 Ga0495622_0010785
1728 Ga0495622_0044666
1729 Ga0495633_0000040
1730 Ga0495633_0003735
1731 Ga0495633_0007547
1732 Ga0495633_0066898
1733 Ga0495667_0227340
1734 Ga0495656_0028388
1735 Ga0495656_0059671
1736 Ga0495668_0001353
1737 Ga0495668_0032107
1738 Ga0495668_0050697
1739 Ga0495668_0096456
1740 Ga0495634_0008936
1741 Ga0495634_0010361
1742 Ga0495611_0000001
1743 Ga0495611_0000027
1744 Ga0495611_0000918
1745 Ga0495611_0003256
1746 Ga0495611_0003539
1747 Ga0495611_0007338
1748 Ga0495611_0019423
1749 Ga0495611_0084838
1750 Ga0495625_0000037
1751 Ga0495625_0002110
1752 Ga0495625_0004836
1753 Ga0495625_0014674
1754 Ga0495625_0017547
1755 Ga0495625_0058085
1756 Ga0495625_0058410
1757 Ga0495625_0090300
1758 Ga0495625_0101294
1759 Ga0495625_0175066
1760 Ga0495635_0009714
1761 Ga0495635_0079253
1762 Ga0495635_0086663
1763 Ga0495635_0210353
1764 Ga0495659_0000883
1765 Ga0495659_0032182
1766 Ga0495659_0035335
1767 Ga0495661_0000037
1768 Ga0495661_0003926
1769 Ga0495661_0007526
1770 Ga0495661_0010570
1771 Ga0495661_0011316
1772 Ga0495661_0011493
1773 Ga0495661_0048213
1774 Ga0495661_0059485
1775 Ga0495661_0064341
1776 Ga0495661_0088173
1777 Ga0495588_0012636
1778 Ga0495588_0018140
1779 Ga0495588_0053688
1780 Ga0495588_0102262
1781 Ga0495588_0133269
1782 Ga0495599_0380902
1783 Ga0495623_0009046
1784 Ga0495646_0000953
1785 Ga0495646_0059661
1786 Ga0495646_0163730
1787 Ga0495658_0031488
1788 Ga0495669_0001725
1789 Ga0495669_0003637
1790 Ga0495613_0012226
1791 Ga0495613_0032289
1792 Ga0495613_0048129
1793 Ga0495613_0066682
1794 Ga0495624_0001882
1795 Ga0495670_0000709
1796 Ga0495670_0004374
1797 Ga0495670_0005236
1798 Ga0495670_0023737
1799 Ga0495670_0032594
1800 Ga0495670_0043751
1801 Ga0495670_0050965
1802 Ga0495670_0065327
1803 Ga0495671_0001424
1804 Ga0495671_0001841
1805 Ga0495671_0002352
1806 Ga0495671_0005900
1807 Ga0495671_0012431
1808 Ga0495671_0020650
1809 Ga0495671_0021664
1810 Ga0495671_0032052
1811 Ga0495671_0040679
1812 Ga0495671_0115570
1813 Ga0495649_0002234
1814 Ga0495649_0002275
1815 Ga0495649_0005634
1816 Ga0495649_0008096
1817 Ga0495649_0009798
1818 Ga0495649_0037996
1819 Ga0495649_0067181
1820 Ga0495589_0000263
1821 Ga0495589_0000366
1822 Ga0495589_0000858
1823 Ga0495589_0002405
1824 Ga0495589_0003745
1825 Ga0495589_0004393
1826 Ga0495589_0007845
1827 Ga0495589_0008973
1828 Ga0495600_0018471
1829 Ga0495660_0002590
1830 Ga0495660_0006354
1831 Ga0495660_0007978
1832 Ga0495660_0011063
1833 Ga0495660_0016204
1834 Ga0495660_0038082
1835 Ga0495660_0051280
1836 Ga0495660_0052074
1837 Ga0495660_0084381
1838 Ga0495660_0139464
1839 Ga0495660_0156035
1840 Ga0495581_0007326
1841 Ga0495581_0022149
1842 Ga0495604_0012312
1843 Ga0495604_0015482
1844 Ga0495604_0159090
1845 Ga0495636_0000753
1846 Ga0495636_0002077
1847 Ga0495674_0021739
1848 Ga0495672_0001393
1849 Ga0495672_0001568
1850 Ga0495672_0002587
1851 Ga0495672_0002676
1852 Ga0495672_0003479
1853 Ga0495672_0003814
1854 Ga0495672_0013604
1855 Ga0495672_0013933
1856 Ga0495676_0004271
1857 Ga0495676_0015854
1858 Ga0495680_0012930
1859 Ga0495680_0015919
1860 Ga0495680_0017679
1861 Ga0495680_0022647
1862 Ga0495683_0000011
1863 Ga0495683_0000784
1864 Ga0495683_0004075
1865 Ga0495683_0005637
1866 Ga0495683_0005732
1867 Ga0495683_0006421
1868 Ga0495683_0028039
1869 Ga0495683_0031292
1870 Ga0495683_0040156
1871 Ga0495683_0040907
1872 Ga0495683_0082517
1873 Ga0495687_002112
1874 Ga0495687_008543
1875 Ga0495675_0013975
1876 Ga0495675_0014655
1877 Ga0495677_0000393
1878 Ga0495679_000001
1879 Ga0495679_000176
1880 Ga0495679_003695
1881 Ga0495679_004059
1882 Ga0495679_004736
1883 Ga0495679_018686
1884 Ga0495685_001024
1885 Ga0495685_025697
1886 Ga0495673_0000607
1887 Ga0495673_0001083
1888 Ga0495673_0001179
1889 Ga0495673_0001247
1890 Ga0495673_0002001
1891 Ga0495673_0002223
1892 Ga0495673_0006626
1893 Ga0495673_0006858
1894 Ga0495673_0007482
1895 Ga0495673_0007539
1896 Ga0495673_0019067
1897 Ga0495673_0023705
1898 Ga0495673_0023870
1899 Ga0495673_0026076
1900 Ga0495673_0031248
1901 Ga0495673_0047147
1902 Ga0495673_0059595
1903 Ga0495673_0110398
1904 Ga0495681_0000536
1905 Ga0495681_0001815
1906 Ga0495681_0041658
1907 Ga0495681_0052239
1908 Ga0495681_0059785
1909 Ga0495681_0118806
1910 Ga0495686_0004152
1911 Ga0495686_0007204
1912 Ga0495686_0012958
1913 Ga0495686_0033662
1914 Ga0495593_0003966
1915 Ga0495593_0009549
1916 Ga0495593_0013731
1917 Ga0495602_0016910
1918 Ga0495614_0083515
1919 Ga0495626_0001557
1920 Ga0495626_0002243
1921 Ga0495626_0002531
1922 Ga0495626_0005293
1923 Ga0495626_0005902
1924 Ga0495626_0006059
1925 Ga0495626_0006581
1926 Ga0495626_0008233
1927 Ga0495626_0025111
1928 Ga0495626_0103881
1929 Ga0496100_0102358
1930 Ga0496101_0062377
1931 Ga0496102_0000604
1932 Ga0496102_0104440
1933 Ga0496103_0006912
1934 Ga0496103_0102586
1935 Ga0496108_0027022
1936 Ga0496110_0006365
1937 Ga0496110_0014430
1938 Ga0496110_0045914
1939 Ga0496110_0243113
1940 Ga0496110_0492637
1941 Ga0496116_0003029
1942 Ga0496116_0004538
1943 Ga0496116_0013152
1944 Ga0496116_0013391
1945 Ga0496116_0076126
1946 Ga0496116_0149135
1947 Ga0496117_0001815
1948 Ga0496117_0015165
1949 Ga0496117_0015909
1950 Ga0496117_0016327
1951 Ga0496117_0022217
1952 Ga0496117_0042483
1953 Ga0496117_0042485
1954 Ga0496118_0002174
1955 Ga0496118_0016288
1956 Ga0496118_0018025
1957 Ga0496118_0026191
1958 Ga0496118_0072065
1959 Ga0496118_0091257
1960 Ga0496118_0108002
1961 Ga0496118_0138970
1962 Ga0496119_0013863
1963 Ga0496119_0014255
1964 Ga0496119_0071686
1965 Ga0496120_0063200
1966 Ga0496120_0108804
1967 Ga0496121_0001008
1968 Ga0496121_0002419
1969 Ga0496121_0002497
1970 Ga0496121_0018103
1971 Ga0496121_0029665
1972 Ga0496121_0092180
1973 Ga0496121_0104954
1974 Ga0496121_0158374
1975 Ga0496121_0174369
1976 Ga0496122_0000945
1977 Ga0496122_0018845
1978 Ga0496122_0019180
1979 Ga0496122_0180157
1980 Ga0496123_0000888
1981 Ga0496123_0005883
1982 Ga0496123_0050801
1983 Ga0496123_0098019
1984 Ga0496124_0002611
1985 Ga0496124_0004905
1986 Ga0496124_0010228
1987 Ga0496124_0102260
1988 Ga0496124_0114546
1989 Ga0496124_0162257
1990 Ga0496124_0185723
1991 Ga0496125_0005661
1992 Ga0496125_0007915
1993 Ga0496125_0012895
1994 Ga0496125_0018010
1995 Ga0496125_0033034
1996 Ga0496125_0061124
1997 Ga0496125_0087911
1998 Ga0496126_0002379
1999 Ga0496126_0133150
2000 Ga0496126_0167695
2001 Ga0495678_000028
2002 Ga0495678_000033
2003 Ga0495678_000311
2004 Ga0495678_002317
2005 Ga0495678_002782
2006 Ga0495678_003313
2007 Ga0495678_004804
2008 Ga0495678_005647
2009 Ga0495678_008179
2010 Ga0495678_041489
2011 Ga0495678_046636
2012 Ga0495678_057442
2013 Ga0495682_0000072
2014 Ga0495682_0000265
2015 Ga0495682_0001293
2016 Ga0495682_0002849
2017 Ga0495682_0003811
2018 Ga0495682_0017809
2019 Ga0495682_0018489
2020 Ga0495682_0019820
2021 Ga0495682_0020861
2022 Ga0495682_0041754
2023 Ga0501222_000921
2024 Ga0501241_000864
2025 Ga0501269_002850
2026 Ga0501226_000988
2027 nmdc:mga03683_111520_c1
2028 nmdc:mga00v17_147598_c1
2029 nmdc:mga00v17_153323_c1
2030 nmdc:mga0k408_78_c1
2031 nmdc:mga08x19_70088_c1
2032 nmdc:mga0sz30_6379_c1
2033 Ga0495601_0038246
2034 Ga0495612_0178938
2035 Ga0495619_0149469
2036 Ga0495619_0336777
2037 Ga0500643_000053
2038 Ga0500555_000867
2039 Ga0500586_003095
2040 2511252423
2041 2511263984
2042 2511272029
2043 2511280489
2044 2511292052
2045 2511296747
2046 2511324466
2047 2511341429
2048 2511352289
2049 2511363612
2050 2511366544
2051 2511416363
2052 2511823530
2053 2512324956
2054 2514422866
2055 2583791081
2056 2585392061
2057 2597856774
2058 2599483797
2059 2599504026
2060 2599801443
2061 2599887679
2062 2599899842
2063 2599931982
2064 2599960419
2065 2599971532
2066 2599988021
2067 2600017541
2068 2600030336
2069 2600052365
2070 2600360768
2071 2600365744
2072 2601795427
2073 2606075495
2074 2606128593
2075 2624493644
2076 2644187228
2077 2644206907
2078 2644650555
2079 2671090340
2080 2671768392
2081 2715751880
2082 2715754929
2083 2718633205
2084 2723577651
2085 2735835980
2086 2739316102
2087 2740995010
2088 2743736202
2089 2765582760
2090 2774122805
2091 2774137518
2092 2784259872
2093 2784315163
2094 2794596258
2095 2808931816
2096 2808953936
2097 2809216306
2098 2819654083
2099 2842832769
2100 2842848143
2101 2842854510
2102 2844669106
2103 2852658840
2104 2860340093
2105 2876398832
2106 2878031367
2107 2880232229
2108 2881163045
2109 2904521874
2110 2904553271
2111 2904665364
2112 2919064163
2113 2919386327
2114 2919457181
2115 2919481707
2116 2919491397
2117 2919702944
2118 2923155216
2119 2931400015
2120 2961120364
2121 2968116831
2122 2969306148
2123 2974292202
2124 2984290822
2125 2988733424
2126 2998141538
2127 3007614559
2128 3007622416
2129 3007722869
2130 3007863222
2131 8015689437
2132 8019774155
2133 8019780175
2134 8029999210
2135 8054931023
2136 8055772571
2137 8056141439
2138 8056147404
2139 8056156713
2140 8056169448
2141 8056175627
2142 8057798999

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

28

252

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kvq-assembly1.cif.gz_A-2 udp-galactose 4-epimerase complexed with udp-phenol 0.9009 1 280
7kn1-assembly2.cif.gz_B crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound nad and formylated udp-arabinopyranose 0.8999 2 280
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8983 2 280
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8925 1 280
1kvu-assembly1.cif.gz_A-2 udp-galactose 4-epimerase complexed with udp-phenol 0.8852 1 280
ID Description Score Start End Superfamily
5twcA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9058 2 34 3.50.50.60
af_F4JRN8_123_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8888 1 74 3.40.50.720
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8863 2 34 3.50.50.60
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8821 3 34 3.50.50.60
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8714 122 280 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1G0MWY4-F1-model_v4 Epimerase 0.9867 1 279
AF-A0A1G0CXL0-F1-model_v4 Epimerase 0.9814 49 281
AF-A0A1W6E4R5-F1-model_v4 deleted 0.9763 1 278
AF-A0A1M3H5E6-F1-model_v4 Epimerase 0.9726 2 280
AF-A0A1F9BJB4-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9712 1 284

Map