F489502

General Info

Members Datasets Scaffolds Average Seq Length
1072 341 2144 89

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_101341274|Ga0070673_1013412741
Length 103
Sequence VQLARVIGDVVATVKDPRLDGHKLLILQPITPDPEPRPVGRTLIAIDSTGAGVGEYVFFVRGREASFPFLPVETPVDACVIGIIDHWDLEPGAGSLQPGAPSL

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
217 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
229 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
230 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
231 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
232 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
233 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
234 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
235 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
236 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
237 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
238 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
243 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
338 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 6.53
Rhizosphere 90.67
Stem 0
Stem Tuber 0
Unclassified 22.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_101341274 3300005364 Bacteria 672
2 JGI24743J22301_10138864 3300001991 Unclassified 540
3 JGI24744J21845_10089966 3300002077 Unclassified 563
4 JGI24034J26672_10063540 3300002239 Bacteria 652
5 JGI24751J29686_10047507 3300002459 Bacteria 886
6 Ga0065714_10191579 3300005288 Unclassified 926
7 Ga0065704_10409366 3300005289 Bacteria 743
8 Ga0065712_10000353 3300005290 Bacteria 21043
9 Ga0065712_10085891 3300005290 Bacteria 2667
10 Ga0065712_10193404 3300005290 Bacteria 1138
11 Ga0065712_10245698 3300005290 Bacteria 972
12 Ga0065712_10442568 3300005290 Unclassified 693
13 Ga0065715_10090861 3300005293 Bacteria 6371
14 Ga0065715_10122953 3300005293 Unclassified 2190
15 Ga0065715_10158840 3300005293 Bacteria 1633
16 Ga0065715_10208819 3300005293 Bacteria 1314
17 Ga0065715_10255844 3300005293 Bacteria 1153
18 Ga0065715_10378796 3300005293 Unclassified 910
19 Ga0065715_10422987 3300005293 Bacteria 856
20 Ga0065715_10692944 3300005293 Bacteria 657
21 Ga0065707_10004263 3300005295 Bacteria 3652
22 Ga0065707_10102583 3300005295 Bacteria 2797
23 Ga0070676_10050842 3300005328 Bacteria 2431
24 Ga0070676_10125248 3300005328 Bacteria 1618
25 Ga0070676_10139873 3300005328 Bacteria 1540
26 Ga0070676_10962820 3300005328 Bacteria 639
27 Ga0070683_100001936 3300005329 Bacteria 16209
28 Ga0070683_100049491 3300005329 Bacteria 3888
29 Ga0070690_100063175 3300005330 Unclassified 2389
30 Ga0070690_100114351 3300005330 Bacteria 1804
31 Ga0070690_100313695 3300005330 Bacteria 1128
32 Ga0070690_101154256 3300005330 Unclassified 616
33 Ga0070670_100001546 3300005331 Bacteria 18553
34 Ga0070670_100024170 3300005331 Bacteria 5228
35 Ga0070670_100047682 3300005331 Bacteria 3686
36 Ga0070670_100150277 3300005331 Bacteria 2016
37 Ga0070670_101301605 3300005331 Unclassified 665
38 Ga0070677_10261944 3300005333 Bacteria 863
39 Ga0070677_10341987 3300005333 Bacteria 773
40 Ga0068869_100122062 3300005334 Unclassified 1994
41 Ga0068869_100219783 3300005334 Bacteria 1505
42 Ga0068869_100345015 3300005334 Bacteria 1212
43 Ga0070666_10067969 3300005335 Bacteria 2420
44 Ga0070666_10092137 3300005335 Unclassified 2083
45 Ga0070666_10193636 3300005335 Bacteria 1429
46 Ga0070666_10406124 3300005335 Bacteria 980
47 Ga0070666_11051055 3300005335 Unclassified 605
48 Ga0070682_100172025 3300005337 Bacteria 1506
49 Ga0068868_100095156 3300005338 Unclassified 2404
50 Ga0068868_100132380 3300005338 Bacteria 2041
51 Ga0070660_100096787 3300005339 Bacteria 2335
52 Ga0070660_100661703 3300005339 Bacteria 875
53 Ga0070689_100141077 3300005340 Bacteria 1938
54 Ga0070689_101508873 3300005340 Unclassified 609
55 Ga0070689_102168393 3300005340 Unclassified 509
56 Ga0070687_100030453 3300005343 Bacteria 2638
57 Ga0070687_100052795 3300005343 Unclassified 2111
58 Ga0070687_100917645 3300005343 Unclassified 629
59 Ga0070661_100006579 3300005344 Bacteria 8013
60 Ga0070661_100555592 3300005344 Bacteria 924
61 Ga0070692_10141854 3300005345 Bacteria 1360
62 Ga0070692_11061622 3300005345 Bacteria 570
63 Ga0070692_11192751 3300005345 Bacteria 542
64 Ga0070668_100979764 3300005347 Unclassified 759
65 Ga0070668_101732551 3300005347 Unclassified 574
66 Ga0070668_102006358 3300005347 Unclassified 534
67 Ga0070669_100000166 3300005353 Bacteria 58014
68 Ga0070669_100050963 3300005353 Unclassified 3025
69 Ga0070669_100187620 3300005353 Bacteria 1621
70 Ga0070669_100743340 3300005353 Bacteria 831
71 Ga0070669_101235117 3300005353 Unclassified 646
72 Ga0070669_101913318 3300005353 Bacteria 518
73 Ga0070675_100002899 3300005354 Bacteria 12924
74 Ga0070675_100078452 3300005354 Bacteria 2750
75 Ga0070675_100120981 3300005354 Bacteria 2224
76 Ga0070675_100470081 3300005354 Unclassified 1130
77 Ga0070675_100512164 3300005354 Bacteria 1082
78 Ga0070675_100672619 3300005354 Bacteria 942
79 Ga0070675_100693337 3300005354 Unclassified 927
80 Ga0070675_100955987 3300005354 Unclassified 786
81 Ga0070675_101011476 3300005354 Bacteria 763
82 Ga0070671_100183091 3300005355 Unclassified 1774
83 Ga0070671_100185058 3300005355 Bacteria 1764
84 Ga0070671_100312360 3300005355 Bacteria 1339
85 Ga0070671_101434808 3300005355 Unclassified 610
86 Ga0070674_100011525 3300005356 Bacteria 5387
87 Ga0070674_100097298 3300005356 Bacteria 2137
88 Ga0070674_100126422 3300005356 Bacteria 1900
89 Ga0070674_100588196 3300005356 Bacteria 939
90 Ga0070674_100719633 3300005356 Bacteria 855
91 Ga0070674_100770303 3300005356 Bacteria 828
92 Ga0070674_101555351 3300005356 Bacteria 595
93 Ga0070673_100002561 3300005364 Bacteria 11095
94 Ga0070673_101513306 3300005364 Unclassified 633
95 Ga0070673_101597864 3300005364 Bacteria 616
96 Ga0070673_102322210 3300005364 Bacteria 510
97 Ga0070688_100014815 3300005365 Bacteria 4424
98 Ga0070688_100208852 3300005365 Bacteria 1370
99 Ga0070688_100305285 3300005365 Unclassified 1151
100 Ga0070688_101514940 3300005365 Unclassified 546
101 Ga0070659_100168933 3300005366 Bacteria 1791
102 Ga0070659_100354644 3300005366 Bacteria 1231
103 Ga0070659_100852790 3300005366 Bacteria 794
104 Ga0070659_101167960 3300005366 Bacteria 680
105 Ga0070659_101856936 3300005366 Unclassified 540
106 Ga0070667_100048804 3300005367 Unclassified 3564
107 Ga0070667_100963734 3300005367 Unclassified 795
108 Ga0070667_102138147 3300005367 Bacteria 527
109 Ga0070713_100386032 3300005436 Unclassified 1305
110 Ga0070701_10003736 3300005438 Bacteria 6077
111 Ga0070701_10909765 3300005438 Bacteria 608
112 Ga0070711_100902157 3300005439 Unclassified 754
113 Ga0070711_101536326 3300005439 Bacteria 581
114 Ga0070705_100600092 3300005440 Unclassified 851
115 Ga0070705_101075107 3300005440 Bacteria 657
116 Ga0070700_100630669 3300005441 Unclassified 844
117 Ga0070700_100944530 3300005441 Unclassified 705
118 Ga0070700_101143879 3300005441 Unclassified 647
119 Ga0070694_100896708 3300005444 Unclassified 732
120 Ga0070694_100991037 3300005444 Bacteria 697
121 Ga0070663_100170260 3300005455 Unclassified 1683
122 Ga0070663_100388748 3300005455 Bacteria 1138
123 Ga0070663_100390052 3300005455 Bacteria 1136
124 Ga0070663_100448748 3300005455 Bacteria 1063
125 Ga0070678_100122387 3300005456 Unclassified 2054
126 Ga0070678_100145886 3300005456 Bacteria 1900
127 Ga0070678_100256343 3300005456 Unclassified 1469
128 Ga0070678_100415177 3300005456 Bacteria 1172
129 Ga0070678_100736357 3300005456 Bacteria 891
130 Ga0070678_101106059 3300005456 Bacteria 732
131 Ga0070678_101442012 3300005456 Unclassified 643
132 Ga0070662_100040943 3300005457 Bacteria 3302
133 Ga0070662_100158979 3300005457 Unclassified 1766
134 Ga0070662_100680803 3300005457 Bacteria 869
135 Ga0070681_10108734 3300005458 Bacteria 2713
136 Ga0070681_11908863 3300005458 Unclassified 521
137 Ga0068867_100011928 3300005459 Bacteria 6139
138 Ga0068867_100085366 3300005459 Bacteria 2386
139 Ga0068867_100592081 3300005459 Bacteria 966
140 Ga0070685_10003988 3300005466 Bacteria 7458
141 Ga0070685_11523048 3300005466 Bacteria 516
142 Ga0070706_100634444 3300005467 Bacteria 992
143 Ga0070706_100794605 3300005467 Bacteria 876
144 Ga0070707_100931109 3300005468 Bacteria 834
145 Ga0070707_101659703 3300005468 Bacteria 606
146 Ga0070698_100340178 3300005471 Bacteria 1432
147 Ga0070698_101119969 3300005471 Bacteria 736
148 Ga0070698_101503986 3300005471 Bacteria 625
149 Ga0070698_101620173 3300005471 Unclassified 599
150 Ga0074259_10932921 3300005507 Unclassified 509
151 Ga0070699_100951258 3300005518 Bacteria 787
152 Ga0070699_101491838 3300005518 Bacteria 620
153 Ga0070684_100000291 3300005535 Bacteria 34899
154 Ga0070684_100722382 3300005535 Bacteria 929
155 Ga0068853_100824579 3300005539 Unclassified 889
156 Ga0068853_101443326 3300005539 Unclassified 666
157 Ga0068853_102293707 3300005539 Bacteria 523
158 Ga0068853_102352289 3300005539 Unclassified 516
159 Ga0070672_100019443 3300005543 Bacteria 4929
160 Ga0070672_100021908 3300005543 Bacteria 4683
161 Ga0070672_100118152 3300005543 Bacteria 2168
162 Ga0070672_100232545 3300005543 Bacteria 1549
163 Ga0070672_101240170 3300005543 Unclassified 665
164 Ga0070686_100033623 3300005544 Bacteria 3152
165 Ga0070686_100306200 3300005544 Unclassified 1180
166 Ga0070686_101057707 3300005544 Bacteria 668
167 Ga0070696_100295643 3300005546 Bacteria 1239
168 Ga0070696_100483150 3300005546 Bacteria 983
169 Ga0070696_100721736 3300005546 Bacteria 814
170 Ga0070693_101016747 3300005547 Bacteria 628
171 Ga0070693_101049058 3300005547 Bacteria 619
172 Ga0070665_100010087 3300005548 Bacteria 9559
173 Ga0070665_100022622 3300005548 Bacteria 6329
174 Ga0070665_100248210 3300005548 Bacteria 1780
175 Ga0070665_100250519 3300005548 Bacteria 1772
176 Ga0070665_100476735 3300005548 Bacteria 1258
177 Ga0070665_100483781 3300005548 Bacteria 1249
178 Ga0070665_100801899 3300005548 Unclassified 955
179 Ga0070665_101085551 3300005548 Bacteria 812
180 Ga0070704_100071794 3300005549 Bacteria 2516
181 Ga0070704_100175306 3300005549 Bacteria 1710
182 Ga0070704_100277876 3300005549 Bacteria 1386
183 Ga0070704_100544980 3300005549 Bacteria 1013
184 Ga0070704_100917012 3300005549 Unclassified 789
185 Ga0070704_101040332 3300005549 Bacteria 742
186 Ga0068855_100929771 3300005563 Bacteria 917
187 Ga0068855_101573479 3300005563 Bacteria 673
188 Ga0070664_100003002 3300005564 Bacteria 13648
189 Ga0070664_100142540 3300005564 Unclassified 2111
190 Ga0070664_100335665 3300005564 Unclassified 1372
191 Ga0070664_100710477 3300005564 Bacteria 937
192 Ga0070664_101806239 3300005564 Bacteria 580
193 Ga0070664_102143281 3300005564 Unclassified 530
194 Ga0068854_100099848 3300005578 Bacteria 2174
195 Ga0068854_100436159 3300005578 Bacteria 1091
196 Ga0068854_100549707 3300005578 Unclassified 979
197 Ga0068854_101246943 3300005578 Unclassified 668
198 Ga0068856_100062149 3300005614 Bacteria 3689
199 Ga0068856_101189163 3300005614 Unclassified 779
200 Ga0068856_101588804 3300005614 Unclassified 667
201 Ga0070702_100149497 3300005615 Bacteria 1497
202 Ga0070702_100377258 3300005615 Bacteria 1007
203 Ga0070702_100659878 3300005615 Bacteria 792
204 Ga0068852_100078194 3300005616 Bacteria 2926
205 Ga0068852_100111289 3300005616 Unclassified 2490
206 Ga0068852_100223280 3300005616 Bacteria 1793
207 Ga0068852_100920448 3300005616 Bacteria 892
208 Ga0068852_102667994 3300005616 Bacteria 519
209 Ga0068859_100003822 3300005617 Bacteria 15377
210 Ga0068859_100644005 3300005617 Unclassified 1152
211 Ga0068864_100028940 3300005618 Unclassified 4687
212 Ga0068864_100732842 3300005618 Bacteria 968
213 Ga0068864_100922272 3300005618 Unclassified 863
214 Ga0068864_101172838 3300005618 Unclassified 766
215 Ga0068864_101462168 3300005618 Bacteria 686
216 Ga0068866_10044883 3300005718 Bacteria 2214
217 Ga0068866_10599907 3300005718 Bacteria 743
218 Ga0068861_100105876 3300005719 Unclassified 2246
219 Ga0068861_100372418 3300005719 Bacteria 1259
220 Ga0068861_100479695 3300005719 Bacteria 1120
221 Ga0068861_101872619 3300005719 Unclassified 596
222 Ga0068861_102129904 3300005719 Bacteria 561
223 Ga0068851_10247991 3300005834 Bacteria 1009
224 Ga0068851_10890393 3300005834 Bacteria 557
225 Ga0068870_10156858 3300005840 Bacteria 1346
226 Ga0068863_100011808 3300005841 Bacteria 8443
227 Ga0068863_100080513 3300005841 Bacteria 3085
228 Ga0068863_100276921 3300005841 Unclassified 1625
229 Ga0068863_101011481 3300005841 Bacteria 834
230 Ga0068863_102019482 3300005841 Bacteria 587
231 Ga0068858_100425073 3300005842 Bacteria 1278
232 Ga0068858_100567704 3300005842 Bacteria 1099
233 Ga0068858_100959293 3300005842 Bacteria 837
234 Ga0068858_102026130 3300005842 Bacteria 569
235 Ga0068860_100153064 3300005843 Bacteria 2221
236 Ga0068860_100656848 3300005843 Bacteria 1057
237 Ga0068862_100026965 3300005844 Bacteria 4832
238 Ga0068862_100053947 3300005844 Bacteria 3442
239 Ga0068862_100087875 3300005844 Unclassified 2703
240 Ga0068862_100706697 3300005844 Unclassified 977
241 Ga0068862_100723461 3300005844 Bacteria 966
242 Ga0068862_100812019 3300005844 Unclassified 914
243 Ga0068862_101272499 3300005844 Bacteria 736
244 Ga0068862_101415778 3300005844 Unclassified 699
245 Ga0068862_101667013 3300005844 Unclassified 645
246 Ga0070717_10284219 3300006028 Unclassified 1468
247 Ga0075365_10000562 3300006038 Bacteria 14387
248 Ga0075365_11091067 3300006038 Unclassified 562
249 Ga0075368_10053538 3300006042 Bacteria 1607
250 Ga0075364_10004066 3300006051 Bacteria 8395
251 Ga0075364_10005645 3300006051 Bacteria 7292
252 Ga0075364_10252862 3300006051 Bacteria 1198
253 Ga0075432_10453801 3300006058 Unclassified 563
254 Ga0070716_100479436 3300006173 Bacteria 913
255 Ga0075362_10105944 3300006177 Bacteria 1319
256 Ga0075367_10033063 3300006178 Bacteria 2979
257 Ga0075366_10000965 3300006195 Bacteria 14034
258 Ga0075366_10470540 3300006195 Bacteria 776
259 Ga0075366_10531682 3300006195 Bacteria 728
260 Ga0097621_100037514 3300006237 Bacteria 3884
261 Ga0097621_101063255 3300006237 Unclassified 759
262 Ga0068871_100045078 3300006358 Bacteria 3548
263 Ga0068871_100213392 3300006358 Unclassified 1670
264 Ga0068871_100223288 3300006358 Unclassified 1633
265 Ga0068871_100819182 3300006358 Bacteria 859
266 Ga0068871_101205864 3300006358 Unclassified 710
267 Ga0068871_101426741 3300006358 Unclassified 653
268 Ga0075428_100002190 3300006844 Bacteria 21137
269 Ga0075428_100730850 3300006844 Unclassified 1054
270 Ga0075428_100807477 3300006844 Unclassified 997
271 Ga0075428_101100872 3300006844 Bacteria 839
272 Ga0075430_100006051 3300006846 Bacteria 10198
273 Ga0075430_100019324 3300006846 Bacteria 5792
274 Ga0075430_101613232 3300006846 Bacteria 533
275 Ga0075431_100014795 3300006847 Bacteria 7898
276 Ga0075431_100118506 3300006847 Bacteria 2731
277 Ga0075431_100435891 3300006847 Bacteria 1308
278 Ga0075433_10031686 3300006852 Bacteria 4521
279 Ga0075433_10032746 3300006852 Bacteria 4454
280 Ga0075433_10058944 3300006852 Bacteria 3359
281 Ga0075433_10088645 3300006852 Bacteria 2734
282 Ga0075433_11730977 3300006852 Unclassified 538
283 Ga0075434_100004927 3300006871 Bacteria 12099
284 Ga0075434_100023434 3300006871 Bacteria 6016
285 Ga0075434_100195972 3300006871 Bacteria 2040
286 Ga0075434_100567873 3300006871 Unclassified 1154
287 Ga0075429_100214588 3300006880 Bacteria 1686
288 Ga0075429_100229844 3300006880 Bacteria 1625
289 Ga0068865_100423063 3300006881 Unclassified 1096
290 Ga0068865_100645482 3300006881 Bacteria 899
291 Ga0068865_101667383 3300006881 Bacteria 574
292 Ga0068865_101782309 3300006881 Unclassified 556
293 Ga0068865_102000795 3300006881 Unclassified 526
294 Ga0075436_100306906 3300006914 Unclassified 1138
295 Ga0075436_100429528 3300006914 Bacteria 960
296 Ga0097620_100003822 3300006931 Bacteria 15377
297 Ga0097620_100644013 3300006931 Unclassified 1152
298 Ga0075435_100006365 3300007076 Bacteria 8345
299 Ga0075435_100015028 3300007076 Bacteria 5809
300 Ga0075435_100272534 3300007076 Bacteria 1444
301 Ga0075435_100279837 3300007076 Bacteria 1424
302 Ga0105240_10195813 3300009093 Bacteria 2373
303 Ga0105240_10302364 3300009093 Bacteria 1830
304 Ga0105240_11641437 3300009093 Bacteria 672
305 Ga0105240_12076160 3300009093 Bacteria 590
306 Ga0111539_10001892 3300009094 Bacteria 27846
307 Ga0111539_10024552 3300009094 Bacteria 7393
308 Ga0111539_10140000 3300009094 Bacteria 2833
309 Ga0111539_10173669 3300009094 Unclassified 2518
310 Ga0111539_10460819 3300009094 Bacteria 1480
311 Ga0111539_10730386 3300009094 Bacteria 1153
312 Ga0111539_11547838 3300009094 Unclassified 769
313 Ga0111539_11984297 3300009094 Bacteria 675
314 Ga0111539_13090895 3300009094 Bacteria 537
315 Ga0111539_13447851 3300009094 Bacteria 508
316 Ga0105245_10374069 3300009098 Unclassified 1417
317 Ga0105245_11597005 3300009098 Unclassified 704
318 Ga0105247_10100266 3300009101 Bacteria 1851
319 Ga0105247_10359334 3300009101 Bacteria 1026
320 Ga0114129_10002861 3300009147 Bacteria 24137
321 Ga0114129_10004267 3300009147 Bacteria 20199
322 Ga0114129_10007233 3300009147 Bacteria 15803
323 Ga0114129_10155007 3300009147 Bacteria 3133
324 Ga0114129_10188247 3300009147 Bacteria 2804
325 Ga0114129_11936848 3300009147 Bacteria 714
326 Ga0114129_12298525 3300009147 Bacteria 647
327 Ga0105243_10110197 3300009148 Bacteria 2301
328 Ga0105243_11841527 3300009148 Bacteria 637
329 Ga0105241_10221699 3300009174 Bacteria 1590
330 Ga0105242_10031143 3300009176 Bacteria 4258
331 Ga0105242_10071788 3300009176 Unclassified 2874
332 Ga0105242_10097671 3300009176 Bacteria 2483
333 Ga0105242_10873422 3300009176 Bacteria 897
334 Ga0105242_13148114 3300009176 Bacteria 512
335 Ga0105248_10026313 3300009177 Bacteria 6472
336 Ga0105248_10054044 3300009177 Bacteria 4504
337 Ga0105248_10058976 3300009177 Bacteria 4311
338 Ga0105248_10059861 3300009177 Unclassified 4278
339 Ga0105248_10178054 3300009177 Bacteria 2396
340 Ga0105248_11490066 3300009177 Bacteria 766
341 Ga0105248_11824620 3300009177 Bacteria 690
342 Ga0105248_11901247 3300009177 Unclassified 675
343 Ga0105248_12086345 3300009177 Unclassified 644
344 Ga0105248_13388069 3300009177 Unclassified 506
345 Ga0105238_10136346 3300009551 Bacteria 2432
346 Ga0105238_10382426 3300009551 Bacteria 1399
347 Ga0105238_11569608 3300009551 Archaea 688
348 Ga0105249_10001254 3300009553 Bacteria 22246
349 Ga0105249_10005766 3300009553 Bacteria 10712
350 Ga0105249_10080278 3300009553 Bacteria 3030
351 Ga0105249_10791467 3300009553 Bacteria 1012
352 Ga0105239_10140364 3300010375 Unclassified 2692
353 Ga0105239_10296047 3300010375 Bacteria 1822
354 Ga0105246_10647265 3300011119 Bacteria 920
355 Ga0105246_10809966 3300011119 Unclassified 832
356 Ga0105246_11047866 3300011119 Unclassified 741
357 Ga0157369_10085696 3300013105 Bacteria 3366
358 Ga0157369_10753118 3300013105 Bacteria 1002
359 Ga0157374_10076825 3300013296 Bacteria 3158
360 Ga0157374_10313768 3300013296 Bacteria 1553
361 Ga0157374_11056116 3300013296 Bacteria 832
362 Ga0157378_10899471 3300013297 Bacteria 916
363 Ga0157378_10972425 3300013297 Unclassified 882
364 Ga0157378_11134919 3300013297 Bacteria 819
365 Ga0157378_11189019 3300013297 Bacteria 802
366 Ga0157378_11506415 3300013297 Bacteria 717
367 Ga0157378_12540327 3300013297 Unclassified 564
368 Ga0157378_13011974 3300013297 Bacteria 523
369 Ga0163162_10048642 3300013306 Bacteria 4249
370 Ga0163162_10144922 3300013306 Bacteria 2490
371 Ga0163162_10421010 3300013306 Bacteria 1468
372 Ga0163162_11700818 3300013306 Unclassified 720
373 Ga0157372_10225441 3300013307 Bacteria 2173
374 Ga0157372_11058298 3300013307 Bacteria 939
375 Ga0157375_10152246 3300013308 Unclassified 2449
376 Ga0157375_10208129 3300013308 Bacteria 2113
377 Ga0157375_10259698 3300013308 Bacteria 1899
378 Ga0157375_10835267 3300013308 Unclassified 1068
379 Ga0157375_12002510 3300013308 Unclassified 688
380 Ga0157375_13404568 3300013308 Bacteria 530
381 Ga0163163_10059827 3300014325 Bacteria 3770
382 Ga0163163_10137123 3300014325 Unclassified 2488
383 Ga0163163_10137638 3300014325 Bacteria 2483
384 Ga0163163_10187170 3300014325 Unclassified 2118
385 Ga0163163_10868487 3300014325 Bacteria 965
386 Ga0163163_12296948 3300014325 Unclassified 598
387 Ga0163163_12641817 3300014325 Bacteria 559
388 Ga0157380_10097792 3300014326 Bacteria 2437
389 Ga0157380_10143224 3300014326 Bacteria 2056
390 Ga0157380_10225108 3300014326 Bacteria 1681
391 Ga0157380_10848854 3300014326 Unclassified 935
392 Ga0157380_10874255 3300014326 Bacteria 923
393 Ga0157380_10874444 3300014326 Bacteria 923
394 Ga0157380_11520023 3300014326 Bacteria 723
395 Ga0157380_11634596 3300014326 Bacteria 700
396 Ga0157380_11740667 3300014326 Bacteria 681
397 Ga0157380_13167981 3300014326 Unclassified 525
398 Ga0157379_10216935 3300014968 Bacteria 1733
399 Ga0157379_10385819 3300014968 Bacteria 1286
400 Ga0157379_10726632 3300014968 Bacteria 933
401 Ga0157376_10009699 3300014969 Bacteria 7007
402 Ga0157376_10029717 3300014969 Unclassified 4356
403 Ga0157376_10224087 3300014969 Unclassified 1743
404 Ga0157376_10435551 3300014969 Bacteria 1275
405 Ga0157376_11815180 3300014969 Unclassified 646
406 Ga0157376_11931565 3300014969 Bacteria 627
407 Ga0163161_10861593 3300017792 Bacteria 765
408 Ga0206353_10674301 3300020082 Bacteria 535
409 Ga0213876_10119947 3300021384 Bacteria 1396
410 Ga0207666_1076982 3300025271 Unclassified 538
411 Ga0207697_10000772 3300025315 Bacteria 18141
412 Ga0207656_10269417 3300025321 Bacteria 838
413 Ga0207656_10664497 3300025321 Bacteria 533
414 Ga0207682_10212584 3300025893 Bacteria 892
415 Ga0207682_10404771 3300025893 Bacteria 645
416 Ga0207682_10492726 3300025893 Bacteria 580
417 Ga0207642_10196629 3300025899 Bacteria 1111
418 Ga0207642_10483927 3300025899 Bacteria 755
419 Ga0207710_10377925 3300025900 Bacteria 725
420 Ga0207688_10002773 3300025901 Bacteria 9498
421 Ga0207688_10165611 3300025901 Bacteria 1312
422 Ga0207680_10052607 3300025903 Bacteria 2441
423 Ga0207680_10075968 3300025903 Unclassified 2097
424 Ga0207680_10287234 3300025903 Bacteria 1144
425 Ga0207647_10116664 3300025904 Bacteria 1576
426 Ga0207647_10609017 3300025904 Bacteria 602
427 Ga0207647_10610010 3300025904 Bacteria 601
428 Ga0207645_10937110 3300025907 Unclassified 588
429 Ga0207643_10182357 3300025908 Bacteria 1271
430 Ga0207684_10364960 3300025910 Bacteria 1243
431 Ga0207684_10438502 3300025910 Bacteria 1122
432 Ga0207684_10778491 3300025910 Bacteria 810
433 Ga0207707_10677920 3300025912 Bacteria 867
434 Ga0207707_11113714 3300025912 Bacteria 643
435 Ga0207695_10125684 3300025913 Bacteria 2527
436 Ga0207663_10558001 3300025916 Unclassified 896
437 Ga0207660_10638366 3300025917 Bacteria 868
438 Ga0207662_10002361 3300025918 Bacteria 9462
439 Ga0207662_10061797 3300025918 Unclassified 2250
440 Ga0207662_10938226 3300025918 Unclassified 613
441 Ga0207657_10201517 3300025919 Bacteria 1600
442 Ga0207649_10003342 3300025920 Bacteria 8775
443 Ga0207649_10304409 3300025920 Unclassified 1166
444 Ga0207649_10367202 3300025920 Bacteria 1069
445 Ga0207681_10022832 3300025923 Bacteria 3994
446 Ga0207681_10088153 3300025923 Unclassified 2209
447 Ga0207681_10220674 3300025923 Bacteria 1466
448 Ga0207681_10328906 3300025923 Bacteria 1218
449 Ga0207694_10370275 3300025924 Bacteria 1188
450 Ga0207694_10882807 3300025924 Unclassified 756
451 Ga0207694_11071375 3300025924 Bacteria 682
452 Ga0207650_10010455 3300025925 Bacteria 6361
453 Ga0207650_10022308 3300025925 Bacteria 4479
454 Ga0207650_10064504 3300025925 Bacteria 2742
455 Ga0207650_10160269 3300025925 Bacteria 1782
456 Ga0207650_10207722 3300025925 Bacteria 1571
457 Ga0207650_10539789 3300025925 Bacteria 977
458 Ga0207659_10078671 3300025926 Unclassified 2430
459 Ga0207659_10096263 3300025926 Bacteria 2222
460 Ga0207659_10384772 3300025926 Bacteria 1170
461 Ga0207659_10406365 3300025926 Bacteria 1140
462 Ga0207659_10533713 3300025926 Bacteria 996
463 Ga0207659_10940076 3300025926 Unclassified 743
464 Ga0207687_10060991 3300025927 Bacteria 2662
465 Ga0207687_10188748 3300025927 Bacteria 1602
466 Ga0207687_10440398 3300025927 Bacteria 1079
467 Ga0207700_10349793 3300025928 Unclassified 1287
468 Ga0207644_10089495 3300025931 Bacteria 2291
469 Ga0207644_10154648 3300025931 Bacteria 1777
470 Ga0207644_10172039 3300025931 Unclassified 1692
471 Ga0207690_10254468 3300025932 Bacteria 1358
472 Ga0207690_10271928 3300025932 Bacteria 1317
473 Ga0207690_10736624 3300025932 Bacteria 812
474 Ga0207690_11251775 3300025932 Bacteria 620
475 Ga0207706_10036735 3300025933 Bacteria 4351
476 Ga0207706_10085694 3300025933 Bacteria 2770
477 Ga0207706_10181333 3300025933 Unclassified 1849
478 Ga0207706_10547227 3300025933 Bacteria 997
479 Ga0207706_10822047 3300025933 Bacteria 788
480 Ga0207706_10863325 3300025933 Bacteria 766
481 Ga0207686_10040704 3300025934 Bacteria 2827
482 Ga0207686_10064654 3300025934 Bacteria 2330
483 Ga0207686_11714098 3300025934 Unclassified 520
484 Ga0207709_10059748 3300025935 Bacteria 2374
485 Ga0207709_10187417 3300025935 Bacteria 1466
486 Ga0207709_10938905 3300025935 Unclassified 705
487 Ga0207670_10063237 3300025936 Bacteria 2531
488 Ga0207670_10872255 3300025936 Unclassified 753
489 Ga0207670_11205493 3300025936 Bacteria 641
490 Ga0207669_10045755 3300025937 Unclassified 2581
491 Ga0207669_10077387 3300025937 Bacteria 2115
492 Ga0207669_10462811 3300025937 Bacteria 1007
493 Ga0207669_10593369 3300025937 Bacteria 899
494 Ga0207669_10681576 3300025937 Bacteria 843
495 Ga0207669_11662304 3300025937 Bacteria 545
496 Ga0207704_10048697 3300025938 Unclassified 2543
497 Ga0207704_10113482 3300025938 Bacteria 1837
498 Ga0207704_10234030 3300025938 Bacteria 1368
499 Ga0207704_11334434 3300025938 Unclassified 614
500 Ga0207691_10021474 3300025940 Bacteria 6095
501 Ga0207691_10053749 3300025940 Bacteria 3676
502 Ga0207691_10148042 3300025940 Bacteria 2066
503 Ga0207691_10192644 3300025940 Bacteria 1777
504 Ga0207691_10601706 3300025940 Bacteria 931
505 Ga0207711_10018265 3300025941 Bacteria 5829
506 Ga0207711_10144641 3300025941 Unclassified 2141
507 Ga0207711_10144777 3300025941 Unclassified 2140
508 Ga0207711_10330700 3300025941 Bacteria 1409
509 Ga0207711_10624986 3300025941 Bacteria 1005
510 Ga0207711_11417222 3300025941 Bacteria 637
511 Ga0207711_11774495 3300025941 Bacteria 560
512 Ga0207711_12075604 3300025941 Bacteria 511
513 Ga0207689_10074129 3300025942 Bacteria 2797
514 Ga0207689_10127286 3300025942 Bacteria 2095
515 Ga0207689_10960749 3300025942 Bacteria 721
516 Ga0207661_10001428 3300025944 Bacteria 16108
517 Ga0207661_10012308 3300025944 Bacteria 6215
518 Ga0207679_10002083 3300025945 Bacteria 12410
519 Ga0207679_10041983 3300025945 Bacteria 3284
520 Ga0207679_10233106 3300025945 Bacteria 1556
521 Ga0207679_10368845 3300025945 Bacteria 1256
522 Ga0207679_11478069 3300025945 Bacteria 623
523 Ga0207667_10756568 3300025949 Bacteria 971
524 Ga0207651_10001330 3300025960 Bacteria 11158
525 Ga0207651_10597674 3300025960 Bacteria 964
526 Ga0207651_10726985 3300025960 Bacteria 876
527 Ga0207651_11188574 3300025960 Bacteria 685
528 Ga0207651_11933639 3300025960 Bacteria 530
529 Ga0207712_10011937 3300025961 Bacteria 5540
530 Ga0207712_10078458 3300025961 Bacteria 2396
531 Ga0207712_10652875 3300025961 Bacteria 914
532 Ga0207712_10666017 3300025961 Bacteria 906
533 Ga0207712_11257449 3300025961 Unclassified 661
534 Ga0207712_11336061 3300025961 Bacteria 641
535 Ga0207712_11391467 3300025961 Unclassified 628
536 Ga0207668_10321528 3300025972 Bacteria 1284
537 Ga0207668_10721926 3300025972 Bacteria 877
538 Ga0207668_11915835 3300025972 Bacteria 534
539 Ga0207668_12081120 3300025972 Unclassified 511
540 Ga0207640_10225562 3300025981 Unclassified 1437
541 Ga0207640_10565627 3300025981 Bacteria 957
542 Ga0207640_10678815 3300025981 Bacteria 881
543 Ga0207640_10970716 3300025981 Bacteria 746
544 Ga0207658_10111366 3300025986 Bacteria 2165
545 Ga0207658_10520384 3300025986 Bacteria 1062
546 Ga0207658_11896125 3300025986 Unclassified 543
547 Ga0207677_10013411 3300026023 Bacteria 4749
548 Ga0207677_10236423 3300026023 Bacteria 1475
549 Ga0207677_10247294 3300026023 Bacteria 1446
550 Ga0207677_10413697 3300026023 Bacteria 1147
551 Ga0207703_10343359 3300026035 Bacteria 1373
552 Ga0207703_10421748 3300026035 Bacteria 1242
553 Ga0207703_10522849 3300026035 Bacteria 1116
554 Ga0207639_10394324 3300026041 Bacteria 1246
555 Ga0207639_10686133 3300026041 Bacteria 949
556 Ga0207639_10954421 3300026041 Bacteria 802
557 Ga0207678_10062158 3300026067 Bacteria 3211
558 Ga0207678_10066402 3300026067 Bacteria 3098
559 Ga0207678_10402467 3300026067 Bacteria 1185
560 Ga0207708_10001093 3300026075 Bacteria 20328
561 Ga0207708_10455269 3300026075 Bacteria 1066
562 Ga0207708_10511461 3300026075 Bacteria 1008
563 Ga0207708_11448935 3300026075 Bacteria 603
564 Ga0207708_11637692 3300026075 Unclassified 565
565 Ga0207702_10171726 3300026078 Bacteria 1988
566 Ga0207702_10996829 3300026078 Bacteria 831
567 Ga0207641_10014969 3300026088 Bacteria 6359
568 Ga0207641_10064332 3300026088 Bacteria 3135
569 Ga0207641_10200120 3300026088 Bacteria 1841
570 Ga0207641_10206070 3300026088 Bacteria 1816
571 Ga0207641_10361365 3300026088 Bacteria 1386
572 Ga0207641_10735499 3300026088 Bacteria 973
573 Ga0207648_10007485 3300026089 Bacteria 10729
574 Ga0207648_10011911 3300026089 Bacteria 8168
575 Ga0207648_10150231 3300026089 Unclassified 2055
576 Ga0207648_11500138 3300026089 Unclassified 634
577 Ga0207648_11645629 3300026089 Unclassified 603
578 Ga0207648_11790717 3300026089 Bacteria 576
579 Ga0207676_10098053 3300026095 Unclassified 2422
580 Ga0207676_10592018 3300026095 Bacteria 1064
581 Ga0207676_10708581 3300026095 Bacteria 976
582 Ga0207676_10729959 3300026095 Bacteria 962
583 Ga0207676_11104632 3300026095 Unclassified 784
584 Ga0207676_11268119 3300026095 Unclassified 731
585 Ga0207674_11809654 3300026116 Bacteria 578
586 Ga0207675_100153719 3300026118 Unclassified 2192
587 Ga0207675_100564433 3300026118 Bacteria 1138
588 Ga0207675_100621348 3300026118 Bacteria 1085
589 Ga0207675_100713542 3300026118 Bacteria 1012
590 Ga0207675_101030748 3300026118 Bacteria 842
591 Ga0207675_101576150 3300026118 Bacteria 677
592 Ga0207683_10016603 3300026121 Bacteria 6266
593 Ga0207683_10046066 3300026121 Bacteria 3814
594 Ga0207683_10083873 3300026121 Bacteria 2832
595 Ga0207683_10151646 3300026121 Unclassified 2092
596 Ga0207683_10157805 3300026121 Bacteria 2050
597 Ga0207683_10594449 3300026121 Bacteria 1024
598 Ga0207683_10691580 3300026121 Bacteria 945
599 Ga0207683_10950776 3300026121 Bacteria 798
600 Ga0207683_11006305 3300026121 Bacteria 774
601 Ga0207698_10104018 3300026142 Unclassified 2361
602 Ga0207698_10327331 3300026142 Unclassified 1438
603 Ga0207698_10531528 3300026142 Bacteria 1149
604 Ga0207698_10789066 3300026142 Bacteria 951
605 Ga0209983_1066781 3300027665 Unclassified 798
606 Ga0209998_10033825 3300027717 Bacteria 1141
607 Ga0209813_10085216 3300027866 Bacteria 1052
608 Ga0209974_10065162 3300027876 Bacteria 1237
609 Ga0209974_10095280 3300027876 Bacteria 1035
610 Ga0207428_10016103 3300027907 Bacteria 6441
611 Ga0268266_10256241 3300028379 Bacteria 1620
612 Ga0268266_10699476 3300028379 Bacteria 977
613 Ga0268266_10981289 3300028379 Unclassified 817
614 Ga0268266_11030104 3300028379 Bacteria 796
615 Ga0268266_11654958 3300028379 Bacteria 615
616 Ga0268265_10122749 3300028380 Bacteria 2143
617 Ga0268265_10124906 3300028380 Unclassified 2127
618 Ga0268265_10341819 3300028380 Bacteria 1363
619 Ga0268265_10922509 3300028380 Bacteria 859
620 Ga0268265_10937031 3300028380 Unclassified 852
621 Ga0268265_11272228 3300028380 Unclassified 735
622 Ga0268265_11944779 3300028380 Bacteria 595
623 Ga0268265_12267722 3300028380 Bacteria 550
624 Ga0268264_10266278 3300028381 Bacteria 1599
625 Ga0307513_10771604 3300031456 Bacteria 667
626 Ga0307408_100040174 3300031548 Bacteria 3312
627 Ga0307408_100176766 3300031548 Bacteria 1708
628 Ga0307408_100593034 3300031548 Bacteria 983
629 Ga0307405_10557249 3300031731 Bacteria 928
630 Ga0307410_10018152 3300031852 Bacteria 4245
631 Ga0307410_10458030 3300031852 Bacteria 1042
632 Ga0307410_11673589 3300031852 Bacteria 563
633 Ga0307407_10154023 3300031903 Bacteria 1497
634 Ga0307407_10219668 3300031903 Bacteria 1284
635 Ga0307412_10150812 3300031911 Bacteria 1715
636 Ga0307412_10220979 3300031911 Bacteria 1452
637 Ga0307412_11552073 3300031911 Bacteria 603
638 Ga0307409_100030071 3300031995 Bacteria 3897
639 Ga0307409_100089370 3300031995 Bacteria 2518
640 Ga0307409_100173215 3300031995 Bacteria 1902
641 Ga0307409_101483992 3300031995 Bacteria 705
642 Ga0307416_100040357 3300032002 Bacteria 3625
643 Ga0307416_100056201 3300032002 Bacteria 3175
644 Ga0307416_100360816 3300032002 Bacteria 1475
645 Ga0307416_100475328 3300032002 Bacteria 1308
646 Ga0307416_100598913 3300032002 Bacteria 1182
647 Ga0307416_101061513 3300032002 Unclassified 914
648 Ga0307416_101342006 3300032002 Bacteria 821
649 Ga0307416_101572766 3300032002 Bacteria 763
650 Ga0307416_101764404 3300032002 Bacteria 723
651 Ga0307416_103701786 3300032002 Bacteria 512
652 Ga0307411_10081445 3300032005 Bacteria 2229
653 Ga0307411_10319128 3300032005 Bacteria 1254
654 Ga0307411_10512552 3300032005 Unclassified 1016
655 Ga0307411_10981694 3300032005 Bacteria 755
656 Ga0307415_100195976 3300032126 Bacteria 1598
657 Ga0307415_100342065 3300032126 Bacteria 1256
658 Ga0373940_0123896 3300035088 Bacteria 804
659 Ga0373951_0027075 3300035091 Bacteria 1338
660 Ga0373932_0030680 3300035112 Bacteria 1492
661 Ga0373941_0314819 3300035115 Unclassified 628
662 Ga0373945_0305763 3300035116 Bacteria 682
663 Ga0373954_0639826 3300035118 Unclassified 527
664 Ga0373956_0408164 3300035119 Unclassified 648
665 Ga0373943_0121418 3300035170 Bacteria 1389
666 Ga0373943_0229432 3300035170 Unclassified 1037
667 Ga0373946_0144595 3300035171 Bacteria 1105
668 Ga0373955_0191679 3300035172 Bacteria 1215
669 Ga0373942_0073203 3300035207 Bacteria 1004
670 Ga0373961_0111885 3300035241 Bacteria 895
671 Ga0373961_0226756 3300035241 Unclassified 668
672 Ga0373962_0187825 3300035242 Bacteria 694
673 Ga0373931_0092841 3300035691 Bacteria 1685
674 Ga0373931_0592533 3300035691 Unclassified 724
675 Ga0373937_0000651 3300036401 Bacteria 30483
676 Ga0373937_0280691 3300036401 Bacteria 1573
677 Ga0373925_0006513 3300037068 Bacteria 8586
678 Ga0373925_1139757 3300037068 Bacteria 641
679 Ga0395900_0875039 3300037418 Bacteria 823
680 Ga0436365_0113116 3300039437 Bacteria 1636
681 Ga0439439_0086069 3300041406 Bacteria 854
682 Ga0439461_0060476 3300041410 Unclassified 859
683 Ga0451791_1519790 3300041451 Bacteria 601
684 Ga0451793_0108495 3300041452 Unclassified 642
685 Ga0451802_0119544 3300041460 Bacteria 586
686 Ga0451802_0912663 3300041460 Bacteria 733
687 Ga0451804_0779925 3300041463 Bacteria 810
688 Ga0451807_0449784 3300041486 Bacteria 685
689 Ga0451845_0675573 3300041501 Unclassified 661
690 Ga0451853_0170158 3300041512 Bacteria 727
691 Ga0451853_1132466 3300041512 Unclassified 602
692 Ga0451853_1313310 3300041512 Bacteria 620
693 Ga0451853_2018823 3300041512 Bacteria 1263
694 Ga0451853_3998079 3300041512 Bacteria 1226
695 Ga0439433_0021574 3300041999 Bacteria 1441
696 Ga0439433_0051436 3300041999 Bacteria 972
697 Ga0439449_0120317 3300042007 Bacteria 975
698 Ga0439454_056707 3300042011 Bacteria 672
699 Ga0439457_116874 3300042014 Unclassified 629
700 Ga0439462_0091092 3300042015 Bacteria 836
701 Ga0450920_018330 3300042122 Bacteria 1340
702 Ga0450920_044911 3300042122 Bacteria 883
703 Ga0450923_012281 3300042125 Bacteria 1556
704 Ga0450891_019284 3300042129 Unclassified 663
705 Ga0450894_002011 3300042131 Bacteria 2802
706 Ga0450895_005338 3300042132 Bacteria 1034
707 Ga0450896_000284 3300042133 Bacteria 4738
708 Ga0450899_017456 3300042135 Bacteria 826
709 Ga0450905_075900 3300042142 Bacteria 578
710 Ga0450905_083305 3300042142 Unclassified 558
711 Ga0450906_038357 3300042145 Bacteria 845
712 Ga0439446_0013235 3300042156 Bacteria 2262
713 Ga0439446_0107312 3300042156 Unclassified 888
714 Ga0450908_020092 3300042184 Bacteria 1175
715 Ga0439434_0070902 3300042435 Bacteria 1097
716 Ga0439434_0272390 3300042435 Unclassified 582
717 Ga0439435_0040353 3300042436 Bacteria 1304
718 Ga0439460_0028314 3300042461 Bacteria 1580
719 Ga0450916_018446 3300042530 Bacteria 940
720 Ga0450916_065943 3300042530 Unclassified 596
721 Ga0450893_0007133 3300042532 Bacteria 1814
722 Ga0451577_0033978 3300042876 Bacteria 4599
723 Ga0453684_0230994 3300044712 Bacteria 2136
724 Ga0451576_0585839 3300045051 Bacteria 1172
725 Ga0495592_0860683 3300046454 Bacteria 535
726 Ga0495603_0015692 3300046455 Bacteria 4583
727 Ga0495629_0264585 3300046459 Bacteria 1182
728 Ga0495651_0790365 3300046462 Unclassified 586
729 Ga0495653_0016842 3300046463 Bacteria 5948
730 Ga0495582_0584143 3300046473 Unclassified 646
731 Ga0495585_0612910 3300046492 Unclassified 511
732 Ga0495594_0235853 3300046499 Bacteria 1043
733 Ga0495618_0811460 3300046514 Bacteria 544
734 Ga0495630_0924182 3300046517 Unclassified 664
735 Ga0495652_0255448 3300046529 Bacteria 1297
736 Ga0495640_0245015 3300046533 Bacteria 1124
737 Ga0495586_0282431 3300046535 Bacteria 950
738 Ga0495621_0190859 3300046539 Bacteria 821
739 Ga0495667_0114538 3300046559 Bacteria 1742
740 Ga0495634_0579531 3300046642 Bacteria 652
741 Ga0495635_0314122 3300046663 Bacteria 1049
742 Ga0495659_0286459 3300046664 Unclassified 693
743 Ga0495658_0099746 3300046683 Bacteria 1732
744 Ga0495658_0172874 3300046683 Bacteria 1338
745 Ga0495658_0569642 3300046683 Bacteria 725
746 Ga0495658_0801188 3300046683 Unclassified 603
747 Ga0495613_0047197 3300046689 Bacteria 3182
748 Ga0495613_0589545 3300046689 Unclassified 740
749 Ga0495604_0200006 3300047317 Bacteria 1387
750 Ga0495674_0077950 3300047319 Bacteria 2848
751 Ga0495674_0439832 3300047319 Unclassified 1049
752 Ga0495674_0645816 3300047319 Bacteria 835
753 Ga0495674_0802443 3300047319 Bacteria 732
754 Ga0496100_0152608 3300048903 Bacteria 1649
755 Ga0496100_0531087 3300048903 Unclassified 909
756 Ga0496100_0540795 3300048903 Unclassified 900
757 Ga0496101_0025059 3300048904 Bacteria 4135
758 Ga0496101_0468680 3300048904 Bacteria 994
759 Ga0496101_0915932 3300048904 Bacteria 690
760 Ga0496101_0963197 3300048904 Unclassified 671
761 Ga0496102_0166996 3300048905 Unclassified 2071
762 Ga0496102_0560969 3300048905 Bacteria 1065
763 Ga0496102_0702480 3300048905 Bacteria 934
764 Ga0496102_1548139 3300048905 Bacteria 581
765 Ga0496102_1578786 3300048905 Bacteria 575
766 Ga0496103_0213103 3300048906 Bacteria 1242
767 Ga0496104_0000157 3300048907 Bacteria 61755
768 Ga0496104_0042987 3300048907 Bacteria 4243
769 Ga0496104_0086907 3300048907 Unclassified 2986
770 Ga0496104_0404824 3300048907 Bacteria 1277
771 Ga0496105_0593340 3300048908 Bacteria 860
772 Ga0496105_0811839 3300048908 Unclassified 710
773 Ga0496105_0837321 3300048908 Bacteria 697
774 Ga0496106_0111211 3300048909 Bacteria 2133
775 Ga0496106_0349184 3300048909 Unclassified 1188
776 Ga0496106_0443834 3300048909 Bacteria 1042
777 Ga0496106_0506700 3300048909 Unclassified 969
778 Ga0496106_0849733 3300048909 Unclassified 722
779 Ga0496106_0974294 3300048909 Bacteria 668
780 Ga0496107_0078155 3300048910 Bacteria 2411
781 Ga0496107_0135686 3300048910 Unclassified 1818
782 Ga0496107_0361523 3300048910 Bacteria 1080
783 Ga0496107_0742530 3300048910 Bacteria 720
784 Ga0496107_0846301 3300048910 Unclassified 668
785 Ga0496108_0008261 3300048911 Bacteria 8444
786 Ga0496108_0132996 3300048911 Unclassified 2138
787 Ga0496108_0200393 3300048911 Bacteria 1732
788 Ga0496108_0204459 3300048911 Bacteria 1714
789 Ga0496108_0395800 3300048911 Bacteria 1207
790 Ga0496108_0509991 3300048911 Bacteria 1050
791 Ga0496109_0010308 3300048912 Bacteria 7981
792 Ga0496109_0011076 3300048912 Bacteria 7731
793 Ga0496109_0098078 3300048912 Bacteria 2717
794 Ga0496109_0148942 3300048912 Bacteria 2191
795 Ga0496109_0228590 3300048912 Bacteria 1750
796 Ga0496109_0948229 3300048912 Bacteria 798
797 Ga0496109_1087468 3300048912 Bacteria 737
798 Ga0496110_0002759 3300048913 Bacteria 13257
799 Ga0496110_0010807 3300048913 Bacteria 7443
800 Ga0496110_0011106 3300048913 Bacteria 7357
801 Ga0496110_0111841 3300048913 Unclassified 2455
802 Ga0496110_0182747 3300048913 Bacteria 1904
803 Ga0496110_1383736 3300048913 Bacteria 613
804 Ga0496110_1503263 3300048913 Unclassified 583
805 Ga0496111_0013452 3300048914 Bacteria 5570
806 Ga0496111_0065455 3300048914 Bacteria 2638
807 Ga0496111_0118079 3300048914 Bacteria 1958
808 Ga0496111_0510770 3300048914 Bacteria 884
809 Ga0496111_0647055 3300048914 Bacteria 771
810 Ga0496112_0000148 3300048915 Bacteria 44089
811 Ga0496112_0004165 3300048915 Bacteria 12183
812 Ga0496112_0232059 3300048915 Bacteria 1800
813 Ga0496112_0301031 3300048915 Bacteria 1549
814 Ga0496112_0995801 3300048915 Unclassified 758
815 Ga0496113_0103583 3300048916 Unclassified 2207
816 Ga0496114_0027098 3300048917 Bacteria 4693
817 Ga0496114_0444674 3300048917 Unclassified 1148
818 Ga0501031_0108509 3300049568 Bacteria 1812
819 Ga0501031_0110018 3300049568 Bacteria 1799
820 Ga0501031_0243145 3300049568 Bacteria 1170
821 Ga0501032_0094652 3300049569 Bacteria 1980
822 Ga0501032_0601387 3300049569 Unclassified 699
823 Ga0501032_0638444 3300049569 Bacteria 676
824 Ga0501033_0048274 3300049570 Bacteria 3162
825 Ga0501033_0139266 3300049570 Bacteria 1755
826 Ga0501033_0807887 3300049570 Bacteria 634
827 Ga0501033_1071967 3300049570 Bacteria 537
828 Ga0501034_0006113 3300049571 Bacteria 12991
829 Ga0501034_0128066 3300049571 Bacteria 2523
830 Ga0501034_0663665 3300049571 Bacteria 943
831 Ga0501034_1246297 3300049571 Unclassified 621
832 Ga0501036_0021023 3300049572 Bacteria 5480
833 Ga0501036_0175496 3300049572 Bacteria 1804
834 Ga0501036_0177638 3300049572 Bacteria 1793
835 Ga0501036_0214351 3300049572 Bacteria 1617
836 Ga0501036_0395912 3300049572 Bacteria 1152
837 Ga0501036_0728600 3300049572 Bacteria 818
838 Ga0501036_0888572 3300049572 Bacteria 732
839 Ga0501037_0150182 3300049573 Bacteria 1665
840 Ga0501037_0765940 3300049573 Bacteria 639
841 Ga0501038_0026845 3300049574 Bacteria 5127
842 Ga0501038_0065980 3300049574 Bacteria 3083
843 Ga0501038_0229508 3300049574 Bacteria 1478
844 Ga0501038_0557184 3300049574 Bacteria 871
845 Ga0501039_0059409 3300049575 Bacteria 2962
846 Ga0501039_0086565 3300049575 Bacteria 2440
847 Ga0501039_0121123 3300049575 Bacteria 2050
848 Ga0501039_1588473 3300049575 Unclassified 502
849 Ga0501040_0202994 3300049576 Unclassified 1408
850 Ga0501040_0348611 3300049576 Bacteria 1060
851 Ga0501040_0486101 3300049576 Bacteria 890
852 Ga0501040_0616573 3300049576 Bacteria 784
853 Ga0501040_0702329 3300049576 Unclassified 731
854 Ga0501040_0782944 3300049576 Bacteria 690
855 Ga0501041_0082306 3300049577 Bacteria 1983
856 Ga0501041_0155832 3300049577 Bacteria 1427
857 Ga0501041_0602352 3300049577 Bacteria 701
858 Ga0501041_0702693 3300049577 Bacteria 647
859 Ga0501042_0021483 3300049578 Bacteria 4499
860 Ga0501042_0260722 3300049578 Bacteria 1251
861 Ga0501042_0371331 3300049578 Unclassified 1035
862 Ga0501042_0465593 3300049578 Bacteria 917
863 Ga0501042_0500515 3300049578 Bacteria 882
864 Ga0501042_0992274 3300049578 Unclassified 612
865 Ga0501043_0003776 3300049579 Bacteria 12447
866 Ga0501043_0349186 3300049579 Bacteria 1124
867 Ga0501043_0424204 3300049579 Bacteria 1002
868 Ga0501043_0974685 3300049579 Unclassified 605
869 Ga0501043_1235536 3300049579 Bacteria 523
870 Ga0501046_0005320 3300049580 Bacteria 11510
871 Ga0501046_0011536 3300049580 Bacteria 7556
872 Ga0501046_0069357 3300049580 Bacteria 2743
873 Ga0501046_0296786 3300049580 Unclassified 1181
874 Ga0501046_1012268 3300049580 Unclassified 576
875 Ga0501046_1037604 3300049580 Bacteria 568
876 Ga0501047_0001473 3300049581 Bacteria 22948
877 Ga0501047_0051950 3300049581 Bacteria 3961
878 Ga0501047_0096646 3300049581 Bacteria 2832
879 Ga0501047_0156752 3300049581 Bacteria 2150
880 Ga0501047_0440795 3300049581 Unclassified 1132
881 Ga0501048_0151199 3300049582 Bacteria 1642
882 Ga0501048_0156468 3300049582 Bacteria 1612
883 Ga0501048_0685850 3300049582 Bacteria 735
884 Ga0501048_0975704 3300049582 Bacteria 609
885 Ga0501067_0228787 3300049583 Bacteria 1035
886 Ga0501067_0247372 3300049583 Bacteria 992
887 Ga0501067_0407869 3300049583 Unclassified 758
888 Ga0501067_0436425 3300049583 Bacteria 731
889 Ga0501067_0500022 3300049583 Bacteria 680
890 Ga0501068_0006774 3300049584 Bacteria 6331
891 Ga0501068_0620940 3300049584 Bacteria 705
892 Ga0501069_0217962 3300049585 Bacteria 1108
893 Ga0501069_0784561 3300049585 Unclassified 577
894 Ga0501070_0404719 3300049586 Bacteria 1103
895 Ga0501071_0035635 3300049587 Bacteria 3545
896 Ga0501071_0055007 3300049587 Bacteria 2872
897 Ga0501071_0137129 3300049587 Bacteria 1821
898 Ga0501071_0177385 3300049587 Bacteria 1596
899 Ga0501071_1174141 3300049587 Bacteria 593
900 Ga0501072_0018755 3300049588 Bacteria 5335
901 Ga0501072_0040269 3300049588 Bacteria 3669
902 Ga0501072_0264553 3300049588 Bacteria 1369
903 Ga0501072_0346760 3300049588 Bacteria 1179
904 Ga0501072_0347587 3300049588 Bacteria 1177
905 Ga0501072_0529226 3300049588 Unclassified 932
906 Ga0501072_0584751 3300049588 Bacteria 881
907 Ga0501072_0601348 3300049588 Bacteria 867
908 Ga0501072_0837720 3300049588 Bacteria 719
909 Ga0501072_1474436 3300049588 Bacteria 525
910 Ga0501073_0040646 3300049589 Bacteria 3289
911 Ga0501073_0110912 3300049589 Bacteria 1903
912 Ga0501073_0118916 3300049589 Bacteria 1831
913 Ga0501073_0147300 3300049589 Bacteria 1631
914 Ga0501073_0192543 3300049589 Bacteria 1411
915 Ga0501073_0224747 3300049589 Bacteria 1297
916 Ga0501073_0378015 3300049589 Bacteria 978
917 Ga0501073_0383720 3300049589 Bacteria 971
918 Ga0501074_0160395 3300049590 Bacteria 1606
919 Ga0501074_0162251 3300049590 Bacteria 1596
920 Ga0501074_0186184 3300049590 Bacteria 1480
921 Ga0501074_0343411 3300049590 Unclassified 1060
922 Ga0501074_0706996 3300049590 Bacteria 711
923 Ga0501075_0037021 3300049591 Bacteria 3643
924 Ga0501075_0042891 3300049591 Bacteria 3393
925 Ga0501075_0060105 3300049591 Bacteria 2864
926 Ga0501075_0088648 3300049591 Bacteria 2346
927 Ga0501075_0189572 3300049591 Bacteria 1568
928 Ga0501075_0541494 3300049591 Bacteria 888
929 Ga0501076_0005978 3300049592 Bacteria 8786
930 Ga0501076_0056689 3300049592 Bacteria 3110
931 Ga0501076_0086660 3300049592 Bacteria 2517
932 Ga0501076_0089559 3300049592 Bacteria 2474
933 Ga0501076_0241737 3300049592 Bacteria 1477
934 Ga0501076_0252368 3300049592 Unclassified 1444
935 Ga0501076_0323579 3300049592 Bacteria 1265
936 Ga0501076_0452904 3300049592 Bacteria 1057
937 Ga0501076_0775457 3300049592 Unclassified 791
938 Ga0501076_1358166 3300049592 Unclassified 584
939 Ga0501077_0040315 3300049593 Bacteria 2976
940 Ga0501077_0086806 3300049593 Bacteria 1983
941 Ga0501077_0184000 3300049593 Bacteria 1328
942 Ga0501077_0419057 3300049593 Unclassified 856
943 Ga0501077_0574753 3300049593 Bacteria 723
944 Ga0501249_173077 3300049679 Unclassified 554
945 Ga0501079_0054982 3300049741 Bacteria 3071
946 Ga0501079_0058537 3300049741 Bacteria 2973
947 Ga0501079_0103295 3300049741 Bacteria 2211
948 Ga0501079_0291780 3300049741 Bacteria 1276
949 Ga0501079_0312420 3300049741 Bacteria 1230
950 Ga0501079_0876309 3300049741 Unclassified 707
951 Ga0501079_0881503 3300049741 Unclassified 705
952 Ga0501080_0027293 3300049742 Bacteria 5309
953 Ga0501080_0287010 3300049742 Bacteria 1495
954 Ga0501080_0291905 3300049742 Unclassified 1480
955 Ga0501080_0607157 3300049742 Bacteria 971
956 Ga0501080_0608565 3300049742 Bacteria 969
957 Ga0501080_0621866 3300049742 Bacteria 957
958 Ga0501080_0746448 3300049742 Bacteria 861
959 Ga0501080_1534035 3300049742 Bacteria 565
960 Ga0501080_1557705 3300049742 Bacteria 560
961 Ga0501081_0042825 3300049743 Bacteria 3104
962 Ga0501081_0063454 3300049743 Bacteria 2564
963 Ga0501081_0212806 3300049743 Unclassified 1404
964 Ga0501081_0299607 3300049743 Bacteria 1179
965 Ga0501081_0635315 3300049743 Bacteria 800
966 Ga0501081_0710202 3300049743 Unclassified 755
967 Ga0501083_0012875 3300049744 Bacteria 5850
968 Ga0501083_0115600 3300049744 Bacteria 1761
969 Ga0501035_0094786 3300049822 Bacteria 2624
970 Ga0501035_0104196 3300049822 Bacteria 2488
971 Ga0501035_0193773 3300049822 Bacteria 1746
972 Ga0501044_0025113 3300049823 Bacteria 6319
973 Ga0501044_0037359 3300049823 Bacteria 5076
974 Ga0501045_0037298 3300049824 Bacteria 3532
975 Ga0501045_0046206 3300049824 Bacteria 3171
976 Ga0501045_0128366 3300049824 Bacteria 1884
977 Ga0501045_0850916 3300049824 Bacteria 671
978 Ga0501045_0930076 3300049824 Bacteria 638
979 nmdc:mga03683_11941_c1 3300050489 Bacteria 3159
980 nmdc:mga00v17_59698_c1 3300050491 Bacteria 2341
981 nmdc:mga0yw44_1015696_c1 3300050492 Unclassified 561
982 nmdc:mga0yw44_303014_c1 3300050492 Bacteria 1071
983 nmdc:mga0k408_290120_c1 3300050493 Bacteria 976
984 nmdc:mga0k408_5399_c1 3300050493 Bacteria 6797
985 nmdc:mga0k408_6905_c1 3300050493 Bacteria 6057
986 nmdc:mga06z11_294816_c1 3300050494 Unclassified 963
987 nmdc:mga04h51_72200_c1 3300050495 Bacteria 1207
988 nmdc:mga05p37_1068279_c1 3300050507 Bacteria 849
989 nmdc:mga05p37_167732_c1 3300050507 Bacteria 2679
990 nmdc:mga05p37_2454_c1 3300050507 Bacteria 21555
991 nmdc:mga05p37_34417_c1 3300050507 Bacteria 6205
992 nmdc:mga05p37_41627_c1 3300050507 Bacteria 5641
993 nmdc:mga05p37_613640_c2 3300050507 Bacteria 706
994 nmdc:mga05p37_63372_c1 3300050507 Bacteria 4549
995 nmdc:mga09592_143785_c1 3300050508 Unclassified 2056
996 nmdc:mga09592_144718_c1 3300050508 Bacteria 2049
997 nmdc:mga09592_1484143_c1 3300050508 Bacteria 552
998 nmdc:mga0qj67_139841_c1 3300050509 Bacteria 1963
999 nmdc:mga0qj67_4402_c1 3300050509 Bacteria 10199
1000 nmdc:mga0qj67_45318_c1 3300050509 Bacteria 3470
1001 nmdc:mga06r32_36771_c1 3300050510 Bacteria 4629
1002 nmdc:mga06r32_454924_c1 3300050510 Bacteria 1260
1003 nmdc:mga06r32_66537_c1 3300050510 Bacteria 3477
1004 nmdc:mga06r32_7498_c1 3300050510 Bacteria 9812
1005 nmdc:mga08y16_1464923_c1 3300050511 Bacteria 644
1006 nmdc:mga08y16_153994_c1 3300050511 Unclassified 2389
1007 nmdc:mga08y16_167701_c1 3300050511 Bacteria 2281
1008 nmdc:mga08y16_1963090_c1 3300050511 Bacteria 535
1009 nmdc:mga08y16_20168_c1 3300050511 Bacteria 7034
1010 nmdc:mga08y16_2821_c1 3300050511 Bacteria 17849
1011 nmdc:mga08y16_579412_c1 3300050511 Unclassified 1133
1012 nmdc:mga08y16_66551_c2 3300050511 Bacteria 2833
1013 nmdc:mga08y16_716615_c1 3300050511 Bacteria 999
1014 nmdc:mga0n895_115148_c1 3300050512 Bacteria 2707
1015 nmdc:mga0n895_1750711_c1 3300050512 Bacteria 583
1016 nmdc:mga0n895_233473_c1 3300050512 Bacteria 1867
1017 nmdc:mga0n895_24578_c1 3300050512 Bacteria 5680
1018 nmdc:mga0n895_368008_c1 3300050512 Bacteria 1455
1019 nmdc:mga0n895_411574_c1 3300050512 Bacteria 1367
1020 nmdc:mga0rr50_108886_c1 3300050513 Bacteria 2190
1021 nmdc:mga0rr50_165429_c1 3300050513 Bacteria 1798
1022 nmdc:mga0rr50_1819885_c1 3300050513 Unclassified 512
1023 nmdc:mga0rr50_1831293_c1 3300050513 Bacteria 511
1024 nmdc:mga0rr50_30217_c1 3300050513 Unclassified 3833
1025 nmdc:mga08x19_212632_c1 3300050514 Bacteria 1328
1026 nmdc:mga08x19_301288_c1 3300050514 Bacteria 1113
1027 nmdc:mga08x19_355707_c1 3300050514 Unclassified 1023
1028 nmdc:mga0a205_1146693_c1 3300050515 Bacteria 625
1029 nmdc:mga0a205_49034_c1 3300050515 Bacteria 4075
1030 nmdc:mga0a205_61638_c1 3300050515 Bacteria 3623
1031 nmdc:mga0a205_65091_c1 3300050515 Bacteria 3521
1032 nmdc:mga0a205_6759_c1 3300050515 Bacteria 10372
1033 Ga0495601_0076870 3300053077 Bacteria 2138
1034 Ga0495601_0084465 3300053077 Bacteria 2039
1035 Ga0495595_0042625 3300053084 Bacteria 2079
1036 Ga0495595_0115643 3300053084 Bacteria 1304
1037 Ga0495595_0652844 3300053084 Bacteria 539
1038 Ga0495619_0001225 3300053085 Bacteria 16804
1039 Ga0501084_0006584 3300054114 Bacteria 9545
1040 Ga0501084_0017135 3300054114 Bacteria 6018
1041 Ga0501084_0035496 3300054114 Bacteria 4168
1042 Ga0501084_0071519 3300054114 Bacteria 2905
1043 Ga0501084_0162260 3300054114 Bacteria 1885
1044 Ga0501084_0550247 3300054114 Bacteria 975
1045 Ga0501084_0555518 3300054114 Bacteria 970
1046 Ga0501084_0587188 3300054114 Bacteria 941
1047 Ga0501084_0718101 3300054114 Unclassified 842
1048 Ga0501084_0855243 3300054114 Bacteria 765
1049 Ga0501084_0869774 3300054114 Bacteria 758
1050 Ga0501084_1590854 3300054114 Bacteria 546
1051 Ga0590071_004751 3300059421 Bacteria 3280
1052 Ga0590075_003372 3300059424 Bacteria 3803
1053 Ga0590077_008658 3300059426 Bacteria 2083
1054 Ga0501082_0026825 3300060353 Bacteria 4964
1055 Ga0501082_0047449 3300060353 Bacteria 3701
1056 Ga0501082_0160030 3300060353 Bacteria 1956
1057 Ga0501082_0272132 3300060353 Bacteria 1474
1058 Ga0501082_0758095 3300060353 Bacteria 849
1059 Ga0501082_0776644 3300060353 Bacteria 838
1060 Ga0501082_0826581 3300060353 Bacteria 810
1061 Ga0501082_0920344 3300060353 Bacteria 765
1062 Ga0501082_0935583 3300060353 Unclassified 758
1063 Ga0501082_0962246 3300060353 Bacteria 746
1064 Ga0501082_1627775 3300060353 Unclassified 564
1065 Ga0530510_0243740 3300061734 Bacteria 1338
1066 Ga0530510_0344118 3300061734 Bacteria 1120
1067 Ga0530510_0390335 3300061734 Bacteria 1048
1068 Ga0530510_0445218 3300061734 Bacteria 979
1069 Ga0530510_0544508 3300061734 Bacteria 881
1070 Ga0530510_0683748 3300061734 Bacteria 782
1071 Ga0530510_0745755 3300061734 Bacteria 747
1072 Ga0530510_0991487 3300061734 Bacteria 643
1073 Ga0070673_101341274
1074 JGI24743J22301_10138864
1075 JGI24744J21845_10089966
1076 JGI24034J26672_10063540
1077 JGI24751J29686_10047507
1078 Ga0065714_10191579
1079 Ga0065704_10409366
1080 Ga0065712_10000353
1081 Ga0065712_10085891
1082 Ga0065712_10193404
1083 Ga0065712_10245698
1084 Ga0065712_10442568
1085 Ga0065715_10090861
1086 Ga0065715_10122953
1087 Ga0065715_10158840
1088 Ga0065715_10208819
1089 Ga0065715_10255844
1090 Ga0065715_10378796
1091 Ga0065715_10422987
1092 Ga0065715_10692944
1093 Ga0065707_10004263
1094 Ga0065707_10102583
1095 Ga0070676_10050842
1096 Ga0070676_10125248
1097 Ga0070676_10139873
1098 Ga0070676_10962820
1099 Ga0070683_100001936
1100 Ga0070683_100049491
1101 Ga0070690_100063175
1102 Ga0070690_100114351
1103 Ga0070690_100313695
1104 Ga0070690_101154256
1105 Ga0070670_100001546
1106 Ga0070670_100024170
1107 Ga0070670_100047682
1108 Ga0070670_100150277
1109 Ga0070670_101301605
1110 Ga0070677_10261944
1111 Ga0070677_10341987
1112 Ga0068869_100122062
1113 Ga0068869_100219783
1114 Ga0068869_100345015
1115 Ga0070666_10067969
1116 Ga0070666_10092137
1117 Ga0070666_10193636
1118 Ga0070666_10406124
1119 Ga0070666_11051055
1120 Ga0070682_100172025
1121 Ga0068868_100095156
1122 Ga0068868_100132380
1123 Ga0070660_100096787
1124 Ga0070660_100661703
1125 Ga0070689_100141077
1126 Ga0070689_101508873
1127 Ga0070689_102168393
1128 Ga0070687_100030453
1129 Ga0070687_100052795
1130 Ga0070687_100917645
1131 Ga0070661_100006579
1132 Ga0070661_100555592
1133 Ga0070692_10141854
1134 Ga0070692_11061622
1135 Ga0070692_11192751
1136 Ga0070668_100979764
1137 Ga0070668_101732551
1138 Ga0070668_102006358
1139 Ga0070669_100000166
1140 Ga0070669_100050963
1141 Ga0070669_100187620
1142 Ga0070669_100743340
1143 Ga0070669_101235117
1144 Ga0070669_101913318
1145 Ga0070675_100002899
1146 Ga0070675_100078452
1147 Ga0070675_100120981
1148 Ga0070675_100470081
1149 Ga0070675_100512164
1150 Ga0070675_100672619
1151 Ga0070675_100693337
1152 Ga0070675_100955987
1153 Ga0070675_101011476
1154 Ga0070671_100183091
1155 Ga0070671_100185058
1156 Ga0070671_100312360
1157 Ga0070671_101434808
1158 Ga0070674_100011525
1159 Ga0070674_100097298
1160 Ga0070674_100126422
1161 Ga0070674_100588196
1162 Ga0070674_100719633
1163 Ga0070674_100770303
1164 Ga0070674_101555351
1165 Ga0070673_100002561
1166 Ga0070673_101513306
1167 Ga0070673_101597864
1168 Ga0070673_102322210
1169 Ga0070688_100014815
1170 Ga0070688_100208852
1171 Ga0070688_100305285
1172 Ga0070688_101514940
1173 Ga0070659_100168933
1174 Ga0070659_100354644
1175 Ga0070659_100852790
1176 Ga0070659_101167960
1177 Ga0070659_101856936
1178 Ga0070667_100048804
1179 Ga0070667_100963734
1180 Ga0070667_102138147
1181 Ga0070713_100386032
1182 Ga0070701_10003736
1183 Ga0070701_10909765
1184 Ga0070711_100902157
1185 Ga0070711_101536326
1186 Ga0070705_100600092
1187 Ga0070705_101075107
1188 Ga0070700_100630669
1189 Ga0070700_100944530
1190 Ga0070700_101143879
1191 Ga0070694_100896708
1192 Ga0070694_100991037
1193 Ga0070663_100170260
1194 Ga0070663_100388748
1195 Ga0070663_100390052
1196 Ga0070663_100448748
1197 Ga0070678_100122387
1198 Ga0070678_100145886
1199 Ga0070678_100256343
1200 Ga0070678_100415177
1201 Ga0070678_100736357
1202 Ga0070678_101106059
1203 Ga0070678_101442012
1204 Ga0070662_100040943
1205 Ga0070662_100158979
1206 Ga0070662_100680803
1207 Ga0070681_10108734
1208 Ga0070681_11908863
1209 Ga0068867_100011928
1210 Ga0068867_100085366
1211 Ga0068867_100592081
1212 Ga0070685_10003988
1213 Ga0070685_11523048
1214 Ga0070706_100634444
1215 Ga0070706_100794605
1216 Ga0070707_100931109
1217 Ga0070707_101659703
1218 Ga0070698_100340178
1219 Ga0070698_101119969
1220 Ga0070698_101503986
1221 Ga0070698_101620173
1222 Ga0074259_10932921
1223 Ga0070699_100951258
1224 Ga0070699_101491838
1225 Ga0070684_100000291
1226 Ga0070684_100722382
1227 Ga0068853_100824579
1228 Ga0068853_101443326
1229 Ga0068853_102293707
1230 Ga0068853_102352289
1231 Ga0070672_100019443
1232 Ga0070672_100021908
1233 Ga0070672_100118152
1234 Ga0070672_100232545
1235 Ga0070672_101240170
1236 Ga0070686_100033623
1237 Ga0070686_100306200
1238 Ga0070686_101057707
1239 Ga0070696_100295643
1240 Ga0070696_100483150
1241 Ga0070696_100721736
1242 Ga0070693_101016747
1243 Ga0070693_101049058
1244 Ga0070665_100010087
1245 Ga0070665_100022622
1246 Ga0070665_100248210
1247 Ga0070665_100250519
1248 Ga0070665_100476735
1249 Ga0070665_100483781
1250 Ga0070665_100801899
1251 Ga0070665_101085551
1252 Ga0070704_100071794
1253 Ga0070704_100175306
1254 Ga0070704_100277876
1255 Ga0070704_100544980
1256 Ga0070704_100917012
1257 Ga0070704_101040332
1258 Ga0068855_100929771
1259 Ga0068855_101573479
1260 Ga0070664_100003002
1261 Ga0070664_100142540
1262 Ga0070664_100335665
1263 Ga0070664_100710477
1264 Ga0070664_101806239
1265 Ga0070664_102143281
1266 Ga0068854_100099848
1267 Ga0068854_100436159
1268 Ga0068854_100549707
1269 Ga0068854_101246943
1270 Ga0068856_100062149
1271 Ga0068856_101189163
1272 Ga0068856_101588804
1273 Ga0070702_100149497
1274 Ga0070702_100377258
1275 Ga0070702_100659878
1276 Ga0068852_100078194
1277 Ga0068852_100111289
1278 Ga0068852_100223280
1279 Ga0068852_100920448
1280 Ga0068852_102667994
1281 Ga0068859_100003822
1282 Ga0068859_100644005
1283 Ga0068864_100028940
1284 Ga0068864_100732842
1285 Ga0068864_100922272
1286 Ga0068864_101172838
1287 Ga0068864_101462168
1288 Ga0068866_10044883
1289 Ga0068866_10599907
1290 Ga0068861_100105876
1291 Ga0068861_100372418
1292 Ga0068861_100479695
1293 Ga0068861_101872619
1294 Ga0068861_102129904
1295 Ga0068851_10247991
1296 Ga0068851_10890393
1297 Ga0068870_10156858
1298 Ga0068863_100011808
1299 Ga0068863_100080513
1300 Ga0068863_100276921
1301 Ga0068863_101011481
1302 Ga0068863_102019482
1303 Ga0068858_100425073
1304 Ga0068858_100567704
1305 Ga0068858_100959293
1306 Ga0068858_102026130
1307 Ga0068860_100153064
1308 Ga0068860_100656848
1309 Ga0068862_100026965
1310 Ga0068862_100053947
1311 Ga0068862_100087875
1312 Ga0068862_100706697
1313 Ga0068862_100723461
1314 Ga0068862_100812019
1315 Ga0068862_101272499
1316 Ga0068862_101415778
1317 Ga0068862_101667013
1318 Ga0070717_10284219
1319 Ga0075365_10000562
1320 Ga0075365_11091067
1321 Ga0075368_10053538
1322 Ga0075364_10004066
1323 Ga0075364_10005645
1324 Ga0075364_10252862
1325 Ga0075432_10453801
1326 Ga0070716_100479436
1327 Ga0075362_10105944
1328 Ga0075367_10033063
1329 Ga0075366_10000965
1330 Ga0075366_10470540
1331 Ga0075366_10531682
1332 Ga0097621_100037514
1333 Ga0097621_101063255
1334 Ga0068871_100045078
1335 Ga0068871_100213392
1336 Ga0068871_100223288
1337 Ga0068871_100819182
1338 Ga0068871_101205864
1339 Ga0068871_101426741
1340 Ga0075428_100002190
1341 Ga0075428_100730850
1342 Ga0075428_100807477
1343 Ga0075428_101100872
1344 Ga0075430_100006051
1345 Ga0075430_100019324
1346 Ga0075430_101613232
1347 Ga0075431_100014795
1348 Ga0075431_100118506
1349 Ga0075431_100435891
1350 Ga0075433_10031686
1351 Ga0075433_10032746
1352 Ga0075433_10058944
1353 Ga0075433_10088645
1354 Ga0075433_11730977
1355 Ga0075434_100004927
1356 Ga0075434_100023434
1357 Ga0075434_100195972
1358 Ga0075434_100567873
1359 Ga0075429_100214588
1360 Ga0075429_100229844
1361 Ga0068865_100423063
1362 Ga0068865_100645482
1363 Ga0068865_101667383
1364 Ga0068865_101782309
1365 Ga0068865_102000795
1366 Ga0075436_100306906
1367 Ga0075436_100429528
1368 Ga0097620_100003822
1369 Ga0097620_100644013
1370 Ga0075435_100006365
1371 Ga0075435_100015028
1372 Ga0075435_100272534
1373 Ga0075435_100279837
1374 Ga0105240_10195813
1375 Ga0105240_10302364
1376 Ga0105240_11641437
1377 Ga0105240_12076160
1378 Ga0111539_10001892
1379 Ga0111539_10024552
1380 Ga0111539_10140000
1381 Ga0111539_10173669
1382 Ga0111539_10460819
1383 Ga0111539_10730386
1384 Ga0111539_11547838
1385 Ga0111539_11984297
1386 Ga0111539_13090895
1387 Ga0111539_13447851
1388 Ga0105245_10374069
1389 Ga0105245_11597005
1390 Ga0105247_10100266
1391 Ga0105247_10359334
1392 Ga0114129_10002861
1393 Ga0114129_10004267
1394 Ga0114129_10007233
1395 Ga0114129_10155007
1396 Ga0114129_10188247
1397 Ga0114129_11936848
1398 Ga0114129_12298525
1399 Ga0105243_10110197
1400 Ga0105243_11841527
1401 Ga0105241_10221699
1402 Ga0105242_10031143
1403 Ga0105242_10071788
1404 Ga0105242_10097671
1405 Ga0105242_10873422
1406 Ga0105242_13148114
1407 Ga0105248_10026313
1408 Ga0105248_10054044
1409 Ga0105248_10058976
1410 Ga0105248_10059861
1411 Ga0105248_10178054
1412 Ga0105248_11490066
1413 Ga0105248_11824620
1414 Ga0105248_11901247
1415 Ga0105248_12086345
1416 Ga0105248_13388069
1417 Ga0105238_10136346
1418 Ga0105238_10382426
1419 Ga0105238_11569608
1420 Ga0105249_10001254
1421 Ga0105249_10005766
1422 Ga0105249_10080278
1423 Ga0105249_10791467
1424 Ga0105239_10140364
1425 Ga0105239_10296047
1426 Ga0105246_10647265
1427 Ga0105246_10809966
1428 Ga0105246_11047866
1429 Ga0157369_10085696
1430 Ga0157369_10753118
1431 Ga0157374_10076825
1432 Ga0157374_10313768
1433 Ga0157374_11056116
1434 Ga0157378_10899471
1435 Ga0157378_10972425
1436 Ga0157378_11134919
1437 Ga0157378_11189019
1438 Ga0157378_11506415
1439 Ga0157378_12540327
1440 Ga0157378_13011974
1441 Ga0163162_10048642
1442 Ga0163162_10144922
1443 Ga0163162_10421010
1444 Ga0163162_11700818
1445 Ga0157372_10225441
1446 Ga0157372_11058298
1447 Ga0157375_10152246
1448 Ga0157375_10208129
1449 Ga0157375_10259698
1450 Ga0157375_10835267
1451 Ga0157375_12002510
1452 Ga0157375_13404568
1453 Ga0163163_10059827
1454 Ga0163163_10137123
1455 Ga0163163_10137638
1456 Ga0163163_10187170
1457 Ga0163163_10868487
1458 Ga0163163_12296948
1459 Ga0163163_12641817
1460 Ga0157380_10097792
1461 Ga0157380_10143224
1462 Ga0157380_10225108
1463 Ga0157380_10848854
1464 Ga0157380_10874255
1465 Ga0157380_10874444
1466 Ga0157380_11520023
1467 Ga0157380_11634596
1468 Ga0157380_11740667
1469 Ga0157380_13167981
1470 Ga0157379_10216935
1471 Ga0157379_10385819
1472 Ga0157379_10726632
1473 Ga0157376_10009699
1474 Ga0157376_10029717
1475 Ga0157376_10224087
1476 Ga0157376_10435551
1477 Ga0157376_11815180
1478 Ga0157376_11931565
1479 Ga0163161_10861593
1480 Ga0206353_10674301
1481 Ga0213876_10119947
1482 Ga0207666_1076982
1483 Ga0207697_10000772
1484 Ga0207656_10269417
1485 Ga0207656_10664497
1486 Ga0207682_10212584
1487 Ga0207682_10404771
1488 Ga0207682_10492726
1489 Ga0207642_10196629
1490 Ga0207642_10483927
1491 Ga0207710_10377925
1492 Ga0207688_10002773
1493 Ga0207688_10165611
1494 Ga0207680_10052607
1495 Ga0207680_10075968
1496 Ga0207680_10287234
1497 Ga0207647_10116664
1498 Ga0207647_10609017
1499 Ga0207647_10610010
1500 Ga0207645_10937110
1501 Ga0207643_10182357
1502 Ga0207684_10364960
1503 Ga0207684_10438502
1504 Ga0207684_10778491
1505 Ga0207707_10677920
1506 Ga0207707_11113714
1507 Ga0207695_10125684
1508 Ga0207663_10558001
1509 Ga0207660_10638366
1510 Ga0207662_10002361
1511 Ga0207662_10061797
1512 Ga0207662_10938226
1513 Ga0207657_10201517
1514 Ga0207649_10003342
1515 Ga0207649_10304409
1516 Ga0207649_10367202
1517 Ga0207681_10022832
1518 Ga0207681_10088153
1519 Ga0207681_10220674
1520 Ga0207681_10328906
1521 Ga0207694_10370275
1522 Ga0207694_10882807
1523 Ga0207694_11071375
1524 Ga0207650_10010455
1525 Ga0207650_10022308
1526 Ga0207650_10064504
1527 Ga0207650_10160269
1528 Ga0207650_10207722
1529 Ga0207650_10539789
1530 Ga0207659_10078671
1531 Ga0207659_10096263
1532 Ga0207659_10384772
1533 Ga0207659_10406365
1534 Ga0207659_10533713
1535 Ga0207659_10940076
1536 Ga0207687_10060991
1537 Ga0207687_10188748
1538 Ga0207687_10440398
1539 Ga0207700_10349793
1540 Ga0207644_10089495
1541 Ga0207644_10154648
1542 Ga0207644_10172039
1543 Ga0207690_10254468
1544 Ga0207690_10271928
1545 Ga0207690_10736624
1546 Ga0207690_11251775
1547 Ga0207706_10036735
1548 Ga0207706_10085694
1549 Ga0207706_10181333
1550 Ga0207706_10547227
1551 Ga0207706_10822047
1552 Ga0207706_10863325
1553 Ga0207686_10040704
1554 Ga0207686_10064654
1555 Ga0207686_11714098
1556 Ga0207709_10059748
1557 Ga0207709_10187417
1558 Ga0207709_10938905
1559 Ga0207670_10063237
1560 Ga0207670_10872255
1561 Ga0207670_11205493
1562 Ga0207669_10045755
1563 Ga0207669_10077387
1564 Ga0207669_10462811
1565 Ga0207669_10593369
1566 Ga0207669_10681576
1567 Ga0207669_11662304
1568 Ga0207704_10048697
1569 Ga0207704_10113482
1570 Ga0207704_10234030
1571 Ga0207704_11334434
1572 Ga0207691_10021474
1573 Ga0207691_10053749
1574 Ga0207691_10148042
1575 Ga0207691_10192644
1576 Ga0207691_10601706
1577 Ga0207711_10018265
1578 Ga0207711_10144641
1579 Ga0207711_10144777
1580 Ga0207711_10330700
1581 Ga0207711_10624986
1582 Ga0207711_11417222
1583 Ga0207711_11774495
1584 Ga0207711_12075604
1585 Ga0207689_10074129
1586 Ga0207689_10127286
1587 Ga0207689_10960749
1588 Ga0207661_10001428
1589 Ga0207661_10012308
1590 Ga0207679_10002083
1591 Ga0207679_10041983
1592 Ga0207679_10233106
1593 Ga0207679_10368845
1594 Ga0207679_11478069
1595 Ga0207667_10756568
1596 Ga0207651_10001330
1597 Ga0207651_10597674
1598 Ga0207651_10726985
1599 Ga0207651_11188574
1600 Ga0207651_11933639
1601 Ga0207712_10011937
1602 Ga0207712_10078458
1603 Ga0207712_10652875
1604 Ga0207712_10666017
1605 Ga0207712_11257449
1606 Ga0207712_11336061
1607 Ga0207712_11391467
1608 Ga0207668_10321528
1609 Ga0207668_10721926
1610 Ga0207668_11915835
1611 Ga0207668_12081120
1612 Ga0207640_10225562
1613 Ga0207640_10565627
1614 Ga0207640_10678815
1615 Ga0207640_10970716
1616 Ga0207658_10111366
1617 Ga0207658_10520384
1618 Ga0207658_11896125
1619 Ga0207677_10013411
1620 Ga0207677_10236423
1621 Ga0207677_10247294
1622 Ga0207677_10413697
1623 Ga0207703_10343359
1624 Ga0207703_10421748
1625 Ga0207703_10522849
1626 Ga0207639_10394324
1627 Ga0207639_10686133
1628 Ga0207639_10954421
1629 Ga0207678_10062158
1630 Ga0207678_10066402
1631 Ga0207678_10402467
1632 Ga0207708_10001093
1633 Ga0207708_10455269
1634 Ga0207708_10511461
1635 Ga0207708_11448935
1636 Ga0207708_11637692
1637 Ga0207702_10171726
1638 Ga0207702_10996829
1639 Ga0207641_10014969
1640 Ga0207641_10064332
1641 Ga0207641_10200120
1642 Ga0207641_10206070
1643 Ga0207641_10361365
1644 Ga0207641_10735499
1645 Ga0207648_10007485
1646 Ga0207648_10011911
1647 Ga0207648_10150231
1648 Ga0207648_11500138
1649 Ga0207648_11645629
1650 Ga0207648_11790717
1651 Ga0207676_10098053
1652 Ga0207676_10592018
1653 Ga0207676_10708581
1654 Ga0207676_10729959
1655 Ga0207676_11104632
1656 Ga0207676_11268119
1657 Ga0207674_11809654
1658 Ga0207675_100153719
1659 Ga0207675_100564433
1660 Ga0207675_100621348
1661 Ga0207675_100713542
1662 Ga0207675_101030748
1663 Ga0207675_101576150
1664 Ga0207683_10016603
1665 Ga0207683_10046066
1666 Ga0207683_10083873
1667 Ga0207683_10151646
1668 Ga0207683_10157805
1669 Ga0207683_10594449
1670 Ga0207683_10691580
1671 Ga0207683_10950776
1672 Ga0207683_11006305
1673 Ga0207698_10104018
1674 Ga0207698_10327331
1675 Ga0207698_10531528
1676 Ga0207698_10789066
1677 Ga0209983_1066781
1678 Ga0209998_10033825
1679 Ga0209813_10085216
1680 Ga0209974_10065162
1681 Ga0209974_10095280
1682 Ga0207428_10016103
1683 Ga0268266_10256241
1684 Ga0268266_10699476
1685 Ga0268266_10981289
1686 Ga0268266_11030104
1687 Ga0268266_11654958
1688 Ga0268265_10122749
1689 Ga0268265_10124906
1690 Ga0268265_10341819
1691 Ga0268265_10922509
1692 Ga0268265_10937031
1693 Ga0268265_11272228
1694 Ga0268265_11944779
1695 Ga0268265_12267722
1696 Ga0268264_10266278
1697 Ga0307513_10771604
1698 Ga0307408_100040174
1699 Ga0307408_100176766
1700 Ga0307408_100593034
1701 Ga0307405_10557249
1702 Ga0307410_10018152
1703 Ga0307410_10458030
1704 Ga0307410_11673589
1705 Ga0307407_10154023
1706 Ga0307407_10219668
1707 Ga0307412_10150812
1708 Ga0307412_10220979
1709 Ga0307412_11552073
1710 Ga0307409_100030071
1711 Ga0307409_100089370
1712 Ga0307409_100173215
1713 Ga0307409_101483992
1714 Ga0307416_100040357
1715 Ga0307416_100056201
1716 Ga0307416_100360816
1717 Ga0307416_100475328
1718 Ga0307416_100598913
1719 Ga0307416_101061513
1720 Ga0307416_101342006
1721 Ga0307416_101572766
1722 Ga0307416_101764404
1723 Ga0307416_103701786
1724 Ga0307411_10081445
1725 Ga0307411_10319128
1726 Ga0307411_10512552
1727 Ga0307411_10981694
1728 Ga0307415_100195976
1729 Ga0307415_100342065
1730 Ga0373940_0123896
1731 Ga0373951_0027075
1732 Ga0373932_0030680
1733 Ga0373941_0314819
1734 Ga0373945_0305763
1735 Ga0373954_0639826
1736 Ga0373956_0408164
1737 Ga0373943_0121418
1738 Ga0373943_0229432
1739 Ga0373946_0144595
1740 Ga0373955_0191679
1741 Ga0373942_0073203
1742 Ga0373961_0111885
1743 Ga0373961_0226756
1744 Ga0373962_0187825
1745 Ga0373931_0092841
1746 Ga0373931_0592533
1747 Ga0373937_0000651
1748 Ga0373937_0280691
1749 Ga0373925_0006513
1750 Ga0373925_1139757
1751 Ga0395900_0875039
1752 Ga0436365_0113116
1753 Ga0439439_0086069
1754 Ga0439461_0060476
1755 Ga0451791_1519790
1756 Ga0451793_0108495
1757 Ga0451802_0119544
1758 Ga0451802_0912663
1759 Ga0451804_0779925
1760 Ga0451807_0449784
1761 Ga0451845_0675573
1762 Ga0451853_0170158
1763 Ga0451853_1132466
1764 Ga0451853_1313310
1765 Ga0451853_2018823
1766 Ga0451853_3998079
1767 Ga0439433_0021574
1768 Ga0439433_0051436
1769 Ga0439449_0120317
1770 Ga0439454_056707
1771 Ga0439457_116874
1772 Ga0439462_0091092
1773 Ga0450920_018330
1774 Ga0450920_044911
1775 Ga0450923_012281
1776 Ga0450891_019284
1777 Ga0450894_002011
1778 Ga0450895_005338
1779 Ga0450896_000284
1780 Ga0450899_017456
1781 Ga0450905_075900
1782 Ga0450905_083305
1783 Ga0450906_038357
1784 Ga0439446_0013235
1785 Ga0439446_0107312
1786 Ga0450908_020092
1787 Ga0439434_0070902
1788 Ga0439434_0272390
1789 Ga0439435_0040353
1790 Ga0439460_0028314
1791 Ga0450916_018446
1792 Ga0450916_065943
1793 Ga0450893_0007133
1794 Ga0451577_0033978
1795 Ga0453684_0230994
1796 Ga0451576_0585839
1797 Ga0495592_0860683
1798 Ga0495603_0015692
1799 Ga0495629_0264585
1800 Ga0495651_0790365
1801 Ga0495653_0016842
1802 Ga0495582_0584143
1803 Ga0495585_0612910
1804 Ga0495594_0235853
1805 Ga0495618_0811460
1806 Ga0495630_0924182
1807 Ga0495652_0255448
1808 Ga0495640_0245015
1809 Ga0495586_0282431
1810 Ga0495621_0190859
1811 Ga0495667_0114538
1812 Ga0495634_0579531
1813 Ga0495635_0314122
1814 Ga0495659_0286459
1815 Ga0495658_0099746
1816 Ga0495658_0172874
1817 Ga0495658_0569642
1818 Ga0495658_0801188
1819 Ga0495613_0047197
1820 Ga0495613_0589545
1821 Ga0495604_0200006
1822 Ga0495674_0077950
1823 Ga0495674_0439832
1824 Ga0495674_0645816
1825 Ga0495674_0802443
1826 Ga0496100_0152608
1827 Ga0496100_0531087
1828 Ga0496100_0540795
1829 Ga0496101_0025059
1830 Ga0496101_0468680
1831 Ga0496101_0915932
1832 Ga0496101_0963197
1833 Ga0496102_0166996
1834 Ga0496102_0560969
1835 Ga0496102_0702480
1836 Ga0496102_1548139
1837 Ga0496102_1578786
1838 Ga0496103_0213103
1839 Ga0496104_0000157
1840 Ga0496104_0042987
1841 Ga0496104_0086907
1842 Ga0496104_0404824
1843 Ga0496105_0593340
1844 Ga0496105_0811839
1845 Ga0496105_0837321
1846 Ga0496106_0111211
1847 Ga0496106_0349184
1848 Ga0496106_0443834
1849 Ga0496106_0506700
1850 Ga0496106_0849733
1851 Ga0496106_0974294
1852 Ga0496107_0078155
1853 Ga0496107_0135686
1854 Ga0496107_0361523
1855 Ga0496107_0742530
1856 Ga0496107_0846301
1857 Ga0496108_0008261
1858 Ga0496108_0132996
1859 Ga0496108_0200393
1860 Ga0496108_0204459
1861 Ga0496108_0395800
1862 Ga0496108_0509991
1863 Ga0496109_0010308
1864 Ga0496109_0011076
1865 Ga0496109_0098078
1866 Ga0496109_0148942
1867 Ga0496109_0228590
1868 Ga0496109_0948229
1869 Ga0496109_1087468
1870 Ga0496110_0002759
1871 Ga0496110_0010807
1872 Ga0496110_0011106
1873 Ga0496110_0111841
1874 Ga0496110_0182747
1875 Ga0496110_1383736
1876 Ga0496110_1503263
1877 Ga0496111_0013452
1878 Ga0496111_0065455
1879 Ga0496111_0118079
1880 Ga0496111_0510770
1881 Ga0496111_0647055
1882 Ga0496112_0000148
1883 Ga0496112_0004165
1884 Ga0496112_0232059
1885 Ga0496112_0301031
1886 Ga0496112_0995801
1887 Ga0496113_0103583
1888 Ga0496114_0027098
1889 Ga0496114_0444674
1890 Ga0501031_0108509
1891 Ga0501031_0110018
1892 Ga0501031_0243145
1893 Ga0501032_0094652
1894 Ga0501032_0601387
1895 Ga0501032_0638444
1896 Ga0501033_0048274
1897 Ga0501033_0139266
1898 Ga0501033_0807887
1899 Ga0501033_1071967
1900 Ga0501034_0006113
1901 Ga0501034_0128066
1902 Ga0501034_0663665
1903 Ga0501034_1246297
1904 Ga0501036_0021023
1905 Ga0501036_0175496
1906 Ga0501036_0177638
1907 Ga0501036_0214351
1908 Ga0501036_0395912
1909 Ga0501036_0728600
1910 Ga0501036_0888572
1911 Ga0501037_0150182
1912 Ga0501037_0765940
1913 Ga0501038_0026845
1914 Ga0501038_0065980
1915 Ga0501038_0229508
1916 Ga0501038_0557184
1917 Ga0501039_0059409
1918 Ga0501039_0086565
1919 Ga0501039_0121123
1920 Ga0501039_1588473
1921 Ga0501040_0202994
1922 Ga0501040_0348611
1923 Ga0501040_0486101
1924 Ga0501040_0616573
1925 Ga0501040_0702329
1926 Ga0501040_0782944
1927 Ga0501041_0082306
1928 Ga0501041_0155832
1929 Ga0501041_0602352
1930 Ga0501041_0702693
1931 Ga0501042_0021483
1932 Ga0501042_0260722
1933 Ga0501042_0371331
1934 Ga0501042_0465593
1935 Ga0501042_0500515
1936 Ga0501042_0992274
1937 Ga0501043_0003776
1938 Ga0501043_0349186
1939 Ga0501043_0424204
1940 Ga0501043_0974685
1941 Ga0501043_1235536
1942 Ga0501046_0005320
1943 Ga0501046_0011536
1944 Ga0501046_0069357
1945 Ga0501046_0296786
1946 Ga0501046_1012268
1947 Ga0501046_1037604
1948 Ga0501047_0001473
1949 Ga0501047_0051950
1950 Ga0501047_0096646
1951 Ga0501047_0156752
1952 Ga0501047_0440795
1953 Ga0501048_0151199
1954 Ga0501048_0156468
1955 Ga0501048_0685850
1956 Ga0501048_0975704
1957 Ga0501067_0228787
1958 Ga0501067_0247372
1959 Ga0501067_0407869
1960 Ga0501067_0436425
1961 Ga0501067_0500022
1962 Ga0501068_0006774
1963 Ga0501068_0620940
1964 Ga0501069_0217962
1965 Ga0501069_0784561
1966 Ga0501070_0404719
1967 Ga0501071_0035635
1968 Ga0501071_0055007
1969 Ga0501071_0137129
1970 Ga0501071_0177385
1971 Ga0501071_1174141
1972 Ga0501072_0018755
1973 Ga0501072_0040269
1974 Ga0501072_0264553
1975 Ga0501072_0346760
1976 Ga0501072_0347587
1977 Ga0501072_0529226
1978 Ga0501072_0584751
1979 Ga0501072_0601348
1980 Ga0501072_0837720
1981 Ga0501072_1474436
1982 Ga0501073_0040646
1983 Ga0501073_0110912
1984 Ga0501073_0118916
1985 Ga0501073_0147300
1986 Ga0501073_0192543
1987 Ga0501073_0224747
1988 Ga0501073_0378015
1989 Ga0501073_0383720
1990 Ga0501074_0160395
1991 Ga0501074_0162251
1992 Ga0501074_0186184
1993 Ga0501074_0343411
1994 Ga0501074_0706996
1995 Ga0501075_0037021
1996 Ga0501075_0042891
1997 Ga0501075_0060105
1998 Ga0501075_0088648
1999 Ga0501075_0189572
2000 Ga0501075_0541494
2001 Ga0501076_0005978
2002 Ga0501076_0056689
2003 Ga0501076_0086660
2004 Ga0501076_0089559
2005 Ga0501076_0241737
2006 Ga0501076_0252368
2007 Ga0501076_0323579
2008 Ga0501076_0452904
2009 Ga0501076_0775457
2010 Ga0501076_1358166
2011 Ga0501077_0040315
2012 Ga0501077_0086806
2013 Ga0501077_0184000
2014 Ga0501077_0419057
2015 Ga0501077_0574753
2016 Ga0501249_173077
2017 Ga0501079_0054982
2018 Ga0501079_0058537
2019 Ga0501079_0103295
2020 Ga0501079_0291780
2021 Ga0501079_0312420
2022 Ga0501079_0876309
2023 Ga0501079_0881503
2024 Ga0501080_0027293
2025 Ga0501080_0287010
2026 Ga0501080_0291905
2027 Ga0501080_0607157
2028 Ga0501080_0608565
2029 Ga0501080_0621866
2030 Ga0501080_0746448
2031 Ga0501080_1534035
2032 Ga0501080_1557705
2033 Ga0501081_0042825
2034 Ga0501081_0063454
2035 Ga0501081_0212806
2036 Ga0501081_0299607
2037 Ga0501081_0635315
2038 Ga0501081_0710202
2039 Ga0501083_0012875
2040 Ga0501083_0115600
2041 Ga0501035_0094786
2042 Ga0501035_0104196
2043 Ga0501035_0193773
2044 Ga0501044_0025113
2045 Ga0501044_0037359
2046 Ga0501045_0037298
2047 Ga0501045_0046206
2048 Ga0501045_0128366
2049 Ga0501045_0850916
2050 Ga0501045_0930076
2051 nmdc:mga03683_11941_c1
2052 nmdc:mga00v17_59698_c1
2053 nmdc:mga0yw44_1015696_c1
2054 nmdc:mga0yw44_303014_c1
2055 nmdc:mga0k408_290120_c1
2056 nmdc:mga0k408_5399_c1
2057 nmdc:mga0k408_6905_c1
2058 nmdc:mga06z11_294816_c1
2059 nmdc:mga04h51_72200_c1
2060 nmdc:mga05p37_1068279_c1
2061 nmdc:mga05p37_167732_c1
2062 nmdc:mga05p37_2454_c1
2063 nmdc:mga05p37_34417_c1
2064 nmdc:mga05p37_41627_c1
2065 nmdc:mga05p37_613640_c2
2066 nmdc:mga05p37_63372_c1
2067 nmdc:mga09592_143785_c1
2068 nmdc:mga09592_144718_c1
2069 nmdc:mga09592_1484143_c1
2070 nmdc:mga0qj67_139841_c1
2071 nmdc:mga0qj67_4402_c1
2072 nmdc:mga0qj67_45318_c1
2073 nmdc:mga06r32_36771_c1
2074 nmdc:mga06r32_454924_c1
2075 nmdc:mga06r32_66537_c1
2076 nmdc:mga06r32_7498_c1
2077 nmdc:mga08y16_1464923_c1
2078 nmdc:mga08y16_153994_c1
2079 nmdc:mga08y16_167701_c1
2080 nmdc:mga08y16_1963090_c1
2081 nmdc:mga08y16_20168_c1
2082 nmdc:mga08y16_2821_c1
2083 nmdc:mga08y16_579412_c1
2084 nmdc:mga08y16_66551_c2
2085 nmdc:mga08y16_716615_c1
2086 nmdc:mga0n895_115148_c1
2087 nmdc:mga0n895_1750711_c1
2088 nmdc:mga0n895_233473_c1
2089 nmdc:mga0n895_24578_c1
2090 nmdc:mga0n895_368008_c1
2091 nmdc:mga0n895_411574_c1
2092 nmdc:mga0rr50_108886_c1
2093 nmdc:mga0rr50_165429_c1
2094 nmdc:mga0rr50_1819885_c1
2095 nmdc:mga0rr50_1831293_c1
2096 nmdc:mga0rr50_30217_c1
2097 nmdc:mga08x19_212632_c1
2098 nmdc:mga08x19_301288_c1
2099 nmdc:mga08x19_355707_c1
2100 nmdc:mga0a205_1146693_c1
2101 nmdc:mga0a205_49034_c1
2102 nmdc:mga0a205_61638_c1
2103 nmdc:mga0a205_65091_c1
2104 nmdc:mga0a205_6759_c1
2105 Ga0495601_0076870
2106 Ga0495601_0084465
2107 Ga0495595_0042625
2108 Ga0495595_0115643
2109 Ga0495595_0652844
2110 Ga0495619_0001225
2111 Ga0501084_0006584
2112 Ga0501084_0017135
2113 Ga0501084_0035496
2114 Ga0501084_0071519
2115 Ga0501084_0162260
2116 Ga0501084_0550247
2117 Ga0501084_0555518
2118 Ga0501084_0587188
2119 Ga0501084_0718101
2120 Ga0501084_0855243
2121 Ga0501084_0869774
2122 Ga0501084_1590854
2123 Ga0590071_004751
2124 Ga0590075_003372
2125 Ga0590077_008658
2126 Ga0501082_0026825
2127 Ga0501082_0047449
2128 Ga0501082_0160030
2129 Ga0501082_0272132
2130 Ga0501082_0758095
2131 Ga0501082_0776644
2132 Ga0501082_0826581
2133 Ga0501082_0920344
2134 Ga0501082_0935583
2135 Ga0501082_0962246
2136 Ga0501082_1627775
2137 Ga0530510_0243740
2138 Ga0530510_0344118
2139 Ga0530510_0390335
2140 Ga0530510_0445218
2141 Ga0530510_0544508
2142 Ga0530510_0683748
2143 Ga0530510_0745755
2144 Ga0530510_0991487

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03319

EutN_CcmL

Ethanolamine utilisation protein EutN/carboxysome

1

85

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9187 1 87
4i7a-assembly1.cif.gz_A grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9175 1 88
4i7a-assembly1.cif.gz_C grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9155 1 88
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9082 1 87
4i7a-assembly1.cif.gz_A grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9073 1 88
ID Description Score Start End Superfamily
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.9187 1 87 2.40.50.220
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.9082 1 87 2.40.50.220
4n8x100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8747 1 83 2.40.50.220
2z9hB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8653 1 83 2.40.50.220
2hd3F00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8632 2 83 2.40.50.220
ID Description Score Start End GO Terms
AF-A0A523NDQ4-F1-model_v4 Ethanolamine utilization protein EutN 0.982 1 60 GO:0031469
AF-X1G3E1-F1-model_v4 Ethanolamine utilization protein EutN 0.977 1 64 GO:0031469
AF-X1HQN0-F1-model_v4 Ethanolamine utilization protein EutN 0.975 1 60 GO:0031469
AF-A0A831KBR1-F1-model_v4 Ethanolamine utilization protein EutN 0.9721 1 56 GO:0031469
AF-A0A3N5X188-F1-model_v4 Ethanolamine utilization protein EutN 0.9672 2 55 GO:0031469

Map