F489495

General Info

Members Datasets Scaffolds Average Seq Length
1071 429 2142 254

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0317066|Ga0501035_0317066_75_1007
Length 310
Sequence MSFRFLKAFHVLKPALAKAAQHNDTRGESQSGEPGAMLSYDGATANEETRAMNKPTSSAEVATAGKVPAGMSPEEWQARIDLAAVYRLVAHYGWDDVIYNHASMRVPGEPRMFLMKRHELLYTEVTASNLAKVSMDADLDEKSGVNRPGFTLHGGVLAARPDVNCALHMHTEIGMAFSALKHGLRMLSQPAVRFYNRIGYHPYEGLTEDFGERERIARNLGNGKALVMRNHGLLTVGRTARDAFVLMEHLAEAADIQMRLEATGAELVEIPPEVCEKTAAQFEAHDRGRGQADWPAYLRILDGIDPGFRN

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
240 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
241 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
242 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
243 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
244 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
245 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
248 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
249 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
250 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
251 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
252 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
255 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
256 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
257 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
258 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
259 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
260 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
265 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
268 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
269 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
270 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
271 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
272 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
273 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
276 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
277 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
278 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
288 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
289 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
290 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
306 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
322 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
349 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
350 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
351 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
352 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
353 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
354 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
364 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
392 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
393 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
394 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
395 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
396 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
397 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
401 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
406 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
407 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
408 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
409 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
410 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
418 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
419 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
420 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
421 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
422 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
423 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
424 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
425 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
426 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
429 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 0
Rhizoplane 7.38
Rhizosphere 87.96
Stem 0
Stem Tuber 0
Unclassified 11.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0317066 3300049822 Bacteria 1311
2 JGI24741J21665_1008381 3300001915 Unclassified 1951
3 JGI24752J21851_1003823 3300001976 Bacteria 1984
4 JGI24746J21847_1000120 3300001977 Bacteria 9362
5 JGI24740J21852_10067766 3300001979 Unclassified 965
6 JGI24739J22299_10000176 3300001989 Bacteria 21293
7 JGI24737J22298_10000190 3300001990 Bacteria 19907
8 JGI24743J22301_10028038 3300001991 Unclassified 1101
9 JGI24750J21931_1000450 3300002070 Bacteria 6586
10 JGI24748J21848_1000227 3300002074 Bacteria 6844
11 JGI24738J21930_10000193 3300002075 Bacteria 16010
12 JGI24749J21850_1000755 3300002076 Bacteria 4674
13 JGI24744J21845_10001617 3300002077 Bacteria 4501
14 JGI24744J21845_10017010 3300002077 Bacteria 1445
15 JGI24035J26624_1000163 3300002126 Bacteria 6058
16 JGI24034J26672_10002430 3300002239 Bacteria 2559
17 JGI24742J22300_10004712 3300002244 Bacteria 2237
18 JGI24751J29686_10002684 3300002459 Bacteria 3582
19 JGI24751J29686_10025703 3300002459 Unclassified 1222
20 JGI25405J52794_10049024 3300003911 Bacteria 903
21 Ga0065704_10167307 3300005289 Bacteria 1314
22 Ga0065712_10000779 3300005290 Bacteria 10304
23 Ga0065712_10102865 3300005290 Bacteria 1944
24 Ga0065715_10089014 3300005293 Bacteria 17041
25 Ga0070676_10004465 3300005328 Bacteria 7363
26 Ga0070676_10044243 3300005328 Bacteria 2591
27 Ga0070683_100000173 3300005329 Bacteria 42675
28 Ga0070683_100039525 3300005329 Bacteria 4331
29 Ga0070683_100051833 3300005329 Bacteria 3800
30 Ga0070690_100001979 3300005330 Bacteria 10917
31 Ga0070670_100010494 3300005331 Bacteria 7907
32 Ga0070677_10000054 3300005333 Bacteria 35290
33 Ga0068869_100000316 3300005334 Bacteria 25656
34 Ga0068869_100163636 3300005334 Bacteria 1733
35 Ga0070666_10012204 3300005335 Bacteria 5414
36 Ga0070666_10303714 3300005335 Bacteria 1137
37 Ga0070680_100006219 3300005336 Bacteria 9058
38 Ga0070680_100221265 3300005336 Bacteria 1598
39 Ga0070680_100542331 3300005336 Bacteria 997
40 Ga0070682_100001435 3300005337 Bacteria 13410
41 Ga0070682_100127927 3300005337 Unclassified 1715
42 Ga0068868_100000176 3300005338 Bacteria 42456
43 Ga0068868_100213697 3300005338 Bacteria 1613
44 Ga0068868_100316046 3300005338 Bacteria 1329
45 Ga0070660_100000595 3300005339 Bacteria 24271
46 Ga0070660_100143899 3300005339 Bacteria 1914
47 Ga0070689_100000116 3300005340 Bacteria 45723
48 Ga0070689_100396606 3300005340 Unclassified 1166
49 Ga0070689_100575718 3300005340 Bacteria 973
50 Ga0070691_10003422 3300005341 Bacteria 7132
51 Ga0070691_10206891 3300005341 Unclassified 1034
52 Ga0070687_100000232 3300005343 Bacteria 19153
53 Ga0070687_100030450 3300005343 Bacteria 2638
54 Ga0070687_100096957 3300005343 Bacteria 1643
55 Ga0070661_100000680 3300005344 Bacteria 24930
56 Ga0070661_100029004 3300005344 Bacteria 3993
57 Ga0070661_100080428 3300005344 Bacteria 2405
58 Ga0070692_10000138 3300005345 Bacteria 17517
59 Ga0070692_10267264 3300005345 Unclassified 1031
60 Ga0070668_100001184 3300005347 Bacteria 18480
61 Ga0070668_100328130 3300005347 Bacteria 1290
62 Ga0070669_100002530 3300005353 Bacteria 13217
63 Ga0070675_100000398 3300005354 Bacteria 29530
64 Ga0070675_100535772 3300005354 Bacteria 1058
65 Ga0070671_100000708 3300005355 Bacteria 23978
66 Ga0070671_100023382 3300005355 Bacteria 5058
67 Ga0070674_100000672 3300005356 Bacteria 17283
68 Ga0070674_100052962 3300005356 Unclassified 2800
69 Ga0070674_100111998 3300005356 Bacteria 2005
70 Ga0070673_100000199 3300005364 Bacteria 29530
71 Ga0070673_100024556 3300005364 Bacteria 4422
72 Ga0070673_100049799 3300005364 Bacteria 3272
73 Ga0070673_100257620 3300005364 Bacteria 1523
74 Ga0070688_100002526 3300005365 Bacteria 9259
75 Ga0070688_100016957 3300005365 Bacteria 4173
76 Ga0070659_100000476 3300005366 Bacteria 29530
77 Ga0070667_100003351 3300005367 Bacteria 13683
78 Ga0070667_100161020 3300005367 Bacteria 1976
79 Ga0070667_100236316 3300005367 Bacteria 1631
80 Ga0070703_10016756 3300005406 Bacteria 2106
81 Ga0070709_10008770 3300005434 Bacteria 5564
82 Ga0070709_10209216 3300005434 Unclassified 1386
83 Ga0070709_10253003 3300005434 Bacteria 1270
84 Ga0070714_100089689 3300005435 Bacteria 2692
85 Ga0070714_100118740 3300005435 Bacteria 2350
86 Ga0070714_100235083 3300005435 Bacteria 1689
87 Ga0070713_100000368 3300005436 Bacteria 29007
88 Ga0070713_100088482 3300005436 Bacteria 2658
89 Ga0070713_100487046 3300005436 Unclassified 1162
90 Ga0070710_10033625 3300005437 Bacteria 2785
91 Ga0070710_10042930 3300005437 Bacteria 2502
92 Ga0070710_10144142 3300005437 Unclassified 1463
93 Ga0070710_10262588 3300005437 Bacteria 1114
94 Ga0070701_10000211 3300005438 Bacteria 18307
95 Ga0070701_10032677 3300005438 Bacteria 2594
96 Ga0070701_10214452 3300005438 Unclassified 1145
97 Ga0070711_100034978 3300005439 Bacteria 3355
98 Ga0070711_100036661 3300005439 Bacteria 3286
99 Ga0070711_100322066 3300005439 Bacteria 1235
100 Ga0070705_100000446 3300005440 Bacteria 23733
101 Ga0070700_100000490 3300005441 Bacteria 19856
102 Ga0070700_100227883 3300005441 Bacteria 1324
103 Ga0070694_100001164 3300005444 Bacteria 15144
104 Ga0070708_100049088 3300005445 Bacteria 3733
105 Ga0070708_100406314 3300005445 Unclassified 1284
106 Ga0070663_100000546 3300005455 Bacteria 19979
107 Ga0070663_100101191 3300005455 Bacteria 2150
108 Ga0070678_100000142 3300005456 Bacteria 29530
109 Ga0070678_100017253 3300005456 Bacteria 4643
110 Ga0070662_100012272 3300005457 Bacteria 5675
111 Ga0070662_100055926 3300005457 Unclassified 2864
112 Ga0070681_10000980 3300005458 Bacteria 24149
113 Ga0070681_10021188 3300005458 Bacteria 6513
114 Ga0070681_10040733 3300005458 Bacteria 4653
115 Ga0070681_10356822 3300005458 Unclassified 1372
116 Ga0070681_10703697 3300005458 Bacteria 926
117 Ga0068867_100001587 3300005459 Bacteria 15804
118 Ga0068867_100043695 3300005459 Bacteria 3281
119 Ga0070685_10000603 3300005466 Bacteria 19845
120 Ga0070685_10279786 3300005466 Bacteria 1116
121 Ga0070698_100031369 3300005471 Bacteria 5511
122 Ga0070679_100002691 3300005530 Bacteria 16188
123 Ga0070679_100016776 3300005530 Bacteria 7078
124 Ga0070679_100031424 3300005530 Bacteria 5245
125 Ga0070679_100035045 3300005530 Bacteria 4977
126 Ga0070679_100129911 3300005530 Bacteria 2500
127 Ga0070679_100278968 3300005530 Bacteria 1624
128 Ga0070679_100353108 3300005530 Bacteria 1418
129 Ga0070679_100525541 3300005530 Bacteria 1127
130 Ga0070684_100000146 3300005535 Bacteria 47523
131 Ga0070684_100346793 3300005535 Unclassified 1365
132 Ga0068853_100002495 3300005539 Bacteria 13797
133 Ga0070672_100000063 3300005543 Bacteria 49365
134 Ga0070672_100049971 3300005543 Bacteria 3256
135 Ga0070672_100053875 3300005543 Bacteria 3147
136 Ga0070686_100000695 3300005544 Bacteria 19514
137 Ga0070695_100000044 3300005545 Bacteria 47690
138 Ga0070695_100100933 3300005545 Bacteria 1943
139 Ga0070696_100004713 3300005546 Bacteria 9117
140 Ga0070693_100000297 3300005547 Bacteria 23138
141 Ga0070693_100004176 3300005547 Bacteria 6816
142 Ga0070665_100257174 3300005548 Unclassified 1747
143 Ga0070704_100000520 3300005549 Bacteria 18363
144 Ga0070704_100318710 3300005549 Unclassified 1302
145 Ga0070704_100449010 3300005549 Unclassified 1110
146 Ga0068855_100057301 3300005563 Bacteria 4568
147 Ga0068855_100232463 3300005563 Bacteria 2063
148 Ga0070664_100000287 3300005564 Bacteria 36455
149 Ga0068857_100000332 3300005577 Bacteria 32588
150 Ga0068857_100563504 3300005577 Unclassified 1074
151 Ga0068854_100000493 3300005578 Bacteria 24047
152 Ga0068854_100223760 3300005578 Bacteria 1490
153 Ga0068856_100001778 3300005614 Bacteria 22526
154 Ga0068856_100139637 3300005614 Bacteria 2430
155 Ga0070702_100000060 3300005615 Bacteria 31414
156 Ga0070702_100073847 3300005615 Bacteria 2022
157 Ga0070702_100075108 3300005615 Bacteria 2007
158 Ga0068852_100002718 3300005616 Bacteria 12224
159 Ga0068859_100002562 3300005617 Bacteria 18452
160 Ga0068859_100080058 3300005617 Unclassified 3307
161 Ga0068859_100106590 3300005617 Bacteria 2862
162 Ga0068864_100000316 3300005618 Bacteria 42705
163 Ga0068864_100012805 3300005618 Bacteria 6934
164 Ga0068864_100024748 3300005618 Bacteria 5051
165 Ga0068864_100262336 3300005618 Bacteria 1607
166 Ga0068864_100484362 3300005618 Unclassified 1188
167 Ga0068866_10000272 3300005718 Bacteria 24607
168 Ga0068866_10053048 3300005718 Bacteria 2071
169 Ga0068866_10064399 3300005718 Bacteria 1914
170 Ga0068861_100005790 3300005719 Bacteria 8387
171 Ga0068861_100187979 3300005719 Unclassified 1724
172 Ga0068851_10116115 3300005834 Bacteria 1434
173 Ga0068870_10000420 3300005840 Bacteria 15979
174 Ga0068870_10053014 3300005840 Bacteria 2153
175 Ga0068863_100000334 3300005841 Bacteria 47864
176 Ga0068863_100169061 3300005841 Bacteria 2096
177 Ga0068863_100590377 3300005841 Unclassified 1099
178 Ga0068858_100003943 3300005842 Bacteria 14653
179 Ga0068860_100000816 3300005843 Bacteria 34864
180 Ga0068860_100036965 3300005843 Bacteria 4675
181 Ga0068860_100323262 3300005843 Bacteria 1514
182 Ga0068862_100000672 3300005844 Bacteria 34973
183 Ga0068862_100096724 3300005844 Bacteria 2577
184 Ga0081455_10001860 3300005937 Bacteria 25395
185 Ga0081455_10010994 3300005937 Bacteria 9123
186 Ga0081455_10066862 3300005937 Bacteria 2998
187 Ga0081455_10106038 3300005937 Bacteria 2244
188 Ga0081538_10005426 3300005981 Bacteria 11450
189 Ga0081538_10023338 3300005981 Bacteria 4450
190 Ga0081538_10044624 3300005981 Bacteria 2762
191 Ga0081540_1074143 3300005983 Bacteria 1560
192 Ga0070717_10005996 3300006028 Bacteria 8902
193 Ga0070717_10056864 3300006028 Bacteria 3233
194 Ga0070717_10121589 3300006028 Bacteria 2237
195 Ga0075365_10011942 3300006038 Bacteria 5131
196 Ga0075365_10038703 3300006038 Bacteria 3102
197 Ga0075365_10085494 3300006038 Bacteria 2142
198 Ga0075365_10130574 3300006038 Bacteria 1738
199 Ga0075368_10027421 3300006042 Unclassified 2198
200 Ga0075368_10108112 3300006042 Bacteria 1145
201 Ga0075363_100051278 3300006048 Bacteria 2200
202 Ga0075363_100112741 3300006048 Bacteria 1513
203 Ga0075364_10032091 3300006051 Bacteria 3374
204 Ga0075364_10282458 3300006051 Bacteria 1129
205 Ga0075432_10002355 3300006058 Bacteria 6299
206 Ga0070715_10007706 3300006163 Bacteria 3719
207 Ga0070715_10057951 3300006163 Unclassified 1689
208 Ga0070715_10173963 3300006163 Unclassified 1075
209 Ga0070716_100031571 3300006173 Bacteria 2882
210 Ga0070716_100068505 3300006173 Unclassified 2076
211 Ga0070716_100124361 3300006173 Bacteria 1620
212 Ga0070712_100019966 3300006175 Bacteria 4381
213 Ga0070712_100062755 3300006175 Bacteria 2628
214 Ga0070712_100141436 3300006175 Bacteria 1837
215 Ga0070712_100223176 3300006175 Unclassified 1493
216 Ga0070712_100271171 3300006175 Unclassified 1363
217 Ga0075362_10040601 3300006177 Bacteria 2049
218 Ga0075367_10006771 3300006178 Bacteria 5819
219 Ga0075367_10028695 3300006178 Bacteria 3176
220 Ga0075369_10012309 3300006186 Bacteria 3380
221 Ga0075366_10052396 3300006195 Bacteria 2424
222 Ga0075366_10086855 3300006195 Bacteria 1871
223 Ga0097621_100000019 3300006237 Bacteria 88022
224 Ga0097621_100019564 3300006237 Bacteria 5199
225 Ga0097621_100236910 3300006237 Bacteria 1594
226 Ga0075370_10045017 3300006353 Bacteria 2495
227 Ga0075370_10045594 3300006353 Unclassified 2480
228 Ga0075370_10064509 3300006353 Bacteria 2089
229 Ga0075370_10078861 3300006353 Bacteria 1891
230 Ga0075370_10142477 3300006353 Unclassified 1401
231 Ga0075370_10320235 3300006353 Bacteria 924
232 Ga0068871_100000293 3300006358 Bacteria 34898
233 Ga0068871_100013376 3300006358 Bacteria 6089
234 Ga0068871_100054862 3300006358 Bacteria 3234
235 Ga0075428_100051979 3300006844 Bacteria 4493
236 Ga0075428_100106765 3300006844 Plasmid 3052
237 Ga0075428_100124897 3300006844 Unclassified 2801
238 Ga0075428_100274931 3300006844 Bacteria 1812
239 Ga0075428_100387815 3300006844 Bacteria 1497
240 Ga0075430_100000293 3300006846 Bacteria 35315
241 Ga0075430_100000327 3300006846 Bacteria 34023
242 Ga0075430_100082249 3300006846 Bacteria 2698
243 Ga0075430_100355873 3300006846 Bacteria 1209
244 Ga0075431_100005554 3300006847 Bacteria 12447
245 Ga0075431_100015952 3300006847 Bacteria 7622
246 Ga0075431_100114318 3300006847 Bacteria 2786
247 Ga0075431_100213988 3300006847 Unclassified 1968
248 Ga0075431_100752788 3300006847 Bacteria 950
249 Ga0075433_10012481 3300006852 Bacteria 6867
250 Ga0075433_10014765 3300006852 Bacteria 6393
251 Ga0075433_10405521 3300006852 Bacteria 1203
252 Ga0075434_100000042 3300006871 Bacteria 59376
253 Ga0075434_100008550 3300006871 Bacteria 9520
254 Ga0075434_100013525 3300006871 Bacteria 7771
255 Ga0075434_100045938 3300006871 Unclassified 4334
256 Ga0075434_100124982 3300006871 Bacteria 2590
257 Ga0075429_100025101 3300006880 Bacteria 5174
258 Ga0075429_100063005 3300006880 Bacteria 3231
259 Ga0075429_100187529 3300006880 Bacteria 1812
260 Ga0068865_100000183 3300006881 Bacteria 34856
261 Ga0068865_100003957 3300006881 Bacteria 8888
262 Ga0075436_100031580 3300006914 Bacteria 3647
263 Ga0075436_100035442 3300006914 Bacteria 3443
264 Ga0097620_100002562 3300006931 Bacteria 18452
265 Ga0097620_100080058 3300006931 Unclassified 3307
266 Ga0097620_100106592 3300006931 Bacteria 2862
267 Ga0075435_100139260 3300007076 Unclassified 2035
268 Ga0075435_100139484 3300007076 Bacteria 2033
269 Ga0075435_100177948 3300007076 Bacteria 1797
270 Ga0075435_100295818 3300007076 Bacteria 1384
271 Ga0075435_100653054 3300007076 Unclassified 913
272 Ga0099795_10000484 3300007788 Bacteria 7428
273 Ga0105251_10096278 3300009011 Bacteria 1356
274 Ga0105244_10015753 3300009036 Bacteria 4328
275 Ga0105250_10008874 3300009092 Bacteria 4253
276 Ga0105240_10015725 3300009093 Bacteria 10269
277 Ga0105240_10306754 3300009093 Bacteria 1814
278 Ga0111539_10001254 3300009094 Bacteria 33808
279 Ga0111539_10002524 3300009094 Bacteria 24257
280 Ga0111539_10035317 3300009094 Bacteria 6053
281 Ga0111539_10042413 3300009094 Bacteria 5464
282 Ga0111539_10200789 3300009094 Bacteria 2325
283 Ga0105245_10000142 3300009098 Bacteria 68105
284 Ga0105245_10044321 3300009098 Bacteria 3970
285 Ga0105245_10205717 3300009098 Bacteria 1892
286 Ga0105245_10294830 3300009098 Unclassified 1590
287 Ga0105245_10488443 3300009098 Unclassified 1246
288 Ga0105245_10808618 3300009098 Unclassified 976
289 Ga0105247_10008521 3300009101 Bacteria 6244
290 Ga0105247_10065809 3300009101 Bacteria 2255
291 Ga0105247_10078830 3300009101 Bacteria 2072
292 Ga0105247_10173983 3300009101 Unclassified 1433
293 Ga0114129_10017130 3300009147 Bacteria 10319
294 Ga0114129_10024961 3300009147 Bacteria 8474
295 Ga0114129_10072678 3300009147 Bacteria 4795
296 Ga0114129_10120613 3300009147 Bacteria 3610
297 Ga0114129_10212088 3300009147 Bacteria 2617
298 Ga0114129_10666835 3300009147 Bacteria 1341
299 Ga0114129_10999293 3300009147 Bacteria 1054
300 Ga0105243_10000376 3300009148 Bacteria 47951
301 Ga0105243_10011332 3300009148 Bacteria 6746
302 Ga0105243_10157139 3300009148 Bacteria 1956
303 Ga0105243_10675892 3300009148 Bacteria 1003
304 Ga0105241_10001391 3300009174 Bacteria 18495
305 Ga0105241_10169691 3300009174 Unclassified 1801
306 Ga0105241_10207278 3300009174 Bacteria 1641
307 Ga0105242_10000380 3300009176 Bacteria 35290
308 Ga0105242_10049109 3300009176 Bacteria 3432
309 Ga0105242_10093079 3300009176 Bacteria 2540
310 Ga0105242_10108558 3300009176 Bacteria 2362
311 Ga0105248_10000549 3300009177 Bacteria 42722
312 Ga0105248_10103414 3300009177 Bacteria 3211
313 Ga0105248_10253098 3300009177 Bacteria 1982
314 Ga0105248_10597598 3300009177 Unclassified 1245
315 Ga0105237_10342498 3300009545 Unclassified 1499
316 Ga0105238_10036077 3300009551 Bacteria 5026
317 Ga0105238_10575363 3300009551 Bacteria 1132
318 Ga0105238_10705387 3300009551 Unclassified 1021
319 Ga0105249_10001601 3300009553 Bacteria 19823
320 Ga0105249_10069791 3300009553 Bacteria 3243
321 Ga0105249_10374038 3300009553 Bacteria 1449
322 Ga0099796_10012112 3300010159 Bacteria 2425
323 Ga0105239_10000656 3300010375 Bacteria 49301
324 Ga0105239_10255639 3300010375 Bacteria 1968
325 Ga0105239_10279321 3300010375 Unclassified 1880
326 Ga0105239_10719111 3300010375 Bacteria 1142
327 Ga0105246_10000027 3300011119 Bacteria 53374
328 Ga0105246_10046442 3300011119 Bacteria 2962
329 Ga0157373_10007428 3300013100 Bacteria 8153
330 Ga0157373_10020687 3300013100 Bacteria 4780
331 Ga0157371_10019225 3300013102 Bacteria 5040
332 Ga0157369_10152310 3300013105 Bacteria 2444
333 Ga0157374_10015586 3300013296 Bacteria 6671
334 Ga0157374_10051895 3300013296 Bacteria 3817
335 Ga0157374_10084337 3300013296 Bacteria 3020
336 Ga0157374_10112264 3300013296 Unclassified 2622
337 Ga0157378_10000786 3300013297 Bacteria 29476
338 Ga0157378_10286430 3300013297 Bacteria 1590
339 Ga0163162_10002019 3300013306 Bacteria 19089
340 Ga0163162_10155857 3300013306 Bacteria 2404
341 Ga0163162_10388696 3300013306 Bacteria 1528
342 Ga0157372_10028341 3300013307 Bacteria 6111
343 Ga0157372_11094181 3300013307 Bacteria 922
344 Ga0157375_10000293 3300013308 Bacteria 45355
345 Ga0157375_10273733 3300013308 Bacteria 1851
346 Ga0157375_10521759 3300013308 Unclassified 1351
347 Ga0163163_10000482 3300014325 Bacteria 36134
348 Ga0163163_10006324 3300014325 Bacteria 10341
349 Ga0163163_10013569 3300014325 Bacteria 7462
350 Ga0163163_10027715 3300014325 Bacteria 5431
351 Ga0163163_10183734 3300014325 Unclassified 2138
352 Ga0157380_10000927 3300014326 Bacteria 18486
353 Ga0157380_10208236 3300014326 Bacteria 1741
354 Ga0157380_10384053 3300014326 Bacteria 1326
355 Ga0182008_10040088 3300014497 Unclassified 2339
356 Ga0157377_10000136 3300014745 Bacteria 47102
357 Ga0157379_10001911 3300014968 Bacteria 17235
358 Ga0157379_10016208 3300014968 Bacteria 6557
359 Ga0157379_10145202 3300014968 Bacteria 2139
360 Ga0157379_10154441 3300014968 Bacteria 2070
361 Ga0157379_10476013 3300014968 Bacteria 1155
362 Ga0157376_10000073 3300014969 Bacteria 76981
363 Ga0157376_10040052 3300014969 Bacteria 3827
364 Ga0157376_10046917 3300014969 Bacteria 3565
365 Ga0163161_10000476 3300017792 Bacteria 33279
366 Ga0163161_10128307 3300017792 Bacteria 1911
367 Ga0163161_10198527 3300017792 Bacteria 1545
368 Ga0206353_11138709 3300020082 Bacteria 1097
369 Ga0213876_10003884 3300021384 Bacteria 8442
370 Ga0213876_10299770 3300021384 Bacteria 854
371 Ga0207666_1000055 3300025271 Bacteria 20260
372 Ga0207673_1000158 3300025290 Bacteria 6644
373 Ga0209758_1000370 3300025297 Bacteria 79289
374 Ga0207426_1088694 3300025302 Bacteria 823
375 Ga0207697_10000622 3300025315 Bacteria 20117
376 Ga0207656_10033741 3300025321 Bacteria 2134
377 Ga0207696_1047998 3300025711 Unclassified 1229
378 Ga0207655_1029921 3300025728 Bacteria 2540
379 Ga0207653_10001943 3300025885 Bacteria 6615
380 Ga0207682_10000074 3300025893 Bacteria 43885
381 Ga0207692_10007770 3300025898 Bacteria 4408
382 Ga0207692_10134218 3300025898 Bacteria 1401
383 Ga0207642_10011274 3300025899 Bacteria 3182
384 Ga0207642_10039025 3300025899 Unclassified 2059
385 Ga0207642_10084655 3300025899 Bacteria 1549
386 Ga0207642_10087769 3300025899 Bacteria 1528
387 Ga0207710_10002334 3300025900 Bacteria 8870
388 Ga0207710_10013487 3300025900 Bacteria 3439
389 Ga0207710_10045112 3300025900 Bacteria 1965
390 Ga0207688_10000423 3300025901 Bacteria 19899
391 Ga0207688_10031180 3300025901 Bacteria 2942
392 Ga0207688_10065182 3300025901 Bacteria 2058
393 Ga0207680_10004765 3300025903 Bacteria 6458
394 Ga0207680_10149159 3300025903 Bacteria 1558
395 Ga0207680_10363187 3300025903 Unclassified 1018
396 Ga0207647_10005297 3300025904 Bacteria 9482
397 Ga0207647_10014286 3300025904 Bacteria 5477
398 Ga0207685_10006352 3300025905 Bacteria 3211
399 Ga0207685_10029984 3300025905 Bacteria 1932
400 Ga0207699_10008676 3300025906 Bacteria 5028
401 Ga0207699_10030445 3300025906 Bacteria 3020
402 Ga0207699_10070486 3300025906 Bacteria 2134
403 Ga0207699_10113108 3300025906 Bacteria 1743
404 Ga0207699_10260214 3300025906 Bacteria 1199
405 Ga0207645_10000291 3300025907 Bacteria 42040
406 Ga0207645_10023307 3300025907 Bacteria 4024
407 Ga0207643_10000116 3300025908 Bacteria 54500
408 Ga0207643_10000872 3300025908 Bacteria 18178
409 Ga0207705_10144176 3300025909 Bacteria 1781
410 Ga0207654_10000917 3300025911 Bacteria 16287
411 Ga0207654_10108762 3300025911 Unclassified 1721
412 Ga0207707_10000563 3300025912 Bacteria 37612
413 Ga0207707_10480923 3300025912 Unclassified 1061
414 Ga0207695_10031303 3300025913 Bacteria 5837
415 Ga0207693_10005802 3300025915 Bacteria 10238
416 Ga0207693_10038010 3300025915 Bacteria 3792
417 Ga0207693_10044565 3300025915 Bacteria 3487
418 Ga0207693_10068060 3300025915 Bacteria 2787
419 Ga0207693_10070555 3300025915 Bacteria 2734
420 Ga0207693_10131345 3300025915 Bacteria 1969
421 Ga0207663_10005835 3300025916 Bacteria 6241
422 Ga0207663_10132045 3300025916 Bacteria 1727
423 Ga0207660_10000043 3300025917 Bacteria 62068
424 Ga0207660_10000134 3300025917 Bacteria 43910
425 Ga0207660_10030574 3300025917 Bacteria 3703
426 Ga0207662_10000386 3300025918 Bacteria 19776
427 Ga0207662_10007580 3300025918 Bacteria 5912
428 Ga0207662_10028910 3300025918 Bacteria 3209
429 Ga0207657_10002520 3300025919 Bacteria 19810
430 Ga0207657_10023526 3300025919 Bacteria 5735
431 Ga0207657_10081420 3300025919 Bacteria 2720
432 Ga0207649_10000204 3300025920 Bacteria 49651
433 Ga0207649_10347921 3300025920 Unclassified 1096
434 Ga0207652_10001156 3300025921 Bacteria 23738
435 Ga0207652_10093104 3300025921 Unclassified 2651
436 Ga0207652_10111291 3300025921 Bacteria 2428
437 Ga0207681_10000066 3300025923 Bacteria 98794
438 Ga0207694_10233225 3300025924 Bacteria 1503
439 Ga0207694_10451831 3300025924 Unclassified 1073
440 Ga0207650_10002222 3300025925 Bacteria 13558
441 Ga0207650_10002953 3300025925 Bacteria 11730
442 Ga0207659_10000100 3300025926 Bacteria 50549
443 Ga0207687_10000052 3300025927 Bacteria 90736
444 Ga0207687_10062086 3300025927 Unclassified 2641
445 Ga0207700_10001520 3300025928 Bacteria 13129
446 Ga0207700_10006951 3300025928 Bacteria 6884
447 Ga0207700_10116013 3300025928 Bacteria 2163
448 Ga0207700_10216496 3300025928 Unclassified 1621
449 Ga0207700_10338603 3300025928 Bacteria 1307
450 Ga0207664_10073355 3300025929 Bacteria 2762
451 Ga0207664_10139192 3300025929 Bacteria 2051
452 Ga0207664_10145011 3300025929 Bacteria 2012
453 Ga0207664_10189569 3300025929 Unclassified 1769
454 Ga0207664_10219186 3300025929 Bacteria 1649
455 Ga0207644_10000572 3300025931 Bacteria 23617
456 Ga0207644_10010069 3300025931 Bacteria 6225
457 Ga0207644_10082223 3300025931 Bacteria 2382
458 Ga0207644_10117391 3300025931 Bacteria 2021
459 Ga0207690_10000187 3300025932 Bacteria 47796
460 Ga0207690_10152722 3300025932 Bacteria 1713
461 Ga0207706_10003689 3300025933 Bacteria 14615
462 Ga0207706_10006344 3300025933 Bacteria 10985
463 Ga0207706_10073082 3300025933 Bacteria 3015
464 Ga0207686_10000331 3300025934 Bacteria 34083
465 Ga0207686_10049398 3300025934 Bacteria 2611
466 Ga0207686_10086964 3300025934 Unclassified 2054
467 Ga0207686_10334534 3300025934 Unclassified 1135
468 Ga0207709_10000243 3300025935 Bacteria 67001
469 Ga0207709_10130015 3300025935 Bacteria 1715
470 Ga0207670_10000140 3300025936 Bacteria 47642
471 Ga0207670_10022501 3300025936 Bacteria 3908
472 Ga0207670_10066542 3300025936 Bacteria 2476
473 Ga0207669_10000034 3300025937 Bacteria 82098
474 Ga0207704_10000108 3300025938 Bacteria 45380
475 Ga0207704_10107366 3300025938 Bacteria 1878
476 Ga0207665_10000860 3300025939 Bacteria 20521
477 Ga0207665_10006295 3300025939 Bacteria 7873
478 Ga0207665_10127648 3300025939 Bacteria 1802
479 Ga0207665_10145335 3300025939 Bacteria 1694
480 Ga0207665_10183122 3300025939 Bacteria 1518
481 Ga0207691_10001957 3300025940 Bacteria 20117
482 Ga0207691_10007735 3300025940 Bacteria 10345
483 Ga0207711_10001312 3300025941 Bacteria 23521
484 Ga0207711_10024752 3300025941 Bacteria 5035
485 Ga0207711_10210381 3300025941 Bacteria 1776
486 Ga0207711_10458193 3300025941 Unclassified 1187
487 Ga0207689_10000233 3300025942 Bacteria 49558
488 Ga0207689_10112768 3300025942 Bacteria 2235
489 Ga0207661_10000230 3300025944 Bacteria 36712
490 Ga0207661_10078867 3300025944 Bacteria 2713
491 Ga0207679_10000052 3300025945 Bacteria 110612
492 Ga0207679_10456428 3300025945 Unclassified 1134
493 Ga0207667_10009406 3300025949 Bacteria 11511
494 Ga0207667_10160054 3300025949 Bacteria 2316
495 Ga0207651_10000421 3300025960 Bacteria 18042
496 Ga0207651_10180490 3300025960 Unclassified 1674
497 Ga0207712_10000265 3300025961 Bacteria 50879
498 Ga0207712_10169791 3300025961 Bacteria 1704
499 Ga0207668_10000151 3300025972 Bacteria 47939
500 Ga0207668_10220372 3300025972 Unclassified 1523
501 Ga0207668_10413229 3300025972 Bacteria 1143
502 Ga0207640_10000129 3300025981 Bacteria 57276
503 Ga0207640_10247161 3300025981 Unclassified 1382
504 Ga0207640_10257825 3300025981 Unclassified 1357
505 Ga0207658_10005018 3300025986 Bacteria 9120
506 Ga0207658_10120838 3300025986 Unclassified 2088
507 Ga0207658_10246402 3300025986 Unclassified 1516
508 Ga0207677_10000349 3300026023 Bacteria 32391
509 Ga0207677_10042728 3300026023 Bacteria 3007
510 Ga0207703_10009975 3300026035 Bacteria 7450
511 Ga0207703_10307818 3300026035 Bacteria 1447
512 Ga0207703_10767429 3300026035 Unclassified 919
513 Ga0207639_10000825 3300026041 Bacteria 21067
514 Ga0207678_10001156 3300026067 Bacteria 24150
515 Ga0207678_10003613 3300026067 Bacteria 13902
516 Ga0207678_10005238 3300026067 Bacteria 11614
517 Ga0207708_10001163 3300026075 Bacteria 19820
518 Ga0207708_10005514 3300026075 Bacteria 9339
519 Ga0207702_10001465 3300026078 Bacteria 23457
520 Ga0207641_10000468 3300026088 Bacteria 45600
521 Ga0207641_10038901 3300026088 Bacteria 3977
522 Ga0207641_10388206 3300026088 Bacteria 1338
523 Ga0207641_10441744 3300026088 Bacteria 1256
524 Ga0207648_10002454 3300026089 Bacteria 19932
525 Ga0207648_10026444 3300026089 Bacteria 5156
526 Ga0207648_10075360 3300026089 Bacteria 2941
527 Ga0207676_10000335 3300026095 Bacteria 40477
528 Ga0207676_10092500 3300026095 Bacteria 2487
529 Ga0207676_10150702 3300026095 Unclassified 2002
530 Ga0207674_10000639 3300026116 Bacteria 45600
531 Ga0207674_10058822 3300026116 Bacteria 3892
532 Ga0207674_10876963 3300026116 Bacteria 865
533 Ga0207675_100001363 3300026118 Bacteria 24484
534 Ga0207683_10000048 3300026121 Bacteria 88501
535 Ga0207683_10006535 3300026121 Bacteria 9983
536 Ga0207683_10010853 3300026121 Bacteria 7769
537 Ga0207698_10003731 3300026142 Bacteria 9203
538 Ga0209973_1001466 3300027252 Bacteria 2067
539 Ga0209179_1040275 3300027512 Bacteria 982
540 Ga0210002_1000574 3300027617 Bacteria 4977
541 Ga0209971_1006961 3300027682 Bacteria 2682
542 Ga0209998_10018758 3300027717 Unclassified 1471
543 Ga0209813_10006297 3300027866 Bacteria 2926
544 Ga0209974_10004320 3300027876 Bacteria 5053
545 Ga0207428_10000247 3300027907 Bacteria 73484
546 Ga0207428_10000784 3300027907 Bacteria 35988
547 Ga0207428_10041877 3300027907 Bacteria 3706
548 Ga0207428_10071073 3300027907 Bacteria 2734
549 Ga0268266_10196925 3300028379 Bacteria 1842
550 Ga0268266_10387008 3300028379 Bacteria 1320
551 Ga0268265_10000871 3300028380 Bacteria 28300
552 Ga0268265_10601816 3300028380 Bacteria 1051
553 Ga0268264_10000735 3300028381 Bacteria 37414
554 Ga0268264_10252765 3300028381 Bacteria 1638
555 Ga0265337_1001061 3300028556 Bacteria 14176
556 Ga0265338_10141636 3300028800 Bacteria 1882
557 Ga0265325_10000377 3300031241 Bacteria 31339
558 Ga0265325_10012333 3300031241 Bacteria 4889
559 Ga0265325_10017402 3300031241 Bacteria 3995
560 Ga0265340_10004931 3300031247 Bacteria 7422
561 Ga0265339_10019520 3300031249 Bacteria 3978
562 Ga0265339_10058544 3300031249 Bacteria 2080
563 Ga0265331_10009591 3300031250 Bacteria 5425
564 Ga0265313_10000218 3300031595 Bacteria 61915
565 Ga0265313_10012813 3300031595 Bacteria 5088
566 Ga0265313_10020380 3300031595 Bacteria 3659
567 Ga0265313_10096144 3300031595 Bacteria 1321
568 Ga0265314_10011277 3300031711 Bacteria 7392
569 Ga0265342_10078456 3300031712 Bacteria 1911
570 Ga0316583_10000148 3300032133 Bacteria 16835
571 Ga0373930_0004895 3300034816 Bacteria 2204
572 Ga0373948_0000531 3300034817 Bacteria 4782
573 Ga0373958_0007270 3300034819 Unclassified 1758
574 Ga0373938_0006041 3300034957 Bacteria 2077
575 Ga0373926_0024846 3300035083 Bacteria 2088
576 Ga0373926_0084708 3300035083 Bacteria 1175
577 Ga0373928_0001239 3300035084 Bacteria 5012
578 Ga0373929_0000881 3300035085 Bacteria 5853
579 Ga0373929_0011968 3300035085 Bacteria 1642
580 Ga0373929_0046096 3300035085 Unclassified 984
581 Ga0373934_0047206 3300035086 Unclassified 1703
582 Ga0373940_0031448 3300035088 Bacteria 1417
583 Ga0373940_0048592 3300035088 Bacteria 1186
584 Ga0373944_0006259 3300035089 Bacteria 3154
585 Ga0373944_0007932 3300035089 Bacteria 2860
586 Ga0373951_0000290 3300035091 Bacteria 16024
587 Ga0373951_0006502 3300035091 Bacteria 2672
588 Ga0373952_0001526 3300035092 Bacteria 4216
589 Ga0373923_0002516 3300035111 Bacteria 5665
590 Ga0373923_0053206 3300035111 Unclassified 1702
591 Ga0373923_0111068 3300035111 Bacteria 1217
592 Ga0373932_0020873 3300035112 Bacteria 1722
593 Ga0373936_0000283 3300035113 Bacteria 17009
594 Ga0373939_0000192 3300035114 Bacteria 16989
595 Ga0373939_0011140 3300035114 Bacteria 2262
596 Ga0373939_0082668 3300035114 Bacteria 1070
597 Ga0373941_0000031 3300035115 Bacteria 21368
598 Ga0373945_0002393 3300035116 Bacteria 5884
599 Ga0373945_0017828 3300035116 Unclassified 2408
600 Ga0373953_0035231 3300035117 Bacteria 1966
601 Ga0373953_0039278 3300035117 Bacteria 1875
602 Ga0373954_0001724 3300035118 Bacteria 8951
603 Ga0373954_0024572 3300035118 Bacteria 2748
604 Ga0373954_0057463 3300035118 Bacteria 1832
605 Ga0373954_0073600 3300035118 Bacteria 1626
606 Ga0373954_0081541 3300035118 Bacteria 1546
607 Ga0373956_0023961 3300035119 Bacteria 2625
608 Ga0373956_0055170 3300035119 Unclassified 1792
609 Ga0373957_0015827 3300035120 Bacteria 2602
610 Ga0373957_0026468 3300035120 Bacteria 2098
611 Ga0373960_0009485 3300035121 Bacteria 2359
612 Ga0373943_0083106 3300035170 Bacteria 1645
613 Ga0373943_0114982 3300035170 Bacteria 1424
614 Ga0373946_0010660 3300035171 Bacteria 3408
615 Ga0373946_0027647 3300035171 Bacteria 2245
616 Ga0373946_0068616 3300035171 Unclassified 1525
617 Ga0373946_0094255 3300035171 Bacteria 1332
618 Ga0373955_0000334 3300035172 Bacteria 19669
619 Ga0373955_0008925 3300035172 Bacteria 4677
620 Ga0373955_0016443 3300035172 Unclassified 3642
621 Ga0373955_0043198 3300035172 Bacteria 2424
622 Ga0373955_0056389 3300035172 Unclassified 2155
623 Ga0373955_0198442 3300035172 Bacteria 1194
624 Ga0373942_0003290 3300035207 Bacteria 3804
625 Ga0373942_0041448 3300035207 Bacteria 1259
626 Ga0373961_0004317 3300035241 Unclassified 3439
627 Ga0373961_0049418 3300035241 Bacteria 1243
628 Ga0373961_0081138 3300035241 Bacteria 1021
629 Ga0373962_0001119 3300035242 Bacteria 6249
630 Ga0373962_0011124 3300035242 Bacteria 2252
631 Ga0373962_0045860 3300035242 Bacteria 1246
632 Ga0373924_0000358 3300035410 Bacteria 14065
633 Ga0373924_0007042 3300035410 Bacteria 4050
634 Ga0373924_0048746 3300035410 Bacteria 1751
635 Ga0373931_0000273 3300035691 Bacteria 21808
636 Ga0373931_0109441 3300035691 Bacteria 1565
637 Ga0373931_0255119 3300035691 Bacteria 1068
638 Ga0373935_0001324 3300035692 Bacteria 13718
639 Ga0373935_0034408 3300035692 Bacteria 3157
640 Ga0373935_0049223 3300035692 Bacteria 2671
641 Ga0373935_0084728 3300035692 Bacteria 2065
642 Ga0373935_0122232 3300035692 Bacteria 1741
643 Ga0373935_0228993 3300035692 Unclassified 1293
644 Ga0373935_0399979 3300035692 Bacteria 986
645 Ga0373927_0028494 3300035695 Bacteria 3643
646 Ga0373927_0037555 3300035695 Bacteria 3147
647 Ga0373927_0045830 3300035695 Bacteria 2829
648 Ga0373927_0076935 3300035695 Bacteria 2161
649 Ga0373927_0097250 3300035695 Bacteria 1913
650 Ga0373927_0143427 3300035695 Bacteria 1563
651 Ga0373927_0156703 3300035695 Bacteria 1491
652 Ga0373933_0001162 3300035724 Bacteria 15600
653 Ga0373933_0001830 3300035724 Bacteria 12312
654 Ga0373933_0070295 3300035724 Bacteria 2129
655 Ga0373933_0071647 3300035724 Unclassified 2110
656 Ga0373933_0161907 3300035724 Unclassified 1421
657 Ga0373933_0194364 3300035724 Bacteria 1297
658 Ga0373947_0002784 3300035725 Bacteria 10457
659 Ga0373947_0020264 3300035725 Bacteria 3838
660 Ga0373947_0161214 3300035725 Unclassified 1450
661 Ga0373947_0205553 3300035725 Bacteria 1290
662 Ga0373937_0001118 3300036401 Bacteria 22628
663 Ga0373937_0001692 3300036401 Bacteria 18558
664 Ga0373937_0006485 3300036401 Bacteria 10099
665 Ga0373937_0012619 3300036401 Bacteria 7436
666 Ga0373937_0028187 3300036401 Bacteria 5080
667 Ga0373937_0031982 3300036401 Bacteria 4770
668 Ga0373937_0151600 3300036401 Bacteria 2172
669 Ga0373937_0670866 3300036401 Bacteria 982
670 Ga0373925_0000084 3300037068 Bacteria 100945
671 Ga0373925_0003690 3300037068 Bacteria 11767
672 Ga0373925_0009586 3300037068 Bacteria 7055
673 Ga0373925_0017236 3300037068 Bacteria 5232
674 Ga0373925_0019319 3300037068 Bacteria 4955
675 Ga0373925_0049034 3300037068 Bacteria 3147
676 Ga0373925_0111409 3300037068 Bacteria 2115
677 Ga0373925_0148098 3300037068 Bacteria 1841
678 Ga0373925_0277419 3300037068 Unclassified 1349
679 Ga0436365_1232763 3300039437 Bacteria 8240
680 Ga0436365_1344708 3300039437 Unclassified 864
681 Ga0436365_1513096 3300039437 Bacteria 912
682 Ga0436365_1762134 3300039437 Bacteria 3129
683 Ga0451793_0025165 3300041452 Unclassified 854
684 Ga0439448_0047682 3300042005 Bacteria 1398
685 Ga0439455_0012427 3300042012 Bacteria 1912
686 Ga0450916_015161 3300042530 Unclassified 1011
687 Ga0466967_0117632 3300045976 Bacteria 2450
688 Ga0495592_0000026 3300046454 Bacteria 136204
689 Ga0495592_0016983 3300046454 Bacteria 5525
690 Ga0495592_0058557 3300046454 Bacteria 2841
691 Ga0495592_0081952 3300046454 Bacteria 2332
692 Ga0495592_0120738 3300046454 Bacteria 1844
693 Ga0495603_0014206 3300046455 Bacteria 4817
694 Ga0495603_0018977 3300046455 Bacteria 4162
695 Ga0495603_0131137 3300046455 Bacteria 1459
696 Ga0495629_0000171 3300046459 Bacteria 57349
697 Ga0495629_0024446 3300046459 Bacteria 4302
698 Ga0495629_0039765 3300046459 Bacteria 3309
699 Ga0495629_0214342 3300046459 Bacteria 1329
700 Ga0495629_0230419 3300046459 Bacteria 1277
701 Ga0495641_0003584 3300046461 Bacteria 11514
702 Ga0495641_0046148 3300046461 Bacteria 2004
703 Ga0495641_0114652 3300046461 Bacteria 1202
704 Ga0495651_0000790 3300046462 Bacteria 24562
705 Ga0495651_0008223 3300046462 Bacteria 7997
706 Ga0495651_0025993 3300046462 Bacteria 4558
707 Ga0495653_0000155 3300046463 Bacteria 56764
708 Ga0495653_0058758 3300046463 Bacteria 2922
709 Ga0495653_0084943 3300046463 Bacteria 2330
710 Ga0495653_0086116 3300046463 Bacteria 2310
711 Ga0495582_0002454 3300046473 Bacteria 10333
712 Ga0495639_0040288 3300046475 Bacteria 2101
713 Ga0495662_0015227 3300046476 Bacteria 3736
714 Ga0495662_0092193 3300046476 Bacteria 1477
715 Ga0495662_0145381 3300046476 Unclassified 1167
716 Ga0495664_0000001 3300046477 Bacteria 757730
717 Ga0495664_0086008 3300046477 Unclassified 1888
718 Ga0495584_0128523 3300046491 Bacteria 1285
719 Ga0495585_0000251 3300046492 Bacteria 55561
720 Ga0495585_0013489 3300046492 Bacteria 4780
721 Ga0495594_0022664 3300046499 Bacteria 3359
722 Ga0495594_0218570 3300046499 Unclassified 1086
723 Ga0495607_0001699 3300046501 Bacteria 18921
724 Ga0495607_0109705 3300046501 Bacteria 1465
725 Ga0495583_0082716 3300046506 Bacteria 1393
726 Ga0495608_0000012 3300046511 Bacteria 242758
727 Ga0495608_0002359 3300046511 Bacteria 13607
728 Ga0495608_0083008 3300046511 Bacteria 2080
729 Ga0495608_0096314 3300046511 Bacteria 1911
730 Ga0495608_0186857 3300046511 Bacteria 1309
731 Ga0495616_0037138 3300046513 Bacteria 2508
732 Ga0495618_0000041 3300046514 Bacteria 96631
733 Ga0495618_0052984 3300046514 Bacteria 2566
734 Ga0495628_0000033 3300046516 Bacteria 118203
735 Ga0495628_0059214 3300046516 Bacteria 3007
736 Ga0495628_0064026 3300046516 Bacteria 2879
737 Ga0495628_0212340 3300046516 Bacteria 1455
738 Ga0495630_0009244 3300046517 Bacteria 7086
739 Ga0495630_0039949 3300046517 Bacteria 3507
740 Ga0495630_0095665 3300046517 Bacteria 2246
741 Ga0495631_0011416 3300046518 Bacteria 4369
742 Ga0495644_0002554 3300046523 Bacteria 7243
743 Ga0495663_0054396 3300046525 Bacteria 1246
744 Ga0495666_0003467 3300046526 Bacteria 7964
745 Ga0495666_0024242 3300046526 Bacteria 2998
746 Ga0495642_0136479 3300046528 Unclassified 1058
747 Ga0495652_0000001 3300046529 Bacteria 1045081
748 Ga0495652_0001796 3300046529 Bacteria 22869
749 Ga0495652_0031224 3300046529 Bacteria 4666
750 Ga0495665_0017934 3300046531 Bacteria 3804
751 Ga0495640_0000010 3300046533 Bacteria 214167
752 Ga0495640_0016033 3300046533 Bacteria 5617
753 Ga0495640_0188971 3300046533 Bacteria 1310
754 Ga0495587_0000003 3300046536 Bacteria 424188
755 Ga0495587_0049031 3300046536 Bacteria 2501
756 Ga0495587_0062606 3300046536 Bacteria 2178
757 Ga0495587_0125462 3300046536 Bacteria 1469
758 Ga0495598_0001482 3300046537 Bacteria 4673
759 Ga0495598_0003879 3300046537 Bacteria 3204
760 Ga0495609_0017594 3300046538 Bacteria 3319
761 Ga0495645_0000026 3300046543 Bacteria 118737
762 Ga0495645_0003084 3300046543 Bacteria 11283
763 Ga0495645_0016073 3300046543 Bacteria 5336
764 Ga0495622_0071900 3300046557 Unclassified 1596
765 Ga0495633_0006405 3300046558 Bacteria 6982
766 Ga0495633_0077656 3300046558 Bacteria 1546
767 Ga0495667_0000389 3300046559 Bacteria 27954
768 Ga0495667_0001979 3300046559 Bacteria 13569
769 Ga0495667_0011491 3300046559 Bacteria 5993
770 Ga0495667_0020583 3300046559 Bacteria 4451
771 Ga0495667_0103935 3300046559 Unclassified 1837
772 Ga0495656_0000191 3300046615 Bacteria 22072
773 Ga0495668_0130262 3300046616 Bacteria 1377
774 Ga0495634_0000285 3300046642 Bacteria 48349
775 Ga0495634_0078208 3300046642 Bacteria 2167
776 Ga0495611_0069292 3300046648 Bacteria 1611
777 Ga0495635_0000113 3300046663 Bacteria 48231
778 Ga0495635_0013079 3300046663 Bacteria 5811
779 Ga0495635_0064469 3300046663 Bacteria 2515
780 Ga0495659_0002654 3300046664 Bacteria 5758
781 Ga0495588_0008289 3300046674 Bacteria 4761
782 Ga0495588_0060953 3300046674 Bacteria 1953
783 Ga0495657_0000258 3300046675 Bacteria 48270
784 Ga0495657_0053677 3300046675 Bacteria 2696
785 Ga0495657_0373614 3300046675 Bacteria 841
786 Ga0495599_0000070 3300046678 Bacteria 71413
787 Ga0495599_0005630 3300046678 Bacteria 7515
788 Ga0495599_0014500 3300046678 Bacteria 4881
789 Ga0495599_0019535 3300046678 Bacteria 4223
790 Ga0495599_0159733 3300046678 Bacteria 1393
791 Ga0495623_0000003 3300046679 Bacteria 147316
792 Ga0495623_0022373 3300046679 Bacteria 4084
793 Ga0495646_0000070 3300046680 Bacteria 47494
794 Ga0495646_0001840 3300046680 Bacteria 12737
795 Ga0495646_0138269 3300046680 Bacteria 1364
796 Ga0495647_0002939 3300046681 Bacteria 5405
797 Ga0495647_0055086 3300046681 Bacteria 1556
798 Ga0495647_0161499 3300046681 Bacteria 966
799 Ga0495658_0000282 3300046683 Bacteria 28789
800 Ga0495658_0007523 3300046683 Bacteria 5395
801 Ga0495658_0086001 3300046683 Bacteria 1854
802 Ga0495658_0216305 3300046683 Unclassified 1198
803 Ga0495613_0022200 3300046689 Bacteria 4729
804 Ga0495624_0011727 3300046690 Bacteria 6018
805 Ga0495670_0000204 3300046691 Bacteria 26707
806 Ga0495671_0015506 3300046692 Bacteria 4081
807 Ga0495589_0047550 3300046794 Bacteria 2126
808 Ga0495600_0000007 3300046809 Bacteria 150995
809 Ga0495600_0048247 3300046809 Bacteria 2778
810 Ga0495600_0059756 3300046809 Bacteria 2490
811 Ga0495581_0255145 3300047315 Unclassified 1025
812 Ga0495604_0000010 3300047317 Bacteria 312236
813 Ga0495604_0015304 3300047317 Bacteria 6122
814 Ga0495674_0000013 3300047319 Bacteria 248475
815 Ga0495674_0022656 3300047319 Bacteria 5791
816 Ga0495674_0128684 3300047319 Bacteria 2134
817 Ga0495674_0141310 3300047319 Bacteria 2023
818 Ga0495674_0212003 3300047319 Bacteria 1604
819 Ga0495674_0268890 3300047319 Bacteria 1399
820 Ga0495676_0059847 3300047321 Bacteria 2988
821 Ga0495676_0078519 3300047321 Bacteria 2513
822 Ga0495676_0103230 3300047321 Bacteria 2105
823 Ga0495676_0114449 3300047321 Bacteria 1973
824 Ga0495676_0125214 3300047321 Unclassified 1863
825 Ga0495680_0000666 3300047322 Bacteria 38461
826 Ga0495680_0004448 3300047322 Bacteria 13397
827 Ga0495680_0013117 3300047322 Bacteria 7242
828 Ga0495680_0148863 3300047322 Bacteria 1708
829 Ga0495680_0325730 3300047322 Bacteria 1074
830 Ga0495675_0000567 3300047444 Bacteria 23900
831 Ga0495675_0014786 3300047444 Bacteria 4934
832 Ga0495675_0017706 3300047444 Bacteria 4517
833 Ga0495679_020017 3300047446 Bacteria 2338
834 Ga0495684_0000008 3300047471 Bacteria 201370
835 Ga0495684_0022473 3300047471 Bacteria 4852
836 Ga0495684_0172019 3300047471 Unclassified 1610
837 Ga0495684_0178542 3300047471 Bacteria 1575
838 Ga0495684_0270973 3300047471 Bacteria 1228
839 Ga0495684_0346552 3300047471 Bacteria 1056
840 Ga0495593_0002332 3300047673 Bacteria 11402
841 Ga0495593_0259212 3300047673 Bacteria 870
842 Ga0495602_0000264 3300048088 Bacteria 48258
843 Ga0495602_0000568 3300048088 Bacteria 34391
844 Ga0495602_0199342 3300048088 Unclassified 1528
845 Ga0495602_0216016 3300048088 Bacteria 1451
846 Ga0495602_0313377 3300048088 Unclassified 1144
847 Ga0496100_0000255 3300048903 Bacteria 27283
848 Ga0496100_0022447 3300048903 Bacteria 3819
849 Ga0496100_0058396 3300048903 Bacteria 2531
850 Ga0496101_0000317 3300048904 Bacteria 33300
851 Ga0496101_0005168 3300048904 Bacteria 8303
852 Ga0496101_0045030 3300048904 Bacteria 3159
853 Ga0496101_0075080 3300048904 Bacteria 2488
854 Ga0496102_0001113 3300048905 Bacteria 24650
855 Ga0496102_0052571 3300048905 Bacteria 3712
856 Ga0496102_0062761 3300048905 Unclassified 3402
857 Ga0496102_0063229 3300048905 Bacteria 3388
858 Ga0496102_0177348 3300048905 Bacteria 2007
859 Ga0496103_0000528 3300048906 Bacteria 31170
860 Ga0496103_0049495 3300048906 Bacteria 2598
861 Ga0496103_0057083 3300048906 Bacteria 2424
862 Ga0496103_0172895 3300048906 Bacteria 1387
863 Ga0496104_0000082 3300048907 Bacteria 93223
864 Ga0496104_0001732 3300048907 Bacteria 18840
865 Ga0496104_0001798 3300048907 Bacteria 18583
866 Ga0496104_0004876 3300048907 Bacteria 11697
867 Ga0496104_0007168 3300048907 Bacteria 9828
868 Ga0496104_0103866 3300048907 Bacteria 2722
869 Ga0496104_0126757 3300048907 Unclassified 2451
870 Ga0496104_0158263 3300048907 Unclassified 2173
871 Ga0496104_0245894 3300048907 Bacteria 1701
872 Ga0496105_0000563 3300048908 Bacteria 24520
873 Ga0496105_0001322 3300048908 Bacteria 17343
874 Ga0496105_0002542 3300048908 Bacteria 13233
875 Ga0496105_0012374 3300048908 Bacteria 6756
876 Ga0496105_0021540 3300048908 Bacteria 5215
877 Ga0496105_0062196 3300048908 Bacteria 3080
878 Ga0496105_0331320 3300048908 Bacteria 1218
879 Ga0496106_0000165 3300048909 Bacteria 47763
880 Ga0496106_0028529 3300048909 Bacteria 4157
881 Ga0496106_0076376 3300048909 Unclassified 2567
882 Ga0496106_0139632 3300048909 Unclassified 1905
883 Ga0496106_0277109 3300048909 Unclassified 1343
884 Ga0496106_0601510 3300048909 Bacteria 880
885 Ga0496107_0000201 3300048910 Bacteria 31298
886 Ga0496107_0009106 3300048910 Bacteria 6883
887 Ga0496108_0002292 3300048911 Bacteria 15331
888 Ga0496108_0009174 3300048911 Bacteria 8006
889 Ga0496108_0085375 3300048911 Bacteria 2679
890 Ga0496108_0131813 3300048911 Bacteria 2148
891 Ga0496108_0179475 3300048911 Bacteria 1833
892 Ga0496108_0199665 3300048911 Bacteria 1735
893 Ga0496109_0002809 3300048912 Bacteria 14583
894 Ga0496109_0003316 3300048912 Bacteria 13454
895 Ga0496109_0031863 3300048912 Bacteria 4735
896 Ga0496109_0080575 3300048912 Bacteria 2999
897 Ga0496109_0276991 3300048912 Bacteria 1581
898 Ga0496109_0811529 3300048912 Unclassified 873
899 Ga0496110_0014166 3300048913 Bacteria 6615
900 Ga0496110_0105889 3300048913 Unclassified 2523
901 Ga0496110_0135796 3300048913 Unclassified 2222
902 Ga0496111_0025450 3300048914 Bacteria 4175
903 Ga0496111_0030271 3300048914 Unclassified 3849
904 Ga0496111_0126095 3300048914 Bacteria 1892
905 Ga0496112_0006605 3300048915 Bacteria 10208
906 Ga0496112_0009460 3300048915 Bacteria 8783
907 Ga0496112_0624308 3300048915 Unclassified 1008
908 Ga0496113_0004968 3300048916 Bacteria 8242
909 Ga0496113_0034635 3300048916 Bacteria 3685
910 Ga0496113_0045130 3300048916 Bacteria 3267
911 Ga0496113_0058019 3300048916 Bacteria 2911
912 Ga0496113_0063744 3300048916 Unclassified 2785
913 Ga0496113_0133067 3300048916 Bacteria 1953
914 Ga0496113_0276091 3300048916 Bacteria 1343
915 Ga0496114_0000928 3300048917 Bacteria 21913
916 Ga0496114_0009782 3300048917 Bacteria 7617
917 Ga0496114_0080883 3300048917 Bacteria 2744
918 Ga0496115_0000667 3300048918 Bacteria 25359
919 Ga0496115_0010445 3300048918 Bacteria 6938
920 Ga0496115_0025523 3300048918 Bacteria 4601
921 Ga0496115_0029013 3300048918 Bacteria 4342
922 Ga0496115_0134465 3300048918 Bacteria 2039
923 Ga0496115_0321672 3300048918 Unclassified 1265
924 Ga0496115_0459270 3300048918 Unclassified 1027
925 Ga0496126_0089821 3300048929 Bacteria 2704
926 Ga0501031_0010487 3300049568 Bacteria 6036
927 Ga0501032_0000001 3300049569 Bacteria 422097
928 Ga0501032_0064310 3300049569 Bacteria 2455
929 Ga0501032_0126310 3300049569 Bacteria 1689
930 Ga0501033_0000515 3300049570 Bacteria 36220
931 Ga0501033_0007008 3300049570 Bacteria 8800
932 Ga0501034_0000023 3300049571 Bacteria 263892
933 Ga0501034_0245997 3300049571 Bacteria 1734
934 Ga0501034_0366818 3300049571 Bacteria 1366
935 Ga0501036_0032817 3300049572 Bacteria 4389
936 Ga0501036_0076480 3300049572 Bacteria 2831
937 Ga0501037_0000065 3300049573 Bacteria 96747
938 Ga0501038_0002005 3300049574 Bacteria 18789
939 Ga0501038_0014065 3300049574 Bacteria 7292
940 Ga0501038_0058445 3300049574 Bacteria 3306
941 Ga0501038_0116498 3300049574 Bacteria 2208
942 Ga0501038_0458148 3300049574 Bacteria 980
943 Ga0501039_0000022 3300049575 Bacteria 160858
944 Ga0501039_0057042 3300049575 Bacteria 3025
945 Ga0501039_0283953 3300049575 Bacteria 1301
946 Ga0501039_0370654 3300049575 Bacteria 1125
947 Ga0501041_0159212 3300049577 Unclassified 1411
948 Ga0501041_0302229 3300049577 Bacteria 1008
949 Ga0501042_0138742 3300049578 Bacteria 1753
950 Ga0501043_0000093 3300049579 Bacteria 80521
951 Ga0501046_0006925 3300049580 Bacteria 9990
952 Ga0501047_0197541 3300049581 Bacteria 1873
953 Ga0501047_0287845 3300049581 Bacteria 1487
954 Ga0501048_0002288 3300049582 Bacteria 14613
955 Ga0501048_0199264 3300049582 Bacteria 1419
956 Ga0501067_0014486 3300049583 Bacteria 4365
957 Ga0501068_0007260 3300049584 Bacteria 6137
958 Ga0501069_0013029 3300049585 Bacteria 4430
959 Ga0501070_0075537 3300049586 Bacteria 2790
960 Ga0501070_0128149 3300049586 Bacteria 2097
961 Ga0501071_0287920 3300049587 Bacteria 1244
962 Ga0501071_0337213 3300049587 Bacteria 1146
963 Ga0501073_0076635 3300049589 Bacteria 2326
964 Ga0501073_0161707 3300049589 Bacteria 1551
965 Ga0501074_0003219 3300049590 Bacteria 11530
966 Ga0501075_0079327 3300049591 Bacteria 2485
967 Ga0501075_0488893 3300049591 Bacteria 939
968 Ga0501076_0033914 3300049592 Bacteria 3987
969 Ga0501076_0318996 3300049592 Bacteria 1275
970 Ga0501077_0003399 3300049593 Bacteria 9566
971 Ga0501077_0046578 3300049593 Bacteria 2755
972 Ga0501077_0180378 3300049593 Bacteria 1342
973 Ga0501079_0029518 3300049741 Bacteria 4210
974 Ga0501079_0551114 3300049741 Bacteria 907
975 Ga0501081_0135163 3300049743 Bacteria 1765
976 Ga0501035_0000336 3300049822 Bacteria 54776
977 Ga0501044_0001021 3300049823 Bacteria 33699
978 Ga0501044_0200543 3300049823 Bacteria 1954
979 Ga0501044_0253795 3300049823 Bacteria 1698
980 Ga0501044_0396408 3300049823 Bacteria 1293
981 Ga0501045_0013355 3300049824 Bacteria 5799
982 nmdc:mga03683_52066_c1 3300050489 Bacteria 1711
983 nmdc:mga00v17_30922_c1 3300050491 Bacteria 3154
984 nmdc:mga0yw44_55006_c1 3300050492 Bacteria 2421
985 nmdc:mga0yw44_918_c1 3300050492 Bacteria 11147
986 nmdc:mga0k408_108352_c1 3300050493 Bacteria 1641
987 nmdc:mga0k408_4295_c1 3300050493 Bacteria 7567
988 nmdc:mga0k408_68849_c1 3300050493 Bacteria 2065
989 nmdc:mga06z11_16410_c1 3300050494 Bacteria 3335
990 nmdc:mga06z11_22339_c1 3300050494 Bacteria 2954
991 nmdc:mga06z11_8019_c1 3300050494 Bacteria 4379
992 nmdc:mga04h51_8228_c1 3300050495 Bacteria 2785
993 nmdc:mga07m45_18954_c1 3300050496 Bacteria 3724
994 nmdc:mga07m45_60813_c1 3300050496 Bacteria 2139
995 nmdc:mga05p37_162898_c1 3300050507 Bacteria 2176
996 nmdc:mga05p37_191383_c1 3300050507 Bacteria 2483
997 nmdc:mga05p37_26421_c1 3300050507 Bacteria 7062
998 nmdc:mga05p37_47186_c1 3300050507 Bacteria 5297
999 nmdc:mga05p37_64007_c1 3300050507 Bacteria 4525
1000 nmdc:mga05p37_660009_c1 3300050507 Bacteria 1169
1001 nmdc:mga05p37_69_c2 3300050507 Bacteria 32137
1002 nmdc:mga05p37_83478_c1 3300050507 Bacteria 3936
1003 nmdc:mga09592_1744_c1 3300050508 Bacteria 17486
1004 nmdc:mga09592_67827_c1 3300050508 Bacteria 3026
1005 nmdc:mga09592_95436_c1 3300050508 Bacteria 2544
1006 nmdc:mga0qj67_1033_c1 3300050509 Bacteria 19245
1007 nmdc:mga0qj67_323519_c1 3300050509 Bacteria 1248
1008 nmdc:mga0qj67_37_c1 3300050509 Bacteria 92978
1009 nmdc:mga0qj67_3998_c1 3300050509 Bacteria 10676
1010 nmdc:mga0qj67_67208_c1 3300050509 Bacteria 2856
1011 nmdc:mga06r32_235285_c1 3300050510 Bacteria 1819
1012 nmdc:mga06r32_544884_c1 3300050510 Unclassified 1134
1013 nmdc:mga06r32_6015_c1 3300050510 Bacteria 10916
1014 nmdc:mga08y16_190481_c1 3300050511 Bacteria 2127
1015 nmdc:mga08y16_25098_c1 3300050511 Bacteria 6287
1016 nmdc:mga08y16_27814_c1 3300050511 Bacteria 5959
1017 nmdc:mga08y16_80954_c1 3300050511 Bacteria 3386
1018 nmdc:mga08y16_891_c1 3300050511 Bacteria 28805
1019 nmdc:mga08y16_948514_c1 3300050511 Bacteria 844
1020 nmdc:mga0n895_113390_c1 3300050512 Bacteria 2728
1021 nmdc:mga0n895_135077_c1 3300050512 Bacteria 2493
1022 nmdc:mga0n895_289541_c1 3300050512 Bacteria 1661
1023 nmdc:mga0n895_29192_c1 3300050512 Bacteria 5257
1024 nmdc:mga0n895_44_c1 3300050512 Bacteria 74241
1025 nmdc:mga0n895_769_c1 3300050512 Bacteria 22759
1026 nmdc:mga0n895_98430_c1 3300050512 Bacteria 2932
1027 nmdc:mga0rr50_124159_c1 3300050513 Bacteria 2059
1028 nmdc:mga0rr50_273231_c1 3300050513 Bacteria 1409
1029 nmdc:mga0rr50_297295_c1 3300050513 Bacteria 1350
1030 nmdc:mga0rr50_37935_c1 3300050513 Bacteria 3482
1031 nmdc:mga0rr50_47953_c1 3300050513 Bacteria 3155
1032 nmdc:mga0rr50_621046_c1 3300050513 Unclassified 922
1033 nmdc:mga08x19_11978_c1 3300050514 Bacteria 5219
1034 nmdc:mga08x19_123526_c1 3300050514 Bacteria 1737
1035 nmdc:mga08x19_296160_c1 3300050514 Bacteria 1123
1036 nmdc:mga08x19_40712_c1 3300050514 Bacteria 2958
1037 nmdc:mga08x19_96802_c1 3300050514 Bacteria 1954
1038 nmdc:mga0a205_120508_c1 3300050515 Bacteria 2523
1039 nmdc:mga0a205_247_c1 3300050515 Bacteria 38521
1040 nmdc:mga0a205_37931_c1 3300050515 Bacteria 4634
1041 nmdc:mga0a205_4580_c1 3300050515 Bacteria 12399
1042 nmdc:mga0sz30_15572_c2 3300050516 Bacteria 2099
1043 Ga0495601_0000003 3300053077 Bacteria 493642
1044 Ga0495601_0000151 3300053077 Bacteria 38914
1045 Ga0495601_0000398 3300053077 Bacteria 23035
1046 Ga0495601_0006487 3300053077 Bacteria 6844
1047 Ga0495601_0008245 3300053077 Bacteria 6148
1048 Ga0495601_0018815 3300053077 Bacteria 4206
1049 Ga0495601_0068660 3300053077 Bacteria 2259
1050 Ga0495612_0000009 3300053078 Bacteria 229858
1051 Ga0495612_0001511 3300053078 Bacteria 9570
1052 Ga0495655_0018187 3300053083 Bacteria 1541
1053 Ga0495655_0073699 3300053083 Unclassified 960
1054 Ga0495595_0000075 3300053084 Bacteria 48300
1055 Ga0495595_0000226 3300053084 Bacteria 22467
1056 Ga0495595_0018508 3300053084 Bacteria 3011
1057 Ga0495595_0030840 3300053084 Bacteria 2406
1058 Ga0495619_0000039 3300053085 Bacteria 118681
1059 Ga0495619_0000086 3300053085 Bacteria 69774
1060 Ga0495619_0000379 3300053085 Bacteria 30688
1061 Ga0495619_0001781 3300053085 Bacteria 14325
1062 Ga0500562_005751 3300053108 Bacteria 3121
1063 Ga0500595_041249 3300053119 Bacteria 1484
1064 Ga0500658_0085423 3300053134 Bacteria 1357
1065 Ga0500645_000099 3300053730 Bacteria 68426
1066 Ga0501084_0019616 3300054114 Bacteria 5634
1067 Ga0501084_0033970 3300054114 Bacteria 4265
1068 Ga0501084_0056755 3300054114 Bacteria 3276
1069 Ga0501082_0022891 3300060353 Bacteria 5383
1070 Ga0530510_0062042 3300061734 Bacteria 2706
1071 Ga0530510_0109978 3300061734 Bacteria 2018
1072 Ga0501035_0317066
1073 JGI24741J21665_1008381
1074 JGI24752J21851_1003823
1075 JGI24746J21847_1000120
1076 JGI24740J21852_10067766
1077 JGI24739J22299_10000176
1078 JGI24737J22298_10000190
1079 JGI24743J22301_10028038
1080 JGI24750J21931_1000450
1081 JGI24748J21848_1000227
1082 JGI24738J21930_10000193
1083 JGI24749J21850_1000755
1084 JGI24744J21845_10001617
1085 JGI24744J21845_10017010
1086 JGI24035J26624_1000163
1087 JGI24034J26672_10002430
1088 JGI24742J22300_10004712
1089 JGI24751J29686_10002684
1090 JGI24751J29686_10025703
1091 JGI25405J52794_10049024
1092 Ga0065704_10167307
1093 Ga0065712_10000779
1094 Ga0065712_10102865
1095 Ga0065715_10089014
1096 Ga0070676_10004465
1097 Ga0070676_10044243
1098 Ga0070683_100000173
1099 Ga0070683_100039525
1100 Ga0070683_100051833
1101 Ga0070690_100001979
1102 Ga0070670_100010494
1103 Ga0070677_10000054
1104 Ga0068869_100000316
1105 Ga0068869_100163636
1106 Ga0070666_10012204
1107 Ga0070666_10303714
1108 Ga0070680_100006219
1109 Ga0070680_100221265
1110 Ga0070680_100542331
1111 Ga0070682_100001435
1112 Ga0070682_100127927
1113 Ga0068868_100000176
1114 Ga0068868_100213697
1115 Ga0068868_100316046
1116 Ga0070660_100000595
1117 Ga0070660_100143899
1118 Ga0070689_100000116
1119 Ga0070689_100396606
1120 Ga0070689_100575718
1121 Ga0070691_10003422
1122 Ga0070691_10206891
1123 Ga0070687_100000232
1124 Ga0070687_100030450
1125 Ga0070687_100096957
1126 Ga0070661_100000680
1127 Ga0070661_100029004
1128 Ga0070661_100080428
1129 Ga0070692_10000138
1130 Ga0070692_10267264
1131 Ga0070668_100001184
1132 Ga0070668_100328130
1133 Ga0070669_100002530
1134 Ga0070675_100000398
1135 Ga0070675_100535772
1136 Ga0070671_100000708
1137 Ga0070671_100023382
1138 Ga0070674_100000672
1139 Ga0070674_100052962
1140 Ga0070674_100111998
1141 Ga0070673_100000199
1142 Ga0070673_100024556
1143 Ga0070673_100049799
1144 Ga0070673_100257620
1145 Ga0070688_100002526
1146 Ga0070688_100016957
1147 Ga0070659_100000476
1148 Ga0070667_100003351
1149 Ga0070667_100161020
1150 Ga0070667_100236316
1151 Ga0070703_10016756
1152 Ga0070709_10008770
1153 Ga0070709_10209216
1154 Ga0070709_10253003
1155 Ga0070714_100089689
1156 Ga0070714_100118740
1157 Ga0070714_100235083
1158 Ga0070713_100000368
1159 Ga0070713_100088482
1160 Ga0070713_100487046
1161 Ga0070710_10033625
1162 Ga0070710_10042930
1163 Ga0070710_10144142
1164 Ga0070710_10262588
1165 Ga0070701_10000211
1166 Ga0070701_10032677
1167 Ga0070701_10214452
1168 Ga0070711_100034978
1169 Ga0070711_100036661
1170 Ga0070711_100322066
1171 Ga0070705_100000446
1172 Ga0070700_100000490
1173 Ga0070700_100227883
1174 Ga0070694_100001164
1175 Ga0070708_100049088
1176 Ga0070708_100406314
1177 Ga0070663_100000546
1178 Ga0070663_100101191
1179 Ga0070678_100000142
1180 Ga0070678_100017253
1181 Ga0070662_100012272
1182 Ga0070662_100055926
1183 Ga0070681_10000980
1184 Ga0070681_10021188
1185 Ga0070681_10040733
1186 Ga0070681_10356822
1187 Ga0070681_10703697
1188 Ga0068867_100001587
1189 Ga0068867_100043695
1190 Ga0070685_10000603
1191 Ga0070685_10279786
1192 Ga0070698_100031369
1193 Ga0070679_100002691
1194 Ga0070679_100016776
1195 Ga0070679_100031424
1196 Ga0070679_100035045
1197 Ga0070679_100129911
1198 Ga0070679_100278968
1199 Ga0070679_100353108
1200 Ga0070679_100525541
1201 Ga0070684_100000146
1202 Ga0070684_100346793
1203 Ga0068853_100002495
1204 Ga0070672_100000063
1205 Ga0070672_100049971
1206 Ga0070672_100053875
1207 Ga0070686_100000695
1208 Ga0070695_100000044
1209 Ga0070695_100100933
1210 Ga0070696_100004713
1211 Ga0070693_100000297
1212 Ga0070693_100004176
1213 Ga0070665_100257174
1214 Ga0070704_100000520
1215 Ga0070704_100318710
1216 Ga0070704_100449010
1217 Ga0068855_100057301
1218 Ga0068855_100232463
1219 Ga0070664_100000287
1220 Ga0068857_100000332
1221 Ga0068857_100563504
1222 Ga0068854_100000493
1223 Ga0068854_100223760
1224 Ga0068856_100001778
1225 Ga0068856_100139637
1226 Ga0070702_100000060
1227 Ga0070702_100073847
1228 Ga0070702_100075108
1229 Ga0068852_100002718
1230 Ga0068859_100002562
1231 Ga0068859_100080058
1232 Ga0068859_100106590
1233 Ga0068864_100000316
1234 Ga0068864_100012805
1235 Ga0068864_100024748
1236 Ga0068864_100262336
1237 Ga0068864_100484362
1238 Ga0068866_10000272
1239 Ga0068866_10053048
1240 Ga0068866_10064399
1241 Ga0068861_100005790
1242 Ga0068861_100187979
1243 Ga0068851_10116115
1244 Ga0068870_10000420
1245 Ga0068870_10053014
1246 Ga0068863_100000334
1247 Ga0068863_100169061
1248 Ga0068863_100590377
1249 Ga0068858_100003943
1250 Ga0068860_100000816
1251 Ga0068860_100036965
1252 Ga0068860_100323262
1253 Ga0068862_100000672
1254 Ga0068862_100096724
1255 Ga0081455_10001860
1256 Ga0081455_10010994
1257 Ga0081455_10066862
1258 Ga0081455_10106038
1259 Ga0081538_10005426
1260 Ga0081538_10023338
1261 Ga0081538_10044624
1262 Ga0081540_1074143
1263 Ga0070717_10005996
1264 Ga0070717_10056864
1265 Ga0070717_10121589
1266 Ga0075365_10011942
1267 Ga0075365_10038703
1268 Ga0075365_10085494
1269 Ga0075365_10130574
1270 Ga0075368_10027421
1271 Ga0075368_10108112
1272 Ga0075363_100051278
1273 Ga0075363_100112741
1274 Ga0075364_10032091
1275 Ga0075364_10282458
1276 Ga0075432_10002355
1277 Ga0070715_10007706
1278 Ga0070715_10057951
1279 Ga0070715_10173963
1280 Ga0070716_100031571
1281 Ga0070716_100068505
1282 Ga0070716_100124361
1283 Ga0070712_100019966
1284 Ga0070712_100062755
1285 Ga0070712_100141436
1286 Ga0070712_100223176
1287 Ga0070712_100271171
1288 Ga0075362_10040601
1289 Ga0075367_10006771
1290 Ga0075367_10028695
1291 Ga0075369_10012309
1292 Ga0075366_10052396
1293 Ga0075366_10086855
1294 Ga0097621_100000019
1295 Ga0097621_100019564
1296 Ga0097621_100236910
1297 Ga0075370_10045017
1298 Ga0075370_10045594
1299 Ga0075370_10064509
1300 Ga0075370_10078861
1301 Ga0075370_10142477
1302 Ga0075370_10320235
1303 Ga0068871_100000293
1304 Ga0068871_100013376
1305 Ga0068871_100054862
1306 Ga0075428_100051979
1307 Ga0075428_100106765
1308 Ga0075428_100124897
1309 Ga0075428_100274931
1310 Ga0075428_100387815
1311 Ga0075430_100000293
1312 Ga0075430_100000327
1313 Ga0075430_100082249
1314 Ga0075430_100355873
1315 Ga0075431_100005554
1316 Ga0075431_100015952
1317 Ga0075431_100114318
1318 Ga0075431_100213988
1319 Ga0075431_100752788
1320 Ga0075433_10012481
1321 Ga0075433_10014765
1322 Ga0075433_10405521
1323 Ga0075434_100000042
1324 Ga0075434_100008550
1325 Ga0075434_100013525
1326 Ga0075434_100045938
1327 Ga0075434_100124982
1328 Ga0075429_100025101
1329 Ga0075429_100063005
1330 Ga0075429_100187529
1331 Ga0068865_100000183
1332 Ga0068865_100003957
1333 Ga0075436_100031580
1334 Ga0075436_100035442
1335 Ga0097620_100002562
1336 Ga0097620_100080058
1337 Ga0097620_100106592
1338 Ga0075435_100139260
1339 Ga0075435_100139484
1340 Ga0075435_100177948
1341 Ga0075435_100295818
1342 Ga0075435_100653054
1343 Ga0099795_10000484
1344 Ga0105251_10096278
1345 Ga0105244_10015753
1346 Ga0105250_10008874
1347 Ga0105240_10015725
1348 Ga0105240_10306754
1349 Ga0111539_10001254
1350 Ga0111539_10002524
1351 Ga0111539_10035317
1352 Ga0111539_10042413
1353 Ga0111539_10200789
1354 Ga0105245_10000142
1355 Ga0105245_10044321
1356 Ga0105245_10205717
1357 Ga0105245_10294830
1358 Ga0105245_10488443
1359 Ga0105245_10808618
1360 Ga0105247_10008521
1361 Ga0105247_10065809
1362 Ga0105247_10078830
1363 Ga0105247_10173983
1364 Ga0114129_10017130
1365 Ga0114129_10024961
1366 Ga0114129_10072678
1367 Ga0114129_10120613
1368 Ga0114129_10212088
1369 Ga0114129_10666835
1370 Ga0114129_10999293
1371 Ga0105243_10000376
1372 Ga0105243_10011332
1373 Ga0105243_10157139
1374 Ga0105243_10675892
1375 Ga0105241_10001391
1376 Ga0105241_10169691
1377 Ga0105241_10207278
1378 Ga0105242_10000380
1379 Ga0105242_10049109
1380 Ga0105242_10093079
1381 Ga0105242_10108558
1382 Ga0105248_10000549
1383 Ga0105248_10103414
1384 Ga0105248_10253098
1385 Ga0105248_10597598
1386 Ga0105237_10342498
1387 Ga0105238_10036077
1388 Ga0105238_10575363
1389 Ga0105238_10705387
1390 Ga0105249_10001601
1391 Ga0105249_10069791
1392 Ga0105249_10374038
1393 Ga0099796_10012112
1394 Ga0105239_10000656
1395 Ga0105239_10255639
1396 Ga0105239_10279321
1397 Ga0105239_10719111
1398 Ga0105246_10000027
1399 Ga0105246_10046442
1400 Ga0157373_10007428
1401 Ga0157373_10020687
1402 Ga0157371_10019225
1403 Ga0157369_10152310
1404 Ga0157374_10015586
1405 Ga0157374_10051895
1406 Ga0157374_10084337
1407 Ga0157374_10112264
1408 Ga0157378_10000786
1409 Ga0157378_10286430
1410 Ga0163162_10002019
1411 Ga0163162_10155857
1412 Ga0163162_10388696
1413 Ga0157372_10028341
1414 Ga0157372_11094181
1415 Ga0157375_10000293
1416 Ga0157375_10273733
1417 Ga0157375_10521759
1418 Ga0163163_10000482
1419 Ga0163163_10006324
1420 Ga0163163_10013569
1421 Ga0163163_10027715
1422 Ga0163163_10183734
1423 Ga0157380_10000927
1424 Ga0157380_10208236
1425 Ga0157380_10384053
1426 Ga0182008_10040088
1427 Ga0157377_10000136
1428 Ga0157379_10001911
1429 Ga0157379_10016208
1430 Ga0157379_10145202
1431 Ga0157379_10154441
1432 Ga0157379_10476013
1433 Ga0157376_10000073
1434 Ga0157376_10040052
1435 Ga0157376_10046917
1436 Ga0163161_10000476
1437 Ga0163161_10128307
1438 Ga0163161_10198527
1439 Ga0206353_11138709
1440 Ga0213876_10003884
1441 Ga0213876_10299770
1442 Ga0207666_1000055
1443 Ga0207673_1000158
1444 Ga0209758_1000370
1445 Ga0207426_1088694
1446 Ga0207697_10000622
1447 Ga0207656_10033741
1448 Ga0207696_1047998
1449 Ga0207655_1029921
1450 Ga0207653_10001943
1451 Ga0207682_10000074
1452 Ga0207692_10007770
1453 Ga0207692_10134218
1454 Ga0207642_10011274
1455 Ga0207642_10039025
1456 Ga0207642_10084655
1457 Ga0207642_10087769
1458 Ga0207710_10002334
1459 Ga0207710_10013487
1460 Ga0207710_10045112
1461 Ga0207688_10000423
1462 Ga0207688_10031180
1463 Ga0207688_10065182
1464 Ga0207680_10004765
1465 Ga0207680_10149159
1466 Ga0207680_10363187
1467 Ga0207647_10005297
1468 Ga0207647_10014286
1469 Ga0207685_10006352
1470 Ga0207685_10029984
1471 Ga0207699_10008676
1472 Ga0207699_10030445
1473 Ga0207699_10070486
1474 Ga0207699_10113108
1475 Ga0207699_10260214
1476 Ga0207645_10000291
1477 Ga0207645_10023307
1478 Ga0207643_10000116
1479 Ga0207643_10000872
1480 Ga0207705_10144176
1481 Ga0207654_10000917
1482 Ga0207654_10108762
1483 Ga0207707_10000563
1484 Ga0207707_10480923
1485 Ga0207695_10031303
1486 Ga0207693_10005802
1487 Ga0207693_10038010
1488 Ga0207693_10044565
1489 Ga0207693_10068060
1490 Ga0207693_10070555
1491 Ga0207693_10131345
1492 Ga0207663_10005835
1493 Ga0207663_10132045
1494 Ga0207660_10000043
1495 Ga0207660_10000134
1496 Ga0207660_10030574
1497 Ga0207662_10000386
1498 Ga0207662_10007580
1499 Ga0207662_10028910
1500 Ga0207657_10002520
1501 Ga0207657_10023526
1502 Ga0207657_10081420
1503 Ga0207649_10000204
1504 Ga0207649_10347921
1505 Ga0207652_10001156
1506 Ga0207652_10093104
1507 Ga0207652_10111291
1508 Ga0207681_10000066
1509 Ga0207694_10233225
1510 Ga0207694_10451831
1511 Ga0207650_10002222
1512 Ga0207650_10002953
1513 Ga0207659_10000100
1514 Ga0207687_10000052
1515 Ga0207687_10062086
1516 Ga0207700_10001520
1517 Ga0207700_10006951
1518 Ga0207700_10116013
1519 Ga0207700_10216496
1520 Ga0207700_10338603
1521 Ga0207664_10073355
1522 Ga0207664_10139192
1523 Ga0207664_10145011
1524 Ga0207664_10189569
1525 Ga0207664_10219186
1526 Ga0207644_10000572
1527 Ga0207644_10010069
1528 Ga0207644_10082223
1529 Ga0207644_10117391
1530 Ga0207690_10000187
1531 Ga0207690_10152722
1532 Ga0207706_10003689
1533 Ga0207706_10006344
1534 Ga0207706_10073082
1535 Ga0207686_10000331
1536 Ga0207686_10049398
1537 Ga0207686_10086964
1538 Ga0207686_10334534
1539 Ga0207709_10000243
1540 Ga0207709_10130015
1541 Ga0207670_10000140
1542 Ga0207670_10022501
1543 Ga0207670_10066542
1544 Ga0207669_10000034
1545 Ga0207704_10000108
1546 Ga0207704_10107366
1547 Ga0207665_10000860
1548 Ga0207665_10006295
1549 Ga0207665_10127648
1550 Ga0207665_10145335
1551 Ga0207665_10183122
1552 Ga0207691_10001957
1553 Ga0207691_10007735
1554 Ga0207711_10001312
1555 Ga0207711_10024752
1556 Ga0207711_10210381
1557 Ga0207711_10458193
1558 Ga0207689_10000233
1559 Ga0207689_10112768
1560 Ga0207661_10000230
1561 Ga0207661_10078867
1562 Ga0207679_10000052
1563 Ga0207679_10456428
1564 Ga0207667_10009406
1565 Ga0207667_10160054
1566 Ga0207651_10000421
1567 Ga0207651_10180490
1568 Ga0207712_10000265
1569 Ga0207712_10169791
1570 Ga0207668_10000151
1571 Ga0207668_10220372
1572 Ga0207668_10413229
1573 Ga0207640_10000129
1574 Ga0207640_10247161
1575 Ga0207640_10257825
1576 Ga0207658_10005018
1577 Ga0207658_10120838
1578 Ga0207658_10246402
1579 Ga0207677_10000349
1580 Ga0207677_10042728
1581 Ga0207703_10009975
1582 Ga0207703_10307818
1583 Ga0207703_10767429
1584 Ga0207639_10000825
1585 Ga0207678_10001156
1586 Ga0207678_10003613
1587 Ga0207678_10005238
1588 Ga0207708_10001163
1589 Ga0207708_10005514
1590 Ga0207702_10001465
1591 Ga0207641_10000468
1592 Ga0207641_10038901
1593 Ga0207641_10388206
1594 Ga0207641_10441744
1595 Ga0207648_10002454
1596 Ga0207648_10026444
1597 Ga0207648_10075360
1598 Ga0207676_10000335
1599 Ga0207676_10092500
1600 Ga0207676_10150702
1601 Ga0207674_10000639
1602 Ga0207674_10058822
1603 Ga0207674_10876963
1604 Ga0207675_100001363
1605 Ga0207683_10000048
1606 Ga0207683_10006535
1607 Ga0207683_10010853
1608 Ga0207698_10003731
1609 Ga0209973_1001466
1610 Ga0209179_1040275
1611 Ga0210002_1000574
1612 Ga0209971_1006961
1613 Ga0209998_10018758
1614 Ga0209813_10006297
1615 Ga0209974_10004320
1616 Ga0207428_10000247
1617 Ga0207428_10000784
1618 Ga0207428_10041877
1619 Ga0207428_10071073
1620 Ga0268266_10196925
1621 Ga0268266_10387008
1622 Ga0268265_10000871
1623 Ga0268265_10601816
1624 Ga0268264_10000735
1625 Ga0268264_10252765
1626 Ga0265337_1001061
1627 Ga0265338_10141636
1628 Ga0265325_10000377
1629 Ga0265325_10012333
1630 Ga0265325_10017402
1631 Ga0265340_10004931
1632 Ga0265339_10019520
1633 Ga0265339_10058544
1634 Ga0265331_10009591
1635 Ga0265313_10000218
1636 Ga0265313_10012813
1637 Ga0265313_10020380
1638 Ga0265313_10096144
1639 Ga0265314_10011277
1640 Ga0265342_10078456
1641 Ga0316583_10000148
1642 Ga0373930_0004895
1643 Ga0373948_0000531
1644 Ga0373958_0007270
1645 Ga0373938_0006041
1646 Ga0373926_0024846
1647 Ga0373926_0084708
1648 Ga0373928_0001239
1649 Ga0373929_0000881
1650 Ga0373929_0011968
1651 Ga0373929_0046096
1652 Ga0373934_0047206
1653 Ga0373940_0031448
1654 Ga0373940_0048592
1655 Ga0373944_0006259
1656 Ga0373944_0007932
1657 Ga0373951_0000290
1658 Ga0373951_0006502
1659 Ga0373952_0001526
1660 Ga0373923_0002516
1661 Ga0373923_0053206
1662 Ga0373923_0111068
1663 Ga0373932_0020873
1664 Ga0373936_0000283
1665 Ga0373939_0000192
1666 Ga0373939_0011140
1667 Ga0373939_0082668
1668 Ga0373941_0000031
1669 Ga0373945_0002393
1670 Ga0373945_0017828
1671 Ga0373953_0035231
1672 Ga0373953_0039278
1673 Ga0373954_0001724
1674 Ga0373954_0024572
1675 Ga0373954_0057463
1676 Ga0373954_0073600
1677 Ga0373954_0081541
1678 Ga0373956_0023961
1679 Ga0373956_0055170
1680 Ga0373957_0015827
1681 Ga0373957_0026468
1682 Ga0373960_0009485
1683 Ga0373943_0083106
1684 Ga0373943_0114982
1685 Ga0373946_0010660
1686 Ga0373946_0027647
1687 Ga0373946_0068616
1688 Ga0373946_0094255
1689 Ga0373955_0000334
1690 Ga0373955_0008925
1691 Ga0373955_0016443
1692 Ga0373955_0043198
1693 Ga0373955_0056389
1694 Ga0373955_0198442
1695 Ga0373942_0003290
1696 Ga0373942_0041448
1697 Ga0373961_0004317
1698 Ga0373961_0049418
1699 Ga0373961_0081138
1700 Ga0373962_0001119
1701 Ga0373962_0011124
1702 Ga0373962_0045860
1703 Ga0373924_0000358
1704 Ga0373924_0007042
1705 Ga0373924_0048746
1706 Ga0373931_0000273
1707 Ga0373931_0109441
1708 Ga0373931_0255119
1709 Ga0373935_0001324
1710 Ga0373935_0034408
1711 Ga0373935_0049223
1712 Ga0373935_0084728
1713 Ga0373935_0122232
1714 Ga0373935_0228993
1715 Ga0373935_0399979
1716 Ga0373927_0028494
1717 Ga0373927_0037555
1718 Ga0373927_0045830
1719 Ga0373927_0076935
1720 Ga0373927_0097250
1721 Ga0373927_0143427
1722 Ga0373927_0156703
1723 Ga0373933_0001162
1724 Ga0373933_0001830
1725 Ga0373933_0070295
1726 Ga0373933_0071647
1727 Ga0373933_0161907
1728 Ga0373933_0194364
1729 Ga0373947_0002784
1730 Ga0373947_0020264
1731 Ga0373947_0161214
1732 Ga0373947_0205553
1733 Ga0373937_0001118
1734 Ga0373937_0001692
1735 Ga0373937_0006485
1736 Ga0373937_0012619
1737 Ga0373937_0028187
1738 Ga0373937_0031982
1739 Ga0373937_0151600
1740 Ga0373937_0670866
1741 Ga0373925_0000084
1742 Ga0373925_0003690
1743 Ga0373925_0009586
1744 Ga0373925_0017236
1745 Ga0373925_0019319
1746 Ga0373925_0049034
1747 Ga0373925_0111409
1748 Ga0373925_0148098
1749 Ga0373925_0277419
1750 Ga0436365_1232763
1751 Ga0436365_1344708
1752 Ga0436365_1513096
1753 Ga0436365_1762134
1754 Ga0451793_0025165
1755 Ga0439448_0047682
1756 Ga0439455_0012427
1757 Ga0450916_015161
1758 Ga0466967_0117632
1759 Ga0495592_0000026
1760 Ga0495592_0016983
1761 Ga0495592_0058557
1762 Ga0495592_0081952
1763 Ga0495592_0120738
1764 Ga0495603_0014206
1765 Ga0495603_0018977
1766 Ga0495603_0131137
1767 Ga0495629_0000171
1768 Ga0495629_0024446
1769 Ga0495629_0039765
1770 Ga0495629_0214342
1771 Ga0495629_0230419
1772 Ga0495641_0003584
1773 Ga0495641_0046148
1774 Ga0495641_0114652
1775 Ga0495651_0000790
1776 Ga0495651_0008223
1777 Ga0495651_0025993
1778 Ga0495653_0000155
1779 Ga0495653_0058758
1780 Ga0495653_0084943
1781 Ga0495653_0086116
1782 Ga0495582_0002454
1783 Ga0495639_0040288
1784 Ga0495662_0015227
1785 Ga0495662_0092193
1786 Ga0495662_0145381
1787 Ga0495664_0000001
1788 Ga0495664_0086008
1789 Ga0495584_0128523
1790 Ga0495585_0000251
1791 Ga0495585_0013489
1792 Ga0495594_0022664
1793 Ga0495594_0218570
1794 Ga0495607_0001699
1795 Ga0495607_0109705
1796 Ga0495583_0082716
1797 Ga0495608_0000012
1798 Ga0495608_0002359
1799 Ga0495608_0083008
1800 Ga0495608_0096314
1801 Ga0495608_0186857
1802 Ga0495616_0037138
1803 Ga0495618_0000041
1804 Ga0495618_0052984
1805 Ga0495628_0000033
1806 Ga0495628_0059214
1807 Ga0495628_0064026
1808 Ga0495628_0212340
1809 Ga0495630_0009244
1810 Ga0495630_0039949
1811 Ga0495630_0095665
1812 Ga0495631_0011416
1813 Ga0495644_0002554
1814 Ga0495663_0054396
1815 Ga0495666_0003467
1816 Ga0495666_0024242
1817 Ga0495642_0136479
1818 Ga0495652_0000001
1819 Ga0495652_0001796
1820 Ga0495652_0031224
1821 Ga0495665_0017934
1822 Ga0495640_0000010
1823 Ga0495640_0016033
1824 Ga0495640_0188971
1825 Ga0495587_0000003
1826 Ga0495587_0049031
1827 Ga0495587_0062606
1828 Ga0495587_0125462
1829 Ga0495598_0001482
1830 Ga0495598_0003879
1831 Ga0495609_0017594
1832 Ga0495645_0000026
1833 Ga0495645_0003084
1834 Ga0495645_0016073
1835 Ga0495622_0071900
1836 Ga0495633_0006405
1837 Ga0495633_0077656
1838 Ga0495667_0000389
1839 Ga0495667_0001979
1840 Ga0495667_0011491
1841 Ga0495667_0020583
1842 Ga0495667_0103935
1843 Ga0495656_0000191
1844 Ga0495668_0130262
1845 Ga0495634_0000285
1846 Ga0495634_0078208
1847 Ga0495611_0069292
1848 Ga0495635_0000113
1849 Ga0495635_0013079
1850 Ga0495635_0064469
1851 Ga0495659_0002654
1852 Ga0495588_0008289
1853 Ga0495588_0060953
1854 Ga0495657_0000258
1855 Ga0495657_0053677
1856 Ga0495657_0373614
1857 Ga0495599_0000070
1858 Ga0495599_0005630
1859 Ga0495599_0014500
1860 Ga0495599_0019535
1861 Ga0495599_0159733
1862 Ga0495623_0000003
1863 Ga0495623_0022373
1864 Ga0495646_0000070
1865 Ga0495646_0001840
1866 Ga0495646_0138269
1867 Ga0495647_0002939
1868 Ga0495647_0055086
1869 Ga0495647_0161499
1870 Ga0495658_0000282
1871 Ga0495658_0007523
1872 Ga0495658_0086001
1873 Ga0495658_0216305
1874 Ga0495613_0022200
1875 Ga0495624_0011727
1876 Ga0495670_0000204
1877 Ga0495671_0015506
1878 Ga0495589_0047550
1879 Ga0495600_0000007
1880 Ga0495600_0048247
1881 Ga0495600_0059756
1882 Ga0495581_0255145
1883 Ga0495604_0000010
1884 Ga0495604_0015304
1885 Ga0495674_0000013
1886 Ga0495674_0022656
1887 Ga0495674_0128684
1888 Ga0495674_0141310
1889 Ga0495674_0212003
1890 Ga0495674_0268890
1891 Ga0495676_0059847
1892 Ga0495676_0078519
1893 Ga0495676_0103230
1894 Ga0495676_0114449
1895 Ga0495676_0125214
1896 Ga0495680_0000666
1897 Ga0495680_0004448
1898 Ga0495680_0013117
1899 Ga0495680_0148863
1900 Ga0495680_0325730
1901 Ga0495675_0000567
1902 Ga0495675_0014786
1903 Ga0495675_0017706
1904 Ga0495679_020017
1905 Ga0495684_0000008
1906 Ga0495684_0022473
1907 Ga0495684_0172019
1908 Ga0495684_0178542
1909 Ga0495684_0270973
1910 Ga0495684_0346552
1911 Ga0495593_0002332
1912 Ga0495593_0259212
1913 Ga0495602_0000264
1914 Ga0495602_0000568
1915 Ga0495602_0199342
1916 Ga0495602_0216016
1917 Ga0495602_0313377
1918 Ga0496100_0000255
1919 Ga0496100_0022447
1920 Ga0496100_0058396
1921 Ga0496101_0000317
1922 Ga0496101_0005168
1923 Ga0496101_0045030
1924 Ga0496101_0075080
1925 Ga0496102_0001113
1926 Ga0496102_0052571
1927 Ga0496102_0062761
1928 Ga0496102_0063229
1929 Ga0496102_0177348
1930 Ga0496103_0000528
1931 Ga0496103_0049495
1932 Ga0496103_0057083
1933 Ga0496103_0172895
1934 Ga0496104_0000082
1935 Ga0496104_0001732
1936 Ga0496104_0001798
1937 Ga0496104_0004876
1938 Ga0496104_0007168
1939 Ga0496104_0103866
1940 Ga0496104_0126757
1941 Ga0496104_0158263
1942 Ga0496104_0245894
1943 Ga0496105_0000563
1944 Ga0496105_0001322
1945 Ga0496105_0002542
1946 Ga0496105_0012374
1947 Ga0496105_0021540
1948 Ga0496105_0062196
1949 Ga0496105_0331320
1950 Ga0496106_0000165
1951 Ga0496106_0028529
1952 Ga0496106_0076376
1953 Ga0496106_0139632
1954 Ga0496106_0277109
1955 Ga0496106_0601510
1956 Ga0496107_0000201
1957 Ga0496107_0009106
1958 Ga0496108_0002292
1959 Ga0496108_0009174
1960 Ga0496108_0085375
1961 Ga0496108_0131813
1962 Ga0496108_0179475
1963 Ga0496108_0199665
1964 Ga0496109_0002809
1965 Ga0496109_0003316
1966 Ga0496109_0031863
1967 Ga0496109_0080575
1968 Ga0496109_0276991
1969 Ga0496109_0811529
1970 Ga0496110_0014166
1971 Ga0496110_0105889
1972 Ga0496110_0135796
1973 Ga0496111_0025450
1974 Ga0496111_0030271
1975 Ga0496111_0126095
1976 Ga0496112_0006605
1977 Ga0496112_0009460
1978 Ga0496112_0624308
1979 Ga0496113_0004968
1980 Ga0496113_0034635
1981 Ga0496113_0045130
1982 Ga0496113_0058019
1983 Ga0496113_0063744
1984 Ga0496113_0133067
1985 Ga0496113_0276091
1986 Ga0496114_0000928
1987 Ga0496114_0009782
1988 Ga0496114_0080883
1989 Ga0496115_0000667
1990 Ga0496115_0010445
1991 Ga0496115_0025523
1992 Ga0496115_0029013
1993 Ga0496115_0134465
1994 Ga0496115_0321672
1995 Ga0496115_0459270
1996 Ga0496126_0089821
1997 Ga0501031_0010487
1998 Ga0501032_0000001
1999 Ga0501032_0064310
2000 Ga0501032_0126310
2001 Ga0501033_0000515
2002 Ga0501033_0007008
2003 Ga0501034_0000023
2004 Ga0501034_0245997
2005 Ga0501034_0366818
2006 Ga0501036_0032817
2007 Ga0501036_0076480
2008 Ga0501037_0000065
2009 Ga0501038_0002005
2010 Ga0501038_0014065
2011 Ga0501038_0058445
2012 Ga0501038_0116498
2013 Ga0501038_0458148
2014 Ga0501039_0000022
2015 Ga0501039_0057042
2016 Ga0501039_0283953
2017 Ga0501039_0370654
2018 Ga0501041_0159212
2019 Ga0501041_0302229
2020 Ga0501042_0138742
2021 Ga0501043_0000093
2022 Ga0501046_0006925
2023 Ga0501047_0197541
2024 Ga0501047_0287845
2025 Ga0501048_0002288
2026 Ga0501048_0199264
2027 Ga0501067_0014486
2028 Ga0501068_0007260
2029 Ga0501069_0013029
2030 Ga0501070_0075537
2031 Ga0501070_0128149
2032 Ga0501071_0287920
2033 Ga0501071_0337213
2034 Ga0501073_0076635
2035 Ga0501073_0161707
2036 Ga0501074_0003219
2037 Ga0501075_0079327
2038 Ga0501075_0488893
2039 Ga0501076_0033914
2040 Ga0501076_0318996
2041 Ga0501077_0003399
2042 Ga0501077_0046578
2043 Ga0501077_0180378
2044 Ga0501079_0029518
2045 Ga0501079_0551114
2046 Ga0501081_0135163
2047 Ga0501035_0000336
2048 Ga0501044_0001021
2049 Ga0501044_0200543
2050 Ga0501044_0253795
2051 Ga0501044_0396408
2052 Ga0501045_0013355
2053 nmdc:mga03683_52066_c1
2054 nmdc:mga00v17_30922_c1
2055 nmdc:mga0yw44_55006_c1
2056 nmdc:mga0yw44_918_c1
2057 nmdc:mga0k408_108352_c1
2058 nmdc:mga0k408_4295_c1
2059 nmdc:mga0k408_68849_c1
2060 nmdc:mga06z11_16410_c1
2061 nmdc:mga06z11_22339_c1
2062 nmdc:mga06z11_8019_c1
2063 nmdc:mga04h51_8228_c1
2064 nmdc:mga07m45_18954_c1
2065 nmdc:mga07m45_60813_c1
2066 nmdc:mga05p37_162898_c1
2067 nmdc:mga05p37_191383_c1
2068 nmdc:mga05p37_26421_c1
2069 nmdc:mga05p37_47186_c1
2070 nmdc:mga05p37_64007_c1
2071 nmdc:mga05p37_660009_c1
2072 nmdc:mga05p37_69_c2
2073 nmdc:mga05p37_83478_c1
2074 nmdc:mga09592_1744_c1
2075 nmdc:mga09592_67827_c1
2076 nmdc:mga09592_95436_c1
2077 nmdc:mga0qj67_1033_c1
2078 nmdc:mga0qj67_323519_c1
2079 nmdc:mga0qj67_37_c1
2080 nmdc:mga0qj67_3998_c1
2081 nmdc:mga0qj67_67208_c1
2082 nmdc:mga06r32_235285_c1
2083 nmdc:mga06r32_544884_c1
2084 nmdc:mga06r32_6015_c1
2085 nmdc:mga08y16_190481_c1
2086 nmdc:mga08y16_25098_c1
2087 nmdc:mga08y16_27814_c1
2088 nmdc:mga08y16_80954_c1
2089 nmdc:mga08y16_891_c1
2090 nmdc:mga08y16_948514_c1
2091 nmdc:mga0n895_113390_c1
2092 nmdc:mga0n895_135077_c1
2093 nmdc:mga0n895_289541_c1
2094 nmdc:mga0n895_29192_c1
2095 nmdc:mga0n895_44_c1
2096 nmdc:mga0n895_769_c1
2097 nmdc:mga0n895_98430_c1
2098 nmdc:mga0rr50_124159_c1
2099 nmdc:mga0rr50_273231_c1
2100 nmdc:mga0rr50_297295_c1
2101 nmdc:mga0rr50_37935_c1
2102 nmdc:mga0rr50_47953_c1
2103 nmdc:mga0rr50_621046_c1
2104 nmdc:mga08x19_11978_c1
2105 nmdc:mga08x19_123526_c1
2106 nmdc:mga08x19_296160_c1
2107 nmdc:mga08x19_40712_c1
2108 nmdc:mga08x19_96802_c1
2109 nmdc:mga0a205_120508_c1
2110 nmdc:mga0a205_247_c1
2111 nmdc:mga0a205_37931_c1
2112 nmdc:mga0a205_4580_c1
2113 nmdc:mga0sz30_15572_c2
2114 Ga0495601_0000003
2115 Ga0495601_0000151
2116 Ga0495601_0000398
2117 Ga0495601_0006487
2118 Ga0495601_0008245
2119 Ga0495601_0018815
2120 Ga0495601_0068660
2121 Ga0495612_0000009
2122 Ga0495612_0001511
2123 Ga0495655_0018187
2124 Ga0495655_0073699
2125 Ga0495595_0000075
2126 Ga0495595_0000226
2127 Ga0495595_0018508
2128 Ga0495595_0030840
2129 Ga0495619_0000039
2130 Ga0495619_0000086
2131 Ga0495619_0000379
2132 Ga0495619_0001781
2133 Ga0500562_005751
2134 Ga0500595_041249
2135 Ga0500658_0085423
2136 Ga0500645_000099
2137 Ga0501084_0019616
2138 Ga0501084_0033970
2139 Ga0501084_0056755
2140 Ga0501082_0022891
2141 Ga0530510_0062042
2142 Ga0530510_0109978

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

80

258

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ocr-assembly1.cif.gz_A crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9266 12 254
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9189 8 254
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9117 8 254
3ocr-assembly1.cif.gz_A crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.8946 12 254
8iai-assembly1.cif.gz_2 structure of mammalian spectrin-actin junctional complex of membrane skeleton, state ii, global map 0.8823 14 252
ID Description Score Start End Superfamily
af_Q54T47_16_268_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9246 10 254 3.40.225.10
af_Q7LKY2_67_324_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9192 13 254 3.40.225.10
3ocrB00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9148 8 254 3.40.225.10
3ocrB00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9113 8 254 3.40.225.10
af_Q20952_347_604_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9068 13 248 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A6L5FH07-F1-model_v4 Aldolase 0.9948 15 254 GO:0005856
GO:0051015
AF-A0A6L5FH07-F1-model_v4 Aldolase 0.9906 15 254 GO:0005856
GO:0051015
AF-A0A855HTP1-F1-model_v4 deleted 0.9779 90 203
AF-A0A3D0KA91-F1-model_v4 deleted 0.9746 89 205
AF-A0A7Z9K9C0-F1-model_v4 Aldolase 0.9724 44 254 GO:0005856
GO:0051015

Map