F489495
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1071 | 429 | 2142 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0317066|Ga0501035_0317066_75_1007 |
| Length | 310 |
| Sequence | MSFRFLKAFHVLKPALAKAAQHNDTRGESQSGEPGAMLSYDGATANEETRAMNKPTSSAEVATAGKVPAGMSPEEWQARIDLAAVYRLVAHYGWDDVIYNHASMRVPGEPRMFLMKRHELLYTEVTASNLAKVSMDADLDEKSGVNRPGFTLHGGVLAARPDVNCALHMHTEIGMAFSALKHGLRMLSQPAVRFYNRIGYHPYEGLTEDFGERERIARNLGNGKALVMRNHGLLTVGRTARDAFVLMEHLAEAADIQMRLEATGAELVEIPPEVCEKTAAQFEAHDRGRGQADWPAYLRILDGIDPGFRN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 122 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 242 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 243 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 248 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 249 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 250 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 252 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 256 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 271 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 278 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 282 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 287 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 288 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 289 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 290 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 359 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 362 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 363 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 364 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 368 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 369 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 405 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 406 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 407 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 424 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.01 |
| Nodule | 0 |
| Rhizoplane | 7.38 |
| Rhizosphere | 87.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501035_0317066 | 3300049822 | Bacteria | 1311 |
| 2 | JGI24741J21665_1008381 | 3300001915 | Unclassified | 1951 |
| 3 | JGI24752J21851_1003823 | 3300001976 | Bacteria | 1984 |
| 4 | JGI24746J21847_1000120 | 3300001977 | Bacteria | 9362 |
| 5 | JGI24740J21852_10067766 | 3300001979 | Unclassified | 965 |
| 6 | JGI24739J22299_10000176 | 3300001989 | Bacteria | 21293 |
| 7 | JGI24737J22298_10000190 | 3300001990 | Bacteria | 19907 |
| 8 | JGI24743J22301_10028038 | 3300001991 | Unclassified | 1101 |
| 9 | JGI24750J21931_1000450 | 3300002070 | Bacteria | 6586 |
| 10 | JGI24748J21848_1000227 | 3300002074 | Bacteria | 6844 |
| 11 | JGI24738J21930_10000193 | 3300002075 | Bacteria | 16010 |
| 12 | JGI24749J21850_1000755 | 3300002076 | Bacteria | 4674 |
| 13 | JGI24744J21845_10001617 | 3300002077 | Bacteria | 4501 |
| 14 | JGI24744J21845_10017010 | 3300002077 | Bacteria | 1445 |
| 15 | JGI24035J26624_1000163 | 3300002126 | Bacteria | 6058 |
| 16 | JGI24034J26672_10002430 | 3300002239 | Bacteria | 2559 |
| 17 | JGI24742J22300_10004712 | 3300002244 | Bacteria | 2237 |
| 18 | JGI24751J29686_10002684 | 3300002459 | Bacteria | 3582 |
| 19 | JGI24751J29686_10025703 | 3300002459 | Unclassified | 1222 |
| 20 | JGI25405J52794_10049024 | 3300003911 | Bacteria | 903 |
| 21 | Ga0065704_10167307 | 3300005289 | Bacteria | 1314 |
| 22 | Ga0065712_10000779 | 3300005290 | Bacteria | 10304 |
| 23 | Ga0065712_10102865 | 3300005290 | Bacteria | 1944 |
| 24 | Ga0065715_10089014 | 3300005293 | Bacteria | 17041 |
| 25 | Ga0070676_10004465 | 3300005328 | Bacteria | 7363 |
| 26 | Ga0070676_10044243 | 3300005328 | Bacteria | 2591 |
| 27 | Ga0070683_100000173 | 3300005329 | Bacteria | 42675 |
| 28 | Ga0070683_100039525 | 3300005329 | Bacteria | 4331 |
| 29 | Ga0070683_100051833 | 3300005329 | Bacteria | 3800 |
| 30 | Ga0070690_100001979 | 3300005330 | Bacteria | 10917 |
| 31 | Ga0070670_100010494 | 3300005331 | Bacteria | 7907 |
| 32 | Ga0070677_10000054 | 3300005333 | Bacteria | 35290 |
| 33 | Ga0068869_100000316 | 3300005334 | Bacteria | 25656 |
| 34 | Ga0068869_100163636 | 3300005334 | Bacteria | 1733 |
| 35 | Ga0070666_10012204 | 3300005335 | Bacteria | 5414 |
| 36 | Ga0070666_10303714 | 3300005335 | Bacteria | 1137 |
| 37 | Ga0070680_100006219 | 3300005336 | Bacteria | 9058 |
| 38 | Ga0070680_100221265 | 3300005336 | Bacteria | 1598 |
| 39 | Ga0070680_100542331 | 3300005336 | Bacteria | 997 |
| 40 | Ga0070682_100001435 | 3300005337 | Bacteria | 13410 |
| 41 | Ga0070682_100127927 | 3300005337 | Unclassified | 1715 |
| 42 | Ga0068868_100000176 | 3300005338 | Bacteria | 42456 |
| 43 | Ga0068868_100213697 | 3300005338 | Bacteria | 1613 |
| 44 | Ga0068868_100316046 | 3300005338 | Bacteria | 1329 |
| 45 | Ga0070660_100000595 | 3300005339 | Bacteria | 24271 |
| 46 | Ga0070660_100143899 | 3300005339 | Bacteria | 1914 |
| 47 | Ga0070689_100000116 | 3300005340 | Bacteria | 45723 |
| 48 | Ga0070689_100396606 | 3300005340 | Unclassified | 1166 |
| 49 | Ga0070689_100575718 | 3300005340 | Bacteria | 973 |
| 50 | Ga0070691_10003422 | 3300005341 | Bacteria | 7132 |
| 51 | Ga0070691_10206891 | 3300005341 | Unclassified | 1034 |
| 52 | Ga0070687_100000232 | 3300005343 | Bacteria | 19153 |
| 53 | Ga0070687_100030450 | 3300005343 | Bacteria | 2638 |
| 54 | Ga0070687_100096957 | 3300005343 | Bacteria | 1643 |
| 55 | Ga0070661_100000680 | 3300005344 | Bacteria | 24930 |
| 56 | Ga0070661_100029004 | 3300005344 | Bacteria | 3993 |
| 57 | Ga0070661_100080428 | 3300005344 | Bacteria | 2405 |
| 58 | Ga0070692_10000138 | 3300005345 | Bacteria | 17517 |
| 59 | Ga0070692_10267264 | 3300005345 | Unclassified | 1031 |
| 60 | Ga0070668_100001184 | 3300005347 | Bacteria | 18480 |
| 61 | Ga0070668_100328130 | 3300005347 | Bacteria | 1290 |
| 62 | Ga0070669_100002530 | 3300005353 | Bacteria | 13217 |
| 63 | Ga0070675_100000398 | 3300005354 | Bacteria | 29530 |
| 64 | Ga0070675_100535772 | 3300005354 | Bacteria | 1058 |
| 65 | Ga0070671_100000708 | 3300005355 | Bacteria | 23978 |
| 66 | Ga0070671_100023382 | 3300005355 | Bacteria | 5058 |
| 67 | Ga0070674_100000672 | 3300005356 | Bacteria | 17283 |
| 68 | Ga0070674_100052962 | 3300005356 | Unclassified | 2800 |
| 69 | Ga0070674_100111998 | 3300005356 | Bacteria | 2005 |
| 70 | Ga0070673_100000199 | 3300005364 | Bacteria | 29530 |
| 71 | Ga0070673_100024556 | 3300005364 | Bacteria | 4422 |
| 72 | Ga0070673_100049799 | 3300005364 | Bacteria | 3272 |
| 73 | Ga0070673_100257620 | 3300005364 | Bacteria | 1523 |
| 74 | Ga0070688_100002526 | 3300005365 | Bacteria | 9259 |
| 75 | Ga0070688_100016957 | 3300005365 | Bacteria | 4173 |
| 76 | Ga0070659_100000476 | 3300005366 | Bacteria | 29530 |
| 77 | Ga0070667_100003351 | 3300005367 | Bacteria | 13683 |
| 78 | Ga0070667_100161020 | 3300005367 | Bacteria | 1976 |
| 79 | Ga0070667_100236316 | 3300005367 | Bacteria | 1631 |
| 80 | Ga0070703_10016756 | 3300005406 | Bacteria | 2106 |
| 81 | Ga0070709_10008770 | 3300005434 | Bacteria | 5564 |
| 82 | Ga0070709_10209216 | 3300005434 | Unclassified | 1386 |
| 83 | Ga0070709_10253003 | 3300005434 | Bacteria | 1270 |
| 84 | Ga0070714_100089689 | 3300005435 | Bacteria | 2692 |
| 85 | Ga0070714_100118740 | 3300005435 | Bacteria | 2350 |
| 86 | Ga0070714_100235083 | 3300005435 | Bacteria | 1689 |
| 87 | Ga0070713_100000368 | 3300005436 | Bacteria | 29007 |
| 88 | Ga0070713_100088482 | 3300005436 | Bacteria | 2658 |
| 89 | Ga0070713_100487046 | 3300005436 | Unclassified | 1162 |
| 90 | Ga0070710_10033625 | 3300005437 | Bacteria | 2785 |
| 91 | Ga0070710_10042930 | 3300005437 | Bacteria | 2502 |
| 92 | Ga0070710_10144142 | 3300005437 | Unclassified | 1463 |
| 93 | Ga0070710_10262588 | 3300005437 | Bacteria | 1114 |
| 94 | Ga0070701_10000211 | 3300005438 | Bacteria | 18307 |
| 95 | Ga0070701_10032677 | 3300005438 | Bacteria | 2594 |
| 96 | Ga0070701_10214452 | 3300005438 | Unclassified | 1145 |
| 97 | Ga0070711_100034978 | 3300005439 | Bacteria | 3355 |
| 98 | Ga0070711_100036661 | 3300005439 | Bacteria | 3286 |
| 99 | Ga0070711_100322066 | 3300005439 | Bacteria | 1235 |
| 100 | Ga0070705_100000446 | 3300005440 | Bacteria | 23733 |
| 101 | Ga0070700_100000490 | 3300005441 | Bacteria | 19856 |
| 102 | Ga0070700_100227883 | 3300005441 | Bacteria | 1324 |
| 103 | Ga0070694_100001164 | 3300005444 | Bacteria | 15144 |
| 104 | Ga0070708_100049088 | 3300005445 | Bacteria | 3733 |
| 105 | Ga0070708_100406314 | 3300005445 | Unclassified | 1284 |
| 106 | Ga0070663_100000546 | 3300005455 | Bacteria | 19979 |
| 107 | Ga0070663_100101191 | 3300005455 | Bacteria | 2150 |
| 108 | Ga0070678_100000142 | 3300005456 | Bacteria | 29530 |
| 109 | Ga0070678_100017253 | 3300005456 | Bacteria | 4643 |
| 110 | Ga0070662_100012272 | 3300005457 | Bacteria | 5675 |
| 111 | Ga0070662_100055926 | 3300005457 | Unclassified | 2864 |
| 112 | Ga0070681_10000980 | 3300005458 | Bacteria | 24149 |
| 113 | Ga0070681_10021188 | 3300005458 | Bacteria | 6513 |
| 114 | Ga0070681_10040733 | 3300005458 | Bacteria | 4653 |
| 115 | Ga0070681_10356822 | 3300005458 | Unclassified | 1372 |
| 116 | Ga0070681_10703697 | 3300005458 | Bacteria | 926 |
| 117 | Ga0068867_100001587 | 3300005459 | Bacteria | 15804 |
| 118 | Ga0068867_100043695 | 3300005459 | Bacteria | 3281 |
| 119 | Ga0070685_10000603 | 3300005466 | Bacteria | 19845 |
| 120 | Ga0070685_10279786 | 3300005466 | Bacteria | 1116 |
| 121 | Ga0070698_100031369 | 3300005471 | Bacteria | 5511 |
| 122 | Ga0070679_100002691 | 3300005530 | Bacteria | 16188 |
| 123 | Ga0070679_100016776 | 3300005530 | Bacteria | 7078 |
| 124 | Ga0070679_100031424 | 3300005530 | Bacteria | 5245 |
| 125 | Ga0070679_100035045 | 3300005530 | Bacteria | 4977 |
| 126 | Ga0070679_100129911 | 3300005530 | Bacteria | 2500 |
| 127 | Ga0070679_100278968 | 3300005530 | Bacteria | 1624 |
| 128 | Ga0070679_100353108 | 3300005530 | Bacteria | 1418 |
| 129 | Ga0070679_100525541 | 3300005530 | Bacteria | 1127 |
| 130 | Ga0070684_100000146 | 3300005535 | Bacteria | 47523 |
| 131 | Ga0070684_100346793 | 3300005535 | Unclassified | 1365 |
| 132 | Ga0068853_100002495 | 3300005539 | Bacteria | 13797 |
| 133 | Ga0070672_100000063 | 3300005543 | Bacteria | 49365 |
| 134 | Ga0070672_100049971 | 3300005543 | Bacteria | 3256 |
| 135 | Ga0070672_100053875 | 3300005543 | Bacteria | 3147 |
| 136 | Ga0070686_100000695 | 3300005544 | Bacteria | 19514 |
| 137 | Ga0070695_100000044 | 3300005545 | Bacteria | 47690 |
| 138 | Ga0070695_100100933 | 3300005545 | Bacteria | 1943 |
| 139 | Ga0070696_100004713 | 3300005546 | Bacteria | 9117 |
| 140 | Ga0070693_100000297 | 3300005547 | Bacteria | 23138 |
| 141 | Ga0070693_100004176 | 3300005547 | Bacteria | 6816 |
| 142 | Ga0070665_100257174 | 3300005548 | Unclassified | 1747 |
| 143 | Ga0070704_100000520 | 3300005549 | Bacteria | 18363 |
| 144 | Ga0070704_100318710 | 3300005549 | Unclassified | 1302 |
| 145 | Ga0070704_100449010 | 3300005549 | Unclassified | 1110 |
| 146 | Ga0068855_100057301 | 3300005563 | Bacteria | 4568 |
| 147 | Ga0068855_100232463 | 3300005563 | Bacteria | 2063 |
| 148 | Ga0070664_100000287 | 3300005564 | Bacteria | 36455 |
| 149 | Ga0068857_100000332 | 3300005577 | Bacteria | 32588 |
| 150 | Ga0068857_100563504 | 3300005577 | Unclassified | 1074 |
| 151 | Ga0068854_100000493 | 3300005578 | Bacteria | 24047 |
| 152 | Ga0068854_100223760 | 3300005578 | Bacteria | 1490 |
| 153 | Ga0068856_100001778 | 3300005614 | Bacteria | 22526 |
| 154 | Ga0068856_100139637 | 3300005614 | Bacteria | 2430 |
| 155 | Ga0070702_100000060 | 3300005615 | Bacteria | 31414 |
| 156 | Ga0070702_100073847 | 3300005615 | Bacteria | 2022 |
| 157 | Ga0070702_100075108 | 3300005615 | Bacteria | 2007 |
| 158 | Ga0068852_100002718 | 3300005616 | Bacteria | 12224 |
| 159 | Ga0068859_100002562 | 3300005617 | Bacteria | 18452 |
| 160 | Ga0068859_100080058 | 3300005617 | Unclassified | 3307 |
| 161 | Ga0068859_100106590 | 3300005617 | Bacteria | 2862 |
| 162 | Ga0068864_100000316 | 3300005618 | Bacteria | 42705 |
| 163 | Ga0068864_100012805 | 3300005618 | Bacteria | 6934 |
| 164 | Ga0068864_100024748 | 3300005618 | Bacteria | 5051 |
| 165 | Ga0068864_100262336 | 3300005618 | Bacteria | 1607 |
| 166 | Ga0068864_100484362 | 3300005618 | Unclassified | 1188 |
| 167 | Ga0068866_10000272 | 3300005718 | Bacteria | 24607 |
| 168 | Ga0068866_10053048 | 3300005718 | Bacteria | 2071 |
| 169 | Ga0068866_10064399 | 3300005718 | Bacteria | 1914 |
| 170 | Ga0068861_100005790 | 3300005719 | Bacteria | 8387 |
| 171 | Ga0068861_100187979 | 3300005719 | Unclassified | 1724 |
| 172 | Ga0068851_10116115 | 3300005834 | Bacteria | 1434 |
| 173 | Ga0068870_10000420 | 3300005840 | Bacteria | 15979 |
| 174 | Ga0068870_10053014 | 3300005840 | Bacteria | 2153 |
| 175 | Ga0068863_100000334 | 3300005841 | Bacteria | 47864 |
| 176 | Ga0068863_100169061 | 3300005841 | Bacteria | 2096 |
| 177 | Ga0068863_100590377 | 3300005841 | Unclassified | 1099 |
| 178 | Ga0068858_100003943 | 3300005842 | Bacteria | 14653 |
| 179 | Ga0068860_100000816 | 3300005843 | Bacteria | 34864 |
| 180 | Ga0068860_100036965 | 3300005843 | Bacteria | 4675 |
| 181 | Ga0068860_100323262 | 3300005843 | Bacteria | 1514 |
| 182 | Ga0068862_100000672 | 3300005844 | Bacteria | 34973 |
| 183 | Ga0068862_100096724 | 3300005844 | Bacteria | 2577 |
| 184 | Ga0081455_10001860 | 3300005937 | Bacteria | 25395 |
| 185 | Ga0081455_10010994 | 3300005937 | Bacteria | 9123 |
| 186 | Ga0081455_10066862 | 3300005937 | Bacteria | 2998 |
| 187 | Ga0081455_10106038 | 3300005937 | Bacteria | 2244 |
| 188 | Ga0081538_10005426 | 3300005981 | Bacteria | 11450 |
| 189 | Ga0081538_10023338 | 3300005981 | Bacteria | 4450 |
| 190 | Ga0081538_10044624 | 3300005981 | Bacteria | 2762 |
| 191 | Ga0081540_1074143 | 3300005983 | Bacteria | 1560 |
| 192 | Ga0070717_10005996 | 3300006028 | Bacteria | 8902 |
| 193 | Ga0070717_10056864 | 3300006028 | Bacteria | 3233 |
| 194 | Ga0070717_10121589 | 3300006028 | Bacteria | 2237 |
| 195 | Ga0075365_10011942 | 3300006038 | Bacteria | 5131 |
| 196 | Ga0075365_10038703 | 3300006038 | Bacteria | 3102 |
| 197 | Ga0075365_10085494 | 3300006038 | Bacteria | 2142 |
| 198 | Ga0075365_10130574 | 3300006038 | Bacteria | 1738 |
| 199 | Ga0075368_10027421 | 3300006042 | Unclassified | 2198 |
| 200 | Ga0075368_10108112 | 3300006042 | Bacteria | 1145 |
| 201 | Ga0075363_100051278 | 3300006048 | Bacteria | 2200 |
| 202 | Ga0075363_100112741 | 3300006048 | Bacteria | 1513 |
| 203 | Ga0075364_10032091 | 3300006051 | Bacteria | 3374 |
| 204 | Ga0075364_10282458 | 3300006051 | Bacteria | 1129 |
| 205 | Ga0075432_10002355 | 3300006058 | Bacteria | 6299 |
| 206 | Ga0070715_10007706 | 3300006163 | Bacteria | 3719 |
| 207 | Ga0070715_10057951 | 3300006163 | Unclassified | 1689 |
| 208 | Ga0070715_10173963 | 3300006163 | Unclassified | 1075 |
| 209 | Ga0070716_100031571 | 3300006173 | Bacteria | 2882 |
| 210 | Ga0070716_100068505 | 3300006173 | Unclassified | 2076 |
| 211 | Ga0070716_100124361 | 3300006173 | Bacteria | 1620 |
| 212 | Ga0070712_100019966 | 3300006175 | Bacteria | 4381 |
| 213 | Ga0070712_100062755 | 3300006175 | Bacteria | 2628 |
| 214 | Ga0070712_100141436 | 3300006175 | Bacteria | 1837 |
| 215 | Ga0070712_100223176 | 3300006175 | Unclassified | 1493 |
| 216 | Ga0070712_100271171 | 3300006175 | Unclassified | 1363 |
| 217 | Ga0075362_10040601 | 3300006177 | Bacteria | 2049 |
| 218 | Ga0075367_10006771 | 3300006178 | Bacteria | 5819 |
| 219 | Ga0075367_10028695 | 3300006178 | Bacteria | 3176 |
| 220 | Ga0075369_10012309 | 3300006186 | Bacteria | 3380 |
| 221 | Ga0075366_10052396 | 3300006195 | Bacteria | 2424 |
| 222 | Ga0075366_10086855 | 3300006195 | Bacteria | 1871 |
| 223 | Ga0097621_100000019 | 3300006237 | Bacteria | 88022 |
| 224 | Ga0097621_100019564 | 3300006237 | Bacteria | 5199 |
| 225 | Ga0097621_100236910 | 3300006237 | Bacteria | 1594 |
| 226 | Ga0075370_10045017 | 3300006353 | Bacteria | 2495 |
| 227 | Ga0075370_10045594 | 3300006353 | Unclassified | 2480 |
| 228 | Ga0075370_10064509 | 3300006353 | Bacteria | 2089 |
| 229 | Ga0075370_10078861 | 3300006353 | Bacteria | 1891 |
| 230 | Ga0075370_10142477 | 3300006353 | Unclassified | 1401 |
| 231 | Ga0075370_10320235 | 3300006353 | Bacteria | 924 |
| 232 | Ga0068871_100000293 | 3300006358 | Bacteria | 34898 |
| 233 | Ga0068871_100013376 | 3300006358 | Bacteria | 6089 |
| 234 | Ga0068871_100054862 | 3300006358 | Bacteria | 3234 |
| 235 | Ga0075428_100051979 | 3300006844 | Bacteria | 4493 |
| 236 | Ga0075428_100106765 | 3300006844 | Plasmid | 3052 |
| 237 | Ga0075428_100124897 | 3300006844 | Unclassified | 2801 |
| 238 | Ga0075428_100274931 | 3300006844 | Bacteria | 1812 |
| 239 | Ga0075428_100387815 | 3300006844 | Bacteria | 1497 |
| 240 | Ga0075430_100000293 | 3300006846 | Bacteria | 35315 |
| 241 | Ga0075430_100000327 | 3300006846 | Bacteria | 34023 |
| 242 | Ga0075430_100082249 | 3300006846 | Bacteria | 2698 |
| 243 | Ga0075430_100355873 | 3300006846 | Bacteria | 1209 |
| 244 | Ga0075431_100005554 | 3300006847 | Bacteria | 12447 |
| 245 | Ga0075431_100015952 | 3300006847 | Bacteria | 7622 |
| 246 | Ga0075431_100114318 | 3300006847 | Bacteria | 2786 |
| 247 | Ga0075431_100213988 | 3300006847 | Unclassified | 1968 |
| 248 | Ga0075431_100752788 | 3300006847 | Bacteria | 950 |
| 249 | Ga0075433_10012481 | 3300006852 | Bacteria | 6867 |
| 250 | Ga0075433_10014765 | 3300006852 | Bacteria | 6393 |
| 251 | Ga0075433_10405521 | 3300006852 | Bacteria | 1203 |
| 252 | Ga0075434_100000042 | 3300006871 | Bacteria | 59376 |
| 253 | Ga0075434_100008550 | 3300006871 | Bacteria | 9520 |
| 254 | Ga0075434_100013525 | 3300006871 | Bacteria | 7771 |
| 255 | Ga0075434_100045938 | 3300006871 | Unclassified | 4334 |
| 256 | Ga0075434_100124982 | 3300006871 | Bacteria | 2590 |
| 257 | Ga0075429_100025101 | 3300006880 | Bacteria | 5174 |
| 258 | Ga0075429_100063005 | 3300006880 | Bacteria | 3231 |
| 259 | Ga0075429_100187529 | 3300006880 | Bacteria | 1812 |
| 260 | Ga0068865_100000183 | 3300006881 | Bacteria | 34856 |
| 261 | Ga0068865_100003957 | 3300006881 | Bacteria | 8888 |
| 262 | Ga0075436_100031580 | 3300006914 | Bacteria | 3647 |
| 263 | Ga0075436_100035442 | 3300006914 | Bacteria | 3443 |
| 264 | Ga0097620_100002562 | 3300006931 | Bacteria | 18452 |
| 265 | Ga0097620_100080058 | 3300006931 | Unclassified | 3307 |
| 266 | Ga0097620_100106592 | 3300006931 | Bacteria | 2862 |
| 267 | Ga0075435_100139260 | 3300007076 | Unclassified | 2035 |
| 268 | Ga0075435_100139484 | 3300007076 | Bacteria | 2033 |
| 269 | Ga0075435_100177948 | 3300007076 | Bacteria | 1797 |
| 270 | Ga0075435_100295818 | 3300007076 | Bacteria | 1384 |
| 271 | Ga0075435_100653054 | 3300007076 | Unclassified | 913 |
| 272 | Ga0099795_10000484 | 3300007788 | Bacteria | 7428 |
| 273 | Ga0105251_10096278 | 3300009011 | Bacteria | 1356 |
| 274 | Ga0105244_10015753 | 3300009036 | Bacteria | 4328 |
| 275 | Ga0105250_10008874 | 3300009092 | Bacteria | 4253 |
| 276 | Ga0105240_10015725 | 3300009093 | Bacteria | 10269 |
| 277 | Ga0105240_10306754 | 3300009093 | Bacteria | 1814 |
| 278 | Ga0111539_10001254 | 3300009094 | Bacteria | 33808 |
| 279 | Ga0111539_10002524 | 3300009094 | Bacteria | 24257 |
| 280 | Ga0111539_10035317 | 3300009094 | Bacteria | 6053 |
| 281 | Ga0111539_10042413 | 3300009094 | Bacteria | 5464 |
| 282 | Ga0111539_10200789 | 3300009094 | Bacteria | 2325 |
| 283 | Ga0105245_10000142 | 3300009098 | Bacteria | 68105 |
| 284 | Ga0105245_10044321 | 3300009098 | Bacteria | 3970 |
| 285 | Ga0105245_10205717 | 3300009098 | Bacteria | 1892 |
| 286 | Ga0105245_10294830 | 3300009098 | Unclassified | 1590 |
| 287 | Ga0105245_10488443 | 3300009098 | Unclassified | 1246 |
| 288 | Ga0105245_10808618 | 3300009098 | Unclassified | 976 |
| 289 | Ga0105247_10008521 | 3300009101 | Bacteria | 6244 |
| 290 | Ga0105247_10065809 | 3300009101 | Bacteria | 2255 |
| 291 | Ga0105247_10078830 | 3300009101 | Bacteria | 2072 |
| 292 | Ga0105247_10173983 | 3300009101 | Unclassified | 1433 |
| 293 | Ga0114129_10017130 | 3300009147 | Bacteria | 10319 |
| 294 | Ga0114129_10024961 | 3300009147 | Bacteria | 8474 |
| 295 | Ga0114129_10072678 | 3300009147 | Bacteria | 4795 |
| 296 | Ga0114129_10120613 | 3300009147 | Bacteria | 3610 |
| 297 | Ga0114129_10212088 | 3300009147 | Bacteria | 2617 |
| 298 | Ga0114129_10666835 | 3300009147 | Bacteria | 1341 |
| 299 | Ga0114129_10999293 | 3300009147 | Bacteria | 1054 |
| 300 | Ga0105243_10000376 | 3300009148 | Bacteria | 47951 |
| 301 | Ga0105243_10011332 | 3300009148 | Bacteria | 6746 |
| 302 | Ga0105243_10157139 | 3300009148 | Bacteria | 1956 |
| 303 | Ga0105243_10675892 | 3300009148 | Bacteria | 1003 |
| 304 | Ga0105241_10001391 | 3300009174 | Bacteria | 18495 |
| 305 | Ga0105241_10169691 | 3300009174 | Unclassified | 1801 |
| 306 | Ga0105241_10207278 | 3300009174 | Bacteria | 1641 |
| 307 | Ga0105242_10000380 | 3300009176 | Bacteria | 35290 |
| 308 | Ga0105242_10049109 | 3300009176 | Bacteria | 3432 |
| 309 | Ga0105242_10093079 | 3300009176 | Bacteria | 2540 |
| 310 | Ga0105242_10108558 | 3300009176 | Bacteria | 2362 |
| 311 | Ga0105248_10000549 | 3300009177 | Bacteria | 42722 |
| 312 | Ga0105248_10103414 | 3300009177 | Bacteria | 3211 |
| 313 | Ga0105248_10253098 | 3300009177 | Bacteria | 1982 |
| 314 | Ga0105248_10597598 | 3300009177 | Unclassified | 1245 |
| 315 | Ga0105237_10342498 | 3300009545 | Unclassified | 1499 |
| 316 | Ga0105238_10036077 | 3300009551 | Bacteria | 5026 |
| 317 | Ga0105238_10575363 | 3300009551 | Bacteria | 1132 |
| 318 | Ga0105238_10705387 | 3300009551 | Unclassified | 1021 |
| 319 | Ga0105249_10001601 | 3300009553 | Bacteria | 19823 |
| 320 | Ga0105249_10069791 | 3300009553 | Bacteria | 3243 |
| 321 | Ga0105249_10374038 | 3300009553 | Bacteria | 1449 |
| 322 | Ga0099796_10012112 | 3300010159 | Bacteria | 2425 |
| 323 | Ga0105239_10000656 | 3300010375 | Bacteria | 49301 |
| 324 | Ga0105239_10255639 | 3300010375 | Bacteria | 1968 |
| 325 | Ga0105239_10279321 | 3300010375 | Unclassified | 1880 |
| 326 | Ga0105239_10719111 | 3300010375 | Bacteria | 1142 |
| 327 | Ga0105246_10000027 | 3300011119 | Bacteria | 53374 |
| 328 | Ga0105246_10046442 | 3300011119 | Bacteria | 2962 |
| 329 | Ga0157373_10007428 | 3300013100 | Bacteria | 8153 |
| 330 | Ga0157373_10020687 | 3300013100 | Bacteria | 4780 |
| 331 | Ga0157371_10019225 | 3300013102 | Bacteria | 5040 |
| 332 | Ga0157369_10152310 | 3300013105 | Bacteria | 2444 |
| 333 | Ga0157374_10015586 | 3300013296 | Bacteria | 6671 |
| 334 | Ga0157374_10051895 | 3300013296 | Bacteria | 3817 |
| 335 | Ga0157374_10084337 | 3300013296 | Bacteria | 3020 |
| 336 | Ga0157374_10112264 | 3300013296 | Unclassified | 2622 |
| 337 | Ga0157378_10000786 | 3300013297 | Bacteria | 29476 |
| 338 | Ga0157378_10286430 | 3300013297 | Bacteria | 1590 |
| 339 | Ga0163162_10002019 | 3300013306 | Bacteria | 19089 |
| 340 | Ga0163162_10155857 | 3300013306 | Bacteria | 2404 |
| 341 | Ga0163162_10388696 | 3300013306 | Bacteria | 1528 |
| 342 | Ga0157372_10028341 | 3300013307 | Bacteria | 6111 |
| 343 | Ga0157372_11094181 | 3300013307 | Bacteria | 922 |
| 344 | Ga0157375_10000293 | 3300013308 | Bacteria | 45355 |
| 345 | Ga0157375_10273733 | 3300013308 | Bacteria | 1851 |
| 346 | Ga0157375_10521759 | 3300013308 | Unclassified | 1351 |
| 347 | Ga0163163_10000482 | 3300014325 | Bacteria | 36134 |
| 348 | Ga0163163_10006324 | 3300014325 | Bacteria | 10341 |
| 349 | Ga0163163_10013569 | 3300014325 | Bacteria | 7462 |
| 350 | Ga0163163_10027715 | 3300014325 | Bacteria | 5431 |
| 351 | Ga0163163_10183734 | 3300014325 | Unclassified | 2138 |
| 352 | Ga0157380_10000927 | 3300014326 | Bacteria | 18486 |
| 353 | Ga0157380_10208236 | 3300014326 | Bacteria | 1741 |
| 354 | Ga0157380_10384053 | 3300014326 | Bacteria | 1326 |
| 355 | Ga0182008_10040088 | 3300014497 | Unclassified | 2339 |
| 356 | Ga0157377_10000136 | 3300014745 | Bacteria | 47102 |
| 357 | Ga0157379_10001911 | 3300014968 | Bacteria | 17235 |
| 358 | Ga0157379_10016208 | 3300014968 | Bacteria | 6557 |
| 359 | Ga0157379_10145202 | 3300014968 | Bacteria | 2139 |
| 360 | Ga0157379_10154441 | 3300014968 | Bacteria | 2070 |
| 361 | Ga0157379_10476013 | 3300014968 | Bacteria | 1155 |
| 362 | Ga0157376_10000073 | 3300014969 | Bacteria | 76981 |
| 363 | Ga0157376_10040052 | 3300014969 | Bacteria | 3827 |
| 364 | Ga0157376_10046917 | 3300014969 | Bacteria | 3565 |
| 365 | Ga0163161_10000476 | 3300017792 | Bacteria | 33279 |
| 366 | Ga0163161_10128307 | 3300017792 | Bacteria | 1911 |
| 367 | Ga0163161_10198527 | 3300017792 | Bacteria | 1545 |
| 368 | Ga0206353_11138709 | 3300020082 | Bacteria | 1097 |
| 369 | Ga0213876_10003884 | 3300021384 | Bacteria | 8442 |
| 370 | Ga0213876_10299770 | 3300021384 | Bacteria | 854 |
| 371 | Ga0207666_1000055 | 3300025271 | Bacteria | 20260 |
| 372 | Ga0207673_1000158 | 3300025290 | Bacteria | 6644 |
| 373 | Ga0209758_1000370 | 3300025297 | Bacteria | 79289 |
| 374 | Ga0207426_1088694 | 3300025302 | Bacteria | 823 |
| 375 | Ga0207697_10000622 | 3300025315 | Bacteria | 20117 |
| 376 | Ga0207656_10033741 | 3300025321 | Bacteria | 2134 |
| 377 | Ga0207696_1047998 | 3300025711 | Unclassified | 1229 |
| 378 | Ga0207655_1029921 | 3300025728 | Bacteria | 2540 |
| 379 | Ga0207653_10001943 | 3300025885 | Bacteria | 6615 |
| 380 | Ga0207682_10000074 | 3300025893 | Bacteria | 43885 |
| 381 | Ga0207692_10007770 | 3300025898 | Bacteria | 4408 |
| 382 | Ga0207692_10134218 | 3300025898 | Bacteria | 1401 |
| 383 | Ga0207642_10011274 | 3300025899 | Bacteria | 3182 |
| 384 | Ga0207642_10039025 | 3300025899 | Unclassified | 2059 |
| 385 | Ga0207642_10084655 | 3300025899 | Bacteria | 1549 |
| 386 | Ga0207642_10087769 | 3300025899 | Bacteria | 1528 |
| 387 | Ga0207710_10002334 | 3300025900 | Bacteria | 8870 |
| 388 | Ga0207710_10013487 | 3300025900 | Bacteria | 3439 |
| 389 | Ga0207710_10045112 | 3300025900 | Bacteria | 1965 |
| 390 | Ga0207688_10000423 | 3300025901 | Bacteria | 19899 |
| 391 | Ga0207688_10031180 | 3300025901 | Bacteria | 2942 |
| 392 | Ga0207688_10065182 | 3300025901 | Bacteria | 2058 |
| 393 | Ga0207680_10004765 | 3300025903 | Bacteria | 6458 |
| 394 | Ga0207680_10149159 | 3300025903 | Bacteria | 1558 |
| 395 | Ga0207680_10363187 | 3300025903 | Unclassified | 1018 |
| 396 | Ga0207647_10005297 | 3300025904 | Bacteria | 9482 |
| 397 | Ga0207647_10014286 | 3300025904 | Bacteria | 5477 |
| 398 | Ga0207685_10006352 | 3300025905 | Bacteria | 3211 |
| 399 | Ga0207685_10029984 | 3300025905 | Bacteria | 1932 |
| 400 | Ga0207699_10008676 | 3300025906 | Bacteria | 5028 |
| 401 | Ga0207699_10030445 | 3300025906 | Bacteria | 3020 |
| 402 | Ga0207699_10070486 | 3300025906 | Bacteria | 2134 |
| 403 | Ga0207699_10113108 | 3300025906 | Bacteria | 1743 |
| 404 | Ga0207699_10260214 | 3300025906 | Bacteria | 1199 |
| 405 | Ga0207645_10000291 | 3300025907 | Bacteria | 42040 |
| 406 | Ga0207645_10023307 | 3300025907 | Bacteria | 4024 |
| 407 | Ga0207643_10000116 | 3300025908 | Bacteria | 54500 |
| 408 | Ga0207643_10000872 | 3300025908 | Bacteria | 18178 |
| 409 | Ga0207705_10144176 | 3300025909 | Bacteria | 1781 |
| 410 | Ga0207654_10000917 | 3300025911 | Bacteria | 16287 |
| 411 | Ga0207654_10108762 | 3300025911 | Unclassified | 1721 |
| 412 | Ga0207707_10000563 | 3300025912 | Bacteria | 37612 |
| 413 | Ga0207707_10480923 | 3300025912 | Unclassified | 1061 |
| 414 | Ga0207695_10031303 | 3300025913 | Bacteria | 5837 |
| 415 | Ga0207693_10005802 | 3300025915 | Bacteria | 10238 |
| 416 | Ga0207693_10038010 | 3300025915 | Bacteria | 3792 |
| 417 | Ga0207693_10044565 | 3300025915 | Bacteria | 3487 |
| 418 | Ga0207693_10068060 | 3300025915 | Bacteria | 2787 |
| 419 | Ga0207693_10070555 | 3300025915 | Bacteria | 2734 |
| 420 | Ga0207693_10131345 | 3300025915 | Bacteria | 1969 |
| 421 | Ga0207663_10005835 | 3300025916 | Bacteria | 6241 |
| 422 | Ga0207663_10132045 | 3300025916 | Bacteria | 1727 |
| 423 | Ga0207660_10000043 | 3300025917 | Bacteria | 62068 |
| 424 | Ga0207660_10000134 | 3300025917 | Bacteria | 43910 |
| 425 | Ga0207660_10030574 | 3300025917 | Bacteria | 3703 |
| 426 | Ga0207662_10000386 | 3300025918 | Bacteria | 19776 |
| 427 | Ga0207662_10007580 | 3300025918 | Bacteria | 5912 |
| 428 | Ga0207662_10028910 | 3300025918 | Bacteria | 3209 |
| 429 | Ga0207657_10002520 | 3300025919 | Bacteria | 19810 |
| 430 | Ga0207657_10023526 | 3300025919 | Bacteria | 5735 |
| 431 | Ga0207657_10081420 | 3300025919 | Bacteria | 2720 |
| 432 | Ga0207649_10000204 | 3300025920 | Bacteria | 49651 |
| 433 | Ga0207649_10347921 | 3300025920 | Unclassified | 1096 |
| 434 | Ga0207652_10001156 | 3300025921 | Bacteria | 23738 |
| 435 | Ga0207652_10093104 | 3300025921 | Unclassified | 2651 |
| 436 | Ga0207652_10111291 | 3300025921 | Bacteria | 2428 |
| 437 | Ga0207681_10000066 | 3300025923 | Bacteria | 98794 |
| 438 | Ga0207694_10233225 | 3300025924 | Bacteria | 1503 |
| 439 | Ga0207694_10451831 | 3300025924 | Unclassified | 1073 |
| 440 | Ga0207650_10002222 | 3300025925 | Bacteria | 13558 |
| 441 | Ga0207650_10002953 | 3300025925 | Bacteria | 11730 |
| 442 | Ga0207659_10000100 | 3300025926 | Bacteria | 50549 |
| 443 | Ga0207687_10000052 | 3300025927 | Bacteria | 90736 |
| 444 | Ga0207687_10062086 | 3300025927 | Unclassified | 2641 |
| 445 | Ga0207700_10001520 | 3300025928 | Bacteria | 13129 |
| 446 | Ga0207700_10006951 | 3300025928 | Bacteria | 6884 |
| 447 | Ga0207700_10116013 | 3300025928 | Bacteria | 2163 |
| 448 | Ga0207700_10216496 | 3300025928 | Unclassified | 1621 |
| 449 | Ga0207700_10338603 | 3300025928 | Bacteria | 1307 |
| 450 | Ga0207664_10073355 | 3300025929 | Bacteria | 2762 |
| 451 | Ga0207664_10139192 | 3300025929 | Bacteria | 2051 |
| 452 | Ga0207664_10145011 | 3300025929 | Bacteria | 2012 |
| 453 | Ga0207664_10189569 | 3300025929 | Unclassified | 1769 |
| 454 | Ga0207664_10219186 | 3300025929 | Bacteria | 1649 |
| 455 | Ga0207644_10000572 | 3300025931 | Bacteria | 23617 |
| 456 | Ga0207644_10010069 | 3300025931 | Bacteria | 6225 |
| 457 | Ga0207644_10082223 | 3300025931 | Bacteria | 2382 |
| 458 | Ga0207644_10117391 | 3300025931 | Bacteria | 2021 |
| 459 | Ga0207690_10000187 | 3300025932 | Bacteria | 47796 |
| 460 | Ga0207690_10152722 | 3300025932 | Bacteria | 1713 |
| 461 | Ga0207706_10003689 | 3300025933 | Bacteria | 14615 |
| 462 | Ga0207706_10006344 | 3300025933 | Bacteria | 10985 |
| 463 | Ga0207706_10073082 | 3300025933 | Bacteria | 3015 |
| 464 | Ga0207686_10000331 | 3300025934 | Bacteria | 34083 |
| 465 | Ga0207686_10049398 | 3300025934 | Bacteria | 2611 |
| 466 | Ga0207686_10086964 | 3300025934 | Unclassified | 2054 |
| 467 | Ga0207686_10334534 | 3300025934 | Unclassified | 1135 |
| 468 | Ga0207709_10000243 | 3300025935 | Bacteria | 67001 |
| 469 | Ga0207709_10130015 | 3300025935 | Bacteria | 1715 |
| 470 | Ga0207670_10000140 | 3300025936 | Bacteria | 47642 |
| 471 | Ga0207670_10022501 | 3300025936 | Bacteria | 3908 |
| 472 | Ga0207670_10066542 | 3300025936 | Bacteria | 2476 |
| 473 | Ga0207669_10000034 | 3300025937 | Bacteria | 82098 |
| 474 | Ga0207704_10000108 | 3300025938 | Bacteria | 45380 |
| 475 | Ga0207704_10107366 | 3300025938 | Bacteria | 1878 |
| 476 | Ga0207665_10000860 | 3300025939 | Bacteria | 20521 |
| 477 | Ga0207665_10006295 | 3300025939 | Bacteria | 7873 |
| 478 | Ga0207665_10127648 | 3300025939 | Bacteria | 1802 |
| 479 | Ga0207665_10145335 | 3300025939 | Bacteria | 1694 |
| 480 | Ga0207665_10183122 | 3300025939 | Bacteria | 1518 |
| 481 | Ga0207691_10001957 | 3300025940 | Bacteria | 20117 |
| 482 | Ga0207691_10007735 | 3300025940 | Bacteria | 10345 |
| 483 | Ga0207711_10001312 | 3300025941 | Bacteria | 23521 |
| 484 | Ga0207711_10024752 | 3300025941 | Bacteria | 5035 |
| 485 | Ga0207711_10210381 | 3300025941 | Bacteria | 1776 |
| 486 | Ga0207711_10458193 | 3300025941 | Unclassified | 1187 |
| 487 | Ga0207689_10000233 | 3300025942 | Bacteria | 49558 |
| 488 | Ga0207689_10112768 | 3300025942 | Bacteria | 2235 |
| 489 | Ga0207661_10000230 | 3300025944 | Bacteria | 36712 |
| 490 | Ga0207661_10078867 | 3300025944 | Bacteria | 2713 |
| 491 | Ga0207679_10000052 | 3300025945 | Bacteria | 110612 |
| 492 | Ga0207679_10456428 | 3300025945 | Unclassified | 1134 |
| 493 | Ga0207667_10009406 | 3300025949 | Bacteria | 11511 |
| 494 | Ga0207667_10160054 | 3300025949 | Bacteria | 2316 |
| 495 | Ga0207651_10000421 | 3300025960 | Bacteria | 18042 |
| 496 | Ga0207651_10180490 | 3300025960 | Unclassified | 1674 |
| 497 | Ga0207712_10000265 | 3300025961 | Bacteria | 50879 |
| 498 | Ga0207712_10169791 | 3300025961 | Bacteria | 1704 |
| 499 | Ga0207668_10000151 | 3300025972 | Bacteria | 47939 |
| 500 | Ga0207668_10220372 | 3300025972 | Unclassified | 1523 |
| 501 | Ga0207668_10413229 | 3300025972 | Bacteria | 1143 |
| 502 | Ga0207640_10000129 | 3300025981 | Bacteria | 57276 |
| 503 | Ga0207640_10247161 | 3300025981 | Unclassified | 1382 |
| 504 | Ga0207640_10257825 | 3300025981 | Unclassified | 1357 |
| 505 | Ga0207658_10005018 | 3300025986 | Bacteria | 9120 |
| 506 | Ga0207658_10120838 | 3300025986 | Unclassified | 2088 |
| 507 | Ga0207658_10246402 | 3300025986 | Unclassified | 1516 |
| 508 | Ga0207677_10000349 | 3300026023 | Bacteria | 32391 |
| 509 | Ga0207677_10042728 | 3300026023 | Bacteria | 3007 |
| 510 | Ga0207703_10009975 | 3300026035 | Bacteria | 7450 |
| 511 | Ga0207703_10307818 | 3300026035 | Bacteria | 1447 |
| 512 | Ga0207703_10767429 | 3300026035 | Unclassified | 919 |
| 513 | Ga0207639_10000825 | 3300026041 | Bacteria | 21067 |
| 514 | Ga0207678_10001156 | 3300026067 | Bacteria | 24150 |
| 515 | Ga0207678_10003613 | 3300026067 | Bacteria | 13902 |
| 516 | Ga0207678_10005238 | 3300026067 | Bacteria | 11614 |
| 517 | Ga0207708_10001163 | 3300026075 | Bacteria | 19820 |
| 518 | Ga0207708_10005514 | 3300026075 | Bacteria | 9339 |
| 519 | Ga0207702_10001465 | 3300026078 | Bacteria | 23457 |
| 520 | Ga0207641_10000468 | 3300026088 | Bacteria | 45600 |
| 521 | Ga0207641_10038901 | 3300026088 | Bacteria | 3977 |
| 522 | Ga0207641_10388206 | 3300026088 | Bacteria | 1338 |
| 523 | Ga0207641_10441744 | 3300026088 | Bacteria | 1256 |
| 524 | Ga0207648_10002454 | 3300026089 | Bacteria | 19932 |
| 525 | Ga0207648_10026444 | 3300026089 | Bacteria | 5156 |
| 526 | Ga0207648_10075360 | 3300026089 | Bacteria | 2941 |
| 527 | Ga0207676_10000335 | 3300026095 | Bacteria | 40477 |
| 528 | Ga0207676_10092500 | 3300026095 | Bacteria | 2487 |
| 529 | Ga0207676_10150702 | 3300026095 | Unclassified | 2002 |
| 530 | Ga0207674_10000639 | 3300026116 | Bacteria | 45600 |
| 531 | Ga0207674_10058822 | 3300026116 | Bacteria | 3892 |
| 532 | Ga0207674_10876963 | 3300026116 | Bacteria | 865 |
| 533 | Ga0207675_100001363 | 3300026118 | Bacteria | 24484 |
| 534 | Ga0207683_10000048 | 3300026121 | Bacteria | 88501 |
| 535 | Ga0207683_10006535 | 3300026121 | Bacteria | 9983 |
| 536 | Ga0207683_10010853 | 3300026121 | Bacteria | 7769 |
| 537 | Ga0207698_10003731 | 3300026142 | Bacteria | 9203 |
| 538 | Ga0209973_1001466 | 3300027252 | Bacteria | 2067 |
| 539 | Ga0209179_1040275 | 3300027512 | Bacteria | 982 |
| 540 | Ga0210002_1000574 | 3300027617 | Bacteria | 4977 |
| 541 | Ga0209971_1006961 | 3300027682 | Bacteria | 2682 |
| 542 | Ga0209998_10018758 | 3300027717 | Unclassified | 1471 |
| 543 | Ga0209813_10006297 | 3300027866 | Bacteria | 2926 |
| 544 | Ga0209974_10004320 | 3300027876 | Bacteria | 5053 |
| 545 | Ga0207428_10000247 | 3300027907 | Bacteria | 73484 |
| 546 | Ga0207428_10000784 | 3300027907 | Bacteria | 35988 |
| 547 | Ga0207428_10041877 | 3300027907 | Bacteria | 3706 |
| 548 | Ga0207428_10071073 | 3300027907 | Bacteria | 2734 |
| 549 | Ga0268266_10196925 | 3300028379 | Bacteria | 1842 |
| 550 | Ga0268266_10387008 | 3300028379 | Bacteria | 1320 |
| 551 | Ga0268265_10000871 | 3300028380 | Bacteria | 28300 |
| 552 | Ga0268265_10601816 | 3300028380 | Bacteria | 1051 |
| 553 | Ga0268264_10000735 | 3300028381 | Bacteria | 37414 |
| 554 | Ga0268264_10252765 | 3300028381 | Bacteria | 1638 |
| 555 | Ga0265337_1001061 | 3300028556 | Bacteria | 14176 |
| 556 | Ga0265338_10141636 | 3300028800 | Bacteria | 1882 |
| 557 | Ga0265325_10000377 | 3300031241 | Bacteria | 31339 |
| 558 | Ga0265325_10012333 | 3300031241 | Bacteria | 4889 |
| 559 | Ga0265325_10017402 | 3300031241 | Bacteria | 3995 |
| 560 | Ga0265340_10004931 | 3300031247 | Bacteria | 7422 |
| 561 | Ga0265339_10019520 | 3300031249 | Bacteria | 3978 |
| 562 | Ga0265339_10058544 | 3300031249 | Bacteria | 2080 |
| 563 | Ga0265331_10009591 | 3300031250 | Bacteria | 5425 |
| 564 | Ga0265313_10000218 | 3300031595 | Bacteria | 61915 |
| 565 | Ga0265313_10012813 | 3300031595 | Bacteria | 5088 |
| 566 | Ga0265313_10020380 | 3300031595 | Bacteria | 3659 |
| 567 | Ga0265313_10096144 | 3300031595 | Bacteria | 1321 |
| 568 | Ga0265314_10011277 | 3300031711 | Bacteria | 7392 |
| 569 | Ga0265342_10078456 | 3300031712 | Bacteria | 1911 |
| 570 | Ga0316583_10000148 | 3300032133 | Bacteria | 16835 |
| 571 | Ga0373930_0004895 | 3300034816 | Bacteria | 2204 |
| 572 | Ga0373948_0000531 | 3300034817 | Bacteria | 4782 |
| 573 | Ga0373958_0007270 | 3300034819 | Unclassified | 1758 |
| 574 | Ga0373938_0006041 | 3300034957 | Bacteria | 2077 |
| 575 | Ga0373926_0024846 | 3300035083 | Bacteria | 2088 |
| 576 | Ga0373926_0084708 | 3300035083 | Bacteria | 1175 |
| 577 | Ga0373928_0001239 | 3300035084 | Bacteria | 5012 |
| 578 | Ga0373929_0000881 | 3300035085 | Bacteria | 5853 |
| 579 | Ga0373929_0011968 | 3300035085 | Bacteria | 1642 |
| 580 | Ga0373929_0046096 | 3300035085 | Unclassified | 984 |
| 581 | Ga0373934_0047206 | 3300035086 | Unclassified | 1703 |
| 582 | Ga0373940_0031448 | 3300035088 | Bacteria | 1417 |
| 583 | Ga0373940_0048592 | 3300035088 | Bacteria | 1186 |
| 584 | Ga0373944_0006259 | 3300035089 | Bacteria | 3154 |
| 585 | Ga0373944_0007932 | 3300035089 | Bacteria | 2860 |
| 586 | Ga0373951_0000290 | 3300035091 | Bacteria | 16024 |
| 587 | Ga0373951_0006502 | 3300035091 | Bacteria | 2672 |
| 588 | Ga0373952_0001526 | 3300035092 | Bacteria | 4216 |
| 589 | Ga0373923_0002516 | 3300035111 | Bacteria | 5665 |
| 590 | Ga0373923_0053206 | 3300035111 | Unclassified | 1702 |
| 591 | Ga0373923_0111068 | 3300035111 | Bacteria | 1217 |
| 592 | Ga0373932_0020873 | 3300035112 | Bacteria | 1722 |
| 593 | Ga0373936_0000283 | 3300035113 | Bacteria | 17009 |
| 594 | Ga0373939_0000192 | 3300035114 | Bacteria | 16989 |
| 595 | Ga0373939_0011140 | 3300035114 | Bacteria | 2262 |
| 596 | Ga0373939_0082668 | 3300035114 | Bacteria | 1070 |
| 597 | Ga0373941_0000031 | 3300035115 | Bacteria | 21368 |
| 598 | Ga0373945_0002393 | 3300035116 | Bacteria | 5884 |
| 599 | Ga0373945_0017828 | 3300035116 | Unclassified | 2408 |
| 600 | Ga0373953_0035231 | 3300035117 | Bacteria | 1966 |
| 601 | Ga0373953_0039278 | 3300035117 | Bacteria | 1875 |
| 602 | Ga0373954_0001724 | 3300035118 | Bacteria | 8951 |
| 603 | Ga0373954_0024572 | 3300035118 | Bacteria | 2748 |
| 604 | Ga0373954_0057463 | 3300035118 | Bacteria | 1832 |
| 605 | Ga0373954_0073600 | 3300035118 | Bacteria | 1626 |
| 606 | Ga0373954_0081541 | 3300035118 | Bacteria | 1546 |
| 607 | Ga0373956_0023961 | 3300035119 | Bacteria | 2625 |
| 608 | Ga0373956_0055170 | 3300035119 | Unclassified | 1792 |
| 609 | Ga0373957_0015827 | 3300035120 | Bacteria | 2602 |
| 610 | Ga0373957_0026468 | 3300035120 | Bacteria | 2098 |
| 611 | Ga0373960_0009485 | 3300035121 | Bacteria | 2359 |
| 612 | Ga0373943_0083106 | 3300035170 | Bacteria | 1645 |
| 613 | Ga0373943_0114982 | 3300035170 | Bacteria | 1424 |
| 614 | Ga0373946_0010660 | 3300035171 | Bacteria | 3408 |
| 615 | Ga0373946_0027647 | 3300035171 | Bacteria | 2245 |
| 616 | Ga0373946_0068616 | 3300035171 | Unclassified | 1525 |
| 617 | Ga0373946_0094255 | 3300035171 | Bacteria | 1332 |
| 618 | Ga0373955_0000334 | 3300035172 | Bacteria | 19669 |
| 619 | Ga0373955_0008925 | 3300035172 | Bacteria | 4677 |
| 620 | Ga0373955_0016443 | 3300035172 | Unclassified | 3642 |
| 621 | Ga0373955_0043198 | 3300035172 | Bacteria | 2424 |
| 622 | Ga0373955_0056389 | 3300035172 | Unclassified | 2155 |
| 623 | Ga0373955_0198442 | 3300035172 | Bacteria | 1194 |
| 624 | Ga0373942_0003290 | 3300035207 | Bacteria | 3804 |
| 625 | Ga0373942_0041448 | 3300035207 | Bacteria | 1259 |
| 626 | Ga0373961_0004317 | 3300035241 | Unclassified | 3439 |
| 627 | Ga0373961_0049418 | 3300035241 | Bacteria | 1243 |
| 628 | Ga0373961_0081138 | 3300035241 | Bacteria | 1021 |
| 629 | Ga0373962_0001119 | 3300035242 | Bacteria | 6249 |
| 630 | Ga0373962_0011124 | 3300035242 | Bacteria | 2252 |
| 631 | Ga0373962_0045860 | 3300035242 | Bacteria | 1246 |
| 632 | Ga0373924_0000358 | 3300035410 | Bacteria | 14065 |
| 633 | Ga0373924_0007042 | 3300035410 | Bacteria | 4050 |
| 634 | Ga0373924_0048746 | 3300035410 | Bacteria | 1751 |
| 635 | Ga0373931_0000273 | 3300035691 | Bacteria | 21808 |
| 636 | Ga0373931_0109441 | 3300035691 | Bacteria | 1565 |
| 637 | Ga0373931_0255119 | 3300035691 | Bacteria | 1068 |
| 638 | Ga0373935_0001324 | 3300035692 | Bacteria | 13718 |
| 639 | Ga0373935_0034408 | 3300035692 | Bacteria | 3157 |
| 640 | Ga0373935_0049223 | 3300035692 | Bacteria | 2671 |
| 641 | Ga0373935_0084728 | 3300035692 | Bacteria | 2065 |
| 642 | Ga0373935_0122232 | 3300035692 | Bacteria | 1741 |
| 643 | Ga0373935_0228993 | 3300035692 | Unclassified | 1293 |
| 644 | Ga0373935_0399979 | 3300035692 | Bacteria | 986 |
| 645 | Ga0373927_0028494 | 3300035695 | Bacteria | 3643 |
| 646 | Ga0373927_0037555 | 3300035695 | Bacteria | 3147 |
| 647 | Ga0373927_0045830 | 3300035695 | Bacteria | 2829 |
| 648 | Ga0373927_0076935 | 3300035695 | Bacteria | 2161 |
| 649 | Ga0373927_0097250 | 3300035695 | Bacteria | 1913 |
| 650 | Ga0373927_0143427 | 3300035695 | Bacteria | 1563 |
| 651 | Ga0373927_0156703 | 3300035695 | Bacteria | 1491 |
| 652 | Ga0373933_0001162 | 3300035724 | Bacteria | 15600 |
| 653 | Ga0373933_0001830 | 3300035724 | Bacteria | 12312 |
| 654 | Ga0373933_0070295 | 3300035724 | Bacteria | 2129 |
| 655 | Ga0373933_0071647 | 3300035724 | Unclassified | 2110 |
| 656 | Ga0373933_0161907 | 3300035724 | Unclassified | 1421 |
| 657 | Ga0373933_0194364 | 3300035724 | Bacteria | 1297 |
| 658 | Ga0373947_0002784 | 3300035725 | Bacteria | 10457 |
| 659 | Ga0373947_0020264 | 3300035725 | Bacteria | 3838 |
| 660 | Ga0373947_0161214 | 3300035725 | Unclassified | 1450 |
| 661 | Ga0373947_0205553 | 3300035725 | Bacteria | 1290 |
| 662 | Ga0373937_0001118 | 3300036401 | Bacteria | 22628 |
| 663 | Ga0373937_0001692 | 3300036401 | Bacteria | 18558 |
| 664 | Ga0373937_0006485 | 3300036401 | Bacteria | 10099 |
| 665 | Ga0373937_0012619 | 3300036401 | Bacteria | 7436 |
| 666 | Ga0373937_0028187 | 3300036401 | Bacteria | 5080 |
| 667 | Ga0373937_0031982 | 3300036401 | Bacteria | 4770 |
| 668 | Ga0373937_0151600 | 3300036401 | Bacteria | 2172 |
| 669 | Ga0373937_0670866 | 3300036401 | Bacteria | 982 |
| 670 | Ga0373925_0000084 | 3300037068 | Bacteria | 100945 |
| 671 | Ga0373925_0003690 | 3300037068 | Bacteria | 11767 |
| 672 | Ga0373925_0009586 | 3300037068 | Bacteria | 7055 |
| 673 | Ga0373925_0017236 | 3300037068 | Bacteria | 5232 |
| 674 | Ga0373925_0019319 | 3300037068 | Bacteria | 4955 |
| 675 | Ga0373925_0049034 | 3300037068 | Bacteria | 3147 |
| 676 | Ga0373925_0111409 | 3300037068 | Bacteria | 2115 |
| 677 | Ga0373925_0148098 | 3300037068 | Bacteria | 1841 |
| 678 | Ga0373925_0277419 | 3300037068 | Unclassified | 1349 |
| 679 | Ga0436365_1232763 | 3300039437 | Bacteria | 8240 |
| 680 | Ga0436365_1344708 | 3300039437 | Unclassified | 864 |
| 681 | Ga0436365_1513096 | 3300039437 | Bacteria | 912 |
| 682 | Ga0436365_1762134 | 3300039437 | Bacteria | 3129 |
| 683 | Ga0451793_0025165 | 3300041452 | Unclassified | 854 |
| 684 | Ga0439448_0047682 | 3300042005 | Bacteria | 1398 |
| 685 | Ga0439455_0012427 | 3300042012 | Bacteria | 1912 |
| 686 | Ga0450916_015161 | 3300042530 | Unclassified | 1011 |
| 687 | Ga0466967_0117632 | 3300045976 | Bacteria | 2450 |
| 688 | Ga0495592_0000026 | 3300046454 | Bacteria | 136204 |
| 689 | Ga0495592_0016983 | 3300046454 | Bacteria | 5525 |
| 690 | Ga0495592_0058557 | 3300046454 | Bacteria | 2841 |
| 691 | Ga0495592_0081952 | 3300046454 | Bacteria | 2332 |
| 692 | Ga0495592_0120738 | 3300046454 | Bacteria | 1844 |
| 693 | Ga0495603_0014206 | 3300046455 | Bacteria | 4817 |
| 694 | Ga0495603_0018977 | 3300046455 | Bacteria | 4162 |
| 695 | Ga0495603_0131137 | 3300046455 | Bacteria | 1459 |
| 696 | Ga0495629_0000171 | 3300046459 | Bacteria | 57349 |
| 697 | Ga0495629_0024446 | 3300046459 | Bacteria | 4302 |
| 698 | Ga0495629_0039765 | 3300046459 | Bacteria | 3309 |
| 699 | Ga0495629_0214342 | 3300046459 | Bacteria | 1329 |
| 700 | Ga0495629_0230419 | 3300046459 | Bacteria | 1277 |
| 701 | Ga0495641_0003584 | 3300046461 | Bacteria | 11514 |
| 702 | Ga0495641_0046148 | 3300046461 | Bacteria | 2004 |
| 703 | Ga0495641_0114652 | 3300046461 | Bacteria | 1202 |
| 704 | Ga0495651_0000790 | 3300046462 | Bacteria | 24562 |
| 705 | Ga0495651_0008223 | 3300046462 | Bacteria | 7997 |
| 706 | Ga0495651_0025993 | 3300046462 | Bacteria | 4558 |
| 707 | Ga0495653_0000155 | 3300046463 | Bacteria | 56764 |
| 708 | Ga0495653_0058758 | 3300046463 | Bacteria | 2922 |
| 709 | Ga0495653_0084943 | 3300046463 | Bacteria | 2330 |
| 710 | Ga0495653_0086116 | 3300046463 | Bacteria | 2310 |
| 711 | Ga0495582_0002454 | 3300046473 | Bacteria | 10333 |
| 712 | Ga0495639_0040288 | 3300046475 | Bacteria | 2101 |
| 713 | Ga0495662_0015227 | 3300046476 | Bacteria | 3736 |
| 714 | Ga0495662_0092193 | 3300046476 | Bacteria | 1477 |
| 715 | Ga0495662_0145381 | 3300046476 | Unclassified | 1167 |
| 716 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 717 | Ga0495664_0086008 | 3300046477 | Unclassified | 1888 |
| 718 | Ga0495584_0128523 | 3300046491 | Bacteria | 1285 |
| 719 | Ga0495585_0000251 | 3300046492 | Bacteria | 55561 |
| 720 | Ga0495585_0013489 | 3300046492 | Bacteria | 4780 |
| 721 | Ga0495594_0022664 | 3300046499 | Bacteria | 3359 |
| 722 | Ga0495594_0218570 | 3300046499 | Unclassified | 1086 |
| 723 | Ga0495607_0001699 | 3300046501 | Bacteria | 18921 |
| 724 | Ga0495607_0109705 | 3300046501 | Bacteria | 1465 |
| 725 | Ga0495583_0082716 | 3300046506 | Bacteria | 1393 |
| 726 | Ga0495608_0000012 | 3300046511 | Bacteria | 242758 |
| 727 | Ga0495608_0002359 | 3300046511 | Bacteria | 13607 |
| 728 | Ga0495608_0083008 | 3300046511 | Bacteria | 2080 |
| 729 | Ga0495608_0096314 | 3300046511 | Bacteria | 1911 |
| 730 | Ga0495608_0186857 | 3300046511 | Bacteria | 1309 |
| 731 | Ga0495616_0037138 | 3300046513 | Bacteria | 2508 |
| 732 | Ga0495618_0000041 | 3300046514 | Bacteria | 96631 |
| 733 | Ga0495618_0052984 | 3300046514 | Bacteria | 2566 |
| 734 | Ga0495628_0000033 | 3300046516 | Bacteria | 118203 |
| 735 | Ga0495628_0059214 | 3300046516 | Bacteria | 3007 |
| 736 | Ga0495628_0064026 | 3300046516 | Bacteria | 2879 |
| 737 | Ga0495628_0212340 | 3300046516 | Bacteria | 1455 |
| 738 | Ga0495630_0009244 | 3300046517 | Bacteria | 7086 |
| 739 | Ga0495630_0039949 | 3300046517 | Bacteria | 3507 |
| 740 | Ga0495630_0095665 | 3300046517 | Bacteria | 2246 |
| 741 | Ga0495631_0011416 | 3300046518 | Bacteria | 4369 |
| 742 | Ga0495644_0002554 | 3300046523 | Bacteria | 7243 |
| 743 | Ga0495663_0054396 | 3300046525 | Bacteria | 1246 |
| 744 | Ga0495666_0003467 | 3300046526 | Bacteria | 7964 |
| 745 | Ga0495666_0024242 | 3300046526 | Bacteria | 2998 |
| 746 | Ga0495642_0136479 | 3300046528 | Unclassified | 1058 |
| 747 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 748 | Ga0495652_0001796 | 3300046529 | Bacteria | 22869 |
| 749 | Ga0495652_0031224 | 3300046529 | Bacteria | 4666 |
| 750 | Ga0495665_0017934 | 3300046531 | Bacteria | 3804 |
| 751 | Ga0495640_0000010 | 3300046533 | Bacteria | 214167 |
| 752 | Ga0495640_0016033 | 3300046533 | Bacteria | 5617 |
| 753 | Ga0495640_0188971 | 3300046533 | Bacteria | 1310 |
| 754 | Ga0495587_0000003 | 3300046536 | Bacteria | 424188 |
| 755 | Ga0495587_0049031 | 3300046536 | Bacteria | 2501 |
| 756 | Ga0495587_0062606 | 3300046536 | Bacteria | 2178 |
| 757 | Ga0495587_0125462 | 3300046536 | Bacteria | 1469 |
| 758 | Ga0495598_0001482 | 3300046537 | Bacteria | 4673 |
| 759 | Ga0495598_0003879 | 3300046537 | Bacteria | 3204 |
| 760 | Ga0495609_0017594 | 3300046538 | Bacteria | 3319 |
| 761 | Ga0495645_0000026 | 3300046543 | Bacteria | 118737 |
| 762 | Ga0495645_0003084 | 3300046543 | Bacteria | 11283 |
| 763 | Ga0495645_0016073 | 3300046543 | Bacteria | 5336 |
| 764 | Ga0495622_0071900 | 3300046557 | Unclassified | 1596 |
| 765 | Ga0495633_0006405 | 3300046558 | Bacteria | 6982 |
| 766 | Ga0495633_0077656 | 3300046558 | Bacteria | 1546 |
| 767 | Ga0495667_0000389 | 3300046559 | Bacteria | 27954 |
| 768 | Ga0495667_0001979 | 3300046559 | Bacteria | 13569 |
| 769 | Ga0495667_0011491 | 3300046559 | Bacteria | 5993 |
| 770 | Ga0495667_0020583 | 3300046559 | Bacteria | 4451 |
| 771 | Ga0495667_0103935 | 3300046559 | Unclassified | 1837 |
| 772 | Ga0495656_0000191 | 3300046615 | Bacteria | 22072 |
| 773 | Ga0495668_0130262 | 3300046616 | Bacteria | 1377 |
| 774 | Ga0495634_0000285 | 3300046642 | Bacteria | 48349 |
| 775 | Ga0495634_0078208 | 3300046642 | Bacteria | 2167 |
| 776 | Ga0495611_0069292 | 3300046648 | Bacteria | 1611 |
| 777 | Ga0495635_0000113 | 3300046663 | Bacteria | 48231 |
| 778 | Ga0495635_0013079 | 3300046663 | Bacteria | 5811 |
| 779 | Ga0495635_0064469 | 3300046663 | Bacteria | 2515 |
| 780 | Ga0495659_0002654 | 3300046664 | Bacteria | 5758 |
| 781 | Ga0495588_0008289 | 3300046674 | Bacteria | 4761 |
| 782 | Ga0495588_0060953 | 3300046674 | Bacteria | 1953 |
| 783 | Ga0495657_0000258 | 3300046675 | Bacteria | 48270 |
| 784 | Ga0495657_0053677 | 3300046675 | Bacteria | 2696 |
| 785 | Ga0495657_0373614 | 3300046675 | Bacteria | 841 |
| 786 | Ga0495599_0000070 | 3300046678 | Bacteria | 71413 |
| 787 | Ga0495599_0005630 | 3300046678 | Bacteria | 7515 |
| 788 | Ga0495599_0014500 | 3300046678 | Bacteria | 4881 |
| 789 | Ga0495599_0019535 | 3300046678 | Bacteria | 4223 |
| 790 | Ga0495599_0159733 | 3300046678 | Bacteria | 1393 |
| 791 | Ga0495623_0000003 | 3300046679 | Bacteria | 147316 |
| 792 | Ga0495623_0022373 | 3300046679 | Bacteria | 4084 |
| 793 | Ga0495646_0000070 | 3300046680 | Bacteria | 47494 |
| 794 | Ga0495646_0001840 | 3300046680 | Bacteria | 12737 |
| 795 | Ga0495646_0138269 | 3300046680 | Bacteria | 1364 |
| 796 | Ga0495647_0002939 | 3300046681 | Bacteria | 5405 |
| 797 | Ga0495647_0055086 | 3300046681 | Bacteria | 1556 |
| 798 | Ga0495647_0161499 | 3300046681 | Bacteria | 966 |
| 799 | Ga0495658_0000282 | 3300046683 | Bacteria | 28789 |
| 800 | Ga0495658_0007523 | 3300046683 | Bacteria | 5395 |
| 801 | Ga0495658_0086001 | 3300046683 | Bacteria | 1854 |
| 802 | Ga0495658_0216305 | 3300046683 | Unclassified | 1198 |
| 803 | Ga0495613_0022200 | 3300046689 | Bacteria | 4729 |
| 804 | Ga0495624_0011727 | 3300046690 | Bacteria | 6018 |
| 805 | Ga0495670_0000204 | 3300046691 | Bacteria | 26707 |
| 806 | Ga0495671_0015506 | 3300046692 | Bacteria | 4081 |
| 807 | Ga0495589_0047550 | 3300046794 | Bacteria | 2126 |
| 808 | Ga0495600_0000007 | 3300046809 | Bacteria | 150995 |
| 809 | Ga0495600_0048247 | 3300046809 | Bacteria | 2778 |
| 810 | Ga0495600_0059756 | 3300046809 | Bacteria | 2490 |
| 811 | Ga0495581_0255145 | 3300047315 | Unclassified | 1025 |
| 812 | Ga0495604_0000010 | 3300047317 | Bacteria | 312236 |
| 813 | Ga0495604_0015304 | 3300047317 | Bacteria | 6122 |
| 814 | Ga0495674_0000013 | 3300047319 | Bacteria | 248475 |
| 815 | Ga0495674_0022656 | 3300047319 | Bacteria | 5791 |
| 816 | Ga0495674_0128684 | 3300047319 | Bacteria | 2134 |
| 817 | Ga0495674_0141310 | 3300047319 | Bacteria | 2023 |
| 818 | Ga0495674_0212003 | 3300047319 | Bacteria | 1604 |
| 819 | Ga0495674_0268890 | 3300047319 | Bacteria | 1399 |
| 820 | Ga0495676_0059847 | 3300047321 | Bacteria | 2988 |
| 821 | Ga0495676_0078519 | 3300047321 | Bacteria | 2513 |
| 822 | Ga0495676_0103230 | 3300047321 | Bacteria | 2105 |
| 823 | Ga0495676_0114449 | 3300047321 | Bacteria | 1973 |
| 824 | Ga0495676_0125214 | 3300047321 | Unclassified | 1863 |
| 825 | Ga0495680_0000666 | 3300047322 | Bacteria | 38461 |
| 826 | Ga0495680_0004448 | 3300047322 | Bacteria | 13397 |
| 827 | Ga0495680_0013117 | 3300047322 | Bacteria | 7242 |
| 828 | Ga0495680_0148863 | 3300047322 | Bacteria | 1708 |
| 829 | Ga0495680_0325730 | 3300047322 | Bacteria | 1074 |
| 830 | Ga0495675_0000567 | 3300047444 | Bacteria | 23900 |
| 831 | Ga0495675_0014786 | 3300047444 | Bacteria | 4934 |
| 832 | Ga0495675_0017706 | 3300047444 | Bacteria | 4517 |
| 833 | Ga0495679_020017 | 3300047446 | Bacteria | 2338 |
| 834 | Ga0495684_0000008 | 3300047471 | Bacteria | 201370 |
| 835 | Ga0495684_0022473 | 3300047471 | Bacteria | 4852 |
| 836 | Ga0495684_0172019 | 3300047471 | Unclassified | 1610 |
| 837 | Ga0495684_0178542 | 3300047471 | Bacteria | 1575 |
| 838 | Ga0495684_0270973 | 3300047471 | Bacteria | 1228 |
| 839 | Ga0495684_0346552 | 3300047471 | Bacteria | 1056 |
| 840 | Ga0495593_0002332 | 3300047673 | Bacteria | 11402 |
| 841 | Ga0495593_0259212 | 3300047673 | Bacteria | 870 |
| 842 | Ga0495602_0000264 | 3300048088 | Bacteria | 48258 |
| 843 | Ga0495602_0000568 | 3300048088 | Bacteria | 34391 |
| 844 | Ga0495602_0199342 | 3300048088 | Unclassified | 1528 |
| 845 | Ga0495602_0216016 | 3300048088 | Bacteria | 1451 |
| 846 | Ga0495602_0313377 | 3300048088 | Unclassified | 1144 |
| 847 | Ga0496100_0000255 | 3300048903 | Bacteria | 27283 |
| 848 | Ga0496100_0022447 | 3300048903 | Bacteria | 3819 |
| 849 | Ga0496100_0058396 | 3300048903 | Bacteria | 2531 |
| 850 | Ga0496101_0000317 | 3300048904 | Bacteria | 33300 |
| 851 | Ga0496101_0005168 | 3300048904 | Bacteria | 8303 |
| 852 | Ga0496101_0045030 | 3300048904 | Bacteria | 3159 |
| 853 | Ga0496101_0075080 | 3300048904 | Bacteria | 2488 |
| 854 | Ga0496102_0001113 | 3300048905 | Bacteria | 24650 |
| 855 | Ga0496102_0052571 | 3300048905 | Bacteria | 3712 |
| 856 | Ga0496102_0062761 | 3300048905 | Unclassified | 3402 |
| 857 | Ga0496102_0063229 | 3300048905 | Bacteria | 3388 |
| 858 | Ga0496102_0177348 | 3300048905 | Bacteria | 2007 |
| 859 | Ga0496103_0000528 | 3300048906 | Bacteria | 31170 |
| 860 | Ga0496103_0049495 | 3300048906 | Bacteria | 2598 |
| 861 | Ga0496103_0057083 | 3300048906 | Bacteria | 2424 |
| 862 | Ga0496103_0172895 | 3300048906 | Bacteria | 1387 |
| 863 | Ga0496104_0000082 | 3300048907 | Bacteria | 93223 |
| 864 | Ga0496104_0001732 | 3300048907 | Bacteria | 18840 |
| 865 | Ga0496104_0001798 | 3300048907 | Bacteria | 18583 |
| 866 | Ga0496104_0004876 | 3300048907 | Bacteria | 11697 |
| 867 | Ga0496104_0007168 | 3300048907 | Bacteria | 9828 |
| 868 | Ga0496104_0103866 | 3300048907 | Bacteria | 2722 |
| 869 | Ga0496104_0126757 | 3300048907 | Unclassified | 2451 |
| 870 | Ga0496104_0158263 | 3300048907 | Unclassified | 2173 |
| 871 | Ga0496104_0245894 | 3300048907 | Bacteria | 1701 |
| 872 | Ga0496105_0000563 | 3300048908 | Bacteria | 24520 |
| 873 | Ga0496105_0001322 | 3300048908 | Bacteria | 17343 |
| 874 | Ga0496105_0002542 | 3300048908 | Bacteria | 13233 |
| 875 | Ga0496105_0012374 | 3300048908 | Bacteria | 6756 |
| 876 | Ga0496105_0021540 | 3300048908 | Bacteria | 5215 |
| 877 | Ga0496105_0062196 | 3300048908 | Bacteria | 3080 |
| 878 | Ga0496105_0331320 | 3300048908 | Bacteria | 1218 |
| 879 | Ga0496106_0000165 | 3300048909 | Bacteria | 47763 |
| 880 | Ga0496106_0028529 | 3300048909 | Bacteria | 4157 |
| 881 | Ga0496106_0076376 | 3300048909 | Unclassified | 2567 |
| 882 | Ga0496106_0139632 | 3300048909 | Unclassified | 1905 |
| 883 | Ga0496106_0277109 | 3300048909 | Unclassified | 1343 |
| 884 | Ga0496106_0601510 | 3300048909 | Bacteria | 880 |
| 885 | Ga0496107_0000201 | 3300048910 | Bacteria | 31298 |
| 886 | Ga0496107_0009106 | 3300048910 | Bacteria | 6883 |
| 887 | Ga0496108_0002292 | 3300048911 | Bacteria | 15331 |
| 888 | Ga0496108_0009174 | 3300048911 | Bacteria | 8006 |
| 889 | Ga0496108_0085375 | 3300048911 | Bacteria | 2679 |
| 890 | Ga0496108_0131813 | 3300048911 | Bacteria | 2148 |
| 891 | Ga0496108_0179475 | 3300048911 | Bacteria | 1833 |
| 892 | Ga0496108_0199665 | 3300048911 | Bacteria | 1735 |
| 893 | Ga0496109_0002809 | 3300048912 | Bacteria | 14583 |
| 894 | Ga0496109_0003316 | 3300048912 | Bacteria | 13454 |
| 895 | Ga0496109_0031863 | 3300048912 | Bacteria | 4735 |
| 896 | Ga0496109_0080575 | 3300048912 | Bacteria | 2999 |
| 897 | Ga0496109_0276991 | 3300048912 | Bacteria | 1581 |
| 898 | Ga0496109_0811529 | 3300048912 | Unclassified | 873 |
| 899 | Ga0496110_0014166 | 3300048913 | Bacteria | 6615 |
| 900 | Ga0496110_0105889 | 3300048913 | Unclassified | 2523 |
| 901 | Ga0496110_0135796 | 3300048913 | Unclassified | 2222 |
| 902 | Ga0496111_0025450 | 3300048914 | Bacteria | 4175 |
| 903 | Ga0496111_0030271 | 3300048914 | Unclassified | 3849 |
| 904 | Ga0496111_0126095 | 3300048914 | Bacteria | 1892 |
| 905 | Ga0496112_0006605 | 3300048915 | Bacteria | 10208 |
| 906 | Ga0496112_0009460 | 3300048915 | Bacteria | 8783 |
| 907 | Ga0496112_0624308 | 3300048915 | Unclassified | 1008 |
| 908 | Ga0496113_0004968 | 3300048916 | Bacteria | 8242 |
| 909 | Ga0496113_0034635 | 3300048916 | Bacteria | 3685 |
| 910 | Ga0496113_0045130 | 3300048916 | Bacteria | 3267 |
| 911 | Ga0496113_0058019 | 3300048916 | Bacteria | 2911 |
| 912 | Ga0496113_0063744 | 3300048916 | Unclassified | 2785 |
| 913 | Ga0496113_0133067 | 3300048916 | Bacteria | 1953 |
| 914 | Ga0496113_0276091 | 3300048916 | Bacteria | 1343 |
| 915 | Ga0496114_0000928 | 3300048917 | Bacteria | 21913 |
| 916 | Ga0496114_0009782 | 3300048917 | Bacteria | 7617 |
| 917 | Ga0496114_0080883 | 3300048917 | Bacteria | 2744 |
| 918 | Ga0496115_0000667 | 3300048918 | Bacteria | 25359 |
| 919 | Ga0496115_0010445 | 3300048918 | Bacteria | 6938 |
| 920 | Ga0496115_0025523 | 3300048918 | Bacteria | 4601 |
| 921 | Ga0496115_0029013 | 3300048918 | Bacteria | 4342 |
| 922 | Ga0496115_0134465 | 3300048918 | Bacteria | 2039 |
| 923 | Ga0496115_0321672 | 3300048918 | Unclassified | 1265 |
| 924 | Ga0496115_0459270 | 3300048918 | Unclassified | 1027 |
| 925 | Ga0496126_0089821 | 3300048929 | Bacteria | 2704 |
| 926 | Ga0501031_0010487 | 3300049568 | Bacteria | 6036 |
| 927 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 928 | Ga0501032_0064310 | 3300049569 | Bacteria | 2455 |
| 929 | Ga0501032_0126310 | 3300049569 | Bacteria | 1689 |
| 930 | Ga0501033_0000515 | 3300049570 | Bacteria | 36220 |
| 931 | Ga0501033_0007008 | 3300049570 | Bacteria | 8800 |
| 932 | Ga0501034_0000023 | 3300049571 | Bacteria | 263892 |
| 933 | Ga0501034_0245997 | 3300049571 | Bacteria | 1734 |
| 934 | Ga0501034_0366818 | 3300049571 | Bacteria | 1366 |
| 935 | Ga0501036_0032817 | 3300049572 | Bacteria | 4389 |
| 936 | Ga0501036_0076480 | 3300049572 | Bacteria | 2831 |
| 937 | Ga0501037_0000065 | 3300049573 | Bacteria | 96747 |
| 938 | Ga0501038_0002005 | 3300049574 | Bacteria | 18789 |
| 939 | Ga0501038_0014065 | 3300049574 | Bacteria | 7292 |
| 940 | Ga0501038_0058445 | 3300049574 | Bacteria | 3306 |
| 941 | Ga0501038_0116498 | 3300049574 | Bacteria | 2208 |
| 942 | Ga0501038_0458148 | 3300049574 | Bacteria | 980 |
| 943 | Ga0501039_0000022 | 3300049575 | Bacteria | 160858 |
| 944 | Ga0501039_0057042 | 3300049575 | Bacteria | 3025 |
| 945 | Ga0501039_0283953 | 3300049575 | Bacteria | 1301 |
| 946 | Ga0501039_0370654 | 3300049575 | Bacteria | 1125 |
| 947 | Ga0501041_0159212 | 3300049577 | Unclassified | 1411 |
| 948 | Ga0501041_0302229 | 3300049577 | Bacteria | 1008 |
| 949 | Ga0501042_0138742 | 3300049578 | Bacteria | 1753 |
| 950 | Ga0501043_0000093 | 3300049579 | Bacteria | 80521 |
| 951 | Ga0501046_0006925 | 3300049580 | Bacteria | 9990 |
| 952 | Ga0501047_0197541 | 3300049581 | Bacteria | 1873 |
| 953 | Ga0501047_0287845 | 3300049581 | Bacteria | 1487 |
| 954 | Ga0501048_0002288 | 3300049582 | Bacteria | 14613 |
| 955 | Ga0501048_0199264 | 3300049582 | Bacteria | 1419 |
| 956 | Ga0501067_0014486 | 3300049583 | Bacteria | 4365 |
| 957 | Ga0501068_0007260 | 3300049584 | Bacteria | 6137 |
| 958 | Ga0501069_0013029 | 3300049585 | Bacteria | 4430 |
| 959 | Ga0501070_0075537 | 3300049586 | Bacteria | 2790 |
| 960 | Ga0501070_0128149 | 3300049586 | Bacteria | 2097 |
| 961 | Ga0501071_0287920 | 3300049587 | Bacteria | 1244 |
| 962 | Ga0501071_0337213 | 3300049587 | Bacteria | 1146 |
| 963 | Ga0501073_0076635 | 3300049589 | Bacteria | 2326 |
| 964 | Ga0501073_0161707 | 3300049589 | Bacteria | 1551 |
| 965 | Ga0501074_0003219 | 3300049590 | Bacteria | 11530 |
| 966 | Ga0501075_0079327 | 3300049591 | Bacteria | 2485 |
| 967 | Ga0501075_0488893 | 3300049591 | Bacteria | 939 |
| 968 | Ga0501076_0033914 | 3300049592 | Bacteria | 3987 |
| 969 | Ga0501076_0318996 | 3300049592 | Bacteria | 1275 |
| 970 | Ga0501077_0003399 | 3300049593 | Bacteria | 9566 |
| 971 | Ga0501077_0046578 | 3300049593 | Bacteria | 2755 |
| 972 | Ga0501077_0180378 | 3300049593 | Bacteria | 1342 |
| 973 | Ga0501079_0029518 | 3300049741 | Bacteria | 4210 |
| 974 | Ga0501079_0551114 | 3300049741 | Bacteria | 907 |
| 975 | Ga0501081_0135163 | 3300049743 | Bacteria | 1765 |
| 976 | Ga0501035_0000336 | 3300049822 | Bacteria | 54776 |
| 977 | Ga0501044_0001021 | 3300049823 | Bacteria | 33699 |
| 978 | Ga0501044_0200543 | 3300049823 | Bacteria | 1954 |
| 979 | Ga0501044_0253795 | 3300049823 | Bacteria | 1698 |
| 980 | Ga0501044_0396408 | 3300049823 | Bacteria | 1293 |
| 981 | Ga0501045_0013355 | 3300049824 | Bacteria | 5799 |
| 982 | nmdc:mga03683_52066_c1 | 3300050489 | Bacteria | 1711 |
| 983 | nmdc:mga00v17_30922_c1 | 3300050491 | Bacteria | 3154 |
| 984 | nmdc:mga0yw44_55006_c1 | 3300050492 | Bacteria | 2421 |
| 985 | nmdc:mga0yw44_918_c1 | 3300050492 | Bacteria | 11147 |
| 986 | nmdc:mga0k408_108352_c1 | 3300050493 | Bacteria | 1641 |
| 987 | nmdc:mga0k408_4295_c1 | 3300050493 | Bacteria | 7567 |
| 988 | nmdc:mga0k408_68849_c1 | 3300050493 | Bacteria | 2065 |
| 989 | nmdc:mga06z11_16410_c1 | 3300050494 | Bacteria | 3335 |
| 990 | nmdc:mga06z11_22339_c1 | 3300050494 | Bacteria | 2954 |
| 991 | nmdc:mga06z11_8019_c1 | 3300050494 | Bacteria | 4379 |
| 992 | nmdc:mga04h51_8228_c1 | 3300050495 | Bacteria | 2785 |
| 993 | nmdc:mga07m45_18954_c1 | 3300050496 | Bacteria | 3724 |
| 994 | nmdc:mga07m45_60813_c1 | 3300050496 | Bacteria | 2139 |
| 995 | nmdc:mga05p37_162898_c1 | 3300050507 | Bacteria | 2176 |
| 996 | nmdc:mga05p37_191383_c1 | 3300050507 | Bacteria | 2483 |
| 997 | nmdc:mga05p37_26421_c1 | 3300050507 | Bacteria | 7062 |
| 998 | nmdc:mga05p37_47186_c1 | 3300050507 | Bacteria | 5297 |
| 999 | nmdc:mga05p37_64007_c1 | 3300050507 | Bacteria | 4525 |
| 1000 | nmdc:mga05p37_660009_c1 | 3300050507 | Bacteria | 1169 |
| 1001 | nmdc:mga05p37_69_c2 | 3300050507 | Bacteria | 32137 |
| 1002 | nmdc:mga05p37_83478_c1 | 3300050507 | Bacteria | 3936 |
| 1003 | nmdc:mga09592_1744_c1 | 3300050508 | Bacteria | 17486 |
| 1004 | nmdc:mga09592_67827_c1 | 3300050508 | Bacteria | 3026 |
| 1005 | nmdc:mga09592_95436_c1 | 3300050508 | Bacteria | 2544 |
| 1006 | nmdc:mga0qj67_1033_c1 | 3300050509 | Bacteria | 19245 |
| 1007 | nmdc:mga0qj67_323519_c1 | 3300050509 | Bacteria | 1248 |
| 1008 | nmdc:mga0qj67_37_c1 | 3300050509 | Bacteria | 92978 |
| 1009 | nmdc:mga0qj67_3998_c1 | 3300050509 | Bacteria | 10676 |
| 1010 | nmdc:mga0qj67_67208_c1 | 3300050509 | Bacteria | 2856 |
| 1011 | nmdc:mga06r32_235285_c1 | 3300050510 | Bacteria | 1819 |
| 1012 | nmdc:mga06r32_544884_c1 | 3300050510 | Unclassified | 1134 |
| 1013 | nmdc:mga06r32_6015_c1 | 3300050510 | Bacteria | 10916 |
| 1014 | nmdc:mga08y16_190481_c1 | 3300050511 | Bacteria | 2127 |
| 1015 | nmdc:mga08y16_25098_c1 | 3300050511 | Bacteria | 6287 |
| 1016 | nmdc:mga08y16_27814_c1 | 3300050511 | Bacteria | 5959 |
| 1017 | nmdc:mga08y16_80954_c1 | 3300050511 | Bacteria | 3386 |
| 1018 | nmdc:mga08y16_891_c1 | 3300050511 | Bacteria | 28805 |
| 1019 | nmdc:mga08y16_948514_c1 | 3300050511 | Bacteria | 844 |
| 1020 | nmdc:mga0n895_113390_c1 | 3300050512 | Bacteria | 2728 |
| 1021 | nmdc:mga0n895_135077_c1 | 3300050512 | Bacteria | 2493 |
| 1022 | nmdc:mga0n895_289541_c1 | 3300050512 | Bacteria | 1661 |
| 1023 | nmdc:mga0n895_29192_c1 | 3300050512 | Bacteria | 5257 |
| 1024 | nmdc:mga0n895_44_c1 | 3300050512 | Bacteria | 74241 |
| 1025 | nmdc:mga0n895_769_c1 | 3300050512 | Bacteria | 22759 |
| 1026 | nmdc:mga0n895_98430_c1 | 3300050512 | Bacteria | 2932 |
| 1027 | nmdc:mga0rr50_124159_c1 | 3300050513 | Bacteria | 2059 |
| 1028 | nmdc:mga0rr50_273231_c1 | 3300050513 | Bacteria | 1409 |
| 1029 | nmdc:mga0rr50_297295_c1 | 3300050513 | Bacteria | 1350 |
| 1030 | nmdc:mga0rr50_37935_c1 | 3300050513 | Bacteria | 3482 |
| 1031 | nmdc:mga0rr50_47953_c1 | 3300050513 | Bacteria | 3155 |
| 1032 | nmdc:mga0rr50_621046_c1 | 3300050513 | Unclassified | 922 |
| 1033 | nmdc:mga08x19_11978_c1 | 3300050514 | Bacteria | 5219 |
| 1034 | nmdc:mga08x19_123526_c1 | 3300050514 | Bacteria | 1737 |
| 1035 | nmdc:mga08x19_296160_c1 | 3300050514 | Bacteria | 1123 |
| 1036 | nmdc:mga08x19_40712_c1 | 3300050514 | Bacteria | 2958 |
| 1037 | nmdc:mga08x19_96802_c1 | 3300050514 | Bacteria | 1954 |
| 1038 | nmdc:mga0a205_120508_c1 | 3300050515 | Bacteria | 2523 |
| 1039 | nmdc:mga0a205_247_c1 | 3300050515 | Bacteria | 38521 |
| 1040 | nmdc:mga0a205_37931_c1 | 3300050515 | Bacteria | 4634 |
| 1041 | nmdc:mga0a205_4580_c1 | 3300050515 | Bacteria | 12399 |
| 1042 | nmdc:mga0sz30_15572_c2 | 3300050516 | Bacteria | 2099 |
| 1043 | Ga0495601_0000003 | 3300053077 | Bacteria | 493642 |
| 1044 | Ga0495601_0000151 | 3300053077 | Bacteria | 38914 |
| 1045 | Ga0495601_0000398 | 3300053077 | Bacteria | 23035 |
| 1046 | Ga0495601_0006487 | 3300053077 | Bacteria | 6844 |
| 1047 | Ga0495601_0008245 | 3300053077 | Bacteria | 6148 |
| 1048 | Ga0495601_0018815 | 3300053077 | Bacteria | 4206 |
| 1049 | Ga0495601_0068660 | 3300053077 | Bacteria | 2259 |
| 1050 | Ga0495612_0000009 | 3300053078 | Bacteria | 229858 |
| 1051 | Ga0495612_0001511 | 3300053078 | Bacteria | 9570 |
| 1052 | Ga0495655_0018187 | 3300053083 | Bacteria | 1541 |
| 1053 | Ga0495655_0073699 | 3300053083 | Unclassified | 960 |
| 1054 | Ga0495595_0000075 | 3300053084 | Bacteria | 48300 |
| 1055 | Ga0495595_0000226 | 3300053084 | Bacteria | 22467 |
| 1056 | Ga0495595_0018508 | 3300053084 | Bacteria | 3011 |
| 1057 | Ga0495595_0030840 | 3300053084 | Bacteria | 2406 |
| 1058 | Ga0495619_0000039 | 3300053085 | Bacteria | 118681 |
| 1059 | Ga0495619_0000086 | 3300053085 | Bacteria | 69774 |
| 1060 | Ga0495619_0000379 | 3300053085 | Bacteria | 30688 |
| 1061 | Ga0495619_0001781 | 3300053085 | Bacteria | 14325 |
| 1062 | Ga0500562_005751 | 3300053108 | Bacteria | 3121 |
| 1063 | Ga0500595_041249 | 3300053119 | Bacteria | 1484 |
| 1064 | Ga0500658_0085423 | 3300053134 | Bacteria | 1357 |
| 1065 | Ga0500645_000099 | 3300053730 | Bacteria | 68426 |
| 1066 | Ga0501084_0019616 | 3300054114 | Bacteria | 5634 |
| 1067 | Ga0501084_0033970 | 3300054114 | Bacteria | 4265 |
| 1068 | Ga0501084_0056755 | 3300054114 | Bacteria | 3276 |
| 1069 | Ga0501082_0022891 | 3300060353 | Bacteria | 5383 |
| 1070 | Ga0530510_0062042 | 3300061734 | Bacteria | 2706 |
| 1071 | Ga0530510_0109978 | 3300061734 | Bacteria | 2018 |
| 1072 | Ga0501035_0317066 | |||
| 1073 | JGI24741J21665_1008381 | |||
| 1074 | JGI24752J21851_1003823 | |||
| 1075 | JGI24746J21847_1000120 | |||
| 1076 | JGI24740J21852_10067766 | |||
| 1077 | JGI24739J22299_10000176 | |||
| 1078 | JGI24737J22298_10000190 | |||
| 1079 | JGI24743J22301_10028038 | |||
| 1080 | JGI24750J21931_1000450 | |||
| 1081 | JGI24748J21848_1000227 | |||
| 1082 | JGI24738J21930_10000193 | |||
| 1083 | JGI24749J21850_1000755 | |||
| 1084 | JGI24744J21845_10001617 | |||
| 1085 | JGI24744J21845_10017010 | |||
| 1086 | JGI24035J26624_1000163 | |||
| 1087 | JGI24034J26672_10002430 | |||
| 1088 | JGI24742J22300_10004712 | |||
| 1089 | JGI24751J29686_10002684 | |||
| 1090 | JGI24751J29686_10025703 | |||
| 1091 | JGI25405J52794_10049024 | |||
| 1092 | Ga0065704_10167307 | |||
| 1093 | Ga0065712_10000779 | |||
| 1094 | Ga0065712_10102865 | |||
| 1095 | Ga0065715_10089014 | |||
| 1096 | Ga0070676_10004465 | |||
| 1097 | Ga0070676_10044243 | |||
| 1098 | Ga0070683_100000173 | |||
| 1099 | Ga0070683_100039525 | |||
| 1100 | Ga0070683_100051833 | |||
| 1101 | Ga0070690_100001979 | |||
| 1102 | Ga0070670_100010494 | |||
| 1103 | Ga0070677_10000054 | |||
| 1104 | Ga0068869_100000316 | |||
| 1105 | Ga0068869_100163636 | |||
| 1106 | Ga0070666_10012204 | |||
| 1107 | Ga0070666_10303714 | |||
| 1108 | Ga0070680_100006219 | |||
| 1109 | Ga0070680_100221265 | |||
| 1110 | Ga0070680_100542331 | |||
| 1111 | Ga0070682_100001435 | |||
| 1112 | Ga0070682_100127927 | |||
| 1113 | Ga0068868_100000176 | |||
| 1114 | Ga0068868_100213697 | |||
| 1115 | Ga0068868_100316046 | |||
| 1116 | Ga0070660_100000595 | |||
| 1117 | Ga0070660_100143899 | |||
| 1118 | Ga0070689_100000116 | |||
| 1119 | Ga0070689_100396606 | |||
| 1120 | Ga0070689_100575718 | |||
| 1121 | Ga0070691_10003422 | |||
| 1122 | Ga0070691_10206891 | |||
| 1123 | Ga0070687_100000232 | |||
| 1124 | Ga0070687_100030450 | |||
| 1125 | Ga0070687_100096957 | |||
| 1126 | Ga0070661_100000680 | |||
| 1127 | Ga0070661_100029004 | |||
| 1128 | Ga0070661_100080428 | |||
| 1129 | Ga0070692_10000138 | |||
| 1130 | Ga0070692_10267264 | |||
| 1131 | Ga0070668_100001184 | |||
| 1132 | Ga0070668_100328130 | |||
| 1133 | Ga0070669_100002530 | |||
| 1134 | Ga0070675_100000398 | |||
| 1135 | Ga0070675_100535772 | |||
| 1136 | Ga0070671_100000708 | |||
| 1137 | Ga0070671_100023382 | |||
| 1138 | Ga0070674_100000672 | |||
| 1139 | Ga0070674_100052962 | |||
| 1140 | Ga0070674_100111998 | |||
| 1141 | Ga0070673_100000199 | |||
| 1142 | Ga0070673_100024556 | |||
| 1143 | Ga0070673_100049799 | |||
| 1144 | Ga0070673_100257620 | |||
| 1145 | Ga0070688_100002526 | |||
| 1146 | Ga0070688_100016957 | |||
| 1147 | Ga0070659_100000476 | |||
| 1148 | Ga0070667_100003351 | |||
| 1149 | Ga0070667_100161020 | |||
| 1150 | Ga0070667_100236316 | |||
| 1151 | Ga0070703_10016756 | |||
| 1152 | Ga0070709_10008770 | |||
| 1153 | Ga0070709_10209216 | |||
| 1154 | Ga0070709_10253003 | |||
| 1155 | Ga0070714_100089689 | |||
| 1156 | Ga0070714_100118740 | |||
| 1157 | Ga0070714_100235083 | |||
| 1158 | Ga0070713_100000368 | |||
| 1159 | Ga0070713_100088482 | |||
| 1160 | Ga0070713_100487046 | |||
| 1161 | Ga0070710_10033625 | |||
| 1162 | Ga0070710_10042930 | |||
| 1163 | Ga0070710_10144142 | |||
| 1164 | Ga0070710_10262588 | |||
| 1165 | Ga0070701_10000211 | |||
| 1166 | Ga0070701_10032677 | |||
| 1167 | Ga0070701_10214452 | |||
| 1168 | Ga0070711_100034978 | |||
| 1169 | Ga0070711_100036661 | |||
| 1170 | Ga0070711_100322066 | |||
| 1171 | Ga0070705_100000446 | |||
| 1172 | Ga0070700_100000490 | |||
| 1173 | Ga0070700_100227883 | |||
| 1174 | Ga0070694_100001164 | |||
| 1175 | Ga0070708_100049088 | |||
| 1176 | Ga0070708_100406314 | |||
| 1177 | Ga0070663_100000546 | |||
| 1178 | Ga0070663_100101191 | |||
| 1179 | Ga0070678_100000142 | |||
| 1180 | Ga0070678_100017253 | |||
| 1181 | Ga0070662_100012272 | |||
| 1182 | Ga0070662_100055926 | |||
| 1183 | Ga0070681_10000980 | |||
| 1184 | Ga0070681_10021188 | |||
| 1185 | Ga0070681_10040733 | |||
| 1186 | Ga0070681_10356822 | |||
| 1187 | Ga0070681_10703697 | |||
| 1188 | Ga0068867_100001587 | |||
| 1189 | Ga0068867_100043695 | |||
| 1190 | Ga0070685_10000603 | |||
| 1191 | Ga0070685_10279786 | |||
| 1192 | Ga0070698_100031369 | |||
| 1193 | Ga0070679_100002691 | |||
| 1194 | Ga0070679_100016776 | |||
| 1195 | Ga0070679_100031424 | |||
| 1196 | Ga0070679_100035045 | |||
| 1197 | Ga0070679_100129911 | |||
| 1198 | Ga0070679_100278968 | |||
| 1199 | Ga0070679_100353108 | |||
| 1200 | Ga0070679_100525541 | |||
| 1201 | Ga0070684_100000146 | |||
| 1202 | Ga0070684_100346793 | |||
| 1203 | Ga0068853_100002495 | |||
| 1204 | Ga0070672_100000063 | |||
| 1205 | Ga0070672_100049971 | |||
| 1206 | Ga0070672_100053875 | |||
| 1207 | Ga0070686_100000695 | |||
| 1208 | Ga0070695_100000044 | |||
| 1209 | Ga0070695_100100933 | |||
| 1210 | Ga0070696_100004713 | |||
| 1211 | Ga0070693_100000297 | |||
| 1212 | Ga0070693_100004176 | |||
| 1213 | Ga0070665_100257174 | |||
| 1214 | Ga0070704_100000520 | |||
| 1215 | Ga0070704_100318710 | |||
| 1216 | Ga0070704_100449010 | |||
| 1217 | Ga0068855_100057301 | |||
| 1218 | Ga0068855_100232463 | |||
| 1219 | Ga0070664_100000287 | |||
| 1220 | Ga0068857_100000332 | |||
| 1221 | Ga0068857_100563504 | |||
| 1222 | Ga0068854_100000493 | |||
| 1223 | Ga0068854_100223760 | |||
| 1224 | Ga0068856_100001778 | |||
| 1225 | Ga0068856_100139637 | |||
| 1226 | Ga0070702_100000060 | |||
| 1227 | Ga0070702_100073847 | |||
| 1228 | Ga0070702_100075108 | |||
| 1229 | Ga0068852_100002718 | |||
| 1230 | Ga0068859_100002562 | |||
| 1231 | Ga0068859_100080058 | |||
| 1232 | Ga0068859_100106590 | |||
| 1233 | Ga0068864_100000316 | |||
| 1234 | Ga0068864_100012805 | |||
| 1235 | Ga0068864_100024748 | |||
| 1236 | Ga0068864_100262336 | |||
| 1237 | Ga0068864_100484362 | |||
| 1238 | Ga0068866_10000272 | |||
| 1239 | Ga0068866_10053048 | |||
| 1240 | Ga0068866_10064399 | |||
| 1241 | Ga0068861_100005790 | |||
| 1242 | Ga0068861_100187979 | |||
| 1243 | Ga0068851_10116115 | |||
| 1244 | Ga0068870_10000420 | |||
| 1245 | Ga0068870_10053014 | |||
| 1246 | Ga0068863_100000334 | |||
| 1247 | Ga0068863_100169061 | |||
| 1248 | Ga0068863_100590377 | |||
| 1249 | Ga0068858_100003943 | |||
| 1250 | Ga0068860_100000816 | |||
| 1251 | Ga0068860_100036965 | |||
| 1252 | Ga0068860_100323262 | |||
| 1253 | Ga0068862_100000672 | |||
| 1254 | Ga0068862_100096724 | |||
| 1255 | Ga0081455_10001860 | |||
| 1256 | Ga0081455_10010994 | |||
| 1257 | Ga0081455_10066862 | |||
| 1258 | Ga0081455_10106038 | |||
| 1259 | Ga0081538_10005426 | |||
| 1260 | Ga0081538_10023338 | |||
| 1261 | Ga0081538_10044624 | |||
| 1262 | Ga0081540_1074143 | |||
| 1263 | Ga0070717_10005996 | |||
| 1264 | Ga0070717_10056864 | |||
| 1265 | Ga0070717_10121589 | |||
| 1266 | Ga0075365_10011942 | |||
| 1267 | Ga0075365_10038703 | |||
| 1268 | Ga0075365_10085494 | |||
| 1269 | Ga0075365_10130574 | |||
| 1270 | Ga0075368_10027421 | |||
| 1271 | Ga0075368_10108112 | |||
| 1272 | Ga0075363_100051278 | |||
| 1273 | Ga0075363_100112741 | |||
| 1274 | Ga0075364_10032091 | |||
| 1275 | Ga0075364_10282458 | |||
| 1276 | Ga0075432_10002355 | |||
| 1277 | Ga0070715_10007706 | |||
| 1278 | Ga0070715_10057951 | |||
| 1279 | Ga0070715_10173963 | |||
| 1280 | Ga0070716_100031571 | |||
| 1281 | Ga0070716_100068505 | |||
| 1282 | Ga0070716_100124361 | |||
| 1283 | Ga0070712_100019966 | |||
| 1284 | Ga0070712_100062755 | |||
| 1285 | Ga0070712_100141436 | |||
| 1286 | Ga0070712_100223176 | |||
| 1287 | Ga0070712_100271171 | |||
| 1288 | Ga0075362_10040601 | |||
| 1289 | Ga0075367_10006771 | |||
| 1290 | Ga0075367_10028695 | |||
| 1291 | Ga0075369_10012309 | |||
| 1292 | Ga0075366_10052396 | |||
| 1293 | Ga0075366_10086855 | |||
| 1294 | Ga0097621_100000019 | |||
| 1295 | Ga0097621_100019564 | |||
| 1296 | Ga0097621_100236910 | |||
| 1297 | Ga0075370_10045017 | |||
| 1298 | Ga0075370_10045594 | |||
| 1299 | Ga0075370_10064509 | |||
| 1300 | Ga0075370_10078861 | |||
| 1301 | Ga0075370_10142477 | |||
| 1302 | Ga0075370_10320235 | |||
| 1303 | Ga0068871_100000293 | |||
| 1304 | Ga0068871_100013376 | |||
| 1305 | Ga0068871_100054862 | |||
| 1306 | Ga0075428_100051979 | |||
| 1307 | Ga0075428_100106765 | |||
| 1308 | Ga0075428_100124897 | |||
| 1309 | Ga0075428_100274931 | |||
| 1310 | Ga0075428_100387815 | |||
| 1311 | Ga0075430_100000293 | |||
| 1312 | Ga0075430_100000327 | |||
| 1313 | Ga0075430_100082249 | |||
| 1314 | Ga0075430_100355873 | |||
| 1315 | Ga0075431_100005554 | |||
| 1316 | Ga0075431_100015952 | |||
| 1317 | Ga0075431_100114318 | |||
| 1318 | Ga0075431_100213988 | |||
| 1319 | Ga0075431_100752788 | |||
| 1320 | Ga0075433_10012481 | |||
| 1321 | Ga0075433_10014765 | |||
| 1322 | Ga0075433_10405521 | |||
| 1323 | Ga0075434_100000042 | |||
| 1324 | Ga0075434_100008550 | |||
| 1325 | Ga0075434_100013525 | |||
| 1326 | Ga0075434_100045938 | |||
| 1327 | Ga0075434_100124982 | |||
| 1328 | Ga0075429_100025101 | |||
| 1329 | Ga0075429_100063005 | |||
| 1330 | Ga0075429_100187529 | |||
| 1331 | Ga0068865_100000183 | |||
| 1332 | Ga0068865_100003957 | |||
| 1333 | Ga0075436_100031580 | |||
| 1334 | Ga0075436_100035442 | |||
| 1335 | Ga0097620_100002562 | |||
| 1336 | Ga0097620_100080058 | |||
| 1337 | Ga0097620_100106592 | |||
| 1338 | Ga0075435_100139260 | |||
| 1339 | Ga0075435_100139484 | |||
| 1340 | Ga0075435_100177948 | |||
| 1341 | Ga0075435_100295818 | |||
| 1342 | Ga0075435_100653054 | |||
| 1343 | Ga0099795_10000484 | |||
| 1344 | Ga0105251_10096278 | |||
| 1345 | Ga0105244_10015753 | |||
| 1346 | Ga0105250_10008874 | |||
| 1347 | Ga0105240_10015725 | |||
| 1348 | Ga0105240_10306754 | |||
| 1349 | Ga0111539_10001254 | |||
| 1350 | Ga0111539_10002524 | |||
| 1351 | Ga0111539_10035317 | |||
| 1352 | Ga0111539_10042413 | |||
| 1353 | Ga0111539_10200789 | |||
| 1354 | Ga0105245_10000142 | |||
| 1355 | Ga0105245_10044321 | |||
| 1356 | Ga0105245_10205717 | |||
| 1357 | Ga0105245_10294830 | |||
| 1358 | Ga0105245_10488443 | |||
| 1359 | Ga0105245_10808618 | |||
| 1360 | Ga0105247_10008521 | |||
| 1361 | Ga0105247_10065809 | |||
| 1362 | Ga0105247_10078830 | |||
| 1363 | Ga0105247_10173983 | |||
| 1364 | Ga0114129_10017130 | |||
| 1365 | Ga0114129_10024961 | |||
| 1366 | Ga0114129_10072678 | |||
| 1367 | Ga0114129_10120613 | |||
| 1368 | Ga0114129_10212088 | |||
| 1369 | Ga0114129_10666835 | |||
| 1370 | Ga0114129_10999293 | |||
| 1371 | Ga0105243_10000376 | |||
| 1372 | Ga0105243_10011332 | |||
| 1373 | Ga0105243_10157139 | |||
| 1374 | Ga0105243_10675892 | |||
| 1375 | Ga0105241_10001391 | |||
| 1376 | Ga0105241_10169691 | |||
| 1377 | Ga0105241_10207278 | |||
| 1378 | Ga0105242_10000380 | |||
| 1379 | Ga0105242_10049109 | |||
| 1380 | Ga0105242_10093079 | |||
| 1381 | Ga0105242_10108558 | |||
| 1382 | Ga0105248_10000549 | |||
| 1383 | Ga0105248_10103414 | |||
| 1384 | Ga0105248_10253098 | |||
| 1385 | Ga0105248_10597598 | |||
| 1386 | Ga0105237_10342498 | |||
| 1387 | Ga0105238_10036077 | |||
| 1388 | Ga0105238_10575363 | |||
| 1389 | Ga0105238_10705387 | |||
| 1390 | Ga0105249_10001601 | |||
| 1391 | Ga0105249_10069791 | |||
| 1392 | Ga0105249_10374038 | |||
| 1393 | Ga0099796_10012112 | |||
| 1394 | Ga0105239_10000656 | |||
| 1395 | Ga0105239_10255639 | |||
| 1396 | Ga0105239_10279321 | |||
| 1397 | Ga0105239_10719111 | |||
| 1398 | Ga0105246_10000027 | |||
| 1399 | Ga0105246_10046442 | |||
| 1400 | Ga0157373_10007428 | |||
| 1401 | Ga0157373_10020687 | |||
| 1402 | Ga0157371_10019225 | |||
| 1403 | Ga0157369_10152310 | |||
| 1404 | Ga0157374_10015586 | |||
| 1405 | Ga0157374_10051895 | |||
| 1406 | Ga0157374_10084337 | |||
| 1407 | Ga0157374_10112264 | |||
| 1408 | Ga0157378_10000786 | |||
| 1409 | Ga0157378_10286430 | |||
| 1410 | Ga0163162_10002019 | |||
| 1411 | Ga0163162_10155857 | |||
| 1412 | Ga0163162_10388696 | |||
| 1413 | Ga0157372_10028341 | |||
| 1414 | Ga0157372_11094181 | |||
| 1415 | Ga0157375_10000293 | |||
| 1416 | Ga0157375_10273733 | |||
| 1417 | Ga0157375_10521759 | |||
| 1418 | Ga0163163_10000482 | |||
| 1419 | Ga0163163_10006324 | |||
| 1420 | Ga0163163_10013569 | |||
| 1421 | Ga0163163_10027715 | |||
| 1422 | Ga0163163_10183734 | |||
| 1423 | Ga0157380_10000927 | |||
| 1424 | Ga0157380_10208236 | |||
| 1425 | Ga0157380_10384053 | |||
| 1426 | Ga0182008_10040088 | |||
| 1427 | Ga0157377_10000136 | |||
| 1428 | Ga0157379_10001911 | |||
| 1429 | Ga0157379_10016208 | |||
| 1430 | Ga0157379_10145202 | |||
| 1431 | Ga0157379_10154441 | |||
| 1432 | Ga0157379_10476013 | |||
| 1433 | Ga0157376_10000073 | |||
| 1434 | Ga0157376_10040052 | |||
| 1435 | Ga0157376_10046917 | |||
| 1436 | Ga0163161_10000476 | |||
| 1437 | Ga0163161_10128307 | |||
| 1438 | Ga0163161_10198527 | |||
| 1439 | Ga0206353_11138709 | |||
| 1440 | Ga0213876_10003884 | |||
| 1441 | Ga0213876_10299770 | |||
| 1442 | Ga0207666_1000055 | |||
| 1443 | Ga0207673_1000158 | |||
| 1444 | Ga0209758_1000370 | |||
| 1445 | Ga0207426_1088694 | |||
| 1446 | Ga0207697_10000622 | |||
| 1447 | Ga0207656_10033741 | |||
| 1448 | Ga0207696_1047998 | |||
| 1449 | Ga0207655_1029921 | |||
| 1450 | Ga0207653_10001943 | |||
| 1451 | Ga0207682_10000074 | |||
| 1452 | Ga0207692_10007770 | |||
| 1453 | Ga0207692_10134218 | |||
| 1454 | Ga0207642_10011274 | |||
| 1455 | Ga0207642_10039025 | |||
| 1456 | Ga0207642_10084655 | |||
| 1457 | Ga0207642_10087769 | |||
| 1458 | Ga0207710_10002334 | |||
| 1459 | Ga0207710_10013487 | |||
| 1460 | Ga0207710_10045112 | |||
| 1461 | Ga0207688_10000423 | |||
| 1462 | Ga0207688_10031180 | |||
| 1463 | Ga0207688_10065182 | |||
| 1464 | Ga0207680_10004765 | |||
| 1465 | Ga0207680_10149159 | |||
| 1466 | Ga0207680_10363187 | |||
| 1467 | Ga0207647_10005297 | |||
| 1468 | Ga0207647_10014286 | |||
| 1469 | Ga0207685_10006352 | |||
| 1470 | Ga0207685_10029984 | |||
| 1471 | Ga0207699_10008676 | |||
| 1472 | Ga0207699_10030445 | |||
| 1473 | Ga0207699_10070486 | |||
| 1474 | Ga0207699_10113108 | |||
| 1475 | Ga0207699_10260214 | |||
| 1476 | Ga0207645_10000291 | |||
| 1477 | Ga0207645_10023307 | |||
| 1478 | Ga0207643_10000116 | |||
| 1479 | Ga0207643_10000872 | |||
| 1480 | Ga0207705_10144176 | |||
| 1481 | Ga0207654_10000917 | |||
| 1482 | Ga0207654_10108762 | |||
| 1483 | Ga0207707_10000563 | |||
| 1484 | Ga0207707_10480923 | |||
| 1485 | Ga0207695_10031303 | |||
| 1486 | Ga0207693_10005802 | |||
| 1487 | Ga0207693_10038010 | |||
| 1488 | Ga0207693_10044565 | |||
| 1489 | Ga0207693_10068060 | |||
| 1490 | Ga0207693_10070555 | |||
| 1491 | Ga0207693_10131345 | |||
| 1492 | Ga0207663_10005835 | |||
| 1493 | Ga0207663_10132045 | |||
| 1494 | Ga0207660_10000043 | |||
| 1495 | Ga0207660_10000134 | |||
| 1496 | Ga0207660_10030574 | |||
| 1497 | Ga0207662_10000386 | |||
| 1498 | Ga0207662_10007580 | |||
| 1499 | Ga0207662_10028910 | |||
| 1500 | Ga0207657_10002520 | |||
| 1501 | Ga0207657_10023526 | |||
| 1502 | Ga0207657_10081420 | |||
| 1503 | Ga0207649_10000204 | |||
| 1504 | Ga0207649_10347921 | |||
| 1505 | Ga0207652_10001156 | |||
| 1506 | Ga0207652_10093104 | |||
| 1507 | Ga0207652_10111291 | |||
| 1508 | Ga0207681_10000066 | |||
| 1509 | Ga0207694_10233225 | |||
| 1510 | Ga0207694_10451831 | |||
| 1511 | Ga0207650_10002222 | |||
| 1512 | Ga0207650_10002953 | |||
| 1513 | Ga0207659_10000100 | |||
| 1514 | Ga0207687_10000052 | |||
| 1515 | Ga0207687_10062086 | |||
| 1516 | Ga0207700_10001520 | |||
| 1517 | Ga0207700_10006951 | |||
| 1518 | Ga0207700_10116013 | |||
| 1519 | Ga0207700_10216496 | |||
| 1520 | Ga0207700_10338603 | |||
| 1521 | Ga0207664_10073355 | |||
| 1522 | Ga0207664_10139192 | |||
| 1523 | Ga0207664_10145011 | |||
| 1524 | Ga0207664_10189569 | |||
| 1525 | Ga0207664_10219186 | |||
| 1526 | Ga0207644_10000572 | |||
| 1527 | Ga0207644_10010069 | |||
| 1528 | Ga0207644_10082223 | |||
| 1529 | Ga0207644_10117391 | |||
| 1530 | Ga0207690_10000187 | |||
| 1531 | Ga0207690_10152722 | |||
| 1532 | Ga0207706_10003689 | |||
| 1533 | Ga0207706_10006344 | |||
| 1534 | Ga0207706_10073082 | |||
| 1535 | Ga0207686_10000331 | |||
| 1536 | Ga0207686_10049398 | |||
| 1537 | Ga0207686_10086964 | |||
| 1538 | Ga0207686_10334534 | |||
| 1539 | Ga0207709_10000243 | |||
| 1540 | Ga0207709_10130015 | |||
| 1541 | Ga0207670_10000140 | |||
| 1542 | Ga0207670_10022501 | |||
| 1543 | Ga0207670_10066542 | |||
| 1544 | Ga0207669_10000034 | |||
| 1545 | Ga0207704_10000108 | |||
| 1546 | Ga0207704_10107366 | |||
| 1547 | Ga0207665_10000860 | |||
| 1548 | Ga0207665_10006295 | |||
| 1549 | Ga0207665_10127648 | |||
| 1550 | Ga0207665_10145335 | |||
| 1551 | Ga0207665_10183122 | |||
| 1552 | Ga0207691_10001957 | |||
| 1553 | Ga0207691_10007735 | |||
| 1554 | Ga0207711_10001312 | |||
| 1555 | Ga0207711_10024752 | |||
| 1556 | Ga0207711_10210381 | |||
| 1557 | Ga0207711_10458193 | |||
| 1558 | Ga0207689_10000233 | |||
| 1559 | Ga0207689_10112768 | |||
| 1560 | Ga0207661_10000230 | |||
| 1561 | Ga0207661_10078867 | |||
| 1562 | Ga0207679_10000052 | |||
| 1563 | Ga0207679_10456428 | |||
| 1564 | Ga0207667_10009406 | |||
| 1565 | Ga0207667_10160054 | |||
| 1566 | Ga0207651_10000421 | |||
| 1567 | Ga0207651_10180490 | |||
| 1568 | Ga0207712_10000265 | |||
| 1569 | Ga0207712_10169791 | |||
| 1570 | Ga0207668_10000151 | |||
| 1571 | Ga0207668_10220372 | |||
| 1572 | Ga0207668_10413229 | |||
| 1573 | Ga0207640_10000129 | |||
| 1574 | Ga0207640_10247161 | |||
| 1575 | Ga0207640_10257825 | |||
| 1576 | Ga0207658_10005018 | |||
| 1577 | Ga0207658_10120838 | |||
| 1578 | Ga0207658_10246402 | |||
| 1579 | Ga0207677_10000349 | |||
| 1580 | Ga0207677_10042728 | |||
| 1581 | Ga0207703_10009975 | |||
| 1582 | Ga0207703_10307818 | |||
| 1583 | Ga0207703_10767429 | |||
| 1584 | Ga0207639_10000825 | |||
| 1585 | Ga0207678_10001156 | |||
| 1586 | Ga0207678_10003613 | |||
| 1587 | Ga0207678_10005238 | |||
| 1588 | Ga0207708_10001163 | |||
| 1589 | Ga0207708_10005514 | |||
| 1590 | Ga0207702_10001465 | |||
| 1591 | Ga0207641_10000468 | |||
| 1592 | Ga0207641_10038901 | |||
| 1593 | Ga0207641_10388206 | |||
| 1594 | Ga0207641_10441744 | |||
| 1595 | Ga0207648_10002454 | |||
| 1596 | Ga0207648_10026444 | |||
| 1597 | Ga0207648_10075360 | |||
| 1598 | Ga0207676_10000335 | |||
| 1599 | Ga0207676_10092500 | |||
| 1600 | Ga0207676_10150702 | |||
| 1601 | Ga0207674_10000639 | |||
| 1602 | Ga0207674_10058822 | |||
| 1603 | Ga0207674_10876963 | |||
| 1604 | Ga0207675_100001363 | |||
| 1605 | Ga0207683_10000048 | |||
| 1606 | Ga0207683_10006535 | |||
| 1607 | Ga0207683_10010853 | |||
| 1608 | Ga0207698_10003731 | |||
| 1609 | Ga0209973_1001466 | |||
| 1610 | Ga0209179_1040275 | |||
| 1611 | Ga0210002_1000574 | |||
| 1612 | Ga0209971_1006961 | |||
| 1613 | Ga0209998_10018758 | |||
| 1614 | Ga0209813_10006297 | |||
| 1615 | Ga0209974_10004320 | |||
| 1616 | Ga0207428_10000247 | |||
| 1617 | Ga0207428_10000784 | |||
| 1618 | Ga0207428_10041877 | |||
| 1619 | Ga0207428_10071073 | |||
| 1620 | Ga0268266_10196925 | |||
| 1621 | Ga0268266_10387008 | |||
| 1622 | Ga0268265_10000871 | |||
| 1623 | Ga0268265_10601816 | |||
| 1624 | Ga0268264_10000735 | |||
| 1625 | Ga0268264_10252765 | |||
| 1626 | Ga0265337_1001061 | |||
| 1627 | Ga0265338_10141636 | |||
| 1628 | Ga0265325_10000377 | |||
| 1629 | Ga0265325_10012333 | |||
| 1630 | Ga0265325_10017402 | |||
| 1631 | Ga0265340_10004931 | |||
| 1632 | Ga0265339_10019520 | |||
| 1633 | Ga0265339_10058544 | |||
| 1634 | Ga0265331_10009591 | |||
| 1635 | Ga0265313_10000218 | |||
| 1636 | Ga0265313_10012813 | |||
| 1637 | Ga0265313_10020380 | |||
| 1638 | Ga0265313_10096144 | |||
| 1639 | Ga0265314_10011277 | |||
| 1640 | Ga0265342_10078456 | |||
| 1641 | Ga0316583_10000148 | |||
| 1642 | Ga0373930_0004895 | |||
| 1643 | Ga0373948_0000531 | |||
| 1644 | Ga0373958_0007270 | |||
| 1645 | Ga0373938_0006041 | |||
| 1646 | Ga0373926_0024846 | |||
| 1647 | Ga0373926_0084708 | |||
| 1648 | Ga0373928_0001239 | |||
| 1649 | Ga0373929_0000881 | |||
| 1650 | Ga0373929_0011968 | |||
| 1651 | Ga0373929_0046096 | |||
| 1652 | Ga0373934_0047206 | |||
| 1653 | Ga0373940_0031448 | |||
| 1654 | Ga0373940_0048592 | |||
| 1655 | Ga0373944_0006259 | |||
| 1656 | Ga0373944_0007932 | |||
| 1657 | Ga0373951_0000290 | |||
| 1658 | Ga0373951_0006502 | |||
| 1659 | Ga0373952_0001526 | |||
| 1660 | Ga0373923_0002516 | |||
| 1661 | Ga0373923_0053206 | |||
| 1662 | Ga0373923_0111068 | |||
| 1663 | Ga0373932_0020873 | |||
| 1664 | Ga0373936_0000283 | |||
| 1665 | Ga0373939_0000192 | |||
| 1666 | Ga0373939_0011140 | |||
| 1667 | Ga0373939_0082668 | |||
| 1668 | Ga0373941_0000031 | |||
| 1669 | Ga0373945_0002393 | |||
| 1670 | Ga0373945_0017828 | |||
| 1671 | Ga0373953_0035231 | |||
| 1672 | Ga0373953_0039278 | |||
| 1673 | Ga0373954_0001724 | |||
| 1674 | Ga0373954_0024572 | |||
| 1675 | Ga0373954_0057463 | |||
| 1676 | Ga0373954_0073600 | |||
| 1677 | Ga0373954_0081541 | |||
| 1678 | Ga0373956_0023961 | |||
| 1679 | Ga0373956_0055170 | |||
| 1680 | Ga0373957_0015827 | |||
| 1681 | Ga0373957_0026468 | |||
| 1682 | Ga0373960_0009485 | |||
| 1683 | Ga0373943_0083106 | |||
| 1684 | Ga0373943_0114982 | |||
| 1685 | Ga0373946_0010660 | |||
| 1686 | Ga0373946_0027647 | |||
| 1687 | Ga0373946_0068616 | |||
| 1688 | Ga0373946_0094255 | |||
| 1689 | Ga0373955_0000334 | |||
| 1690 | Ga0373955_0008925 | |||
| 1691 | Ga0373955_0016443 | |||
| 1692 | Ga0373955_0043198 | |||
| 1693 | Ga0373955_0056389 | |||
| 1694 | Ga0373955_0198442 | |||
| 1695 | Ga0373942_0003290 | |||
| 1696 | Ga0373942_0041448 | |||
| 1697 | Ga0373961_0004317 | |||
| 1698 | Ga0373961_0049418 | |||
| 1699 | Ga0373961_0081138 | |||
| 1700 | Ga0373962_0001119 | |||
| 1701 | Ga0373962_0011124 | |||
| 1702 | Ga0373962_0045860 | |||
| 1703 | Ga0373924_0000358 | |||
| 1704 | Ga0373924_0007042 | |||
| 1705 | Ga0373924_0048746 | |||
| 1706 | Ga0373931_0000273 | |||
| 1707 | Ga0373931_0109441 | |||
| 1708 | Ga0373931_0255119 | |||
| 1709 | Ga0373935_0001324 | |||
| 1710 | Ga0373935_0034408 | |||
| 1711 | Ga0373935_0049223 | |||
| 1712 | Ga0373935_0084728 | |||
| 1713 | Ga0373935_0122232 | |||
| 1714 | Ga0373935_0228993 | |||
| 1715 | Ga0373935_0399979 | |||
| 1716 | Ga0373927_0028494 | |||
| 1717 | Ga0373927_0037555 | |||
| 1718 | Ga0373927_0045830 | |||
| 1719 | Ga0373927_0076935 | |||
| 1720 | Ga0373927_0097250 | |||
| 1721 | Ga0373927_0143427 | |||
| 1722 | Ga0373927_0156703 | |||
| 1723 | Ga0373933_0001162 | |||
| 1724 | Ga0373933_0001830 | |||
| 1725 | Ga0373933_0070295 | |||
| 1726 | Ga0373933_0071647 | |||
| 1727 | Ga0373933_0161907 | |||
| 1728 | Ga0373933_0194364 | |||
| 1729 | Ga0373947_0002784 | |||
| 1730 | Ga0373947_0020264 | |||
| 1731 | Ga0373947_0161214 | |||
| 1732 | Ga0373947_0205553 | |||
| 1733 | Ga0373937_0001118 | |||
| 1734 | Ga0373937_0001692 | |||
| 1735 | Ga0373937_0006485 | |||
| 1736 | Ga0373937_0012619 | |||
| 1737 | Ga0373937_0028187 | |||
| 1738 | Ga0373937_0031982 | |||
| 1739 | Ga0373937_0151600 | |||
| 1740 | Ga0373937_0670866 | |||
| 1741 | Ga0373925_0000084 | |||
| 1742 | Ga0373925_0003690 | |||
| 1743 | Ga0373925_0009586 | |||
| 1744 | Ga0373925_0017236 | |||
| 1745 | Ga0373925_0019319 | |||
| 1746 | Ga0373925_0049034 | |||
| 1747 | Ga0373925_0111409 | |||
| 1748 | Ga0373925_0148098 | |||
| 1749 | Ga0373925_0277419 | |||
| 1750 | Ga0436365_1232763 | |||
| 1751 | Ga0436365_1344708 | |||
| 1752 | Ga0436365_1513096 | |||
| 1753 | Ga0436365_1762134 | |||
| 1754 | Ga0451793_0025165 | |||
| 1755 | Ga0439448_0047682 | |||
| 1756 | Ga0439455_0012427 | |||
| 1757 | Ga0450916_015161 | |||
| 1758 | Ga0466967_0117632 | |||
| 1759 | Ga0495592_0000026 | |||
| 1760 | Ga0495592_0016983 | |||
| 1761 | Ga0495592_0058557 | |||
| 1762 | Ga0495592_0081952 | |||
| 1763 | Ga0495592_0120738 | |||
| 1764 | Ga0495603_0014206 | |||
| 1765 | Ga0495603_0018977 | |||
| 1766 | Ga0495603_0131137 | |||
| 1767 | Ga0495629_0000171 | |||
| 1768 | Ga0495629_0024446 | |||
| 1769 | Ga0495629_0039765 | |||
| 1770 | Ga0495629_0214342 | |||
| 1771 | Ga0495629_0230419 | |||
| 1772 | Ga0495641_0003584 | |||
| 1773 | Ga0495641_0046148 | |||
| 1774 | Ga0495641_0114652 | |||
| 1775 | Ga0495651_0000790 | |||
| 1776 | Ga0495651_0008223 | |||
| 1777 | Ga0495651_0025993 | |||
| 1778 | Ga0495653_0000155 | |||
| 1779 | Ga0495653_0058758 | |||
| 1780 | Ga0495653_0084943 | |||
| 1781 | Ga0495653_0086116 | |||
| 1782 | Ga0495582_0002454 | |||
| 1783 | Ga0495639_0040288 | |||
| 1784 | Ga0495662_0015227 | |||
| 1785 | Ga0495662_0092193 | |||
| 1786 | Ga0495662_0145381 | |||
| 1787 | Ga0495664_0000001 | |||
| 1788 | Ga0495664_0086008 | |||
| 1789 | Ga0495584_0128523 | |||
| 1790 | Ga0495585_0000251 | |||
| 1791 | Ga0495585_0013489 | |||
| 1792 | Ga0495594_0022664 | |||
| 1793 | Ga0495594_0218570 | |||
| 1794 | Ga0495607_0001699 | |||
| 1795 | Ga0495607_0109705 | |||
| 1796 | Ga0495583_0082716 | |||
| 1797 | Ga0495608_0000012 | |||
| 1798 | Ga0495608_0002359 | |||
| 1799 | Ga0495608_0083008 | |||
| 1800 | Ga0495608_0096314 | |||
| 1801 | Ga0495608_0186857 | |||
| 1802 | Ga0495616_0037138 | |||
| 1803 | Ga0495618_0000041 | |||
| 1804 | Ga0495618_0052984 | |||
| 1805 | Ga0495628_0000033 | |||
| 1806 | Ga0495628_0059214 | |||
| 1807 | Ga0495628_0064026 | |||
| 1808 | Ga0495628_0212340 | |||
| 1809 | Ga0495630_0009244 | |||
| 1810 | Ga0495630_0039949 | |||
| 1811 | Ga0495630_0095665 | |||
| 1812 | Ga0495631_0011416 | |||
| 1813 | Ga0495644_0002554 | |||
| 1814 | Ga0495663_0054396 | |||
| 1815 | Ga0495666_0003467 | |||
| 1816 | Ga0495666_0024242 | |||
| 1817 | Ga0495642_0136479 | |||
| 1818 | Ga0495652_0000001 | |||
| 1819 | Ga0495652_0001796 | |||
| 1820 | Ga0495652_0031224 | |||
| 1821 | Ga0495665_0017934 | |||
| 1822 | Ga0495640_0000010 | |||
| 1823 | Ga0495640_0016033 | |||
| 1824 | Ga0495640_0188971 | |||
| 1825 | Ga0495587_0000003 | |||
| 1826 | Ga0495587_0049031 | |||
| 1827 | Ga0495587_0062606 | |||
| 1828 | Ga0495587_0125462 | |||
| 1829 | Ga0495598_0001482 | |||
| 1830 | Ga0495598_0003879 | |||
| 1831 | Ga0495609_0017594 | |||
| 1832 | Ga0495645_0000026 | |||
| 1833 | Ga0495645_0003084 | |||
| 1834 | Ga0495645_0016073 | |||
| 1835 | Ga0495622_0071900 | |||
| 1836 | Ga0495633_0006405 | |||
| 1837 | Ga0495633_0077656 | |||
| 1838 | Ga0495667_0000389 | |||
| 1839 | Ga0495667_0001979 | |||
| 1840 | Ga0495667_0011491 | |||
| 1841 | Ga0495667_0020583 | |||
| 1842 | Ga0495667_0103935 | |||
| 1843 | Ga0495656_0000191 | |||
| 1844 | Ga0495668_0130262 | |||
| 1845 | Ga0495634_0000285 | |||
| 1846 | Ga0495634_0078208 | |||
| 1847 | Ga0495611_0069292 | |||
| 1848 | Ga0495635_0000113 | |||
| 1849 | Ga0495635_0013079 | |||
| 1850 | Ga0495635_0064469 | |||
| 1851 | Ga0495659_0002654 | |||
| 1852 | Ga0495588_0008289 | |||
| 1853 | Ga0495588_0060953 | |||
| 1854 | Ga0495657_0000258 | |||
| 1855 | Ga0495657_0053677 | |||
| 1856 | Ga0495657_0373614 | |||
| 1857 | Ga0495599_0000070 | |||
| 1858 | Ga0495599_0005630 | |||
| 1859 | Ga0495599_0014500 | |||
| 1860 | Ga0495599_0019535 | |||
| 1861 | Ga0495599_0159733 | |||
| 1862 | Ga0495623_0000003 | |||
| 1863 | Ga0495623_0022373 | |||
| 1864 | Ga0495646_0000070 | |||
| 1865 | Ga0495646_0001840 | |||
| 1866 | Ga0495646_0138269 | |||
| 1867 | Ga0495647_0002939 | |||
| 1868 | Ga0495647_0055086 | |||
| 1869 | Ga0495647_0161499 | |||
| 1870 | Ga0495658_0000282 | |||
| 1871 | Ga0495658_0007523 | |||
| 1872 | Ga0495658_0086001 | |||
| 1873 | Ga0495658_0216305 | |||
| 1874 | Ga0495613_0022200 | |||
| 1875 | Ga0495624_0011727 | |||
| 1876 | Ga0495670_0000204 | |||
| 1877 | Ga0495671_0015506 | |||
| 1878 | Ga0495589_0047550 | |||
| 1879 | Ga0495600_0000007 | |||
| 1880 | Ga0495600_0048247 | |||
| 1881 | Ga0495600_0059756 | |||
| 1882 | Ga0495581_0255145 | |||
| 1883 | Ga0495604_0000010 | |||
| 1884 | Ga0495604_0015304 | |||
| 1885 | Ga0495674_0000013 | |||
| 1886 | Ga0495674_0022656 | |||
| 1887 | Ga0495674_0128684 | |||
| 1888 | Ga0495674_0141310 | |||
| 1889 | Ga0495674_0212003 | |||
| 1890 | Ga0495674_0268890 | |||
| 1891 | Ga0495676_0059847 | |||
| 1892 | Ga0495676_0078519 | |||
| 1893 | Ga0495676_0103230 | |||
| 1894 | Ga0495676_0114449 | |||
| 1895 | Ga0495676_0125214 | |||
| 1896 | Ga0495680_0000666 | |||
| 1897 | Ga0495680_0004448 | |||
| 1898 | Ga0495680_0013117 | |||
| 1899 | Ga0495680_0148863 | |||
| 1900 | Ga0495680_0325730 | |||
| 1901 | Ga0495675_0000567 | |||
| 1902 | Ga0495675_0014786 | |||
| 1903 | Ga0495675_0017706 | |||
| 1904 | Ga0495679_020017 | |||
| 1905 | Ga0495684_0000008 | |||
| 1906 | Ga0495684_0022473 | |||
| 1907 | Ga0495684_0172019 | |||
| 1908 | Ga0495684_0178542 | |||
| 1909 | Ga0495684_0270973 | |||
| 1910 | Ga0495684_0346552 | |||
| 1911 | Ga0495593_0002332 | |||
| 1912 | Ga0495593_0259212 | |||
| 1913 | Ga0495602_0000264 | |||
| 1914 | Ga0495602_0000568 | |||
| 1915 | Ga0495602_0199342 | |||
| 1916 | Ga0495602_0216016 | |||
| 1917 | Ga0495602_0313377 | |||
| 1918 | Ga0496100_0000255 | |||
| 1919 | Ga0496100_0022447 | |||
| 1920 | Ga0496100_0058396 | |||
| 1921 | Ga0496101_0000317 | |||
| 1922 | Ga0496101_0005168 | |||
| 1923 | Ga0496101_0045030 | |||
| 1924 | Ga0496101_0075080 | |||
| 1925 | Ga0496102_0001113 | |||
| 1926 | Ga0496102_0052571 | |||
| 1927 | Ga0496102_0062761 | |||
| 1928 | Ga0496102_0063229 | |||
| 1929 | Ga0496102_0177348 | |||
| 1930 | Ga0496103_0000528 | |||
| 1931 | Ga0496103_0049495 | |||
| 1932 | Ga0496103_0057083 | |||
| 1933 | Ga0496103_0172895 | |||
| 1934 | Ga0496104_0000082 | |||
| 1935 | Ga0496104_0001732 | |||
| 1936 | Ga0496104_0001798 | |||
| 1937 | Ga0496104_0004876 | |||
| 1938 | Ga0496104_0007168 | |||
| 1939 | Ga0496104_0103866 | |||
| 1940 | Ga0496104_0126757 | |||
| 1941 | Ga0496104_0158263 | |||
| 1942 | Ga0496104_0245894 | |||
| 1943 | Ga0496105_0000563 | |||
| 1944 | Ga0496105_0001322 | |||
| 1945 | Ga0496105_0002542 | |||
| 1946 | Ga0496105_0012374 | |||
| 1947 | Ga0496105_0021540 | |||
| 1948 | Ga0496105_0062196 | |||
| 1949 | Ga0496105_0331320 | |||
| 1950 | Ga0496106_0000165 | |||
| 1951 | Ga0496106_0028529 | |||
| 1952 | Ga0496106_0076376 | |||
| 1953 | Ga0496106_0139632 | |||
| 1954 | Ga0496106_0277109 | |||
| 1955 | Ga0496106_0601510 | |||
| 1956 | Ga0496107_0000201 | |||
| 1957 | Ga0496107_0009106 | |||
| 1958 | Ga0496108_0002292 | |||
| 1959 | Ga0496108_0009174 | |||
| 1960 | Ga0496108_0085375 | |||
| 1961 | Ga0496108_0131813 | |||
| 1962 | Ga0496108_0179475 | |||
| 1963 | Ga0496108_0199665 | |||
| 1964 | Ga0496109_0002809 | |||
| 1965 | Ga0496109_0003316 | |||
| 1966 | Ga0496109_0031863 | |||
| 1967 | Ga0496109_0080575 | |||
| 1968 | Ga0496109_0276991 | |||
| 1969 | Ga0496109_0811529 | |||
| 1970 | Ga0496110_0014166 | |||
| 1971 | Ga0496110_0105889 | |||
| 1972 | Ga0496110_0135796 | |||
| 1973 | Ga0496111_0025450 | |||
| 1974 | Ga0496111_0030271 | |||
| 1975 | Ga0496111_0126095 | |||
| 1976 | Ga0496112_0006605 | |||
| 1977 | Ga0496112_0009460 | |||
| 1978 | Ga0496112_0624308 | |||
| 1979 | Ga0496113_0004968 | |||
| 1980 | Ga0496113_0034635 | |||
| 1981 | Ga0496113_0045130 | |||
| 1982 | Ga0496113_0058019 | |||
| 1983 | Ga0496113_0063744 | |||
| 1984 | Ga0496113_0133067 | |||
| 1985 | Ga0496113_0276091 | |||
| 1986 | Ga0496114_0000928 | |||
| 1987 | Ga0496114_0009782 | |||
| 1988 | Ga0496114_0080883 | |||
| 1989 | Ga0496115_0000667 | |||
| 1990 | Ga0496115_0010445 | |||
| 1991 | Ga0496115_0025523 | |||
| 1992 | Ga0496115_0029013 | |||
| 1993 | Ga0496115_0134465 | |||
| 1994 | Ga0496115_0321672 | |||
| 1995 | Ga0496115_0459270 | |||
| 1996 | Ga0496126_0089821 | |||
| 1997 | Ga0501031_0010487 | |||
| 1998 | Ga0501032_0000001 | |||
| 1999 | Ga0501032_0064310 | |||
| 2000 | Ga0501032_0126310 | |||
| 2001 | Ga0501033_0000515 | |||
| 2002 | Ga0501033_0007008 | |||
| 2003 | Ga0501034_0000023 | |||
| 2004 | Ga0501034_0245997 | |||
| 2005 | Ga0501034_0366818 | |||
| 2006 | Ga0501036_0032817 | |||
| 2007 | Ga0501036_0076480 | |||
| 2008 | Ga0501037_0000065 | |||
| 2009 | Ga0501038_0002005 | |||
| 2010 | Ga0501038_0014065 | |||
| 2011 | Ga0501038_0058445 | |||
| 2012 | Ga0501038_0116498 | |||
| 2013 | Ga0501038_0458148 | |||
| 2014 | Ga0501039_0000022 | |||
| 2015 | Ga0501039_0057042 | |||
| 2016 | Ga0501039_0283953 | |||
| 2017 | Ga0501039_0370654 | |||
| 2018 | Ga0501041_0159212 | |||
| 2019 | Ga0501041_0302229 | |||
| 2020 | Ga0501042_0138742 | |||
| 2021 | Ga0501043_0000093 | |||
| 2022 | Ga0501046_0006925 | |||
| 2023 | Ga0501047_0197541 | |||
| 2024 | Ga0501047_0287845 | |||
| 2025 | Ga0501048_0002288 | |||
| 2026 | Ga0501048_0199264 | |||
| 2027 | Ga0501067_0014486 | |||
| 2028 | Ga0501068_0007260 | |||
| 2029 | Ga0501069_0013029 | |||
| 2030 | Ga0501070_0075537 | |||
| 2031 | Ga0501070_0128149 | |||
| 2032 | Ga0501071_0287920 | |||
| 2033 | Ga0501071_0337213 | |||
| 2034 | Ga0501073_0076635 | |||
| 2035 | Ga0501073_0161707 | |||
| 2036 | Ga0501074_0003219 | |||
| 2037 | Ga0501075_0079327 | |||
| 2038 | Ga0501075_0488893 | |||
| 2039 | Ga0501076_0033914 | |||
| 2040 | Ga0501076_0318996 | |||
| 2041 | Ga0501077_0003399 | |||
| 2042 | Ga0501077_0046578 | |||
| 2043 | Ga0501077_0180378 | |||
| 2044 | Ga0501079_0029518 | |||
| 2045 | Ga0501079_0551114 | |||
| 2046 | Ga0501081_0135163 | |||
| 2047 | Ga0501035_0000336 | |||
| 2048 | Ga0501044_0001021 | |||
| 2049 | Ga0501044_0200543 | |||
| 2050 | Ga0501044_0253795 | |||
| 2051 | Ga0501044_0396408 | |||
| 2052 | Ga0501045_0013355 | |||
| 2053 | nmdc:mga03683_52066_c1 | |||
| 2054 | nmdc:mga00v17_30922_c1 | |||
| 2055 | nmdc:mga0yw44_55006_c1 | |||
| 2056 | nmdc:mga0yw44_918_c1 | |||
| 2057 | nmdc:mga0k408_108352_c1 | |||
| 2058 | nmdc:mga0k408_4295_c1 | |||
| 2059 | nmdc:mga0k408_68849_c1 | |||
| 2060 | nmdc:mga06z11_16410_c1 | |||
| 2061 | nmdc:mga06z11_22339_c1 | |||
| 2062 | nmdc:mga06z11_8019_c1 | |||
| 2063 | nmdc:mga04h51_8228_c1 | |||
| 2064 | nmdc:mga07m45_18954_c1 | |||
| 2065 | nmdc:mga07m45_60813_c1 | |||
| 2066 | nmdc:mga05p37_162898_c1 | |||
| 2067 | nmdc:mga05p37_191383_c1 | |||
| 2068 | nmdc:mga05p37_26421_c1 | |||
| 2069 | nmdc:mga05p37_47186_c1 | |||
| 2070 | nmdc:mga05p37_64007_c1 | |||
| 2071 | nmdc:mga05p37_660009_c1 | |||
| 2072 | nmdc:mga05p37_69_c2 | |||
| 2073 | nmdc:mga05p37_83478_c1 | |||
| 2074 | nmdc:mga09592_1744_c1 | |||
| 2075 | nmdc:mga09592_67827_c1 | |||
| 2076 | nmdc:mga09592_95436_c1 | |||
| 2077 | nmdc:mga0qj67_1033_c1 | |||
| 2078 | nmdc:mga0qj67_323519_c1 | |||
| 2079 | nmdc:mga0qj67_37_c1 | |||
| 2080 | nmdc:mga0qj67_3998_c1 | |||
| 2081 | nmdc:mga0qj67_67208_c1 | |||
| 2082 | nmdc:mga06r32_235285_c1 | |||
| 2083 | nmdc:mga06r32_544884_c1 | |||
| 2084 | nmdc:mga06r32_6015_c1 | |||
| 2085 | nmdc:mga08y16_190481_c1 | |||
| 2086 | nmdc:mga08y16_25098_c1 | |||
| 2087 | nmdc:mga08y16_27814_c1 | |||
| 2088 | nmdc:mga08y16_80954_c1 | |||
| 2089 | nmdc:mga08y16_891_c1 | |||
| 2090 | nmdc:mga08y16_948514_c1 | |||
| 2091 | nmdc:mga0n895_113390_c1 | |||
| 2092 | nmdc:mga0n895_135077_c1 | |||
| 2093 | nmdc:mga0n895_289541_c1 | |||
| 2094 | nmdc:mga0n895_29192_c1 | |||
| 2095 | nmdc:mga0n895_44_c1 | |||
| 2096 | nmdc:mga0n895_769_c1 | |||
| 2097 | nmdc:mga0n895_98430_c1 | |||
| 2098 | nmdc:mga0rr50_124159_c1 | |||
| 2099 | nmdc:mga0rr50_273231_c1 | |||
| 2100 | nmdc:mga0rr50_297295_c1 | |||
| 2101 | nmdc:mga0rr50_37935_c1 | |||
| 2102 | nmdc:mga0rr50_47953_c1 | |||
| 2103 | nmdc:mga0rr50_621046_c1 | |||
| 2104 | nmdc:mga08x19_11978_c1 | |||
| 2105 | nmdc:mga08x19_123526_c1 | |||
| 2106 | nmdc:mga08x19_296160_c1 | |||
| 2107 | nmdc:mga08x19_40712_c1 | |||
| 2108 | nmdc:mga08x19_96802_c1 | |||
| 2109 | nmdc:mga0a205_120508_c1 | |||
| 2110 | nmdc:mga0a205_247_c1 | |||
| 2111 | nmdc:mga0a205_37931_c1 | |||
| 2112 | nmdc:mga0a205_4580_c1 | |||
| 2113 | nmdc:mga0sz30_15572_c2 | |||
| 2114 | Ga0495601_0000003 | |||
| 2115 | Ga0495601_0000151 | |||
| 2116 | Ga0495601_0000398 | |||
| 2117 | Ga0495601_0006487 | |||
| 2118 | Ga0495601_0008245 | |||
| 2119 | Ga0495601_0018815 | |||
| 2120 | Ga0495601_0068660 | |||
| 2121 | Ga0495612_0000009 | |||
| 2122 | Ga0495612_0001511 | |||
| 2123 | Ga0495655_0018187 | |||
| 2124 | Ga0495655_0073699 | |||
| 2125 | Ga0495595_0000075 | |||
| 2126 | Ga0495595_0000226 | |||
| 2127 | Ga0495595_0018508 | |||
| 2128 | Ga0495595_0030840 | |||
| 2129 | Ga0495619_0000039 | |||
| 2130 | Ga0495619_0000086 | |||
| 2131 | Ga0495619_0000379 | |||
| 2132 | Ga0495619_0001781 | |||
| 2133 | Ga0500562_005751 | |||
| 2134 | Ga0500595_041249 | |||
| 2135 | Ga0500658_0085423 | |||
| 2136 | Ga0500645_000099 | |||
| 2137 | Ga0501084_0019616 | |||
| 2138 | Ga0501084_0033970 | |||
| 2139 | Ga0501084_0056755 | |||
| 2140 | Ga0501082_0022891 | |||
| 2141 | Ga0530510_0062042 | |||
| 2142 | Ga0530510_0109978 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ocr-assembly1.cif.gz_A | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.9266 | 12 | 254 |
| 3ocr-assembly2.cif.gz_B | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.9189 | 8 | 254 |
| 3ocr-assembly2.cif.gz_B | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.9117 | 8 | 254 |
| 3ocr-assembly1.cif.gz_A | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.8946 | 12 | 254 |
| 8iai-assembly1.cif.gz_2 | structure of mammalian spectrin-actin junctional complex of membrane skeleton, state ii, global map | 0.8823 | 14 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54T47_16_268_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9246 | 10 | 254 | 3.40.225.10 |
| af_Q7LKY2_67_324_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9192 | 13 | 254 | 3.40.225.10 |
| 3ocrB00 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9148 | 8 | 254 | 3.40.225.10 |
| 3ocrB00 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9113 | 8 | 254 | 3.40.225.10 |
| af_Q20952_347_604_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9068 | 13 | 248 | 3.40.225.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5FH07-F1-model_v4 | Aldolase | 0.9948 | 15 | 254 |
GO:0005856
GO:0051015 |
| AF-A0A6L5FH07-F1-model_v4 | Aldolase | 0.9906 | 15 | 254 |
GO:0005856
GO:0051015 |
| AF-A0A855HTP1-F1-model_v4 | deleted | 0.9779 | 90 | 203 |
|
| AF-A0A3D0KA91-F1-model_v4 | deleted | 0.9746 | 89 | 205 |
|
| AF-A0A7Z9K9C0-F1-model_v4 | Aldolase | 0.9724 | 44 | 254 |
GO:0005856
GO:0051015 |