F489518
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1072 | 357 | 1059 | 344 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0003293|Ga0501034_0003293_14939_15976 |
| Length | 336 |
| Sequence | MSESATAAPTLTAKDFATDQEVRWCPGCGDYSILAQVQKVMPTIGIPKENIVVISGIGCSSRFPYYMNTYGMHSIHGRATAIASGLKAARPELSVWIVTGDGDGLSIGGNHTMHLLRRNFDVNLLLFNNQIYGLTKGQYSPTSEANKVTKSTPYGSIDHPFNPLALAMGADATFIARSMDRDPKHLQAMLSFLEIYQNCNIFNDGAFEIFTEKATKTEETLFLEQGKPLVFGAAQNKGIKLDGFRPVVVELGNGVSADDLWIHDERDYYKAQALVRMFDDPNKEGGHFPRPFGVFYETDRPCYEDIMSMQIEESIATKGKGNLDKLLRGKEVWEIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 3 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 4 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 5 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 6 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 7 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 8 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 9 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 10 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 11 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 12 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 13 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 213 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 244 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 245 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 246 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 247 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 248 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 254 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 309 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 310 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 311 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 312 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 315 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 317 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 318 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 320 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 323 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 327 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 335 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 337 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 338 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 339 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 340 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 342 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 344 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 346 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 347 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 348 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 350 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 351 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 352 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 357 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.41 |
| Metatranscriptomes | 0.37 |
| Isolates | 1.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.78 |
| Nodule | 0 |
| Rhizoplane | 0.37 |
| Rhizosphere | 90.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1004228 | 3300001904 | Bacteria | 2464 |
| 2 | JGI24740J21852_10000624 | 3300001979 | Bacteria | 15288 |
| 3 | JGI24751J29686_10002550 | 3300002459 | Bacteria | 3660 |
| 4 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 5 | JGI25406J46586_10000389 | 3300003203 | Bacteria | 20207 |
| 6 | JGI25153J46596_10003819 | 3300003215 | Bacteria | 8310 |
| 7 | rootH1_10090487 | 3300003316 | Bacteria | 1241 |
| 8 | rootH2_10000350 | 3300003320 | Bacteria | 4555 |
| 9 | rootH2_10000351 | 3300003320 | Bacteria | 12685 |
| 10 | rootH2_10010343 | 3300003320 | Bacteria | 28765 |
| 11 | rootH2_10075480 | 3300003320 | Bacteria | 2711 |
| 12 | rootL2_10103093 | 3300003322 | Bacteria | 8267 |
| 13 | rootL2_10189206 | 3300003322 | Bacteria | 1598 |
| 14 | rootH1_10011210 | 3300003323 | Bacteria | 23390 |
| 15 | rootH1_10063717 | 3300003323 | Bacteria | 2119 |
| 16 | JGI25160J50197_1000539 | 3300003354 | Bacteria | 21642 |
| 17 | JGI25160J50197_1015171 | 3300003354 | Bacteria | 2541 |
| 18 | Ga0055535_1002213 | 3300003761 | Bacteria | 7348 |
| 19 | Ga0055542_1013782 | 3300003762 | Bacteria | 1349 |
| 20 | Ga0055526_1002779 | 3300003771 | Bacteria | 11598 |
| 21 | Ga0055528_1000060 | 3300003790 | Bacteria | 87471 |
| 22 | Ga0055530_10004470 | 3300003791 | Bacteria | 7176 |
| 23 | Ga0055531_10018412 | 3300003794 | Bacteria | 2883 |
| 24 | Ga0055543_1004611 | 3300004625 | Bacteria | 3696 |
| 25 | Ga0058862_10126549 | 3300004803 | Bacteria | 1796 |
| 26 | Ga0058862_12680979 | 3300004803 | Bacteria | 1461 |
| 27 | Ga0065165_1000392 | 3300005262 | Bacteria | 71163 |
| 28 | Ga0065165_1024281 | 3300005262 | Bacteria | 2039 |
| 29 | Ga0065704_10074555 | 3300005289 | Bacteria | 6189 |
| 30 | Ga0065712_10002576 | 3300005290 | Bacteria | 5218 |
| 31 | Ga0065712_10004494 | 3300005290 | Bacteria | 3453 |
| 32 | Ga0065712_10016705 | 3300005290 | Bacteria | 1586 |
| 33 | Ga0065712_10086854 | 3300005290 | Bacteria | 2611 |
| 34 | Ga0065715_10001122 | 3300005293 | Bacteria | 9719 |
| 35 | Ga0065715_10212451 | 3300005293 | Bacteria | 1308 |
| 36 | Ga0065707_10008266 | 3300005295 | Bacteria | 3690 |
| 37 | Ga0070658_10023982 | 3300005327 | Bacteria | 4895 |
| 38 | Ga0070658_10029210 | 3300005327 | Bacteria | 4429 |
| 39 | Ga0070676_10000653 | 3300005328 | Bacteria | 16869 |
| 40 | Ga0070676_10113171 | 3300005328 | Bacteria | 1693 |
| 41 | Ga0070676_10133736 | 3300005328 | Bacteria | 1571 |
| 42 | Ga0070683_100012489 | 3300005329 | Bacteria | 7382 |
| 43 | Ga0070683_100015725 | 3300005329 | Bacteria | 6652 |
| 44 | Ga0070683_100078532 | 3300005329 | Bacteria | 3088 |
| 45 | Ga0070683_100123940 | 3300005329 | Bacteria | 2442 |
| 46 | Ga0070690_100033980 | 3300005330 | Bacteria | 3194 |
| 47 | Ga0070670_100005023 | 3300005331 | Bacteria | 11131 |
| 48 | Ga0070670_100038908 | 3300005331 | Bacteria | 4090 |
| 49 | Ga0070670_100069651 | 3300005331 | Bacteria | 3020 |
| 50 | Ga0070670_100087294 | 3300005331 | Bacteria | 2681 |
| 51 | Ga0070670_100126829 | 3300005331 | Bacteria | 2203 |
| 52 | Ga0070670_100176772 | 3300005331 | Bacteria | 1853 |
| 53 | Ga0070677_10026840 | 3300005333 | Bacteria | 2163 |
| 54 | Ga0070677_10042768 | 3300005333 | Bacteria | 1796 |
| 55 | Ga0070677_10086913 | 3300005333 | Bacteria | 1351 |
| 56 | Ga0068869_100005421 | 3300005334 | Bacteria | 8023 |
| 57 | Ga0068869_100103186 | 3300005334 | Bacteria | 2160 |
| 58 | Ga0068869_100148067 | 3300005334 | Bacteria | 1819 |
| 59 | Ga0068869_100153769 | 3300005334 | Bacteria | 1786 |
| 60 | Ga0068869_100300906 | 3300005334 | Bacteria | 1295 |
| 61 | Ga0070666_10000055 | 3300005335 | Bacteria | 92269 |
| 62 | Ga0070666_10000400 | 3300005335 | Bacteria | 27232 |
| 63 | Ga0070666_10003676 | 3300005335 | Bacteria | 9296 |
| 64 | Ga0070666_10138795 | 3300005335 | Bacteria | 1693 |
| 65 | Ga0070680_100000160 | 3300005336 | Bacteria | 42287 |
| 66 | Ga0070680_100027122 | 3300005336 | Bacteria | 4587 |
| 67 | Ga0070680_100030174 | 3300005336 | Bacteria | 4355 |
| 68 | Ga0070680_100035984 | 3300005336 | Bacteria | 3998 |
| 69 | Ga0070680_100069013 | 3300005336 | Bacteria | 2902 |
| 70 | Ga0070682_100000041 | 3300005337 | Bacteria | 142152 |
| 71 | Ga0070682_100013705 | 3300005337 | Bacteria | 4672 |
| 72 | Ga0070682_100041701 | 3300005337 | Bacteria | 2830 |
| 73 | Ga0070682_100052742 | 3300005337 | Bacteria | 2546 |
| 74 | Ga0068868_100001911 | 3300005338 | Bacteria | 14309 |
| 75 | Ga0068868_100007251 | 3300005338 | Bacteria | 7885 |
| 76 | Ga0068868_100016572 | 3300005338 | Bacteria | 5477 |
| 77 | Ga0068868_100024924 | 3300005338 | Bacteria | 4543 |
| 78 | Ga0068868_100044769 | 3300005338 | Bacteria | 3460 |
| 79 | Ga0070660_100041007 | 3300005339 | Bacteria | 3526 |
| 80 | Ga0070660_100045762 | 3300005339 | Bacteria | 3351 |
| 81 | Ga0070660_100064503 | 3300005339 | Bacteria | 2850 |
| 82 | Ga0070660_100122356 | 3300005339 | Bacteria | 2077 |
| 83 | Ga0070689_100011119 | 3300005340 | Bacteria | 6439 |
| 84 | Ga0070689_100018119 | 3300005340 | Bacteria | 5182 |
| 85 | Ga0070689_100165021 | 3300005340 | Bacteria | 1792 |
| 86 | Ga0070687_100034251 | 3300005343 | Bacteria | 2513 |
| 87 | Ga0070661_100001376 | 3300005344 | Bacteria | 16996 |
| 88 | Ga0070661_100007905 | 3300005344 | Bacteria | 7344 |
| 89 | Ga0070661_100096116 | 3300005344 | Bacteria | 2198 |
| 90 | Ga0070661_100118825 | 3300005344 | Bacteria | 1978 |
| 91 | Ga0070661_100191562 | 3300005344 | Bacteria | 1559 |
| 92 | Ga0070668_100014784 | 3300005347 | Bacteria | 5833 |
| 93 | Ga0070668_100019363 | 3300005347 | Bacteria | 5123 |
| 94 | Ga0070668_100060762 | 3300005347 | Bacteria | 2927 |
| 95 | Ga0070668_100063488 | 3300005347 | Bacteria | 2863 |
| 96 | Ga0070668_100105402 | 3300005347 | Bacteria | 2239 |
| 97 | Ga0070668_100273283 | 3300005347 | Bacteria | 1409 |
| 98 | Ga0070669_100043207 | 3300005353 | Bacteria | 3281 |
| 99 | Ga0070669_100064037 | 3300005353 | Bacteria | 2707 |
| 100 | Ga0070669_100073367 | 3300005353 | Bacteria | 2535 |
| 101 | Ga0070675_100064550 | 3300005354 | Bacteria | 3027 |
| 102 | Ga0070675_100199503 | 3300005354 | Bacteria | 1736 |
| 103 | Ga0070671_100037638 | 3300005355 | Bacteria | 4013 |
| 104 | Ga0070671_100153844 | 3300005355 | Bacteria | 1942 |
| 105 | Ga0070674_100152558 | 3300005356 | Bacteria | 1745 |
| 106 | Ga0070673_100007228 | 3300005364 | Bacteria | 7304 |
| 107 | Ga0070673_100016889 | 3300005364 | Bacteria | 5175 |
| 108 | Ga0070673_100049484 | 3300005364 | Bacteria | 3282 |
| 109 | Ga0070673_100140320 | 3300005364 | Bacteria | 2038 |
| 110 | Ga0070688_100003597 | 3300005365 | Bacteria | 7995 |
| 111 | Ga0070688_100010064 | 3300005365 | Bacteria | 5198 |
| 112 | Ga0070688_100034246 | 3300005365 | Bacteria | 3075 |
| 113 | Ga0070688_100097256 | 3300005365 | Bacteria | 1935 |
| 114 | Ga0070688_100191164 | 3300005365 | Bacteria | 1426 |
| 115 | Ga0070659_100005889 | 3300005366 | Bacteria | 8831 |
| 116 | Ga0070659_100015884 | 3300005366 | Bacteria | 5647 |
| 117 | Ga0070659_100017088 | 3300005366 | Bacteria | 5453 |
| 118 | Ga0070659_100050411 | 3300005366 | Bacteria | 3272 |
| 119 | Ga0070659_100094716 | 3300005366 | Bacteria | 2398 |
| 120 | Ga0070667_100002402 | 3300005367 | Bacteria | 16395 |
| 121 | Ga0070667_100010585 | 3300005367 | Bacteria | 7616 |
| 122 | Ga0070667_100016479 | 3300005367 | Bacteria | 6116 |
| 123 | Ga0070667_100020920 | 3300005367 | Bacteria | 5435 |
| 124 | Ga0070667_100023520 | 3300005367 | Bacteria | 5113 |
| 125 | Ga0070667_100057559 | 3300005367 | Bacteria | 3286 |
| 126 | Ga0070667_100283877 | 3300005367 | Bacteria | 1487 |
| 127 | Ga0070708_100134901 | 3300005445 | Bacteria | 2286 |
| 128 | Ga0070663_100100515 | 3300005455 | Bacteria | 2157 |
| 129 | Ga0070678_100003657 | 3300005456 | Bacteria | 8586 |
| 130 | Ga0070678_100228650 | 3300005456 | Bacteria | 1550 |
| 131 | Ga0070662_100013337 | 3300005457 | Bacteria | 5467 |
| 132 | Ga0070662_100036365 | 3300005457 | Bacteria | 3482 |
| 133 | Ga0070681_10032814 | 3300005458 | Bacteria | 5213 |
| 134 | Ga0070681_10071670 | 3300005458 | Bacteria | 3430 |
| 135 | Ga0070681_10161775 | 3300005458 | Bacteria | 2162 |
| 136 | Ga0068867_100008127 | 3300005459 | Bacteria | 7413 |
| 137 | Ga0068867_100013549 | 3300005459 | Bacteria | 5774 |
| 138 | Ga0068867_100026998 | 3300005459 | Bacteria | 4125 |
| 139 | Ga0068867_100042723 | 3300005459 | Bacteria | 3318 |
| 140 | Ga0068867_100059980 | 3300005459 | Bacteria | 2821 |
| 141 | Ga0068867_100325519 | 3300005459 | Bacteria | 1275 |
| 142 | Ga0070685_10003458 | 3300005466 | Bacteria | 8029 |
| 143 | Ga0070685_10011080 | 3300005466 | Bacteria | 4708 |
| 144 | Ga0070685_10037460 | 3300005466 | Bacteria | 2747 |
| 145 | Ga0070707_100070724 | 3300005468 | Bacteria | 3361 |
| 146 | Ga0070698_100005877 | 3300005471 | Bacteria | 13398 |
| 147 | Ga0070698_100054790 | 3300005471 | Bacteria | 4048 |
| 148 | Ga0070698_100346558 | 3300005471 | Bacteria | 1417 |
| 149 | Ga0070699_100053273 | 3300005518 | Bacteria | 3502 |
| 150 | Ga0070679_100001168 | 3300005530 | Bacteria | 23003 |
| 151 | Ga0070679_100014547 | 3300005530 | Bacteria | 7559 |
| 152 | Ga0070679_100056346 | 3300005530 | Bacteria | 3916 |
| 153 | Ga0070679_100056952 | 3300005530 | Bacteria | 3895 |
| 154 | Ga0070684_100003135 | 3300005535 | Bacteria | 12340 |
| 155 | Ga0070684_100004694 | 3300005535 | Bacteria | 10432 |
| 156 | Ga0070684_100033387 | 3300005535 | Bacteria | 4393 |
| 157 | Ga0070684_100035292 | 3300005535 | Bacteria | 4280 |
| 158 | Ga0070684_100322443 | 3300005535 | Bacteria | 1419 |
| 159 | Ga0068853_100001210 | 3300005539 | Bacteria | 18401 |
| 160 | Ga0068853_100007459 | 3300005539 | Bacteria | 8754 |
| 161 | Ga0068853_100029333 | 3300005539 | Bacteria | 4636 |
| 162 | Ga0068853_100030592 | 3300005539 | Bacteria | 4549 |
| 163 | Ga0068853_100042311 | 3300005539 | Bacteria | 3895 |
| 164 | Ga0068853_100044637 | 3300005539 | Bacteria | 3794 |
| 165 | Ga0068853_100045147 | 3300005539 | Bacteria | 3774 |
| 166 | Ga0068853_100057198 | 3300005539 | Bacteria | 3365 |
| 167 | Ga0068853_100063355 | 3300005539 | Bacteria | 3202 |
| 168 | Ga0068853_100069458 | 3300005539 | Bacteria | 3064 |
| 169 | Ga0068853_100156707 | 3300005539 | Bacteria | 2052 |
| 170 | Ga0068853_100355185 | 3300005539 | Bacteria | 1364 |
| 171 | Ga0068853_100432447 | 3300005539 | Bacteria | 1236 |
| 172 | Ga0070672_100003073 | 3300005543 | Bacteria | 10764 |
| 173 | Ga0070672_100080768 | 3300005543 | Bacteria | 2605 |
| 174 | Ga0070672_100282065 | 3300005543 | Bacteria | 1405 |
| 175 | Ga0070672_100358777 | 3300005543 | Bacteria | 1244 |
| 176 | Ga0070686_100015822 | 3300005544 | Bacteria | 4380 |
| 177 | Ga0070686_100061921 | 3300005544 | Bacteria | 2419 |
| 178 | Ga0070686_100154790 | 3300005544 | Bacteria | 1609 |
| 179 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 180 | Ga0070665_100142955 | 3300005548 | Bacteria | 2396 |
| 181 | Ga0070665_100160414 | 3300005548 | Bacteria | 2251 |
| 182 | Ga0070665_100175600 | 3300005548 | Bacteria | 2143 |
| 183 | Ga0068855_100002248 | 3300005563 | Bacteria | 23863 |
| 184 | Ga0068855_100004618 | 3300005563 | Bacteria | 16804 |
| 185 | Ga0068855_100013158 | 3300005563 | Bacteria | 9980 |
| 186 | Ga0068855_100017559 | 3300005563 | Bacteria | 8604 |
| 187 | Ga0068855_100020017 | 3300005563 | Bacteria | 8035 |
| 188 | Ga0068855_100026010 | 3300005563 | Bacteria | 7000 |
| 189 | Ga0068855_100050073 | 3300005563 | Bacteria | 4924 |
| 190 | Ga0068855_100071409 | 3300005563 | Bacteria | 4037 |
| 191 | Ga0068855_100093016 | 3300005563 | Unclassified | 3477 |
| 192 | Ga0068855_100142593 | 3300005563 | Bacteria | 2729 |
| 193 | Ga0068855_100158629 | 3300005563 | Bacteria | 2569 |
| 194 | Ga0068855_100291599 | 3300005563 | Bacteria | 1809 |
| 195 | Ga0070664_100024601 | 3300005564 | Bacteria | 4983 |
| 196 | Ga0070664_100037259 | 3300005564 | Bacteria | 4088 |
| 197 | Ga0070664_100226914 | 3300005564 | Bacteria | 1673 |
| 198 | Ga0070664_100344812 | 3300005564 | Bacteria | 1354 |
| 199 | Ga0068857_100008662 | 3300005577 | Bacteria | 8803 |
| 200 | Ga0068857_100023723 | 3300005577 | Bacteria | 5400 |
| 201 | Ga0068857_100045500 | 3300005577 | Bacteria | 3894 |
| 202 | Ga0068857_100063029 | 3300005577 | Bacteria | 3296 |
| 203 | Ga0068857_100065629 | 3300005577 | Bacteria | 3228 |
| 204 | Ga0068857_100189460 | 3300005577 | Bacteria | 1873 |
| 205 | Ga0068854_100062303 | 3300005578 | Bacteria | 2704 |
| 206 | Ga0068854_100137316 | 3300005578 | Bacteria | 1873 |
| 207 | Ga0068856_100011241 | 3300005614 | Bacteria | 8690 |
| 208 | Ga0070702_100123172 | 3300005615 | Bacteria | 1626 |
| 209 | Ga0068852_100006862 | 3300005616 | Bacteria | 8273 |
| 210 | Ga0068852_100039419 | 3300005616 | Bacteria | 3977 |
| 211 | Ga0068852_100040292 | 3300005616 | Bacteria | 3940 |
| 212 | Ga0068852_100082859 | 3300005616 | Bacteria | 2851 |
| 213 | Ga0068852_100104232 | 3300005616 | Bacteria | 2567 |
| 214 | Ga0068852_100153405 | 3300005616 | Bacteria | 2144 |
| 215 | Ga0068852_100169896 | 3300005616 | Bacteria | 2043 |
| 216 | Ga0068852_100350968 | 3300005616 | Bacteria | 1440 |
| 217 | Ga0068852_100472911 | 3300005616 | Bacteria | 1244 |
| 218 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 219 | Ga0068859_100001878 | 3300005617 | Bacteria | 21383 |
| 220 | Ga0068859_100006236 | 3300005617 | Bacteria | 12106 |
| 221 | Ga0068859_100009053 | 3300005617 | Bacteria | 10058 |
| 222 | Ga0068859_100009963 | 3300005617 | Bacteria | 9587 |
| 223 | Ga0068859_100068033 | 3300005617 | Bacteria | 3597 |
| 224 | Ga0068859_100324085 | 3300005617 | Bacteria | 1635 |
| 225 | Ga0068859_100425651 | 3300005617 | Bacteria | 1424 |
| 226 | Ga0068864_100021783 | 3300005618 | Bacteria | 5369 |
| 227 | Ga0068864_100022019 | 3300005618 | Bacteria | 5342 |
| 228 | Ga0068864_100023605 | 3300005618 | Bacteria | 5167 |
| 229 | Ga0068864_100059844 | 3300005618 | Bacteria | 3296 |
| 230 | Ga0068864_100121541 | 3300005618 | Bacteria | 2335 |
| 231 | Ga0068864_100137072 | 3300005618 | Bacteria | 2205 |
| 232 | Ga0068864_100148240 | 3300005618 | Bacteria | 2123 |
| 233 | Ga0068866_10005321 | 3300005718 | Bacteria | 5304 |
| 234 | Ga0068866_10031537 | 3300005718 | Bacteria | 2554 |
| 235 | Ga0068866_10050954 | 3300005718 | Bacteria | 2105 |
| 236 | Ga0068861_100001764 | 3300005719 | Bacteria | 13901 |
| 237 | Ga0068851_10009472 | 3300005834 | Bacteria | 4531 |
| 238 | Ga0068851_10070467 | 3300005834 | Bacteria | 1808 |
| 239 | Ga0068870_10019323 | 3300005840 | Bacteria | 3304 |
| 240 | Ga0068870_10024426 | 3300005840 | Bacteria | 2990 |
| 241 | Ga0068863_100004080 | 3300005841 | Bacteria | 14426 |
| 242 | Ga0068863_100020280 | 3300005841 | Bacteria | 6359 |
| 243 | Ga0068863_100022024 | 3300005841 | Bacteria | 6083 |
| 244 | Ga0068863_100071930 | 3300005841 | Bacteria | 3272 |
| 245 | Ga0068858_100022366 | 3300005842 | Bacteria | 5902 |
| 246 | Ga0068858_100181072 | 3300005842 | Bacteria | 1990 |
| 247 | Ga0068858_100267452 | 3300005842 | Bacteria | 1626 |
| 248 | Ga0068860_100001494 | 3300005843 | Bacteria | 25241 |
| 249 | Ga0068860_100002905 | 3300005843 | Bacteria | 17743 |
| 250 | Ga0068860_100003395 | 3300005843 | Bacteria | 16381 |
| 251 | Ga0068860_100007403 | 3300005843 | Bacteria | 10982 |
| 252 | Ga0068860_100008704 | 3300005843 | Bacteria | 10110 |
| 253 | Ga0068860_100017358 | 3300005843 | Bacteria | 7013 |
| 254 | Ga0068860_100034993 | 3300005843 | Bacteria | 4819 |
| 255 | Ga0068860_100039084 | 3300005843 | Bacteria | 4539 |
| 256 | Ga0068860_100043514 | 3300005843 | Bacteria | 4284 |
| 257 | Ga0068860_100123595 | 3300005843 | Bacteria | 2480 |
| 258 | Ga0068860_100185792 | 3300005843 | Bacteria | 2010 |
| 259 | Ga0068860_100217378 | 3300005843 | Bacteria | 1855 |
| 260 | Ga0068862_100064589 | 3300005844 | Bacteria | 3151 |
| 261 | Ga0068862_100151980 | 3300005844 | Bacteria | 2061 |
| 262 | Ga0068862_100192402 | 3300005844 | Bacteria | 1836 |
| 263 | Ga0068862_100400432 | 3300005844 | Bacteria | 1284 |
| 264 | Ga0081539_10001948 | 3300005985 | Bacteria | 31581 |
| 265 | Ga0081539_10006848 | 3300005985 | Bacteria | 10657 |
| 266 | Ga0075366_10048094 | 3300006195 | Unclassified | 2529 |
| 267 | Ga0075366_10048490 | 3300006195 | Bacteria | 2519 |
| 268 | Ga0075366_10112408 | 3300006195 | Bacteria | 1639 |
| 269 | Ga0097621_100000109 | 3300006237 | Bacteria | 46477 |
| 270 | Ga0097621_100014826 | 3300006237 | Bacteria | 5846 |
| 271 | Ga0097621_100021751 | 3300006237 | Bacteria | 4968 |
| 272 | Ga0097621_100049668 | 3300006237 | Bacteria | 3409 |
| 273 | Ga0097621_100142854 | 3300006237 | Bacteria | 2046 |
| 274 | Ga0097621_100168043 | 3300006237 | Bacteria | 1889 |
| 275 | Ga0097621_100200092 | 3300006237 | Bacteria | 1734 |
| 276 | Ga0068871_100002333 | 3300006358 | Bacteria | 12926 |
| 277 | Ga0068871_100004004 | 3300006358 | Bacteria | 10194 |
| 278 | Ga0068871_100012871 | 3300006358 | Bacteria | 6194 |
| 279 | Ga0068871_100167397 | 3300006358 | Bacteria | 1882 |
| 280 | Ga0068871_100247409 | 3300006358 | Bacteria | 1552 |
| 281 | Ga0068871_100298822 | 3300006358 | Bacteria | 1413 |
| 282 | Ga0075428_100000528 | 3300006844 | Bacteria | 38898 |
| 283 | Ga0075428_100040421 | 3300006844 | Bacteria | 5131 |
| 284 | Ga0075428_100084530 | 3300006844 | Bacteria | 3462 |
| 285 | Ga0075428_100287560 | 3300006844 | Bacteria | 1768 |
| 286 | Ga0075430_100136669 | 3300006846 | Bacteria | 2042 |
| 287 | Ga0075431_100002593 | 3300006847 | Bacteria | 17462 |
| 288 | Ga0075431_100089626 | 3300006847 | Bacteria | 3175 |
| 289 | Ga0075429_100001456 | 3300006880 | Bacteria | 19435 |
| 290 | Ga0075429_100035722 | 3300006880 | Bacteria | 4323 |
| 291 | Ga0068865_100001316 | 3300006881 | Bacteria | 14473 |
| 292 | Ga0068865_100021362 | 3300006881 | Bacteria | 4207 |
| 293 | Ga0068865_100058786 | 3300006881 | Bacteria | 2687 |
| 294 | Ga0068865_100096384 | 3300006881 | Bacteria | 2157 |
| 295 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 296 | Ga0097620_100001878 | 3300006931 | Bacteria | 21383 |
| 297 | Ga0097620_100006236 | 3300006931 | Bacteria | 12106 |
| 298 | Ga0097620_100006943 | 3300006931 | Bacteria | 11498 |
| 299 | Ga0097620_100009053 | 3300006931 | Bacteria | 10058 |
| 300 | Ga0097620_100009963 | 3300006931 | Bacteria | 9587 |
| 301 | Ga0097620_100020271 | 3300006931 | Bacteria | 6674 |
| 302 | Ga0097620_100068033 | 3300006931 | Bacteria | 3597 |
| 303 | Ga0097620_100324082 | 3300006931 | Bacteria | 1635 |
| 304 | Ga0097620_100425572 | 3300006931 | Bacteria | 1424 |
| 305 | Ga0105240_10000011 | 3300009093 | Bacteria | 523646 |
| 306 | Ga0105240_10000106 | 3300009093 | Bacteria | 171825 |
| 307 | Ga0105240_10000895 | 3300009093 | Bacteria | 53295 |
| 308 | Ga0105240_10003561 | 3300009093 | Bacteria | 24159 |
| 309 | Ga0105240_10004054 | 3300009093 | Bacteria | 22536 |
| 310 | Ga0105240_10011259 | 3300009093 | Bacteria | 12470 |
| 311 | Ga0105240_10014654 | 3300009093 | Bacteria | 10699 |
| 312 | Ga0105240_10057080 | 3300009093 | Bacteria | 4881 |
| 313 | Ga0105240_10073100 | 3300009093 | Bacteria | 4235 |
| 314 | Ga0105240_10111545 | 3300009093 | Bacteria | 3308 |
| 315 | Ga0105240_10230492 | 3300009093 | Bacteria | 2153 |
| 316 | Ga0111539_10006625 | 3300009094 | Bacteria | 14919 |
| 317 | Ga0111539_10144975 | 3300009094 | Bacteria | 2780 |
| 318 | Ga0111539_10182203 | 3300009094 | Bacteria | 2453 |
| 319 | Ga0111539_10357967 | 3300009094 | Bacteria | 1698 |
| 320 | Ga0105245_10059034 | 3300009098 | Bacteria | 3454 |
| 321 | Ga0105247_10005677 | 3300009101 | Bacteria | 7818 |
| 322 | Ga0114129_10001087 | 3300009147 | Bacteria | 35667 |
| 323 | Ga0114129_10574063 | 3300009147 | Bacteria | 1464 |
| 324 | Ga0105243_10084386 | 3300009148 | Bacteria | 2601 |
| 325 | Ga0105243_10274000 | 3300009148 | Bacteria | 1517 |
| 326 | Ga0105241_10000085 | 3300009174 | Bacteria | 69963 |
| 327 | Ga0105241_10001234 | 3300009174 | Bacteria | 19553 |
| 328 | Ga0105241_10002042 | 3300009174 | Bacteria | 15268 |
| 329 | Ga0105241_10002426 | 3300009174 | Bacteria | 13985 |
| 330 | Ga0105241_10052333 | 3300009174 | Bacteria | 3117 |
| 331 | Ga0105241_10063653 | 3300009174 | Bacteria | 2847 |
| 332 | Ga0105241_10068129 | 3300009174 | Bacteria | 2756 |
| 333 | Ga0105241_10279516 | 3300009174 | Bacteria | 1425 |
| 334 | Ga0105242_10031800 | 3300009176 | Unclassified | 4218 |
| 335 | Ga0105242_10032132 | 3300009176 | Bacteria | 4196 |
| 336 | Ga0105242_10053071 | 3300009176 | Bacteria | 3309 |
| 337 | Ga0105242_10073555 | 3300009176 | Bacteria | 2842 |
| 338 | Ga0105242_10083180 | 3300009176 | Bacteria | 2680 |
| 339 | Ga0105242_10096462 | 3300009176 | Bacteria | 2498 |
| 340 | Ga0105242_10122574 | 3300009176 | Bacteria | 2233 |
| 341 | Ga0105248_10002485 | 3300009177 | Bacteria | 20490 |
| 342 | Ga0105237_10000512 | 3300009545 | Bacteria | 54825 |
| 343 | Ga0105237_10000890 | 3300009545 | Bacteria | 40284 |
| 344 | Ga0105237_10002282 | 3300009545 | Bacteria | 23838 |
| 345 | Ga0105237_10002430 | 3300009545 | Bacteria | 23126 |
| 346 | Ga0105237_10004341 | 3300009545 | Bacteria | 16433 |
| 347 | Ga0105237_10014775 | 3300009545 | Bacteria | 8148 |
| 348 | Ga0105237_10018640 | 3300009545 | Bacteria | 7176 |
| 349 | Ga0105237_10029968 | 3300009545 | Bacteria | 5528 |
| 350 | Ga0105237_10136406 | 3300009545 | Bacteria | 2448 |
| 351 | Ga0105237_10235368 | 3300009545 | Bacteria | 1833 |
| 352 | Ga0105237_10249408 | 3300009545 | Bacteria | 1777 |
| 353 | Ga0105238_10003933 | 3300009551 | Bacteria | 14745 |
| 354 | Ga0105238_10061554 | 3300009551 | Bacteria | 3756 |
| 355 | Ga0105249_10000561 | 3300009553 | Bacteria | 34246 |
| 356 | Ga0105249_10005594 | 3300009553 | Bacteria | 10867 |
| 357 | Ga0105249_10008945 | 3300009553 | Bacteria | 8746 |
| 358 | Ga0105249_10010060 | 3300009553 | Bacteria | 8301 |
| 359 | Ga0105249_10011723 | 3300009553 | Bacteria | 7708 |
| 360 | Ga0105249_10018185 | 3300009553 | Bacteria | 6248 |
| 361 | Ga0105249_10076176 | 3300009553 | Bacteria | 3109 |
| 362 | Ga0105249_10107186 | 3300009553 | Unclassified | 2637 |
| 363 | Ga0105249_10116448 | 3300009553 | Bacteria | 2533 |
| 364 | Ga0105249_10262299 | 3300009553 | Bacteria | 1717 |
| 365 | Ga0105239_10000019 | 3300010375 | Bacteria | 273836 |
| 366 | Ga0105239_10000384 | 3300010375 | Bacteria | 64479 |
| 367 | Ga0105239_10002513 | 3300010375 | Bacteria | 23322 |
| 368 | Ga0105239_10004264 | 3300010375 | Bacteria | 17158 |
| 369 | Ga0105239_10021483 | 3300010375 | Bacteria | 7116 |
| 370 | Ga0105239_10028067 | 3300010375 | Bacteria | 6193 |
| 371 | Ga0105239_10035894 | 3300010375 | Bacteria | 5443 |
| 372 | Ga0105239_10055610 | 3300010375 | Bacteria | 4340 |
| 373 | Ga0105239_10095902 | 3300010375 | Bacteria | 3276 |
| 374 | Ga0105239_10285026 | 3300010375 | Bacteria | 1860 |
| 375 | Ga0105246_10006084 | 3300011119 | Bacteria | 7364 |
| 376 | Ga0105246_10192698 | 3300011119 | Bacteria | 1579 |
| 377 | Ga0157373_10010020 | 3300013100 | Bacteria | 6984 |
| 378 | Ga0157373_10012596 | 3300013100 | Bacteria | 6217 |
| 379 | Ga0157373_10013318 | 3300013100 | Bacteria | 6036 |
| 380 | Ga0157373_10058387 | 3300013100 | Bacteria | 2736 |
| 381 | Ga0157373_10073897 | 3300013100 | Bacteria | 2405 |
| 382 | Ga0157373_10085537 | 3300013100 | Bacteria | 2223 |
| 383 | Ga0157373_10113677 | 3300013100 | Bacteria | 1903 |
| 384 | Ga0157371_10000250 | 3300013102 | Bacteria | 75550 |
| 385 | Ga0157371_10000407 | 3300013102 | Bacteria | 53632 |
| 386 | Ga0157371_10008816 | 3300013102 | Bacteria | 7988 |
| 387 | Ga0157371_10021059 | 3300013102 | Bacteria | 4793 |
| 388 | Ga0157371_10023265 | 3300013102 | Bacteria | 4531 |
| 389 | Ga0157371_10025438 | 3300013102 | Bacteria | 4314 |
| 390 | Ga0157371_10026427 | 3300013102 | Bacteria | 4220 |
| 391 | Ga0157371_10041967 | 3300013102 | Bacteria | 3262 |
| 392 | Ga0157371_10107200 | 3300013102 | Bacteria | 1983 |
| 393 | Ga0157371_10176636 | 3300013102 | Bacteria | 1527 |
| 394 | Ga0157371_10177175 | 3300013102 | Bacteria | 1524 |
| 395 | Ga0157371_10186089 | 3300013102 | Bacteria | 1486 |
| 396 | Ga0157370_10000585 | 3300013104 | Bacteria | 45433 |
| 397 | Ga0157370_10002572 | 3300013104 | Bacteria | 21775 |
| 398 | Ga0157370_10011832 | 3300013104 | Bacteria | 9105 |
| 399 | Ga0157370_10017059 | 3300013104 | Bacteria | 7338 |
| 400 | Ga0157370_10031858 | 3300013104 | Bacteria | 5153 |
| 401 | Ga0157370_10070861 | 3300013104 | Bacteria | 3290 |
| 402 | Ga0157370_10113165 | 3300013104 | Bacteria | 2536 |
| 403 | Ga0157370_10315491 | 3300013104 | Bacteria | 1442 |
| 404 | Ga0157369_10002663 | 3300013105 | Bacteria | 21313 |
| 405 | Ga0157369_10020379 | 3300013105 | Bacteria | 7412 |
| 406 | Ga0157369_10046176 | 3300013105 | Bacteria | 4734 |
| 407 | Ga0157369_10061837 | 3300013105 | Bacteria | 4036 |
| 408 | Ga0157369_10072453 | 3300013105 | Bacteria | 3698 |
| 409 | Ga0157369_10073789 | 3300013105 | Bacteria | 3660 |
| 410 | Ga0157369_10075372 | 3300013105 | Bacteria | 3618 |
| 411 | Ga0157369_10082140 | 3300013105 | Bacteria | 3448 |
| 412 | Ga0157369_10113312 | 3300013105 | Bacteria | 2881 |
| 413 | Ga0157369_10228616 | 3300013105 | Bacteria | 1945 |
| 414 | Ga0157369_10414016 | 3300013105 | Bacteria | 1398 |
| 415 | Ga0157374_10008165 | 3300013296 | Bacteria | 8946 |
| 416 | Ga0157374_10037083 | 3300013296 | Bacteria | 4471 |
| 417 | Ga0157374_10044017 | 3300013296 | Bacteria | 4125 |
| 418 | Ga0157374_10045228 | 3300013296 | Bacteria | 4074 |
| 419 | Ga0157374_10056493 | 3300013296 | Bacteria | 3664 |
| 420 | Ga0157374_10079191 | 3300013296 | Bacteria | 3113 |
| 421 | Ga0157374_10094417 | 3300013296 | Bacteria | 2858 |
| 422 | Ga0157374_10272271 | 3300013296 | Bacteria | 1670 |
| 423 | Ga0157374_10284572 | 3300013296 | Bacteria | 1633 |
| 424 | Ga0157374_10325504 | 3300013296 | Bacteria | 1524 |
| 425 | Ga0157374_10524805 | 3300013296 | Bacteria | 1190 |
| 426 | Ga0157378_10009840 | 3300013297 | Bacteria | 8338 |
| 427 | Ga0157378_10024055 | 3300013297 | Bacteria | 5358 |
| 428 | Ga0157378_10125222 | 3300013297 | Bacteria | 2373 |
| 429 | Ga0157378_10202165 | 3300013297 | Bacteria | 1879 |
| 430 | Ga0157378_10211878 | 3300013297 | Bacteria | 1837 |
| 431 | Ga0157378_10337328 | 3300013297 | Bacteria | 1469 |
| 432 | Ga0157378_10364872 | 3300013297 | Bacteria | 1414 |
| 433 | Ga0157378_10373474 | 3300013297 | Bacteria | 1398 |
| 434 | Ga0157378_10456758 | 3300013297 | Bacteria | 1269 |
| 435 | Ga0163162_10000579 | 3300013306 | Bacteria | 33893 |
| 436 | Ga0163162_10000612 | 3300013306 | Bacteria | 33144 |
| 437 | Ga0163162_10000687 | 3300013306 | Bacteria | 31377 |
| 438 | Ga0163162_10001718 | 3300013306 | Bacteria | 20509 |
| 439 | Ga0163162_10001831 | 3300013306 | Bacteria | 20004 |
| 440 | Ga0163162_10007132 | 3300013306 | Bacteria | 10846 |
| 441 | Ga0163162_10008479 | 3300013306 | Bacteria | 10029 |
| 442 | Ga0163162_10010121 | 3300013306 | Bacteria | 9166 |
| 443 | Ga0163162_10018072 | 3300013306 | Bacteria | 6901 |
| 444 | Ga0163162_10100604 | 3300013306 | Bacteria | 2982 |
| 445 | Ga0163162_10103157 | 3300013306 | Bacteria | 2946 |
| 446 | Ga0163162_10129461 | 3300013306 | Bacteria | 2632 |
| 447 | Ga0163162_10154466 | 3300013306 | Bacteria | 2414 |
| 448 | Ga0163162_10279801 | 3300013306 | Bacteria | 1800 |
| 449 | Ga0163162_10500127 | 3300013306 | Bacteria | 1346 |
| 450 | Ga0163162_10685843 | 3300013306 | Bacteria | 1147 |
| 451 | Ga0157372_10001462 | 3300013307 | Bacteria | 25620 |
| 452 | Ga0157372_10003195 | 3300013307 | Bacteria | 17687 |
| 453 | Ga0157372_10003494 | 3300013307 | Bacteria | 16941 |
| 454 | Ga0157372_10008214 | 3300013307 | Bacteria | 11093 |
| 455 | Ga0157372_10016144 | 3300013307 | Bacteria | 8012 |
| 456 | Ga0157372_10034953 | 3300013307 | Bacteria | 5531 |
| 457 | Ga0157372_10050711 | 3300013307 | Bacteria | 4616 |
| 458 | Ga0157372_10056027 | 3300013307 | Bacteria | 4404 |
| 459 | Ga0157372_10061020 | 3300013307 | Bacteria | 4220 |
| 460 | Ga0157372_10082298 | 3300013307 | Bacteria | 3644 |
| 461 | Ga0157372_10099881 | 3300013307 | Bacteria | 3311 |
| 462 | Ga0157372_10104518 | 3300013307 | Bacteria | 3238 |
| 463 | Ga0157372_10227859 | 3300013307 | Bacteria | 2160 |
| 464 | Ga0157372_10436106 | 3300013307 | Bacteria | 1527 |
| 465 | Ga0157372_10538576 | 3300013307 | Bacteria | 1361 |
| 466 | Ga0157375_10002298 | 3300013308 | Bacteria | 16512 |
| 467 | Ga0157375_10019039 | 3300013308 | Bacteria | 6233 |
| 468 | Ga0157375_10062542 | 3300013308 | Bacteria | 3699 |
| 469 | Ga0157375_10063784 | 3300013308 | Bacteria | 3667 |
| 470 | Ga0157375_10071325 | 3300013308 | Bacteria | 3487 |
| 471 | Ga0157375_10096253 | 3300013308 | Bacteria | 3033 |
| 472 | Ga0157375_10103890 | 3300013308 | Bacteria | 2929 |
| 473 | Ga0157375_10247085 | 3300013308 | Bacteria | 1945 |
| 474 | Ga0157375_10317584 | 3300013308 | Bacteria | 1722 |
| 475 | Ga0157375_10344313 | 3300013308 | Bacteria | 1656 |
| 476 | Ga0157375_10345753 | 3300013308 | Bacteria | 1653 |
| 477 | Ga0157375_10370833 | 3300013308 | Bacteria | 1598 |
| 478 | Ga0163163_10000325 | 3300014325 | Bacteria | 46201 |
| 479 | Ga0163163_10000401 | 3300014325 | Bacteria | 40925 |
| 480 | Ga0163163_10002269 | 3300014325 | Bacteria | 16219 |
| 481 | Ga0163163_10118986 | 3300014325 | Bacteria | 2674 |
| 482 | Ga0163163_10131419 | 3300014325 | Bacteria | 2544 |
| 483 | Ga0163163_10139945 | 3300014325 | Bacteria | 2462 |
| 484 | Ga0163163_10300487 | 3300014325 | Bacteria | 1658 |
| 485 | Ga0157380_10009743 | 3300014326 | Bacteria | 6895 |
| 486 | Ga0157380_10051428 | 3300014326 | Bacteria | 3259 |
| 487 | Ga0157380_10246934 | 3300014326 | Bacteria | 1613 |
| 488 | Ga0157377_10008604 | 3300014745 | Bacteria | 4981 |
| 489 | Ga0157377_10013802 | 3300014745 | Bacteria | 4095 |
| 490 | Ga0157377_10042283 | 3300014745 | Bacteria | 2531 |
| 491 | Ga0157377_10043394 | 3300014745 | Bacteria | 2502 |
| 492 | Ga0157377_10074302 | 3300014745 | Bacteria | 1972 |
| 493 | Ga0157379_10006192 | 3300014968 | Bacteria | 10306 |
| 494 | Ga0157379_10018323 | 3300014968 | Bacteria | 6172 |
| 495 | Ga0157379_10021086 | 3300014968 | Bacteria | 5767 |
| 496 | Ga0157379_10027729 | 3300014968 | Bacteria | 5041 |
| 497 | Ga0157379_10110109 | 3300014968 | Bacteria | 2474 |
| 498 | Ga0157379_10186655 | 3300014968 | Bacteria | 1874 |
| 499 | Ga0157379_10351675 | 3300014968 | Bacteria | 1349 |
| 500 | Ga0157376_10002607 | 3300014969 | Bacteria | 12248 |
| 501 | Ga0157376_10007180 | 3300014969 | Bacteria | 7920 |
| 502 | Ga0157376_10026343 | 3300014969 | Bacteria | 4593 |
| 503 | Ga0157376_10067688 | 3300014969 | Bacteria | 3021 |
| 504 | Ga0157376_10074918 | 3300014969 | Bacteria | 2886 |
| 505 | Ga0157376_10111712 | 3300014969 | Bacteria | 2407 |
| 506 | Ga0157376_10180865 | 3300014969 | Bacteria | 1927 |
| 507 | Ga0182005_1000069 | 3300015265 | Bacteria | 85864 |
| 508 | Ga0163161_10008477 | 3300017792 | Bacteria | 7118 |
| 509 | Ga0163161_10031847 | 3300017792 | Unclassified | 3760 |
| 510 | Ga0163161_10039508 | 3300017792 | Bacteria | 3388 |
| 511 | Ga0163161_10086648 | 3300017792 | Bacteria | 2312 |
| 512 | Ga0163161_10142207 | 3300017792 | Bacteria | 1817 |
| 513 | Ga0163161_10176224 | 3300017792 | Bacteria | 1637 |
| 514 | Ga0197907_11009971 | 3300020069 | Bacteria | 2174 |
| 515 | Ga0206356_10274599 | 3300020070 | Bacteria | 1336 |
| 516 | Ga0213876_10014861 | 3300021384 | Bacteria | 4126 |
| 517 | Ga0209436_100882 | 3300025208 | Bacteria | 11960 |
| 518 | Ga0209436_102262 | 3300025208 | Bacteria | 5941 |
| 519 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 520 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 521 | Ga0209646_1000578 | 3300025246 | Bacteria | 15188 |
| 522 | Ga0209026_1000192 | 3300025250 | Bacteria | 88221 |
| 523 | Ga0209148_1000546 | 3300025254 | Bacteria | 35936 |
| 524 | Ga0207666_1006039 | 3300025271 | Bacteria | 1562 |
| 525 | Ga0209673_1000258 | 3300025273 | Bacteria | 100207 |
| 526 | Ga0209130_1000871 | 3300025284 | Bacteria | 24706 |
| 527 | Ga0209564_1002451 | 3300025295 | Bacteria | 14614 |
| 528 | Ga0209564_1008546 | 3300025295 | Bacteria | 5032 |
| 529 | Ga0209758_1003782 | 3300025297 | Bacteria | 13345 |
| 530 | Ga0209758_1008980 | 3300025297 | Bacteria | 6327 |
| 531 | Ga0209050_1001914 | 3300025298 | Bacteria | 19914 |
| 532 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 533 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 534 | Ga0207426_1000321 | 3300025302 | Bacteria | 92019 |
| 535 | Ga0207426_1000916 | 3300025302 | Bacteria | 29477 |
| 536 | Ga0209257_1003047 | 3300025304 | Bacteria | 15120 |
| 537 | Ga0207697_10007616 | 3300025315 | Bacteria | 4809 |
| 538 | Ga0207697_10076299 | 3300025315 | Bacteria | 1408 |
| 539 | Ga0207656_10022444 | 3300025321 | Bacteria | 2532 |
| 540 | Ga0207656_10050633 | 3300025321 | Bacteria | 1794 |
| 541 | Ga0207682_10003295 | 3300025893 | Bacteria | 7053 |
| 542 | Ga0207682_10009657 | 3300025893 | Bacteria | 3801 |
| 543 | Ga0207682_10058484 | 3300025893 | Bacteria | 1609 |
| 544 | Ga0207642_10092011 | 3300025899 | Bacteria | 1500 |
| 545 | Ga0207710_10001225 | 3300025900 | Bacteria | 13013 |
| 546 | Ga0207688_10005557 | 3300025901 | Bacteria | 6855 |
| 547 | Ga0207688_10046226 | 3300025901 | Bacteria | 2430 |
| 548 | Ga0207680_10000021 | 3300025903 | Bacteria | 87712 |
| 549 | Ga0207680_10021290 | 3300025903 | Bacteria | 3506 |
| 550 | Ga0207680_10043510 | 3300025903 | Unclassified | 2634 |
| 551 | Ga0207680_10099567 | 3300025903 | Bacteria | 1865 |
| 552 | Ga0207647_10000025 | 3300025904 | Bacteria | 112150 |
| 553 | Ga0207647_10003522 | 3300025904 | Bacteria | 11739 |
| 554 | Ga0207647_10025385 | 3300025904 | Bacteria | 3894 |
| 555 | Ga0207647_10034227 | 3300025904 | Bacteria | 3245 |
| 556 | Ga0207647_10059421 | 3300025904 | Bacteria | 2339 |
| 557 | Ga0207685_10007041 | 3300025905 | Bacteria | 3107 |
| 558 | Ga0207645_10000193 | 3300025907 | Bacteria | 49552 |
| 559 | Ga0207645_10000791 | 3300025907 | Bacteria | 26451 |
| 560 | Ga0207645_10038081 | 3300025907 | Bacteria | 3085 |
| 561 | Ga0207645_10060796 | 3300025907 | Bacteria | 2413 |
| 562 | Ga0207643_10001613 | 3300025908 | Bacteria | 12724 |
| 563 | Ga0207643_10003612 | 3300025908 | Bacteria | 8341 |
| 564 | Ga0207643_10005299 | 3300025908 | Bacteria | 6902 |
| 565 | Ga0207643_10128700 | 3300025908 | Bacteria | 1505 |
| 566 | Ga0207705_10007859 | 3300025909 | Bacteria | 7832 |
| 567 | Ga0207705_10014478 | 3300025909 | Bacteria | 5676 |
| 568 | Ga0207705_10047415 | 3300025909 | Bacteria | 3090 |
| 569 | Ga0207705_10047785 | 3300025909 | Bacteria | 3077 |
| 570 | Ga0207654_10000413 | 3300025911 | Bacteria | 24569 |
| 571 | Ga0207654_10001146 | 3300025911 | Bacteria | 14275 |
| 572 | Ga0207654_10001929 | 3300025911 | Bacteria | 10753 |
| 573 | Ga0207654_10003473 | 3300025911 | Bacteria | 7968 |
| 574 | Ga0207654_10198858 | 3300025911 | Bacteria | 1318 |
| 575 | Ga0207707_10001895 | 3300025912 | Bacteria | 19046 |
| 576 | Ga0207707_10029807 | 3300025912 | Bacteria | 4773 |
| 577 | Ga0207707_10049374 | 3300025912 | Bacteria | 3666 |
| 578 | Ga0207707_10224954 | 3300025912 | Bacteria | 1633 |
| 579 | Ga0207695_10000010 | 3300025913 | Bacteria | 981919 |
| 580 | Ga0207695_10000522 | 3300025913 | Bacteria | 81461 |
| 581 | Ga0207695_10000582 | 3300025913 | Bacteria | 74405 |
| 582 | Ga0207695_10000909 | 3300025913 | Bacteria | 53303 |
| 583 | Ga0207695_10004571 | 3300025913 | Bacteria | 18809 |
| 584 | Ga0207695_10019969 | 3300025913 | Bacteria | 7691 |
| 585 | Ga0207695_10026064 | 3300025913 | Bacteria | 6531 |
| 586 | Ga0207695_10041821 | 3300025913 | Bacteria | 4902 |
| 587 | Ga0207695_10047074 | 3300025913 | Unclassified | 4567 |
| 588 | Ga0207695_10080942 | 3300025913 | Bacteria | 3288 |
| 589 | Ga0207695_10085668 | 3300025913 | Bacteria | 3179 |
| 590 | Ga0207695_10257571 | 3300025913 | Bacteria | 1643 |
| 591 | Ga0207671_10001101 | 3300025914 | Bacteria | 32578 |
| 592 | Ga0207671_10002074 | 3300025914 | Bacteria | 21929 |
| 593 | Ga0207671_10005577 | 3300025914 | Bacteria | 11557 |
| 594 | Ga0207671_10006522 | 3300025914 | Bacteria | 10370 |
| 595 | Ga0207671_10009392 | 3300025914 | Bacteria | 8176 |
| 596 | Ga0207671_10012533 | 3300025914 | Bacteria | 6809 |
| 597 | Ga0207671_10162476 | 3300025914 | Bacteria | 1730 |
| 598 | Ga0207660_10003317 | 3300025917 | Bacteria | 10515 |
| 599 | Ga0207660_10017526 | 3300025917 | Bacteria | 4759 |
| 600 | Ga0207660_10083138 | 3300025917 | Bacteria | 2357 |
| 601 | Ga0207660_10105494 | 3300025917 | Bacteria | 2112 |
| 602 | Ga0207660_10106529 | 3300025917 | Bacteria | 2102 |
| 603 | Ga0207660_10293697 | 3300025917 | Bacteria | 1293 |
| 604 | Ga0207662_10032572 | 3300025918 | Bacteria | 3035 |
| 605 | Ga0207662_10047087 | 3300025918 | Bacteria | 2553 |
| 606 | Ga0207662_10048639 | 3300025918 | Bacteria | 2513 |
| 607 | Ga0207657_10000872 | 3300025919 | Bacteria | 31816 |
| 608 | Ga0207657_10008178 | 3300025919 | Bacteria | 10655 |
| 609 | Ga0207657_10033182 | 3300025919 | Bacteria | 4656 |
| 610 | Ga0207657_10035578 | 3300025919 | Bacteria | 4464 |
| 611 | Ga0207657_10231445 | 3300025919 | Bacteria | 1478 |
| 612 | Ga0207649_10002669 | 3300025920 | Bacteria | 9894 |
| 613 | Ga0207649_10007975 | 3300025920 | Bacteria | 5762 |
| 614 | Ga0207649_10075138 | 3300025920 | Bacteria | 2171 |
| 615 | Ga0207652_10000103 | 3300025921 | Bacteria | 91988 |
| 616 | Ga0207652_10000770 | 3300025921 | Bacteria | 30686 |
| 617 | Ga0207652_10001340 | 3300025921 | Bacteria | 21892 |
| 618 | Ga0207652_10078746 | 3300025921 | Bacteria | 2878 |
| 619 | Ga0207646_10188271 | 3300025922 | Bacteria | 1864 |
| 620 | Ga0207681_10041081 | 3300025923 | Bacteria | 3081 |
| 621 | Ga0207681_10080269 | 3300025923 | Bacteria | 2301 |
| 622 | Ga0207681_10132312 | 3300025923 | Bacteria | 1846 |
| 623 | Ga0207681_10167267 | 3300025923 | Bacteria | 1663 |
| 624 | Ga0207681_10288697 | 3300025923 | Bacteria | 1294 |
| 625 | Ga0207694_10085236 | 3300025924 | Bacteria | 2486 |
| 626 | Ga0207650_10000730 | 3300025925 | Bacteria | 25353 |
| 627 | Ga0207650_10096598 | 3300025925 | Bacteria | 2267 |
| 628 | Ga0207650_10185231 | 3300025925 | Bacteria | 1661 |
| 629 | Ga0207650_10245322 | 3300025925 | Bacteria | 1448 |
| 630 | Ga0207650_10258033 | 3300025925 | Bacteria | 1413 |
| 631 | Ga0207650_10314606 | 3300025925 | Bacteria | 1281 |
| 632 | Ga0207659_10021036 | 3300025926 | Bacteria | 4324 |
| 633 | Ga0207659_10058767 | 3300025926 | Bacteria | 2761 |
| 634 | Ga0207659_10077548 | 3300025926 | Bacteria | 2446 |
| 635 | Ga0207644_10019394 | 3300025931 | Bacteria | 4613 |
| 636 | Ga0207644_10092644 | 3300025931 | Bacteria | 2255 |
| 637 | Ga0207644_10161378 | 3300025931 | Bacteria | 1743 |
| 638 | Ga0207690_10007408 | 3300025932 | Bacteria | 6515 |
| 639 | Ga0207690_10014109 | 3300025932 | Bacteria | 4818 |
| 640 | Ga0207690_10031976 | 3300025932 | Unclassified | 3373 |
| 641 | Ga0207690_10044761 | 3300025932 | Bacteria | 2919 |
| 642 | Ga0207690_10076074 | 3300025932 | Bacteria | 2330 |
| 643 | Ga0207706_10005563 | 3300025933 | Bacteria | 11747 |
| 644 | Ga0207706_10007108 | 3300025933 | Bacteria | 10357 |
| 645 | Ga0207706_10017416 | 3300025933 | Bacteria | 6471 |
| 646 | Ga0207706_10030771 | 3300025933 | Bacteria | 4787 |
| 647 | Ga0207706_10069729 | 3300025933 | Bacteria | 3092 |
| 648 | Ga0207706_10128765 | 3300025933 | Bacteria | 2226 |
| 649 | Ga0207706_10288164 | 3300025933 | Bacteria | 1431 |
| 650 | Ga0207686_10000977 | 3300025934 | Bacteria | 17010 |
| 651 | Ga0207686_10065257 | 3300025934 | Bacteria | 2321 |
| 652 | Ga0207709_10131584 | 3300025935 | Bacteria | 1706 |
| 653 | Ga0207670_10007047 | 3300025936 | Bacteria | 6260 |
| 654 | Ga0207704_10047464 | 3300025938 | Bacteria | 2567 |
| 655 | Ga0207691_10002498 | 3300025940 | Bacteria | 17985 |
| 656 | Ga0207691_10004429 | 3300025940 | Bacteria | 13610 |
| 657 | Ga0207691_10035730 | 3300025940 | Bacteria | 4609 |
| 658 | Ga0207691_10044522 | 3300025940 | Bacteria | 4085 |
| 659 | Ga0207691_10045725 | 3300025940 | Bacteria | 4024 |
| 660 | Ga0207689_10001011 | 3300025942 | Bacteria | 27034 |
| 661 | Ga0207689_10007312 | 3300025942 | Bacteria | 9693 |
| 662 | Ga0207689_10026457 | 3300025942 | Bacteria | 4858 |
| 663 | Ga0207689_10026582 | 3300025942 | Bacteria | 4848 |
| 664 | Ga0207689_10041325 | 3300025942 | Bacteria | 3815 |
| 665 | Ga0207689_10050585 | 3300025942 | Bacteria | 3426 |
| 666 | Ga0207689_10054156 | 3300025942 | Bacteria | 3304 |
| 667 | Ga0207689_10074089 | 3300025942 | Bacteria | 2797 |
| 668 | Ga0207689_10085798 | 3300025942 | Bacteria | 2588 |
| 669 | Ga0207661_10022692 | 3300025944 | Bacteria | 4731 |
| 670 | Ga0207661_10092258 | 3300025944 | Bacteria | 2524 |
| 671 | Ga0207661_10110271 | 3300025944 | Bacteria | 2326 |
| 672 | Ga0207661_10153835 | 3300025944 | Bacteria | 1990 |
| 673 | Ga0207661_10332385 | 3300025944 | Bacteria | 1368 |
| 674 | Ga0207679_10003411 | 3300025945 | Bacteria | 9805 |
| 675 | Ga0207679_10008941 | 3300025945 | Bacteria | 6397 |
| 676 | Ga0207679_10029132 | 3300025945 | Bacteria | 3841 |
| 677 | Ga0207679_10049474 | 3300025945 | Bacteria | 3067 |
| 678 | Ga0207679_10089749 | 3300025945 | Bacteria | 2374 |
| 679 | Ga0207679_10171797 | 3300025945 | Bacteria | 1785 |
| 680 | Ga0207667_10000749 | 3300025949 | Bacteria | 42187 |
| 681 | Ga0207667_10004188 | 3300025949 | Bacteria | 17720 |
| 682 | Ga0207667_10009732 | 3300025949 | Bacteria | 11302 |
| 683 | Ga0207667_10013273 | 3300025949 | Bacteria | 9438 |
| 684 | Ga0207667_10029606 | 3300025949 | Bacteria | 5937 |
| 685 | Ga0207667_10034865 | 3300025949 | Bacteria | 5401 |
| 686 | Ga0207667_10040176 | 3300025949 | Bacteria | 4982 |
| 687 | Ga0207667_10044837 | 3300025949 | Bacteria | 4685 |
| 688 | Ga0207667_10058520 | 3300025949 | Bacteria | 4041 |
| 689 | Ga0207667_10122348 | 3300025949 | Bacteria | 2681 |
| 690 | Ga0207667_10261929 | 3300025949 | Bacteria | 1768 |
| 691 | Ga0207651_10002063 | 3300025960 | Bacteria | 9463 |
| 692 | Ga0207651_10002518 | 3300025960 | Bacteria | 8747 |
| 693 | Ga0207651_10003386 | 3300025960 | Bacteria | 7828 |
| 694 | Ga0207651_10021766 | 3300025960 | Bacteria | 3904 |
| 695 | Ga0207651_10124628 | 3300025960 | Bacteria | 1961 |
| 696 | Ga0207712_10000844 | 3300025961 | Bacteria | 22396 |
| 697 | Ga0207712_10001111 | 3300025961 | Bacteria | 18799 |
| 698 | Ga0207712_10003901 | 3300025961 | Bacteria | 9419 |
| 699 | Ga0207712_10004398 | 3300025961 | Bacteria | 8905 |
| 700 | Ga0207712_10004528 | 3300025961 | Bacteria | 8776 |
| 701 | Ga0207712_10038033 | 3300025961 | Bacteria | 3288 |
| 702 | Ga0207712_10071705 | 3300025961 | Bacteria | 2492 |
| 703 | Ga0207712_10213910 | 3300025961 | Bacteria | 1537 |
| 704 | Ga0207668_10014070 | 3300025972 | Bacteria | 4947 |
| 705 | Ga0207668_10032875 | 3300025972 | Bacteria | 3433 |
| 706 | Ga0207668_10095068 | 3300025972 | Bacteria | 2199 |
| 707 | Ga0207668_10117617 | 3300025972 | Bacteria | 2006 |
| 708 | Ga0207668_10118665 | 3300025972 | Bacteria | 1999 |
| 709 | Ga0207668_10155070 | 3300025972 | Bacteria | 1778 |
| 710 | Ga0207640_10017137 | 3300025981 | Bacteria | 4232 |
| 711 | Ga0207640_10037196 | 3300025981 | Bacteria | 3061 |
| 712 | Ga0207640_10037747 | 3300025981 | Bacteria | 3042 |
| 713 | Ga0207640_10197565 | 3300025981 | Bacteria | 1521 |
| 714 | Ga0207658_10009068 | 3300025986 | Bacteria | 6747 |
| 715 | Ga0207658_10017648 | 3300025986 | Bacteria | 4921 |
| 716 | Ga0207658_10101184 | 3300025986 | Bacteria | 2258 |
| 717 | Ga0207658_10134760 | 3300025986 | Bacteria | 1989 |
| 718 | Ga0207677_10008822 | 3300026023 | Bacteria | 5649 |
| 719 | Ga0207677_10009528 | 3300026023 | Bacteria | 5467 |
| 720 | Ga0207677_10017362 | 3300026023 | Bacteria | 4288 |
| 721 | Ga0207703_10005370 | 3300026035 | Bacteria | 10322 |
| 722 | Ga0207703_10097591 | 3300026035 | Bacteria | 2483 |
| 723 | Ga0207703_10400405 | 3300026035 | Bacteria | 1273 |
| 724 | Ga0207639_10001239 | 3300026041 | Bacteria | 17289 |
| 725 | Ga0207639_10001990 | 3300026041 | Bacteria | 13754 |
| 726 | Ga0207639_10013623 | 3300026041 | Bacteria | 5699 |
| 727 | Ga0207639_10022693 | 3300026041 | Bacteria | 4523 |
| 728 | Ga0207639_10076698 | 3300026041 | Bacteria | 2633 |
| 729 | Ga0207639_10084413 | 3300026041 | Bacteria | 2523 |
| 730 | Ga0207639_10101243 | 3300026041 | Bacteria | 2329 |
| 731 | Ga0207639_10108170 | 3300026041 | Bacteria | 2260 |
| 732 | Ga0207639_10127993 | 3300026041 | Bacteria | 2098 |
| 733 | Ga0207639_10128966 | 3300026041 | Bacteria | 2091 |
| 734 | Ga0207639_10130822 | 3300026041 | Bacteria | 2077 |
| 735 | Ga0207639_10368665 | 3300026041 | Bacteria | 1287 |
| 736 | Ga0207678_10064056 | 3300026067 | Bacteria | 3159 |
| 737 | Ga0207708_10017910 | 3300026075 | Bacteria | 5331 |
| 738 | Ga0207708_10046170 | 3300026075 | Bacteria | 3318 |
| 739 | Ga0207708_10112291 | 3300026075 | Bacteria | 2117 |
| 740 | Ga0207708_10188824 | 3300026075 | Bacteria | 1639 |
| 741 | Ga0207702_10045451 | 3300026078 | Bacteria | 3693 |
| 742 | Ga0207702_10207274 | 3300026078 | Bacteria | 1821 |
| 743 | Ga0207702_10267540 | 3300026078 | Bacteria | 1611 |
| 744 | Ga0207702_10346130 | 3300026078 | Bacteria | 1421 |
| 745 | Ga0207641_10000318 | 3300026088 | Bacteria | 59432 |
| 746 | Ga0207641_10000442 | 3300026088 | Bacteria | 47467 |
| 747 | Ga0207641_10020809 | 3300026088 | Bacteria | 5392 |
| 748 | Ga0207641_10406957 | 3300026088 | Bacteria | 1307 |
| 749 | Ga0207648_10000914 | 3300026089 | Bacteria | 33242 |
| 750 | Ga0207648_10005357 | 3300026089 | Bacteria | 12934 |
| 751 | Ga0207648_10021151 | 3300026089 | Bacteria | 5850 |
| 752 | Ga0207648_10033840 | 3300026089 | Bacteria | 4506 |
| 753 | Ga0207648_10041409 | 3300026089 | Bacteria | 4045 |
| 754 | Ga0207648_10054623 | 3300026089 | Bacteria | 3488 |
| 755 | Ga0207648_10213911 | 3300026089 | Bacteria | 1712 |
| 756 | Ga0207648_10261965 | 3300026089 | Bacteria | 1543 |
| 757 | Ga0207676_10008995 | 3300026095 | Bacteria | 7106 |
| 758 | Ga0207676_10026560 | 3300026095 | Bacteria | 4307 |
| 759 | Ga0207676_10036287 | 3300026095 | Bacteria | 3749 |
| 760 | Ga0207676_10119761 | 3300026095 | Bacteria | 2217 |
| 761 | Ga0207676_10163283 | 3300026095 | Bacteria | 1932 |
| 762 | Ga0207676_10174654 | 3300026095 | Bacteria | 1875 |
| 763 | Ga0207676_10181945 | 3300026095 | Bacteria | 1841 |
| 764 | Ga0207676_10231403 | 3300026095 | Bacteria | 1652 |
| 765 | Ga0207676_10274671 | 3300026095 | Bacteria | 1528 |
| 766 | Ga0207674_10008317 | 3300026116 | Bacteria | 12006 |
| 767 | Ga0207674_10010951 | 3300026116 | Bacteria | 10207 |
| 768 | Ga0207674_10014298 | 3300026116 | Bacteria | 8771 |
| 769 | Ga0207674_10022907 | 3300026116 | Bacteria | 6701 |
| 770 | Ga0207674_10062630 | 3300026116 | Bacteria | 3757 |
| 771 | Ga0207674_10093400 | 3300026116 | Bacteria | 2997 |
| 772 | Ga0207674_10101514 | 3300026116 | Bacteria | 2857 |
| 773 | Ga0207674_10139816 | 3300026116 | Bacteria | 2381 |
| 774 | Ga0207674_10162543 | 3300026116 | Bacteria | 2187 |
| 775 | Ga0207674_10213604 | 3300026116 | Bacteria | 1878 |
| 776 | Ga0207674_10273845 | 3300026116 | Bacteria | 1636 |
| 777 | Ga0207674_10339280 | 3300026116 | Bacteria | 1453 |
| 778 | Ga0207675_100001072 | 3300026118 | Bacteria | 27156 |
| 779 | Ga0207675_100004328 | 3300026118 | Bacteria | 13719 |
| 780 | Ga0207675_100049740 | 3300026118 | Bacteria | 3911 |
| 781 | Ga0207675_100081262 | 3300026118 | Bacteria | 3038 |
| 782 | Ga0207675_100184220 | 3300026118 | Bacteria | 2001 |
| 783 | Ga0207683_10005618 | 3300026121 | Bacteria | 10757 |
| 784 | Ga0207683_10037479 | 3300026121 | Bacteria | 4222 |
| 785 | Ga0207683_10076934 | 3300026121 | Bacteria | 2955 |
| 786 | Ga0207683_10096373 | 3300026121 | Bacteria | 2638 |
| 787 | Ga0207683_10298054 | 3300026121 | Bacteria | 1475 |
| 788 | Ga0207683_10484752 | 3300026121 | Bacteria | 1141 |
| 789 | Ga0207698_10007833 | 3300026142 | Bacteria | 6718 |
| 790 | Ga0207698_10007926 | 3300026142 | Bacteria | 6691 |
| 791 | Ga0207698_10016215 | 3300026142 | Bacteria | 5015 |
| 792 | Ga0207698_10036469 | 3300026142 | Bacteria | 3610 |
| 793 | Ga0207698_10054047 | 3300026142 | Bacteria | 3087 |
| 794 | Ga0207698_10520811 | 3300026142 | Bacteria | 1160 |
| 795 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 796 | Ga0268266_10104009 | 3300028379 | Bacteria | 2507 |
| 797 | Ga0268266_10113177 | 3300028379 | Bacteria | 2406 |
| 798 | Ga0268266_10178797 | 3300028379 | Bacteria | 1930 |
| 799 | Ga0268266_10260800 | 3300028379 | Bacteria | 1606 |
| 800 | Ga0268265_10500099 | 3300028380 | Bacteria | 1145 |
| 801 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 802 | Ga0268264_10000558 | 3300028381 | Bacteria | 45913 |
| 803 | Ga0268264_10001559 | 3300028381 | Bacteria | 21251 |
| 804 | Ga0268264_10026939 | 3300028381 | Bacteria | 4695 |
| 805 | Ga0268264_10053315 | 3300028381 | Bacteria | 3373 |
| 806 | Ga0268264_10061177 | 3300028381 | Bacteria | 3158 |
| 807 | Ga0268264_10068487 | 3300028381 | Bacteria | 2999 |
| 808 | Ga0268264_10242039 | 3300028381 | Bacteria | 1672 |
| 809 | Ga0268264_10260226 | 3300028381 | Bacteria | 1616 |
| 810 | Ga0268264_10403553 | 3300028381 | Bacteria | 1314 |
| 811 | Ga0265318_10027150 | 3300028577 | Bacteria | 2252 |
| 812 | Ga0265318_10030026 | 3300028577 | Bacteria | 2116 |
| 813 | Ga0307517_10000268 | 3300028786 | Bacteria | 89531 |
| 814 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 815 | Ga0307515_10001257 | 3300028794 | Bacteria | 57814 |
| 816 | Ga0307511_10000076 | 3300030521 | Bacteria | 82520 |
| 817 | Ga0265328_10056907 | 3300031239 | Bacteria | 1435 |
| 818 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 819 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 820 | Ga0265327_10000254 | 3300031251 | Bacteria | 106076 |
| 821 | Ga0265327_10001369 | 3300031251 | Bacteria | 31355 |
| 822 | Ga0265327_10024663 | 3300031251 | Bacteria | 3525 |
| 823 | Ga0265327_10031924 | 3300031251 | Bacteria | 2954 |
| 824 | Ga0265327_10036749 | 3300031251 | Bacteria | 2689 |
| 825 | Ga0265327_10048013 | 3300031251 | Bacteria | 2248 |
| 826 | Ga0265316_10171884 | 3300031344 | Bacteria | 1616 |
| 827 | Ga0307509_10062975 | 3300031507 | Bacteria | 3908 |
| 828 | Ga0307408_100395488 | 3300031548 | Bacteria | 1185 |
| 829 | Ga0265313_10030232 | 3300031595 | Bacteria | 2791 |
| 830 | Ga0307508_10125800 | 3300031616 | Bacteria | 2166 |
| 831 | Ga0265314_10054650 | 3300031711 | Bacteria | 2762 |
| 832 | Ga0307516_10001840 | 3300031730 | Bacteria | 29117 |
| 833 | Ga0307516_10140235 | 3300031730 | Bacteria | 2188 |
| 834 | Ga0307405_10053369 | 3300031731 | Bacteria | 2518 |
| 835 | Ga0307406_10043066 | 3300031901 | Bacteria | 2822 |
| 836 | Ga0307407_10045860 | 3300031903 | Bacteria | 2473 |
| 837 | Ga0307412_10030722 | 3300031911 | Bacteria | 3386 |
| 838 | Ga0307416_100061289 | 3300032002 | Bacteria | 3069 |
| 839 | Ga0307414_10140502 | 3300032004 | Bacteria | 1890 |
| 840 | Ga0307414_10167145 | 3300032004 | Bacteria | 1754 |
| 841 | Ga0307415_100022671 | 3300032126 | Bacteria | 3880 |
| 842 | Ga0307507_10161541 | 3300033179 | Bacteria | 1654 |
| 843 | Ga0307510_10000949 | 3300033180 | Bacteria | 30604 |
| 844 | Ga0373934_0018361 | 3300035086 | Bacteria | 2675 |
| 845 | Ga0373956_0062079 | 3300035119 | Bacteria | 1693 |
| 846 | Ga0373924_0074377 | 3300035410 | Bacteria | 1437 |
| 847 | Ga0373927_0128756 | 3300035695 | Bacteria | 1653 |
| 848 | Ga0373933_0191245 | 3300035724 | Bacteria | 1307 |
| 849 | Ga0373937_0042272 | 3300036401 | Bacteria | 4157 |
| 850 | Ga0373937_0101119 | 3300036401 | Bacteria | 2676 |
| 851 | Ga0395899_0000633 | 3300037312 | Bacteria | 36434 |
| 852 | Ga0395899_0006160 | 3300037312 | Bacteria | 9299 |
| 853 | Ga0395899_0011662 | 3300037312 | Bacteria | 6727 |
| 854 | Ga0395899_0119348 | 3300037312 | Bacteria | 1890 |
| 855 | Ga0395900_0002599 | 3300037418 | Bacteria | 19736 |
| 856 | Ga0395900_0005571 | 3300037418 | Bacteria | 13183 |
| 857 | Ga0395900_0079178 | 3300037418 | Bacteria | 3377 |
| 858 | Ga0395898_0002191 | 3300037466 | Bacteria | 23865 |
| 859 | Ga0395898_0053988 | 3300037466 | Bacteria | 3922 |
| 860 | Ga0395898_0403509 | 3300037466 | Bacteria | 1303 |
| 861 | Ga0395905_0000565 | 3300037471 | Bacteria | 50339 |
| 862 | Ga0395905_0179605 | 3300037471 | Bacteria | 1987 |
| 863 | Ga0395901_0005927 | 3300038443 | Bacteria | 12377 |
| 864 | Ga0395901_0077409 | 3300038443 | Bacteria | 3471 |
| 865 | Ga0395901_0086677 | 3300038443 | Bacteria | 3274 |
| 866 | Ga0395901_0101537 | 3300038443 | Bacteria | 3018 |
| 867 | Ga0436365_0257946 | 3300039437 | Bacteria | 2064 |
| 868 | Ga0436365_0473715 | 3300039437 | Bacteria | 54513 |
| 869 | Ga0436365_0987978 | 3300039437 | Bacteria | 58639 |
| 870 | Ga0436365_1175459 | 3300039437 | Bacteria | 1819 |
| 871 | Ga0439465_0037911 | 3300041413 | Bacteria | 1551 |
| 872 | Ga0439449_0031369 | 3300042007 | Bacteria | 1981 |
| 873 | Ga0439434_0021853 | 3300042435 | Bacteria | 1923 |
| 874 | Ga0439434_0024322 | 3300042435 | Bacteria | 1827 |
| 875 | Ga0451577_0063583 | 3300042876 | Bacteria | 3291 |
| 876 | Ga0451577_0065168 | 3300042876 | Bacteria | 3249 |
| 877 | Ga0466969_0000759 | 3300044656 | Bacteria | 17514 |
| 878 | Ga0466972_0000049 | 3300044658 | Bacteria | 118829 |
| 879 | Ga0466972_0000057 | 3300044658 | Bacteria | 110775 |
| 880 | Ga0466972_0006768 | 3300044658 | Bacteria | 5752 |
| 881 | Ga0466972_0009713 | 3300044658 | Bacteria | 4828 |
| 882 | Ga0466972_0010760 | 3300044658 | Bacteria | 4591 |
| 883 | Ga0466966_0002403 | 3300044684 | Bacteria | 12222 |
| 884 | Ga0466966_0114160 | 3300044684 | Bacteria | 1663 |
| 885 | Ga0466961_0010845 | 3300044693 | Bacteria | 5820 |
| 886 | Ga0466964_0018070 | 3300044706 | Bacteria | 2703 |
| 887 | Ga0453684_0068430 | 3300044712 | Bacteria | 4509 |
| 888 | Ga0453684_0071839 | 3300044712 | Bacteria | 4372 |
| 889 | Ga0453684_0091310 | 3300044712 | Bacteria | 3759 |
| 890 | Ga0453684_0571710 | 3300044712 | Bacteria | 1242 |
| 891 | Ga0466968_0055137 | 3300044735 | Bacteria | 1705 |
| 892 | Ga0466970_0000356 | 3300044765 | Bacteria | 22182 |
| 893 | Ga0466957_0000101 | 3300044842 | Bacteria | 34646 |
| 894 | Ga0466957_0000901 | 3300044842 | Bacteria | 15238 |
| 895 | Ga0466957_0247351 | 3300044842 | Bacteria | 1185 |
| 896 | Ga0466960_0158445 | 3300044901 | Bacteria | 1214 |
| 897 | Ga0466959_0000466 | 3300045049 | Bacteria | 23615 |
| 898 | Ga0466959_0022965 | 3300045049 | Bacteria | 4612 |
| 899 | Ga0466959_0115651 | 3300045049 | Bacteria | 1911 |
| 900 | Ga0466958_0075152 | 3300045836 | Bacteria | 2072 |
| 901 | Ga0495629_0313205 | 3300046459 | Bacteria | 1073 |
| 902 | Ga0495638_0014384 | 3300046460 | Bacteria | 5351 |
| 903 | Ga0495638_0087578 | 3300046460 | Bacteria | 1881 |
| 904 | Ga0495650_0011424 | 3300046471 | Bacteria | 4864 |
| 905 | Ga0495606_0001358 | 3300046507 | Bacteria | 33214 |
| 906 | Ga0495608_0078413 | 3300046511 | Bacteria | 2149 |
| 907 | Ga0495618_0127766 | 3300046514 | Bacteria | 1627 |
| 908 | Ga0495628_0045482 | 3300046516 | Bacteria | 3490 |
| 909 | Ga0495630_0015688 | 3300046517 | Bacteria | 5536 |
| 910 | Ga0495643_0013509 | 3300046522 | Bacteria | 4883 |
| 911 | Ga0495648_0008986 | 3300046524 | Bacteria | 7802 |
| 912 | Ga0495665_0075053 | 3300046531 | Bacteria | 1780 |
| 913 | Ga0495640_0151288 | 3300046533 | Bacteria | 1491 |
| 914 | Ga0495621_0016625 | 3300046539 | Bacteria | 2364 |
| 915 | Ga0495633_0000089 | 3300046558 | Bacteria | 123616 |
| 916 | Ga0495668_0000023 | 3300046616 | Bacteria | 363848 |
| 917 | Ga0495668_0083565 | 3300046616 | Bacteria | 1751 |
| 918 | Ga0495634_0188854 | 3300046642 | Bacteria | 1286 |
| 919 | Ga0495611_0000813 | 3300046648 | Bacteria | 17326 |
| 920 | Ga0495646_0056812 | 3300046680 | Bacteria | 2345 |
| 921 | Ga0495658_0009564 | 3300046683 | Bacteria | 4834 |
| 922 | Ga0495649_0103483 | 3300046694 | Bacteria | 1512 |
| 923 | Ga0495600_0219351 | 3300046809 | Bacteria | 1217 |
| 924 | Ga0495604_0048861 | 3300047317 | Bacteria | 3290 |
| 925 | Ga0495674_0097513 | 3300047319 | Bacteria | 2504 |
| 926 | Ga0495674_0243048 | 3300047319 | Bacteria | 1483 |
| 927 | Ga0495672_0005750 | 3300047320 | Bacteria | 9766 |
| 928 | Ga0495680_0052668 | 3300047322 | Bacteria | 3172 |
| 929 | Ga0495687_000429 | 3300047443 | Bacteria | 51940 |
| 930 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 931 | Ga0495686_0007391 | 3300047472 | Bacteria | 8242 |
| 932 | Ga0495602_0196201 | 3300048088 | Bacteria | 1544 |
| 933 | Ga0496102_0276044 | 3300048905 | Bacteria | 1584 |
| 934 | Ga0496104_0378445 | 3300048907 | Bacteria | 1328 |
| 935 | Ga0496114_0000295 | 3300048917 | Bacteria | 36585 |
| 936 | Ga0496115_0490730 | 3300048918 | Bacteria | 988 |
| 937 | Ga0496121_0000086 | 3300048924 | Bacteria | 223703 |
| 938 | Ga0501032_0016997 | 3300049569 | Bacteria | 5112 |
| 939 | Ga0501032_0058001 | 3300049569 | Bacteria | 2600 |
| 940 | Ga0501033_0029345 | 3300049570 | Bacteria | 4134 |
| 941 | Ga0501033_0163269 | 3300049570 | Bacteria | 1603 |
| 942 | Ga0501034_0000152 | 3300049571 | Bacteria | 130576 |
| 943 | Ga0501034_0003293 | 3300049571 | Bacteria | 18452 |
| 944 | Ga0501034_0006045 | 3300049571 | Bacteria | 13078 |
| 945 | Ga0501034_0014518 | 3300049571 | Bacteria | 8110 |
| 946 | Ga0501034_0014902 | 3300049571 | Bacteria | 7994 |
| 947 | Ga0501034_0045748 | 3300049571 | Bacteria | 4421 |
| 948 | Ga0501034_0434242 | 3300049571 | Bacteria | 1232 |
| 949 | Ga0501036_0055414 | 3300049572 | Bacteria | 3358 |
| 950 | Ga0501036_0173546 | 3300049572 | Bacteria | 1816 |
| 951 | Ga0501036_0285736 | 3300049572 | Bacteria | 1380 |
| 952 | Ga0501037_0006685 | 3300049573 | Bacteria | 8433 |
| 953 | Ga0501037_0032282 | 3300049573 | Bacteria | 3867 |
| 954 | Ga0501037_0176095 | 3300049573 | Bacteria | 1519 |
| 955 | Ga0501037_0190506 | 3300049573 | Bacteria | 1452 |
| 956 | Ga0501037_0248040 | 3300049573 | Bacteria | 1246 |
| 957 | Ga0501038_0007716 | 3300049574 | Bacteria | 9921 |
| 958 | Ga0501038_0246977 | 3300049574 | Bacteria | 1415 |
| 959 | Ga0501038_0333282 | 3300049574 | Bacteria | 1185 |
| 960 | Ga0501039_0009882 | 3300049575 | Bacteria | 7277 |
| 961 | Ga0501039_0181712 | 3300049575 | Bacteria | 1654 |
| 962 | Ga0501043_0010435 | 3300049579 | Bacteria | 7276 |
| 963 | Ga0501043_0073170 | 3300049579 | Bacteria | 2692 |
| 964 | Ga0501043_0137555 | 3300049579 | Bacteria | 1913 |
| 965 | Ga0501043_0172601 | 3300049579 | Bacteria | 1686 |
| 966 | Ga0501046_0032568 | 3300049580 | Bacteria | 4221 |
| 967 | Ga0501047_0002365 | 3300049581 | Bacteria | 18037 |
| 968 | Ga0501047_0006105 | 3300049581 | Bacteria | 11323 |
| 969 | Ga0501047_0050222 | 3300049581 | Bacteria | 4028 |
| 970 | Ga0501047_0108947 | 3300049581 | Bacteria | 2652 |
| 971 | Ga0501068_0112435 | 3300049584 | Bacteria | 1694 |
| 972 | Ga0501070_0011797 | 3300049586 | Bacteria | 7381 |
| 973 | Ga0501070_0026484 | 3300049586 | Bacteria | 4863 |
| 974 | Ga0501071_0032292 | 3300049587 | Bacteria | 3717 |
| 975 | Ga0501072_0120761 | 3300049588 | Bacteria | 2088 |
| 976 | Ga0501072_0190887 | 3300049588 | Bacteria | 1634 |
| 977 | Ga0501073_0009804 | 3300049589 | Bacteria | 7052 |
| 978 | Ga0501073_0017228 | 3300049589 | Bacteria | 5233 |
| 979 | Ga0501074_0001751 | 3300049590 | Bacteria | 14833 |
| 980 | Ga0501074_0143642 | 3300049590 | Bacteria | 1706 |
| 981 | Ga0501198_001567 | 3300049649 | Bacteria | 3007 |
| 982 | Ga0501198_001716 | 3300049649 | Bacteria | 2895 |
| 983 | Ga0501201_000708 | 3300049651 | Bacteria | 3120 |
| 984 | Ga0501202_003368 | 3300049652 | Bacteria | 2734 |
| 985 | Ga0501211_005956 | 3300049658 | Bacteria | 1213 |
| 986 | Ga0501223_000907 | 3300049663 | Bacteria | 7010 |
| 987 | Ga0501235_003174 | 3300049669 | Bacteria | 3540 |
| 988 | Ga0501235_039723 | 3300049669 | Bacteria | 1075 |
| 989 | Ga0501250_003742 | 3300049680 | Bacteria | 1476 |
| 990 | Ga0501259_000504 | 3300049688 | Bacteria | 6268 |
| 991 | Ga0501219_000280 | 3300049703 | Bacteria | 9053 |
| 992 | Ga0501221_000752 | 3300049704 | Bacteria | 5229 |
| 993 | Ga0501225_0000893 | 3300049705 | Bacteria | 9288 |
| 994 | Ga0501225_0007520 | 3300049705 | Bacteria | 3156 |
| 995 | Ga0501245_000835 | 3300049708 | Bacteria | 3882 |
| 996 | Ga0501245_000897 | 3300049708 | Bacteria | 3780 |
| 997 | Ga0501080_0010720 | 3300049742 | Bacteria | 8385 |
| 998 | Ga0501080_0299039 | 3300049742 | Bacteria | 1460 |
| 999 | Ga0501083_0025203 | 3300049744 | Bacteria | 4118 |
| 1000 | Ga0501266_003028 | 3300049763 | Bacteria | 2094 |
| 1001 | Ga0501268_019853 | 3300049765 | Bacteria | 1140 |
| 1002 | Ga0501035_0049750 | 3300049822 | Bacteria | 3756 |
| 1003 | Ga0501035_0073727 | 3300049822 | Bacteria | 3020 |
| 1004 | Ga0501035_0121969 | 3300049822 | Bacteria | 2278 |
| 1005 | Ga0501044_0015504 | 3300049823 | Bacteria | 8208 |
| 1006 | Ga0501044_0021151 | 3300049823 | Bacteria | 6946 |
| 1007 | Ga0501044_0062152 | 3300049823 | Bacteria | 3818 |
| 1008 | Ga0501044_0148840 | 3300049823 | Bacteria | 2324 |
| 1009 | Ga0501044_0149920 | 3300049823 | Bacteria | 2315 |
| 1010 | Ga0501044_0155404 | 3300049823 | Bacteria | 2267 |
| 1011 | Ga0501044_0262943 | 3300049823 | Bacteria | 1663 |
| 1012 | Ga0501044_0363016 | 3300049823 | Bacteria | 1366 |
| 1013 | Ga0501284_00002 | 3300050005 | Bacteria | 220402 |
| 1014 | nmdc:mga0k408_2621_c1 | 3300050493 | Bacteria | 9558 |
| 1015 | nmdc:mga0k408_43493_c1 | 3300050493 | Bacteria | 2588 |
| 1016 | nmdc:mga05p37_109386_c1 | 3300050507 | Bacteria | 3400 |
| 1017 | nmdc:mga05p37_4461_c1 | 3300050507 | Bacteria | 6112 |
| 1018 | nmdc:mga09592_1071_c1 | 3300050508 | Bacteria | 21759 |
| 1019 | nmdc:mga09592_147330_c1 | 3300050508 | Bacteria | 2030 |
| 1020 | nmdc:mga09592_46862_c1 | 3300050508 | Bacteria | 3642 |
| 1021 | nmdc:mga09592_68842_c1 | 3300050508 | Bacteria | 3002 |
| 1022 | nmdc:mga0qj67_191942_c1 | 3300050509 | Bacteria | 1660 |
| 1023 | nmdc:mga0qj67_27772_c1 | 3300050509 | Bacteria | 4388 |
| 1024 | nmdc:mga06r32_1494_c1 | 3300050510 | Bacteria | 21025 |
| 1025 | nmdc:mga06r32_204983_c1 | 3300050510 | Bacteria | 1960 |
| 1026 | nmdc:mga08y16_11872_c1 | 3300050511 | Bacteria | 9150 |
| 1027 | nmdc:mga0n895_78750_c1 | 3300050512 | Bacteria | 3280 |
| 1028 | Ga0500578_0000605 | 3300053086 | Bacteria | 43458 |
| 1029 | Ga0500578_0008201 | 3300053086 | Bacteria | 6839 |
| 1030 | Ga0500644_0000042 | 3300053088 | Bacteria | 76909 |
| 1031 | Ga0500646_0001572 | 3300053090 | Bacteria | 6019 |
| 1032 | Ga0500646_0003741 | 3300053090 | Bacteria | 3894 |
| 1033 | Ga0500583_0000055 | 3300053092 | Bacteria | 72367 |
| 1034 | Ga0500583_0002404 | 3300053092 | Bacteria | 5617 |
| 1035 | Ga0500650_0036289 | 3300053098 | Bacteria | 2262 |
| 1036 | Ga0500569_000050 | 3300053109 | Bacteria | 21837 |
| 1037 | Ga0500642_0002824 | 3300053130 | Bacteria | 5158 |
| 1038 | Ga0500652_073854 | 3300053131 | Bacteria | 1415 |
| 1039 | Ga0500658_0001859 | 3300053134 | Bacteria | 8299 |
| 1040 | Ga0500559_0021210 | 3300053136 | Bacteria | 2752 |
| 1041 | Ga0500568_0000080 | 3300053139 | Bacteria | 92694 |
| 1042 | Ga0500568_0061222 | 3300053139 | Bacteria | 1456 |
| 1043 | Ga0500573_0016436 | 3300053140 | Bacteria | 4201 |
| 1044 | Ga0500577_0001039 | 3300053142 | Bacteria | 7156 |
| 1045 | Ga0500588_0007798 | 3300053146 | Bacteria | 2480 |
| 1046 | Ga0500616_0006507 | 3300053153 | Bacteria | 7644 |
| 1047 | Ga0500616_0018027 | 3300053153 | Bacteria | 3995 |
| 1048 | Ga0500622_0000999 | 3300053156 | Bacteria | 23857 |
| 1049 | Ga0500622_0012218 | 3300053156 | Bacteria | 4657 |
| 1050 | Ga0500622_0017747 | 3300053156 | Bacteria | 3786 |
| 1051 | Ga0500633_0000103 | 3300053160 | Bacteria | 11537 |
| 1052 | Ga0500639_030150 | 3300053163 | Bacteria | 2866 |
| 1053 | Ga0500636_0016905 | 3300053177 | Bacteria | 4302 |
| 1054 | Ga0500636_0025813 | 3300053177 | Bacteria | 3473 |
| 1055 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 1056 | Ga0500611_002700 | 3300053727 | Bacteria | 2165 |
| 1057 | Ga0501084_0023012 | 3300054114 | Bacteria | 5201 |
| 1058 | Ga0501082_0059802 | 3300060353 | Bacteria | 3283 |
| 1059 | Ga0466962_0059902 | 3300061719 | Bacteria | 1817 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026116 | Ga0207674_10273845 | Ga0207674_102738452 | 290 |
| 2 | 3300003323 | rootH1_10063717 | rootH1_100637173 | 303 |
| 3 | 3300004625 | Ga0055543_1004611 | Ga0055543_10046113 | 303 |
| 4 | 3300005563 | Ga0068855_100017559 | Ga0068855_1000175593 | 303 |
| 5 | 3300013296 | Ga0157374_10284572 | Ga0157374_102845722 | 303 |
| 6 | 3300048918 | Ga0496115_0490730 | Ga0496115_0490730_34_951 | 303 |
| 7 | 3300049823 | Ga0501044_0262943 | Ga0501044_0262943_43_960 | 303 |
| 8 | 3300061719 | Ga0466962_0059902 | Ga0466962_0059902_17_943 | 307 |
| 9 | 3300003316 | rootH1_10090487 | rootH1_100904871 | 323 |
| 10 | 3300026121 | Ga0207683_10096373 | Ga0207683_100963733 | 323 |
| 11 | 3300013307 | Ga0157372_10099881 | Ga0157372_100998814 | 324 |
| 12 | 3300046522 | Ga0495643_0013509 | Ga0495643_0013509_2041_3039 | 331 |
| 13 | 3300025961 | Ga0207712_10071705 | Ga0207712_100717052 | 332 |
| 14 | 3300005365 | Ga0070688_100034246 | Ga0070688_1000342464 | 333 |
| 15 | 3300005445 | Ga0070708_100134901 | Ga0070708_1001349012 | 333 |
| 16 | 3300009174 | Ga0105241_10279516 | Ga0105241_102795162 | 333 |
| 17 | 3300049571 | Ga0501034_0003293 | Ga0501034_0003293_14939_15976 | 333 |
| 18 | 3300005334 | Ga0068869_100103186 | Ga0068869_1001031862 | 335 |
| 19 | 3300005340 | Ga0070689_100165021 | Ga0070689_1001650212 | 335 |
| 20 | 3300025942 | Ga0207689_10074089 | Ga0207689_100740893 | 335 |
| 21 | 3300013308 | Ga0157375_10247085 | Ga0157375_102470852 | 336 |
| 22 | iso_pu_bacteria | 2738541278 | 2738725521 | 336 |
| 23 | 3300013102 | Ga0157371_10000407 | Ga0157371_100004073 | 337 |
| 24 | 3300013307 | Ga0157372_10003494 | Ga0157372_1000349412 | 337 |
| 25 | 3300004803 | Ga0058862_10126549 | Ga0058862_101265492 | 338 |
| 26 | 3300005327 | Ga0070658_10023982 | Ga0070658_100239824 | 338 |
| 27 | 3300005336 | Ga0070680_100027122 | Ga0070680_1000271223 | 338 |
| 28 | 3300005336 | Ga0070680_100030174 | Ga0070680_1000301744 | 338 |
| 29 | 3300005336 | Ga0070680_100035984 | Ga0070680_1000359842 | 338 |
| 30 | 3300005339 | Ga0070660_100041007 | Ga0070660_1000410074 | 338 |
| 31 | 3300005339 | Ga0070660_100122356 | Ga0070660_1001223562 | 338 |
| 32 | 3300005366 | Ga0070659_100050411 | Ga0070659_1000504112 | 338 |
| 33 | 3300005455 | Ga0070663_100100515 | Ga0070663_1001005152 | 338 |
| 34 | 3300005458 | Ga0070681_10032814 | Ga0070681_100328144 | 338 |
| 35 | 3300005458 | Ga0070681_10161775 | Ga0070681_101617753 | 338 |
| 36 | 3300005530 | Ga0070679_100001168 | Ga0070679_10000116811 | 338 |
| 37 | 3300005530 | Ga0070679_100056952 | Ga0070679_1000569523 | 338 |
| 38 | 3300005539 | Ga0068853_100069458 | Ga0068853_1000694582 | 338 |
| 39 | 3300005563 | Ga0068855_100002248 | Ga0068855_1000022485 | 338 |
| 40 | 3300005563 | Ga0068855_100013158 | Ga0068855_1000131589 | 338 |
| 41 | 3300005563 | Ga0068855_100050073 | Ga0068855_1000500733 | 338 |
| 42 | 3300005563 | Ga0068855_100142593 | Ga0068855_1001425933 | 338 |
| 43 | 3300005578 | Ga0068854_100062303 | Ga0068854_1000623032 | 338 |
| 44 | 3300009093 | Ga0105240_10230492 | Ga0105240_102304922 | 338 |
| 45 | 3300013100 | Ga0157373_10013318 | Ga0157373_100133186 | 338 |
| 46 | 3300013100 | Ga0157373_10073897 | Ga0157373_100738972 | 338 |
| 47 | 3300013100 | Ga0157373_10085537 | Ga0157373_100855371 | 338 |
| 48 | 3300013102 | Ga0157371_10000250 | Ga0157371_1000025035 | 338 |
| 49 | 3300013102 | Ga0157371_10008816 | Ga0157371_100088164 | 338 |
| 50 | 3300013102 | Ga0157371_10025438 | Ga0157371_100254385 | 338 |
| 51 | 3300013102 | Ga0157371_10026427 | Ga0157371_100264275 | 338 |
| 52 | 3300013102 | Ga0157371_10107200 | Ga0157371_101072003 | 338 |
| 53 | 3300013102 | Ga0157371_10176636 | Ga0157371_101766362 | 338 |
| 54 | 3300013102 | Ga0157371_10177175 | Ga0157371_101771751 | 338 |
| 55 | 3300013104 | Ga0157370_10000585 | Ga0157370_1000058512 | 338 |
| 56 | 3300013104 | Ga0157370_10011832 | Ga0157370_100118324 | 338 |
| 57 | 3300013104 | Ga0157370_10017059 | Ga0157370_100170595 | 338 |
| 58 | 3300013105 | Ga0157369_10072453 | Ga0157369_100724533 | 338 |
| 59 | 3300013105 | Ga0157369_10073789 | Ga0157369_100737893 | 338 |
| 60 | 3300013105 | Ga0157369_10082140 | Ga0157369_100821402 | 338 |
| 61 | 3300013105 | Ga0157369_10228616 | Ga0157369_102286161 | 338 |
| 62 | 3300013307 | Ga0157372_10016144 | Ga0157372_100161443 | 338 |
| 63 | 3300013307 | Ga0157372_10050711 | Ga0157372_100507115 | 338 |
| 64 | 3300013307 | Ga0157372_10061020 | Ga0157372_100610204 | 338 |
| 65 | 3300013307 | Ga0157372_10227859 | Ga0157372_102278593 | 338 |
| 66 | 3300025909 | Ga0207705_10007859 | Ga0207705_100078596 | 338 |
| 67 | 3300025909 | Ga0207705_10014478 | Ga0207705_100144784 | 338 |
| 68 | 3300025912 | Ga0207707_10029807 | Ga0207707_100298073 | 338 |
| 69 | 3300025912 | Ga0207707_10224954 | Ga0207707_102249542 | 338 |
| 70 | 3300025917 | Ga0207660_10017526 | Ga0207660_100175262 | 338 |
| 71 | 3300025917 | Ga0207660_10106529 | Ga0207660_101065292 | 338 |
| 72 | 3300025919 | Ga0207657_10033182 | Ga0207657_100331825 | 338 |
| 73 | 3300025919 | Ga0207657_10035578 | Ga0207657_100355786 | 338 |
| 74 | 3300025921 | Ga0207652_10000103 | Ga0207652_1000010334 | 338 |
| 75 | 3300025921 | Ga0207652_10000770 | Ga0207652_1000077026 | 338 |
| 76 | 3300025932 | Ga0207690_10031976 | Ga0207690_100319763 | 338 |
| 77 | 3300025932 | Ga0207690_10044761 | Ga0207690_100447613 | 338 |
| 78 | 3300025944 | Ga0207661_10332385 | Ga0207661_103323851 | 338 |
| 79 | 3300025949 | Ga0207667_10009732 | Ga0207667_100097321 | 338 |
| 80 | 3300025949 | Ga0207667_10040176 | Ga0207667_100401763 | 338 |
| 81 | 3300025949 | Ga0207667_10044837 | Ga0207667_100448376 | 338 |
| 82 | 3300025949 | Ga0207667_10122348 | Ga0207667_101223482 | 338 |
| 83 | 3300026041 | Ga0207639_10076698 | Ga0207639_100766982 | 338 |
| 84 | 3300026067 | Ga0207678_10064056 | Ga0207678_100640563 | 338 |
| 85 | 3300026078 | Ga0207702_10207274 | Ga0207702_102072741 | 338 |
| 86 | 3300026116 | Ga0207674_10101514 | Ga0207674_101015143 | 338 |
| 87 | 3300026142 | Ga0207698_10520811 | Ga0207698_105208111 | 338 |
| 88 | 3300028577 | Ga0265318_10027150 | Ga0265318_100271501 | 338 |
| 89 | 3300037312 | Ga0395899_0000633 | Ga0395899_0000633_35154_36197 | 338 |
| 90 | 3300037312 | Ga0395899_0006160 | Ga0395899_0006160_6371_7414 | 338 |
| 91 | 3300037312 | Ga0395899_0011662 | Ga0395899_0011662_835_1869 | 338 |
| 92 | 3300037312 | Ga0395899_0119348 | Ga0395899_0119348_85_1119 | 338 |
| 93 | 3300037418 | Ga0395900_0002599 | Ga0395900_0002599_7556_8599 | 338 |
| 94 | 3300037418 | Ga0395900_0005571 | Ga0395900_0005571_7800_8843 | 338 |
| 95 | 3300037418 | Ga0395900_0079178 | Ga0395900_0079178_1552_2586 | 338 |
| 96 | 3300037466 | Ga0395898_0002191 | Ga0395898_0002191_15267_16310 | 338 |
| 97 | 3300037466 | Ga0395898_0053988 | Ga0395898_0053988_2134_3168 | 338 |
| 98 | 3300037466 | Ga0395898_0403509 | Ga0395898_0403509_139_1182 | 338 |
| 99 | 3300037471 | Ga0395905_0179605 | Ga0395905_0179605_625_1659 | 338 |
| 100 | 3300038443 | Ga0395901_0005927 | Ga0395901_0005927_11259_12293 | 338 |
| 101 | 3300038443 | Ga0395901_0077409 | Ga0395901_0077409_1034_2077 | 338 |
| 102 | 3300038443 | Ga0395901_0086677 | Ga0395901_0086677_1993_3027 | 338 |
| 103 | 3300038443 | Ga0395901_0101537 | Ga0395901_0101537_1283_2317 | 338 |
| 104 | 3300049571 | Ga0501034_0014518 | Ga0501034_0014518_5948_6985 | 338 |
| 105 | 3300049571 | Ga0501034_0045748 | Ga0501034_0045748_454_1491 | 338 |
| 106 | 3300049574 | Ga0501038_0246977 | Ga0501038_0246977_288_1325 | 338 |
| 107 | 3300049823 | Ga0501044_0155404 | Ga0501044_0155404_460_1494 | 338 |
| 108 | iso_pu_bacteria | 2818991442 | 2819574695 | 338 |
| 109 | iso_pu_bacteria | 2821136567 | 2821140786 | 338 |
| 110 | iso_pu_bacteria | 2884791551 | 2884796457 | 338 |
| 111 | iso_pu_bacteria | 2896085136 | 2896086309 | 338 |
| 112 | iso_pu_bacteria | 2896109856 | 2896113397 | 338 |
| 113 | iso_pu_bacteria | 2904467357 | 2904471288 | 338 |
| 114 | iso_pu_bacteria | 2929177148 | 2929178028 | 338 |
| 115 | iso_pu_bacteria | 2929239360 | 2929240356 | 338 |
| 116 | iso_pu_bacteria | 2929921140 | 2929922100 | 338 |
| 117 | iso_pu_bacteria | 2945977869 | 2945980387 | 338 |
| 118 | iso_pu_bacteria | 2946013367 | 2946013749 | 338 |
| 119 | iso_pu_bacteria | 8003151029 | 8003155684 | 338 |
| 120 | 3300003322 | rootL2_10189206 | rootL2_101892061 | 339 |
| 121 | 3300003323 | rootH1_10011210 | rootH1_1001121011 | 339 |
| 122 | 3300005336 | Ga0070680_100069013 | Ga0070680_1000690133 | 339 |
| 123 | 3300005337 | Ga0070682_100052742 | Ga0070682_1000527423 | 339 |
| 124 | 3300005367 | Ga0070667_100057559 | Ga0070667_1000575593 | 339 |
| 125 | 3300005471 | Ga0070698_100054790 | Ga0070698_1000547902 | 339 |
| 126 | 3300005530 | Ga0070679_100056346 | Ga0070679_1000563464 | 339 |
| 127 | 3300005539 | Ga0068853_100007459 | Ga0068853_1000074597 | 339 |
| 128 | 3300005563 | Ga0068855_100020017 | Ga0068855_1000200174 | 339 |
| 129 | 3300005614 | Ga0068856_100011241 | Ga0068856_1000112417 | 339 |
| 130 | 3300005616 | Ga0068852_100039419 | Ga0068852_1000394193 | 339 |
| 131 | 3300005617 | Ga0068859_100009963 | Ga0068859_1000099633 | 339 |
| 132 | 3300005618 | Ga0068864_100021783 | Ga0068864_1000217835 | 339 |
| 133 | 3300005843 | Ga0068860_100007403 | Ga0068860_1000074039 | 339 |
| 134 | 3300005844 | Ga0068862_100192402 | Ga0068862_1001924022 | 339 |
| 135 | 3300006931 | Ga0097620_100009963 | Ga0097620_1000099638 | 339 |
| 136 | 3300009174 | Ga0105241_10002042 | Ga0105241_1000204210 | 339 |
| 137 | 3300009545 | Ga0105237_10018640 | Ga0105237_100186407 | 339 |
| 138 | 3300010375 | Ga0105239_10028067 | Ga0105239_100280674 | 339 |
| 139 | 3300013100 | Ga0157373_10010020 | Ga0157373_100100205 | 339 |
| 140 | 3300013102 | Ga0157371_10023265 | Ga0157371_100232653 | 339 |
| 141 | 3300013104 | Ga0157370_10315491 | Ga0157370_103154912 | 339 |
| 142 | 3300013105 | Ga0157369_10020379 | Ga0157369_100203796 | 339 |
| 143 | 3300013307 | Ga0157372_10008214 | Ga0157372_100082143 | 339 |
| 144 | 3300013307 | Ga0157372_10056027 | Ga0157372_100560274 | 339 |
| 145 | 3300025246 | Ga0209646_1000578 | Ga0209646_10005789 | 339 |
| 146 | 3300025909 | Ga0207705_10047415 | Ga0207705_100474153 | 339 |
| 147 | 3300025911 | Ga0207654_10003473 | Ga0207654_100034735 | 339 |
| 148 | 3300025917 | Ga0207660_10105494 | Ga0207660_101054942 | 339 |
| 149 | 3300025923 | Ga0207681_10288697 | Ga0207681_102886971 | 339 |
| 150 | 3300025942 | Ga0207689_10085798 | Ga0207689_100857981 | 339 |
| 151 | 3300025949 | Ga0207667_10034865 | Ga0207667_100348653 | 339 |
| 152 | 3300026041 | Ga0207639_10101243 | Ga0207639_101012433 | 339 |
| 153 | 3300026078 | Ga0207702_10267540 | Ga0207702_102675402 | 339 |
| 154 | 3300026095 | Ga0207676_10036287 | Ga0207676_100362874 | 339 |
| 155 | 3300031507 | Ga0307509_10062975 | Ga0307509_100629752 | 339 |
| 156 | 3300035695 | Ga0373927_0128756 | Ga0373927_0128756_154_1179 | 339 |
| 157 | 3300042007 | Ga0439449_0031369 | Ga0439449_0031369_698_1723 | 339 |
| 158 | 3300044658 | Ga0466972_0000049 | Ga0466972_0000049_79897_80922 | 339 |
| 159 | 3300044658 | Ga0466972_0009713 | Ga0466972_0009713_768_1793 | 339 |
| 160 | 3300044842 | Ga0466957_0000901 | Ga0466957_0000901_12283_13308 | 339 |
| 161 | 3300046460 | Ga0495638_0087578 | Ga0495638_0087578_517_1542 | 339 |
| 162 | 3300049705 | Ga0501225_0000893 | Ga0501225_0000893_857_1882 | 339 |
| 163 | 3300050493 | nmdc:mga0k408_43493_c1 | nmdc:mga0k408_43493_c1_1421_2446 | 339 |
| 164 | 3300053086 | Ga0500578_0000605 | Ga0500578_0000605_17508_18533 | 339 |
| 165 | 3300053086 | Ga0500578_0008201 | Ga0500578_0008201_1659_2684 | 339 |
| 166 | 3300053092 | Ga0500583_0000055 | Ga0500583_0000055_31259_32284 | 339 |
| 167 | 3300053098 | Ga0500650_0036289 | Ga0500650_0036289_739_1764 | 339 |
| 168 | 3300053131 | Ga0500652_073854 | Ga0500652_073854_333_1358 | 339 |
| 169 | 3300053140 | Ga0500573_0016436 | Ga0500573_0016436_1074_2099 | 339 |
| 170 | 3300053156 | Ga0500622_0017747 | Ga0500622_0017747_2666_3691 | 339 |
| 171 | 3300053163 | Ga0500639_030150 | Ga0500639_030150_1691_2716 | 339 |
| 172 | 3300053177 | Ga0500636_0025813 | Ga0500636_0025813_152_1177 | 339 |
| 173 | 3300053727 | Ga0500611_002700 | Ga0500611_002700_1101_2126 | 339 |
| 174 | 3300003320 | rootH2_10000350 | rootH2_100003501 | 340 |
| 175 | 3300003320 | rootH2_10075480 | rootH2_100754802 | 340 |
| 176 | 3300003354 | JGI25160J50197_1000539 | JGI25160J50197_100053911 | 340 |
| 177 | 3300005327 | Ga0070658_10029210 | Ga0070658_100292103 | 340 |
| 178 | 3300005329 | Ga0070683_100123940 | Ga0070683_1001239403 | 340 |
| 179 | 3300005339 | Ga0070660_100064503 | Ga0070660_1000645031 | 340 |
| 180 | 3300005354 | Ga0070675_100064550 | Ga0070675_1000645502 | 340 |
| 181 | 3300005366 | Ga0070659_100094716 | Ga0070659_1000947161 | 340 |
| 182 | 3300005530 | Ga0070679_100014547 | Ga0070679_1000145473 | 340 |
| 183 | 3300005539 | Ga0068853_100030592 | Ga0068853_1000305925 | 340 |
| 184 | 3300005544 | Ga0070686_100061921 | Ga0070686_1000619213 | 340 |
| 185 | 3300005563 | Ga0068855_100004618 | Ga0068855_1000046185 | 340 |
| 186 | 3300005563 | Ga0068855_100093016 | Ga0068855_1000930162 | 340 |
| 187 | 3300005563 | Ga0068855_100291599 | Ga0068855_1002915993 | 340 |
| 188 | 3300005616 | Ga0068852_100006862 | Ga0068852_1000068628 | 340 |
| 189 | 3300005719 | Ga0068861_100001764 | Ga0068861_1000017649 | 340 |
| 190 | 3300005843 | Ga0068860_100002905 | Ga0068860_10000290519 | 340 |
| 191 | 3300005844 | Ga0068862_100400432 | Ga0068862_1004004322 | 340 |
| 192 | 3300006195 | Ga0075366_10048094 | Ga0075366_100480942 | 340 |
| 193 | 3300006844 | Ga0075428_100040421 | Ga0075428_1000404212 | 340 |
| 194 | 3300006847 | Ga0075431_100089626 | Ga0075431_1000896261 | 340 |
| 195 | 3300009093 | Ga0105240_10000106 | Ga0105240_10000106129 | 340 |
| 196 | 3300009093 | Ga0105240_10011259 | Ga0105240_1001125912 | 340 |
| 197 | 3300009093 | Ga0105240_10014654 | Ga0105240_100146545 | 340 |
| 198 | 3300009147 | Ga0114129_10001087 | Ga0114129_1000108735 | 340 |
| 199 | 3300009148 | Ga0105243_10084386 | Ga0105243_100843861 | 340 |
| 200 | 3300009174 | Ga0105241_10000085 | Ga0105241_1000008536 | 340 |
| 201 | 3300009545 | Ga0105237_10000512 | Ga0105237_100005126 | 340 |
| 202 | 3300009545 | Ga0105237_10000890 | Ga0105237_1000089025 | 340 |
| 203 | 3300009545 | Ga0105237_10004341 | Ga0105237_1000434116 | 340 |
| 204 | 3300009551 | Ga0105238_10003933 | Ga0105238_1000393314 | 340 |
| 205 | 3300010375 | Ga0105239_10002513 | Ga0105239_100025135 | 340 |
| 206 | 3300010375 | Ga0105239_10055610 | Ga0105239_100556101 | 340 |
| 207 | 3300013104 | Ga0157370_10113165 | Ga0157370_101131653 | 340 |
| 208 | 3300013297 | Ga0157378_10373474 | Ga0157378_103734742 | 340 |
| 209 | 3300013306 | Ga0163162_10000687 | Ga0163162_100006874 | 340 |
| 210 | 3300013307 | Ga0157372_10082298 | Ga0157372_100822982 | 340 |
| 211 | 3300013307 | Ga0157372_10104518 | Ga0157372_101045182 | 340 |
| 212 | 3300025302 | Ga0207426_1000026 | Ga0207426_100002683 | 340 |
| 213 | 3300025909 | Ga0207705_10047785 | Ga0207705_100477853 | 340 |
| 214 | 3300025911 | Ga0207654_10000413 | Ga0207654_1000041322 | 340 |
| 215 | 3300025911 | Ga0207654_10198858 | Ga0207654_101988581 | 340 |
| 216 | 3300025913 | Ga0207695_10000522 | Ga0207695_1000052262 | 340 |
| 217 | 3300025913 | Ga0207695_10019969 | Ga0207695_100199696 | 340 |
| 218 | 3300025913 | Ga0207695_10047074 | Ga0207695_100470746 | 340 |
| 219 | 3300025914 | Ga0207671_10001101 | Ga0207671_1000110132 | 340 |
| 220 | 3300025914 | Ga0207671_10002074 | Ga0207671_100020748 | 340 |
| 221 | 3300025919 | Ga0207657_10008178 | Ga0207657_100081787 | 340 |
| 222 | 3300025924 | Ga0207694_10085236 | Ga0207694_100852362 | 340 |
| 223 | 3300025926 | Ga0207659_10077548 | Ga0207659_100775482 | 340 |
| 224 | 3300025932 | Ga0207690_10076074 | Ga0207690_100760741 | 340 |
| 225 | 3300025935 | Ga0207709_10131584 | Ga0207709_101315841 | 340 |
| 226 | 3300025949 | Ga0207667_10004188 | Ga0207667_100041889 | 340 |
| 227 | 3300025949 | Ga0207667_10029606 | Ga0207667_100296066 | 340 |
| 228 | 3300025949 | Ga0207667_10261929 | Ga0207667_102619292 | 340 |
| 229 | 3300026041 | Ga0207639_10127993 | Ga0207639_101279933 | 340 |
| 230 | 3300026078 | Ga0207702_10346130 | Ga0207702_103461302 | 340 |
| 231 | 3300026118 | Ga0207675_100004328 | Ga0207675_1000043285 | 340 |
| 232 | 3300026142 | Ga0207698_10016215 | Ga0207698_100162155 | 340 |
| 233 | 3300028380 | Ga0268265_10500099 | Ga0268265_105000991 | 340 |
| 234 | 3300028381 | Ga0268264_10403553 | Ga0268264_104035531 | 340 |
| 235 | 3300031251 | Ga0265327_10000013 | Ga0265327_10000013374 | 340 |
| 236 | 3300031251 | Ga0265327_10001369 | Ga0265327_100013694 | 340 |
| 237 | 3300044656 | Ga0466969_0000759 | Ga0466969_0000759_4586_5614 | 340 |
| 238 | 3300044684 | Ga0466966_0002403 | Ga0466966_0002403_3200_4228 | 340 |
| 239 | 3300044735 | Ga0466968_0055137 | Ga0466968_0055137_520_1548 | 340 |
| 240 | 3300044842 | Ga0466957_0000101 | Ga0466957_0000101_1244_2272 | 340 |
| 241 | 3300044901 | Ga0466960_0158445 | Ga0466960_0158445_40_1068 | 340 |
| 242 | 3300045049 | Ga0466959_0000466 | Ga0466959_0000466_19388_20416 | 340 |
| 243 | 3300046616 | Ga0495668_0083565 | Ga0495668_0083565_521_1558 | 340 |
| 244 | 3300047320 | Ga0495672_0005750 | Ga0495672_0005750_279_1304 | 340 |
| 245 | 3300047472 | Ga0495686_0007391 | Ga0495686_0007391_2455_3480 | 340 |
| 246 | 3300048917 | Ga0496114_0000295 | Ga0496114_0000295_16167_17201 | 340 |
| 247 | 3300049569 | Ga0501032_0016997 | Ga0501032_0016997_3284_4309 | 340 |
| 248 | 3300049571 | Ga0501034_0014902 | Ga0501034_0014902_611_1636 | 340 |
| 249 | 3300049573 | Ga0501037_0032282 | Ga0501037_0032282_271_1296 | 340 |
| 250 | 3300049574 | Ga0501038_0333282 | Ga0501038_0333282_22_1056 | 340 |
| 251 | 3300049579 | Ga0501043_0172601 | Ga0501043_0172601_407_1432 | 340 |
| 252 | 3300049581 | Ga0501047_0108947 | Ga0501047_0108947_651_1676 | 340 |
| 253 | 3300049584 | Ga0501068_0112435 | Ga0501068_0112435_659_1684 | 340 |
| 254 | 3300049586 | Ga0501070_0011797 | Ga0501070_0011797_6073_7098 | 340 |
| 255 | 3300049589 | Ga0501073_0017228 | Ga0501073_0017228_925_1950 | 340 |
| 256 | 3300049590 | Ga0501074_0001751 | Ga0501074_0001751_9554_10579 | 340 |
| 257 | 3300049703 | Ga0501219_000280 | Ga0501219_000280_1855_2883 | 340 |
| 258 | 3300049742 | Ga0501080_0010720 | Ga0501080_0010720_1415_2440 | 340 |
| 259 | 3300049744 | Ga0501083_0025203 | Ga0501083_0025203_2898_3923 | 340 |
| 260 | 3300049822 | Ga0501035_0049750 | Ga0501035_0049750_429_1454 | 340 |
| 261 | 3300050005 | Ga0501284_00002 | Ga0501284_00002_71613_72641 | 340 |
| 262 | 3300050493 | nmdc:mga0k408_2621_c1 | nmdc:mga0k408_2621_c1_5364_6389 | 340 |
| 263 | 3300050507 | nmdc:mga05p37_4461_c1 | nmdc:mga05p37_4461_c1_4242_5270 | 340 |
| 264 | 3300050508 | nmdc:mga09592_46862_c1 | nmdc:mga09592_46862_c1_1317_2342 | 340 |
| 265 | 3300050509 | nmdc:mga0qj67_27772_c1 | nmdc:mga0qj67_27772_c1_600_1625 | 340 |
| 266 | 3300050510 | nmdc:mga06r32_204983_c1 | nmdc:mga06r32_204983_c1_370_1395 | 340 |
| 267 | 3300001979 | JGI24740J21852_10000624 | JGI24740J21852_100006248 | 341 |
| 268 | 3300002459 | JGI24751J29686_10002550 | JGI24751J29686_100025502 | 341 |
| 269 | 3300002738 | JGI25154J39366_1000003 | JGI25154J39366_1000003111 | 341 |
| 270 | 3300003215 | JGI25153J46596_10003819 | JGI25153J46596_100038196 | 341 |
| 271 | 3300003320 | rootH2_10000351 | rootH2_1000035113 | 341 |
| 272 | 3300003320 | rootH2_10010343 | rootH2_1001034313 | 341 |
| 273 | 3300003322 | rootL2_10103093 | rootL2_101030939 | 341 |
| 274 | 3300003354 | JGI25160J50197_1015171 | JGI25160J50197_10151713 | 341 |
| 275 | 3300003761 | Ga0055535_1002213 | Ga0055535_10022133 | 341 |
| 276 | 3300003762 | Ga0055542_1013782 | Ga0055542_10137821 | 341 |
| 277 | 3300003771 | Ga0055526_1002779 | Ga0055526_10027794 | 341 |
| 278 | 3300003790 | Ga0055528_1000060 | Ga0055528_100006054 | 341 |
| 279 | 3300003791 | Ga0055530_10004470 | Ga0055530_100044707 | 341 |
| 280 | 3300003794 | Ga0055531_10018412 | Ga0055531_100184123 | 341 |
| 281 | 3300005262 | Ga0065165_1000392 | Ga0065165_100039259 | 341 |
| 282 | 3300005262 | Ga0065165_1024281 | Ga0065165_10242812 | 341 |
| 283 | 3300005289 | Ga0065704_10074555 | Ga0065704_100745552 | 341 |
| 284 | 3300005290 | Ga0065712_10002576 | Ga0065712_100025765 | 341 |
| 285 | 3300005290 | Ga0065712_10004494 | Ga0065712_100044945 | 341 |
| 286 | 3300005290 | Ga0065712_10016705 | Ga0065712_100167052 | 341 |
| 287 | 3300005293 | Ga0065715_10001122 | Ga0065715_1000112210 | 341 |
| 288 | 3300005295 | Ga0065707_10008266 | Ga0065707_100082664 | 341 |
| 289 | 3300005328 | Ga0070676_10000653 | Ga0070676_1000065310 | 341 |
| 290 | 3300005328 | Ga0070676_10113171 | Ga0070676_101131711 | 341 |
| 291 | 3300005328 | Ga0070676_10133736 | Ga0070676_101337362 | 341 |
| 292 | 3300005329 | Ga0070683_100012489 | Ga0070683_1000124893 | 341 |
| 293 | 3300005331 | Ga0070670_100069651 | Ga0070670_1000696513 | 341 |
| 294 | 3300005331 | Ga0070670_100126829 | Ga0070670_1001268292 | 341 |
| 295 | 3300005331 | Ga0070670_100176772 | Ga0070670_1001767721 | 341 |
| 296 | 3300005333 | Ga0070677_10026840 | Ga0070677_100268401 | 341 |
| 297 | 3300005333 | Ga0070677_10042768 | Ga0070677_100427682 | 341 |
| 298 | 3300005333 | Ga0070677_10086913 | Ga0070677_100869132 | 341 |
| 299 | 3300005334 | Ga0068869_100153769 | Ga0068869_1001537692 | 341 |
| 300 | 3300005335 | Ga0070666_10000400 | Ga0070666_1000040013 | 341 |
| 301 | 3300005335 | Ga0070666_10003676 | Ga0070666_100036764 | 341 |
| 302 | 3300005335 | Ga0070666_10138795 | Ga0070666_101387951 | 341 |
| 303 | 3300005337 | Ga0070682_100041701 | Ga0070682_1000417013 | 341 |
| 304 | 3300005338 | Ga0068868_100001911 | Ga0068868_10000191111 | 341 |
| 305 | 3300005338 | Ga0068868_100007251 | Ga0068868_1000072514 | 341 |
| 306 | 3300005338 | Ga0068868_100044769 | Ga0068868_1000447695 | 341 |
| 307 | 3300005340 | Ga0070689_100011119 | Ga0070689_1000111192 | 341 |
| 308 | 3300005340 | Ga0070689_100018119 | Ga0070689_1000181195 | 341 |
| 309 | 3300005343 | Ga0070687_100034251 | Ga0070687_1000342512 | 341 |
| 310 | 3300005347 | Ga0070668_100014784 | Ga0070668_1000147844 | 341 |
| 311 | 3300005347 | Ga0070668_100019363 | Ga0070668_1000193635 | 341 |
| 312 | 3300005347 | Ga0070668_100060762 | Ga0070668_1000607623 | 341 |
| 313 | 3300005347 | Ga0070668_100063488 | Ga0070668_1000634886 | 341 |
| 314 | 3300005347 | Ga0070668_100105402 | Ga0070668_1001054022 | 341 |
| 315 | 3300005347 | Ga0070668_100273283 | Ga0070668_1002732832 | 341 |
| 316 | 3300005353 | Ga0070669_100043207 | Ga0070669_1000432073 | 341 |
| 317 | 3300005353 | Ga0070669_100064037 | Ga0070669_1000640372 | 341 |
| 318 | 3300005353 | Ga0070669_100073367 | Ga0070669_1000733673 | 341 |
| 319 | 3300005354 | Ga0070675_100199503 | Ga0070675_1001995032 | 341 |
| 320 | 3300005356 | Ga0070674_100152558 | Ga0070674_1001525581 | 341 |
| 321 | 3300005364 | Ga0070673_100007228 | Ga0070673_1000072282 | 341 |
| 322 | 3300005364 | Ga0070673_100016889 | Ga0070673_1000168892 | 341 |
| 323 | 3300005364 | Ga0070673_100049484 | Ga0070673_1000494842 | 341 |
| 324 | 3300005364 | Ga0070673_100140320 | Ga0070673_1001403202 | 341 |
| 325 | 3300005365 | Ga0070688_100003597 | Ga0070688_1000035972 | 341 |
| 326 | 3300005365 | Ga0070688_100010064 | Ga0070688_1000100642 | 341 |
| 327 | 3300005367 | Ga0070667_100002402 | Ga0070667_1000024029 | 341 |
| 328 | 3300005367 | Ga0070667_100010585 | Ga0070667_1000105855 | 341 |
| 329 | 3300005367 | Ga0070667_100016479 | Ga0070667_1000164795 | 341 |
| 330 | 3300005456 | Ga0070678_100003657 | Ga0070678_1000036575 | 341 |
| 331 | 3300005457 | Ga0070662_100013337 | Ga0070662_1000133374 | 341 |
| 332 | 3300005458 | Ga0070681_10071670 | Ga0070681_100716702 | 341 |
| 333 | 3300005459 | Ga0068867_100008127 | Ga0068867_1000081275 | 341 |
| 334 | 3300005459 | Ga0068867_100013549 | Ga0068867_1000135492 | 341 |
| 335 | 3300005466 | Ga0070685_10003458 | Ga0070685_100034582 | 341 |
| 336 | 3300005466 | Ga0070685_10011080 | Ga0070685_100110805 | 341 |
| 337 | 3300005466 | Ga0070685_10037460 | Ga0070685_100374602 | 341 |
| 338 | 3300005468 | Ga0070707_100070724 | Ga0070707_1000707243 | 341 |
| 339 | 3300005471 | Ga0070698_100005877 | Ga0070698_1000058776 | 341 |
| 340 | 3300005471 | Ga0070698_100346558 | Ga0070698_1003465582 | 341 |
| 341 | 3300005518 | Ga0070699_100053273 | Ga0070699_1000532733 | 341 |
| 342 | 3300005535 | Ga0070684_100033387 | Ga0070684_1000333875 | 341 |
| 343 | 3300005535 | Ga0070684_100035292 | Ga0070684_1000352923 | 341 |
| 344 | 3300005539 | Ga0068853_100042311 | Ga0068853_1000423115 | 341 |
| 345 | 3300005539 | Ga0068853_100044637 | Ga0068853_1000446374 | 341 |
| 346 | 3300005543 | Ga0070672_100003073 | Ga0070672_1000030736 | 341 |
| 347 | 3300005543 | Ga0070672_100080768 | Ga0070672_1000807682 | 341 |
| 348 | 3300005543 | Ga0070672_100282065 | Ga0070672_1002820651 | 341 |
| 349 | 3300005544 | Ga0070686_100015822 | Ga0070686_1000158223 | 341 |
| 350 | 3300005544 | Ga0070686_100154790 | Ga0070686_1001547902 | 341 |
| 351 | 3300005548 | Ga0070665_100000014 | Ga0070665_100000014127 | 341 |
| 352 | 3300005548 | Ga0070665_100175600 | Ga0070665_1001756001 | 341 |
| 353 | 3300005563 | Ga0068855_100071409 | Ga0068855_1000714092 | 341 |
| 354 | 3300005563 | Ga0068855_100158629 | Ga0068855_1001586294 | 341 |
| 355 | 3300005564 | Ga0070664_100226914 | Ga0070664_1002269142 | 341 |
| 356 | 3300005577 | Ga0068857_100023723 | Ga0068857_1000237235 | 341 |
| 357 | 3300005577 | Ga0068857_100045500 | Ga0068857_1000455003 | 341 |
| 358 | 3300005577 | Ga0068857_100063029 | Ga0068857_1000630293 | 341 |
| 359 | 3300005578 | Ga0068854_100137316 | Ga0068854_1001373162 | 341 |
| 360 | 3300005615 | Ga0070702_100123172 | Ga0070702_1001231722 | 341 |
| 361 | 3300005616 | Ga0068852_100040292 | Ga0068852_1000402922 | 341 |
| 362 | 3300005616 | Ga0068852_100104232 | Ga0068852_1001042323 | 341 |
| 363 | 3300005617 | Ga0068859_100006236 | Ga0068859_1000062367 | 341 |
| 364 | 3300005617 | Ga0068859_100324085 | Ga0068859_1003240852 | 341 |
| 365 | 3300005618 | Ga0068864_100022019 | Ga0068864_1000220193 | 341 |
| 366 | 3300005618 | Ga0068864_100023605 | Ga0068864_1000236053 | 341 |
| 367 | 3300005618 | Ga0068864_100137072 | Ga0068864_1001370721 | 341 |
| 368 | 3300005618 | Ga0068864_100148240 | Ga0068864_1001482403 | 341 |
| 369 | 3300005718 | Ga0068866_10005321 | Ga0068866_100053212 | 341 |
| 370 | 3300005840 | Ga0068870_10024426 | Ga0068870_100244262 | 341 |
| 371 | 3300005841 | Ga0068863_100071930 | Ga0068863_1000719302 | 341 |
| 372 | 3300005842 | Ga0068858_100022366 | Ga0068858_1000223663 | 341 |
| 373 | 3300005842 | Ga0068858_100181072 | Ga0068858_1001810723 | 341 |
| 374 | 3300005843 | Ga0068860_100001494 | Ga0068860_10000149410 | 341 |
| 375 | 3300005843 | Ga0068860_100034993 | Ga0068860_1000349935 | 341 |
| 376 | 3300005843 | Ga0068860_100039084 | Ga0068860_1000390846 | 341 |
| 377 | 3300005843 | Ga0068860_100043514 | Ga0068860_1000435144 | 341 |
| 378 | 3300005843 | Ga0068860_100123595 | Ga0068860_1001235952 | 341 |
| 379 | 3300005843 | Ga0068860_100185792 | Ga0068860_1001857922 | 341 |
| 380 | 3300005843 | Ga0068860_100217378 | Ga0068860_1002173782 | 341 |
| 381 | 3300005844 | Ga0068862_100151980 | Ga0068862_1001519802 | 341 |
| 382 | 3300006195 | Ga0075366_10048490 | Ga0075366_100484902 | 341 |
| 383 | 3300006195 | Ga0075366_10112408 | Ga0075366_101124082 | 341 |
| 384 | 3300006237 | Ga0097621_100014826 | Ga0097621_1000148262 | 341 |
| 385 | 3300006237 | Ga0097621_100049668 | Ga0097621_1000496682 | 341 |
| 386 | 3300006237 | Ga0097621_100142854 | Ga0097621_1001428542 | 341 |
| 387 | 3300006237 | Ga0097621_100168043 | Ga0097621_1001680431 | 341 |
| 388 | 3300006358 | Ga0068871_100012871 | Ga0068871_1000128715 | 341 |
| 389 | 3300006358 | Ga0068871_100167397 | Ga0068871_1001673972 | 341 |
| 390 | 3300006358 | Ga0068871_100247409 | Ga0068871_1002474091 | 341 |
| 391 | 3300006358 | Ga0068871_100298822 | Ga0068871_1002988221 | 341 |
| 392 | 3300006844 | Ga0075428_100000528 | Ga0075428_10000052810 | 341 |
| 393 | 3300006844 | Ga0075428_100084530 | Ga0075428_1000845302 | 341 |
| 394 | 3300006844 | Ga0075428_100287560 | Ga0075428_1002875602 | 341 |
| 395 | 3300006846 | Ga0075430_100136669 | Ga0075430_1001366692 | 341 |
| 396 | 3300006847 | Ga0075431_100002593 | Ga0075431_1000025937 | 341 |
| 397 | 3300006880 | Ga0075429_100001456 | Ga0075429_10000145611 | 341 |
| 398 | 3300006880 | Ga0075429_100035722 | Ga0075429_1000357223 | 341 |
| 399 | 3300006881 | Ga0068865_100001316 | Ga0068865_1000013169 | 341 |
| 400 | 3300006881 | Ga0068865_100021362 | Ga0068865_1000213624 | 341 |
| 401 | 3300006881 | Ga0068865_100058786 | Ga0068865_1000587862 | 341 |
| 402 | 3300006881 | Ga0068865_100096384 | Ga0068865_1000963842 | 341 |
| 403 | 3300006931 | Ga0097620_100006236 | Ga0097620_1000062367 | 341 |
| 404 | 3300006931 | Ga0097620_100006943 | Ga0097620_1000069437 | 341 |
| 405 | 3300006931 | Ga0097620_100020271 | Ga0097620_1000202717 | 341 |
| 406 | 3300006931 | Ga0097620_100324082 | Ga0097620_1003240822 | 341 |
| 407 | 3300009093 | Ga0105240_10000895 | Ga0105240_1000089521 | 341 |
| 408 | 3300009093 | Ga0105240_10004054 | Ga0105240_1000405419 | 341 |
| 409 | 3300009093 | Ga0105240_10057080 | Ga0105240_100570802 | 341 |
| 410 | 3300009093 | Ga0105240_10073100 | Ga0105240_100731001 | 341 |
| 411 | 3300009094 | Ga0111539_10006625 | Ga0111539_1000662512 | 341 |
| 412 | 3300009094 | Ga0111539_10144975 | Ga0111539_101449753 | 341 |
| 413 | 3300009094 | Ga0111539_10182203 | Ga0111539_101822033 | 341 |
| 414 | 3300009094 | Ga0111539_10357967 | Ga0111539_103579672 | 341 |
| 415 | 3300009101 | Ga0105247_10005677 | Ga0105247_100056778 | 341 |
| 416 | 3300009147 | Ga0114129_10574063 | Ga0114129_105740632 | 341 |
| 417 | 3300009148 | Ga0105243_10274000 | Ga0105243_102740002 | 341 |
| 418 | 3300009174 | Ga0105241_10052333 | Ga0105241_100523332 | 341 |
| 419 | 3300009174 | Ga0105241_10063653 | Ga0105241_100636532 | 341 |
| 420 | 3300009174 | Ga0105241_10068129 | Ga0105241_100681292 | 341 |
| 421 | 3300009176 | Ga0105242_10032132 | Ga0105242_100321323 | 341 |
| 422 | 3300009176 | Ga0105242_10053071 | Ga0105242_100530712 | 341 |
| 423 | 3300009176 | Ga0105242_10083180 | Ga0105242_100831802 | 341 |
| 424 | 3300009176 | Ga0105242_10096462 | Ga0105242_100964622 | 341 |
| 425 | 3300009545 | Ga0105237_10002282 | Ga0105237_100022826 | 341 |
| 426 | 3300009545 | Ga0105237_10014775 | Ga0105237_100147752 | 341 |
| 427 | 3300009545 | Ga0105237_10029968 | Ga0105237_100299684 | 341 |
| 428 | 3300009545 | Ga0105237_10136406 | Ga0105237_101364061 | 341 |
| 429 | 3300009545 | Ga0105237_10235368 | Ga0105237_102353681 | 341 |
| 430 | 3300009551 | Ga0105238_10061554 | Ga0105238_100615545 | 341 |
| 431 | 3300009553 | Ga0105249_10000561 | Ga0105249_1000056122 | 341 |
| 432 | 3300009553 | Ga0105249_10005594 | Ga0105249_100055945 | 341 |
| 433 | 3300009553 | Ga0105249_10008945 | Ga0105249_100089455 | 341 |
| 434 | 3300009553 | Ga0105249_10010060 | Ga0105249_100100602 | 341 |
| 435 | 3300009553 | Ga0105249_10011723 | Ga0105249_100117232 | 341 |
| 436 | 3300009553 | Ga0105249_10018185 | Ga0105249_100181856 | 341 |
| 437 | 3300009553 | Ga0105249_10076176 | Ga0105249_100761762 | 341 |
| 438 | 3300009553 | Ga0105249_10262299 | Ga0105249_102622993 | 341 |
| 439 | 3300010375 | Ga0105239_10000019 | Ga0105239_100000195 | 341 |
| 440 | 3300010375 | Ga0105239_10000384 | Ga0105239_1000038449 | 341 |
| 441 | 3300010375 | Ga0105239_10021483 | Ga0105239_100214837 | 341 |
| 442 | 3300010375 | Ga0105239_10035894 | Ga0105239_100358946 | 341 |
| 443 | 3300010375 | Ga0105239_10285026 | Ga0105239_102850262 | 341 |
| 444 | 3300011119 | Ga0105246_10006084 | Ga0105246_100060844 | 341 |
| 445 | 3300011119 | Ga0105246_10192698 | Ga0105246_101926982 | 341 |
| 446 | 3300013100 | Ga0157373_10113677 | Ga0157373_101136772 | 341 |
| 447 | 3300013104 | Ga0157370_10031858 | Ga0157370_100318586 | 341 |
| 448 | 3300013104 | Ga0157370_10070861 | Ga0157370_100708614 | 341 |
| 449 | 3300013105 | Ga0157369_10046176 | Ga0157369_100461764 | 341 |
| 450 | 3300013105 | Ga0157369_10061837 | Ga0157369_100618372 | 341 |
| 451 | 3300013296 | Ga0157374_10094417 | Ga0157374_100944172 | 341 |
| 452 | 3300013296 | Ga0157374_10524805 | Ga0157374_105248051 | 341 |
| 453 | 3300013297 | Ga0157378_10125222 | Ga0157378_101252222 | 341 |
| 454 | 3300013297 | Ga0157378_10337328 | Ga0157378_103373282 | 341 |
| 455 | 3300013306 | Ga0163162_10001831 | Ga0163162_1000183117 | 341 |
| 456 | 3300013306 | Ga0163162_10010121 | Ga0163162_100101211 | 341 |
| 457 | 3300013306 | Ga0163162_10018072 | Ga0163162_100180727 | 341 |
| 458 | 3300013306 | Ga0163162_10279801 | Ga0163162_102798012 | 341 |
| 459 | 3300013307 | Ga0157372_10001462 | Ga0157372_1000146216 | 341 |
| 460 | 3300013307 | Ga0157372_10003195 | Ga0157372_100031959 | 341 |
| 461 | 3300013308 | Ga0157375_10019039 | Ga0157375_100190393 | 341 |
| 462 | 3300013308 | Ga0157375_10062542 | Ga0157375_100625423 | 341 |
| 463 | 3300013308 | Ga0157375_10096253 | Ga0157375_100962532 | 341 |
| 464 | 3300013308 | Ga0157375_10344313 | Ga0157375_103443132 | 341 |
| 465 | 3300014325 | Ga0163163_10118986 | Ga0163163_101189863 | 341 |
| 466 | 3300014325 | Ga0163163_10139945 | Ga0163163_101399451 | 341 |
| 467 | 3300014325 | Ga0163163_10300487 | Ga0163163_103004872 | 341 |
| 468 | 3300014326 | Ga0157380_10009743 | Ga0157380_100097434 | 341 |
| 469 | 3300014326 | Ga0157380_10051428 | Ga0157380_100514282 | 341 |
| 470 | 3300014326 | Ga0157380_10246934 | Ga0157380_102469342 | 341 |
| 471 | 3300014745 | Ga0157377_10008604 | Ga0157377_100086042 | 341 |
| 472 | 3300014745 | Ga0157377_10043394 | Ga0157377_100433943 | 341 |
| 473 | 3300014968 | Ga0157379_10006192 | Ga0157379_100061925 | 341 |
| 474 | 3300014968 | Ga0157379_10018323 | Ga0157379_100183234 | 341 |
| 475 | 3300014968 | Ga0157379_10021086 | Ga0157379_100210864 | 341 |
| 476 | 3300014968 | Ga0157379_10351675 | Ga0157379_103516751 | 341 |
| 477 | 3300014969 | Ga0157376_10002607 | Ga0157376_100026075 | 341 |
| 478 | 3300014969 | Ga0157376_10067688 | Ga0157376_100676883 | 341 |
| 479 | 3300014969 | Ga0157376_10180865 | Ga0157376_101808651 | 341 |
| 480 | 3300015265 | Ga0182005_1000069 | Ga0182005_100006935 | 341 |
| 481 | 3300017792 | Ga0163161_10039508 | Ga0163161_100395082 | 341 |
| 482 | 3300017792 | Ga0163161_10142207 | Ga0163161_101422072 | 341 |
| 483 | 3300017792 | Ga0163161_10176224 | Ga0163161_101762242 | 341 |
| 484 | 3300020069 | Ga0197907_11009971 | Ga0197907_110099711 | 341 |
| 485 | 3300020070 | Ga0206356_10274599 | Ga0206356_102745991 | 341 |
| 486 | 3300025208 | Ga0209436_100882 | Ga0209436_1008828 | 341 |
| 487 | 3300025208 | Ga0209436_102262 | Ga0209436_1022624 | 341 |
| 488 | 3300025242 | Ga0209258_100032 | Ga0209258_100032237 | 341 |
| 489 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004227 | 341 |
| 490 | 3300025250 | Ga0209026_1000192 | Ga0209026_10001924 | 341 |
| 491 | 3300025254 | Ga0209148_1000546 | Ga0209148_100054632 | 341 |
| 492 | 3300025273 | Ga0209673_1000258 | Ga0209673_100025861 | 341 |
| 493 | 3300025284 | Ga0209130_1000871 | Ga0209130_100087111 | 341 |
| 494 | 3300025295 | Ga0209564_1002451 | Ga0209564_10024519 | 341 |
| 495 | 3300025295 | Ga0209564_1008546 | Ga0209564_10085464 | 341 |
| 496 | 3300025297 | Ga0209758_1003782 | Ga0209758_100378210 | 341 |
| 497 | 3300025297 | Ga0209758_1008980 | Ga0209758_10089804 | 341 |
| 498 | 3300025298 | Ga0209050_1001914 | Ga0209050_100191410 | 341 |
| 499 | 3300025302 | Ga0207426_1000033 | Ga0207426_1000033269 | 341 |
| 500 | 3300025302 | Ga0207426_1000321 | Ga0207426_100032168 | 341 |
| 501 | 3300025302 | Ga0207426_1000916 | Ga0207426_100091619 | 341 |
| 502 | 3300025304 | Ga0209257_1003047 | Ga0209257_10030479 | 341 |
| 503 | 3300025315 | Ga0207697_10007616 | Ga0207697_100076166 | 341 |
| 504 | 3300025315 | Ga0207697_10076299 | Ga0207697_100762992 | 341 |
| 505 | 3300025321 | Ga0207656_10022444 | Ga0207656_100224444 | 341 |
| 506 | 3300025321 | Ga0207656_10050633 | Ga0207656_100506332 | 341 |
| 507 | 3300025893 | Ga0207682_10003295 | Ga0207682_100032956 | 341 |
| 508 | 3300025893 | Ga0207682_10009657 | Ga0207682_100096571 | 341 |
| 509 | 3300025893 | Ga0207682_10058484 | Ga0207682_100584842 | 341 |
| 510 | 3300025899 | Ga0207642_10092011 | Ga0207642_100920112 | 341 |
| 511 | 3300025900 | Ga0207710_10001225 | Ga0207710_100012256 | 341 |
| 512 | 3300025901 | Ga0207688_10005557 | Ga0207688_100055575 | 341 |
| 513 | 3300025901 | Ga0207688_10046226 | Ga0207688_100462262 | 341 |
| 514 | 3300025903 | Ga0207680_10021290 | Ga0207680_100212901 | 341 |
| 515 | 3300025904 | Ga0207647_10003522 | Ga0207647_100035229 | 341 |
| 516 | 3300025904 | Ga0207647_10025385 | Ga0207647_100253852 | 341 |
| 517 | 3300025905 | Ga0207685_10007041 | Ga0207685_100070414 | 341 |
| 518 | 3300025907 | Ga0207645_10000193 | Ga0207645_1000019335 | 341 |
| 519 | 3300025907 | Ga0207645_10000791 | Ga0207645_100007919 | 341 |
| 520 | 3300025907 | Ga0207645_10038081 | Ga0207645_100380812 | 341 |
| 521 | 3300025907 | Ga0207645_10060796 | Ga0207645_100607964 | 341 |
| 522 | 3300025908 | Ga0207643_10001613 | Ga0207643_1000161311 | 341 |
| 523 | 3300025908 | Ga0207643_10003612 | Ga0207643_100036127 | 341 |
| 524 | 3300025908 | Ga0207643_10005299 | Ga0207643_100052992 | 341 |
| 525 | 3300025908 | Ga0207643_10128700 | Ga0207643_101287002 | 341 |
| 526 | 3300025912 | Ga0207707_10049374 | Ga0207707_100493743 | 341 |
| 527 | 3300025913 | Ga0207695_10000582 | Ga0207695_1000058242 | 341 |
| 528 | 3300025913 | Ga0207695_10000909 | Ga0207695_1000090924 | 341 |
| 529 | 3300025913 | Ga0207695_10004571 | Ga0207695_100045717 | 341 |
| 530 | 3300025913 | Ga0207695_10026064 | Ga0207695_100260646 | 341 |
| 531 | 3300025913 | Ga0207695_10080942 | Ga0207695_100809421 | 341 |
| 532 | 3300025913 | Ga0207695_10085668 | Ga0207695_100856682 | 341 |
| 533 | 3300025913 | Ga0207695_10257571 | Ga0207695_102575711 | 341 |
| 534 | 3300025914 | Ga0207671_10006522 | Ga0207671_100065223 | 341 |
| 535 | 3300025914 | Ga0207671_10009392 | Ga0207671_100093928 | 341 |
| 536 | 3300025914 | Ga0207671_10012533 | Ga0207671_100125337 | 341 |
| 537 | 3300025914 | Ga0207671_10162476 | Ga0207671_101624762 | 341 |
| 538 | 3300025918 | Ga0207662_10032572 | Ga0207662_100325723 | 341 |
| 539 | 3300025918 | Ga0207662_10047087 | Ga0207662_100470873 | 341 |
| 540 | 3300025918 | Ga0207662_10048639 | Ga0207662_100486392 | 341 |
| 541 | 3300025922 | Ga0207646_10188271 | Ga0207646_101882712 | 341 |
| 542 | 3300025923 | Ga0207681_10041081 | Ga0207681_100410812 | 341 |
| 543 | 3300025923 | Ga0207681_10132312 | Ga0207681_101323121 | 341 |
| 544 | 3300025923 | Ga0207681_10167267 | Ga0207681_101672671 | 341 |
| 545 | 3300025925 | Ga0207650_10096598 | Ga0207650_100965983 | 341 |
| 546 | 3300025925 | Ga0207650_10258033 | Ga0207650_102580331 | 341 |
| 547 | 3300025926 | Ga0207659_10058767 | Ga0207659_100587672 | 341 |
| 548 | 3300025931 | Ga0207644_10161378 | Ga0207644_101613782 | 341 |
| 549 | 3300025933 | Ga0207706_10030771 | Ga0207706_100307711 | 341 |
| 550 | 3300025933 | Ga0207706_10069729 | Ga0207706_100697292 | 341 |
| 551 | 3300025933 | Ga0207706_10128765 | Ga0207706_101287653 | 341 |
| 552 | 3300025934 | Ga0207686_10000977 | Ga0207686_1000097710 | 341 |
| 553 | 3300025936 | Ga0207670_10007047 | Ga0207670_100070474 | 341 |
| 554 | 3300025938 | Ga0207704_10047464 | Ga0207704_100474642 | 341 |
| 555 | 3300025940 | Ga0207691_10002498 | Ga0207691_100024989 | 341 |
| 556 | 3300025940 | Ga0207691_10004429 | Ga0207691_100044296 | 341 |
| 557 | 3300025940 | Ga0207691_10035730 | Ga0207691_100357303 | 341 |
| 558 | 3300025940 | Ga0207691_10044522 | Ga0207691_100445222 | 341 |
| 559 | 3300025942 | Ga0207689_10001011 | Ga0207689_100010115 | 341 |
| 560 | 3300025942 | Ga0207689_10026582 | Ga0207689_100265825 | 341 |
| 561 | 3300025942 | Ga0207689_10050585 | Ga0207689_100505854 | 341 |
| 562 | 3300025945 | Ga0207679_10089749 | Ga0207679_100897492 | 341 |
| 563 | 3300025945 | Ga0207679_10171797 | Ga0207679_101717971 | 341 |
| 564 | 3300025949 | Ga0207667_10000749 | Ga0207667_1000074915 | 341 |
| 565 | 3300025949 | Ga0207667_10013273 | Ga0207667_100132733 | 341 |
| 566 | 3300025949 | Ga0207667_10058520 | Ga0207667_100585202 | 341 |
| 567 | 3300025960 | Ga0207651_10002063 | Ga0207651_100020639 | 341 |
| 568 | 3300025960 | Ga0207651_10003386 | Ga0207651_100033868 | 341 |
| 569 | 3300025960 | Ga0207651_10021766 | Ga0207651_100217664 | 341 |
| 570 | 3300025961 | Ga0207712_10000844 | Ga0207712_100008444 | 341 |
| 571 | 3300025961 | Ga0207712_10001111 | Ga0207712_100011116 | 341 |
| 572 | 3300025961 | Ga0207712_10003901 | Ga0207712_100039017 | 341 |
| 573 | 3300025961 | Ga0207712_10004398 | Ga0207712_100043987 | 341 |
| 574 | 3300025961 | Ga0207712_10038033 | Ga0207712_100380333 | 341 |
| 575 | 3300025961 | Ga0207712_10213910 | Ga0207712_102139102 | 341 |
| 576 | 3300025972 | Ga0207668_10014070 | Ga0207668_100140704 | 341 |
| 577 | 3300025972 | Ga0207668_10032875 | Ga0207668_100328751 | 341 |
| 578 | 3300025972 | Ga0207668_10095068 | Ga0207668_100950682 | 341 |
| 579 | 3300025972 | Ga0207668_10117617 | Ga0207668_101176171 | 341 |
| 580 | 3300025972 | Ga0207668_10118665 | Ga0207668_101186652 | 341 |
| 581 | 3300025981 | Ga0207640_10017137 | Ga0207640_100171372 | 341 |
| 582 | 3300025981 | Ga0207640_10037196 | Ga0207640_100371962 | 341 |
| 583 | 3300025981 | Ga0207640_10197565 | Ga0207640_101975652 | 341 |
| 584 | 3300025986 | Ga0207658_10009068 | Ga0207658_100090682 | 341 |
| 585 | 3300025986 | Ga0207658_10101184 | Ga0207658_101011841 | 341 |
| 586 | 3300025986 | Ga0207658_10134760 | Ga0207658_101347602 | 341 |
| 587 | 3300026023 | Ga0207677_10017362 | Ga0207677_100173624 | 341 |
| 588 | 3300026035 | Ga0207703_10097591 | Ga0207703_100975913 | 341 |
| 589 | 3300026035 | Ga0207703_10400405 | Ga0207703_104004052 | 341 |
| 590 | 3300026041 | Ga0207639_10108170 | Ga0207639_101081702 | 341 |
| 591 | 3300026041 | Ga0207639_10130822 | Ga0207639_101308222 | 341 |
| 592 | 3300026041 | Ga0207639_10368665 | Ga0207639_103686651 | 341 |
| 593 | 3300026075 | Ga0207708_10017910 | Ga0207708_100179107 | 341 |
| 594 | 3300026075 | Ga0207708_10046170 | Ga0207708_100461703 | 341 |
| 595 | 3300026075 | Ga0207708_10112291 | Ga0207708_101122913 | 341 |
| 596 | 3300026075 | Ga0207708_10188824 | Ga0207708_101888242 | 341 |
| 597 | 3300026078 | Ga0207702_10045451 | Ga0207702_100454511 | 341 |
| 598 | 3300026088 | Ga0207641_10000318 | Ga0207641_1000031829 | 341 |
| 599 | 3300026088 | Ga0207641_10406957 | Ga0207641_104069571 | 341 |
| 600 | 3300026089 | Ga0207648_10000914 | Ga0207648_1000091417 | 341 |
| 601 | 3300026089 | Ga0207648_10005357 | Ga0207648_100053576 | 341 |
| 602 | 3300026089 | Ga0207648_10041409 | Ga0207648_100414095 | 341 |
| 603 | 3300026089 | Ga0207648_10054623 | Ga0207648_100546233 | 341 |
| 604 | 3300026089 | Ga0207648_10213911 | Ga0207648_102139112 | 341 |
| 605 | 3300026095 | Ga0207676_10119761 | Ga0207676_101197613 | 341 |
| 606 | 3300026095 | Ga0207676_10163283 | Ga0207676_101632831 | 341 |
| 607 | 3300026095 | Ga0207676_10181945 | Ga0207676_101819452 | 341 |
| 608 | 3300026116 | Ga0207674_10010951 | Ga0207674_100109519 | 341 |
| 609 | 3300026116 | Ga0207674_10062630 | Ga0207674_100626303 | 341 |
| 610 | 3300026116 | Ga0207674_10139816 | Ga0207674_101398162 | 341 |
| 611 | 3300026116 | Ga0207674_10213604 | Ga0207674_102136043 | 341 |
| 612 | 3300026116 | Ga0207674_10339280 | Ga0207674_103392802 | 341 |
| 613 | 3300026118 | Ga0207675_100001072 | Ga0207675_10000107210 | 341 |
| 614 | 3300026118 | Ga0207675_100049740 | Ga0207675_1000497404 | 341 |
| 615 | 3300026118 | Ga0207675_100081262 | Ga0207675_1000812622 | 341 |
| 616 | 3300026118 | Ga0207675_100184220 | Ga0207675_1001842202 | 341 |
| 617 | 3300026121 | Ga0207683_10005618 | Ga0207683_100056189 | 341 |
| 618 | 3300026142 | Ga0207698_10007833 | Ga0207698_100078333 | 341 |
| 619 | 3300026142 | Ga0207698_10054047 | Ga0207698_100540473 | 341 |
| 620 | 3300028379 | Ga0268266_10000048 | Ga0268266_10000048205 | 341 |
| 621 | 3300028379 | Ga0268266_10113177 | Ga0268266_101131771 | 341 |
| 622 | 3300028379 | Ga0268266_10178797 | Ga0268266_101787971 | 341 |
| 623 | 3300028381 | Ga0268264_10000028 | Ga0268264_10000028355 | 341 |
| 624 | 3300028381 | Ga0268264_10000558 | Ga0268264_1000055817 | 341 |
| 625 | 3300028381 | Ga0268264_10026939 | Ga0268264_100269393 | 341 |
| 626 | 3300028381 | Ga0268264_10061177 | Ga0268264_100611772 | 341 |
| 627 | 3300028381 | Ga0268264_10068487 | Ga0268264_100684873 | 341 |
| 628 | 3300028381 | Ga0268264_10260226 | Ga0268264_102602262 | 341 |
| 629 | 3300028577 | Ga0265318_10030026 | Ga0265318_100300262 | 341 |
| 630 | 3300028786 | Ga0307517_10000268 | Ga0307517_1000026824 | 341 |
| 631 | 3300030521 | Ga0307511_10000076 | Ga0307511_1000007637 | 341 |
| 632 | 3300031239 | Ga0265328_10056907 | Ga0265328_100569071 | 341 |
| 633 | 3300031251 | Ga0265327_10000006 | Ga0265327_10000006227 | 341 |
| 634 | 3300031251 | Ga0265327_10031924 | Ga0265327_100319242 | 341 |
| 635 | 3300031251 | Ga0265327_10036749 | Ga0265327_100367492 | 341 |
| 636 | 3300031344 | Ga0265316_10171884 | Ga0265316_101718842 | 341 |
| 637 | 3300031595 | Ga0265313_10030232 | Ga0265313_100302321 | 341 |
| 638 | 3300031616 | Ga0307508_10125800 | Ga0307508_101258001 | 341 |
| 639 | 3300031711 | Ga0265314_10054650 | Ga0265314_100546501 | 341 |
| 640 | 3300031730 | Ga0307516_10001840 | Ga0307516_1000184022 | 341 |
| 641 | 3300031730 | Ga0307516_10140235 | Ga0307516_101402351 | 341 |
| 642 | 3300033179 | Ga0307507_10161541 | Ga0307507_101615411 | 341 |
| 643 | 3300033180 | Ga0307510_10000949 | Ga0307510_1000094923 | 341 |
| 644 | 3300036401 | Ga0373937_0101119 | Ga0373937_0101119_419_1456 | 341 |
| 645 | 3300041413 | Ga0439465_0037911 | Ga0439465_0037911_459_1490 | 341 |
| 646 | 3300042435 | Ga0439434_0021853 | Ga0439434_0021853_284_1315 | 341 |
| 647 | 3300042435 | Ga0439434_0024322 | Ga0439434_0024322_104_1138 | 341 |
| 648 | 3300042876 | Ga0451577_0063583 | Ga0451577_0063583_607_1638 | 341 |
| 649 | 3300044658 | Ga0466972_0000057 | Ga0466972_0000057_61951_62985 | 341 |
| 650 | 3300044658 | Ga0466972_0006768 | Ga0466972_0006768_3449_4486 | 341 |
| 651 | 3300044658 | Ga0466972_0010760 | Ga0466972_0010760_2804_3841 | 341 |
| 652 | 3300044684 | Ga0466966_0114160 | Ga0466966_0114160_520_1554 | 341 |
| 653 | 3300044693 | Ga0466961_0010845 | Ga0466961_0010845_3987_5021 | 341 |
| 654 | 3300044706 | Ga0466964_0018070 | Ga0466964_0018070_715_1767 | 341 |
| 655 | 3300044712 | Ga0453684_0068430 | Ga0453684_0068430_212_1243 | 341 |
| 656 | 3300044712 | Ga0453684_0071839 | Ga0453684_0071839_1960_2991 | 341 |
| 657 | 3300044765 | Ga0466970_0000356 | Ga0466970_0000356_9917_10951 | 341 |
| 658 | 3300044842 | Ga0466957_0247351 | Ga0466957_0247351_13_1047 | 341 |
| 659 | 3300045049 | Ga0466959_0022965 | Ga0466959_0022965_1104_2138 | 341 |
| 660 | 3300045836 | Ga0466958_0075152 | Ga0466958_0075152_1013_2047 | 341 |
| 661 | 3300046460 | Ga0495638_0014384 | Ga0495638_0014384_3557_4594 | 341 |
| 662 | 3300046471 | Ga0495650_0011424 | Ga0495650_0011424_1912_2943 | 341 |
| 663 | 3300046507 | Ga0495606_0001358 | Ga0495606_0001358_7405_8442 | 341 |
| 664 | 3300046524 | Ga0495648_0008986 | Ga0495648_0008986_4778_5815 | 341 |
| 665 | 3300046539 | Ga0495621_0016625 | Ga0495621_0016625_1263_2291 | 341 |
| 666 | 3300046558 | Ga0495633_0000089 | Ga0495633_0000089_53423_54457 | 341 |
| 667 | 3300046648 | Ga0495611_0000813 | Ga0495611_0000813_10835_11872 | 341 |
| 668 | 3300046694 | Ga0495649_0103483 | Ga0495649_0103483_293_1327 | 341 |
| 669 | 3300047443 | Ga0495687_000429 | Ga0495687_000429_29066_30106 | 341 |
| 670 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_589102_590139 | 341 |
| 671 | 3300048924 | Ga0496121_0000086 | Ga0496121_0000086_49723_50757 | 341 |
| 672 | 3300049569 | Ga0501032_0058001 | Ga0501032_0058001_1264_2292 | 341 |
| 673 | 3300049570 | Ga0501033_0029345 | Ga0501033_0029345_2398_3438 | 341 |
| 674 | 3300049570 | Ga0501033_0163269 | Ga0501033_0163269_491_1528 | 341 |
| 675 | 3300049571 | Ga0501034_0006045 | Ga0501034_0006045_386_1426 | 341 |
| 676 | 3300049572 | Ga0501036_0055414 | Ga0501036_0055414_2189_3217 | 341 |
| 677 | 3300049572 | Ga0501036_0285736 | Ga0501036_0285736_263_1303 | 341 |
| 678 | 3300049573 | Ga0501037_0006685 | Ga0501037_0006685_5012_6040 | 341 |
| 679 | 3300049573 | Ga0501037_0190506 | Ga0501037_0190506_57_1091 | 341 |
| 680 | 3300049573 | Ga0501037_0248040 | Ga0501037_0248040_44_1084 | 341 |
| 681 | 3300049574 | Ga0501038_0007716 | Ga0501038_0007716_6548_7588 | 341 |
| 682 | 3300049575 | Ga0501039_0009882 | Ga0501039_0009882_316_1356 | 341 |
| 683 | 3300049579 | Ga0501043_0010435 | Ga0501043_0010435_40_1080 | 341 |
| 684 | 3300049579 | Ga0501043_0137555 | Ga0501043_0137555_501_1541 | 341 |
| 685 | 3300049581 | Ga0501047_0002365 | Ga0501047_0002365_10261_11301 | 341 |
| 686 | 3300049581 | Ga0501047_0006105 | Ga0501047_0006105_10224_11258 | 341 |
| 687 | 3300049588 | Ga0501072_0190887 | Ga0501072_0190887_461_1489 | 341 |
| 688 | 3300049822 | Ga0501035_0073727 | Ga0501035_0073727_158_1198 | 341 |
| 689 | 3300049822 | Ga0501035_0121969 | Ga0501035_0121969_794_1822 | 341 |
| 690 | 3300049823 | Ga0501044_0015504 | Ga0501044_0015504_626_1666 | 341 |
| 691 | 3300049823 | Ga0501044_0148840 | Ga0501044_0148840_1233_2261 | 341 |
| 692 | 3300049823 | Ga0501044_0363016 | Ga0501044_0363016_158_1198 | 341 |
| 693 | 3300050507 | nmdc:mga05p37_109386_c1 | nmdc:mga05p37_109386_c1_410_1438 | 341 |
| 694 | 3300050508 | nmdc:mga09592_1071_c1 | nmdc:mga09592_1071_c1_81_1109 | 341 |
| 695 | 3300050508 | nmdc:mga09592_147330_c1 | nmdc:mga09592_147330_c1_591_1628 | 341 |
| 696 | 3300050508 | nmdc:mga09592_68842_c1 | nmdc:mga09592_68842_c1_119_1153 | 341 |
| 697 | 3300050509 | nmdc:mga0qj67_191942_c1 | nmdc:mga0qj67_191942_c1_268_1296 | 341 |
| 698 | 3300050510 | nmdc:mga06r32_1494_c1 | nmdc:mga06r32_1494_c1_16984_18021 | 341 |
| 699 | 3300050511 | nmdc:mga08y16_11872_c1 | nmdc:mga08y16_11872_c1_2692_3723 | 341 |
| 700 | 3300053088 | Ga0500644_0000042 | Ga0500644_0000042_66149_67183 | 341 |
| 701 | 3300053090 | Ga0500646_0001572 | Ga0500646_0001572_1531_2565 | 341 |
| 702 | 3300053092 | Ga0500583_0002404 | Ga0500583_0002404_276_1313 | 341 |
| 703 | 3300053109 | Ga0500569_000050 | Ga0500569_000050_10250_11284 | 341 |
| 704 | 3300053130 | Ga0500642_0002824 | Ga0500642_0002824_267_1304 | 341 |
| 705 | 3300053134 | Ga0500658_0001859 | Ga0500658_0001859_5862_6896 | 341 |
| 706 | 3300053136 | Ga0500559_0021210 | Ga0500559_0021210_851_1885 | 341 |
| 707 | 3300053139 | Ga0500568_0000080 | Ga0500568_0000080_24928_25956 | 341 |
| 708 | 3300053139 | Ga0500568_0061222 | Ga0500568_0061222_110_1144 | 341 |
| 709 | 3300053142 | Ga0500577_0001039 | Ga0500577_0001039_166_1200 | 341 |
| 710 | 3300053146 | Ga0500588_0007798 | Ga0500588_0007798_524_1555 | 341 |
| 711 | 3300053153 | Ga0500616_0006507 | Ga0500616_0006507_6003_7037 | 341 |
| 712 | 3300053153 | Ga0500616_0018027 | Ga0500616_0018027_47_1078 | 341 |
| 713 | 3300053156 | Ga0500622_0000999 | Ga0500622_0000999_5112_6146 | 341 |
| 714 | 3300053156 | Ga0500622_0012218 | Ga0500622_0012218_62_1099 | 341 |
| 715 | 3300053160 | Ga0500633_0000103 | Ga0500633_0000103_7346_8380 | 341 |
| 716 | 3300053177 | Ga0500636_0016905 | Ga0500636_0016905_93_1127 | 341 |
| 717 | 3300003203 | JGI25406J46586_10000389 | JGI25406J46586_100003894 | 342 |
| 718 | 3300004803 | Ga0058862_12680979 | Ga0058862_126809791 | 342 |
| 719 | 3300005293 | Ga0065715_10212451 | Ga0065715_102124511 | 342 |
| 720 | 3300005330 | Ga0070690_100033980 | Ga0070690_1000339802 | 342 |
| 721 | 3300005334 | Ga0068869_100005421 | Ga0068869_1000054215 | 342 |
| 722 | 3300005334 | Ga0068869_100148067 | Ga0068869_1001480672 | 342 |
| 723 | 3300005334 | Ga0068869_100300906 | Ga0068869_1003009061 | 342 |
| 724 | 3300005335 | Ga0070666_10000055 | Ga0070666_1000005584 | 342 |
| 725 | 3300005336 | Ga0070680_100000160 | Ga0070680_1000001607 | 342 |
| 726 | 3300005337 | Ga0070682_100000041 | Ga0070682_10000004188 | 342 |
| 727 | 3300005337 | Ga0070682_100013705 | Ga0070682_1000137051 | 342 |
| 728 | 3300005338 | Ga0068868_100016572 | Ga0068868_1000165723 | 342 |
| 729 | 3300005339 | Ga0070660_100045762 | Ga0070660_1000457623 | 342 |
| 730 | 3300005344 | Ga0070661_100001376 | Ga0070661_1000013766 | 342 |
| 731 | 3300005344 | Ga0070661_100007905 | Ga0070661_1000079055 | 342 |
| 732 | 3300005344 | Ga0070661_100118825 | Ga0070661_1001188253 | 342 |
| 733 | 3300005344 | Ga0070661_100191562 | Ga0070661_1001915622 | 342 |
| 734 | 3300005355 | Ga0070671_100037638 | Ga0070671_1000376382 | 342 |
| 735 | 3300005365 | Ga0070688_100097256 | Ga0070688_1000972562 | 342 |
| 736 | 3300005365 | Ga0070688_100191164 | Ga0070688_1001911641 | 342 |
| 737 | 3300005366 | Ga0070659_100005889 | Ga0070659_1000058893 | 342 |
| 738 | 3300005366 | Ga0070659_100017088 | Ga0070659_1000170884 | 342 |
| 739 | 3300005367 | Ga0070667_100023520 | Ga0070667_1000235204 | 342 |
| 740 | 3300005367 | Ga0070667_100283877 | Ga0070667_1002838772 | 342 |
| 741 | 3300005456 | Ga0070678_100228650 | Ga0070678_1002286502 | 342 |
| 742 | 3300005457 | Ga0070662_100036365 | Ga0070662_1000363652 | 342 |
| 743 | 3300005459 | Ga0068867_100026998 | Ga0068867_1000269982 | 342 |
| 744 | 3300005459 | Ga0068867_100042723 | Ga0068867_1000427234 | 342 |
| 745 | 3300005459 | Ga0068867_100059980 | Ga0068867_1000599802 | 342 |
| 746 | 3300005459 | Ga0068867_100325519 | Ga0068867_1003255192 | 342 |
| 747 | 3300005535 | Ga0070684_100003135 | Ga0070684_1000031357 | 342 |
| 748 | 3300005535 | Ga0070684_100004694 | Ga0070684_1000046945 | 342 |
| 749 | 3300005535 | Ga0070684_100322443 | Ga0070684_1003224431 | 342 |
| 750 | 3300005539 | Ga0068853_100001210 | Ga0068853_1000012107 | 342 |
| 751 | 3300005539 | Ga0068853_100029333 | Ga0068853_1000293335 | 342 |
| 752 | 3300005539 | Ga0068853_100045147 | Ga0068853_1000451473 | 342 |
| 753 | 3300005539 | Ga0068853_100057198 | Ga0068853_1000571983 | 342 |
| 754 | 3300005539 | Ga0068853_100063355 | Ga0068853_1000633553 | 342 |
| 755 | 3300005539 | Ga0068853_100156707 | Ga0068853_1001567073 | 342 |
| 756 | 3300005539 | Ga0068853_100355185 | Ga0068853_1003551851 | 342 |
| 757 | 3300005539 | Ga0068853_100432447 | Ga0068853_1004324471 | 342 |
| 758 | 3300005543 | Ga0070672_100358777 | Ga0070672_1003587771 | 342 |
| 759 | 3300005548 | Ga0070665_100160414 | Ga0070665_1001604142 | 342 |
| 760 | 3300005563 | Ga0068855_100026010 | Ga0068855_1000260103 | 342 |
| 761 | 3300005564 | Ga0070664_100024601 | Ga0070664_1000246013 | 342 |
| 762 | 3300005564 | Ga0070664_100344812 | Ga0070664_1003448121 | 342 |
| 763 | 3300005577 | Ga0068857_100008662 | Ga0068857_1000086627 | 342 |
| 764 | 3300005577 | Ga0068857_100065629 | Ga0068857_1000656292 | 342 |
| 765 | 3300005577 | Ga0068857_100189460 | Ga0068857_1001894602 | 342 |
| 766 | 3300005616 | Ga0068852_100472911 | Ga0068852_1004729111 | 342 |
| 767 | 3300005617 | Ga0068859_100000003 | Ga0068859_1000000036 | 342 |
| 768 | 3300005617 | Ga0068859_100001878 | Ga0068859_10000187818 | 342 |
| 769 | 3300005617 | Ga0068859_100068033 | Ga0068859_1000680333 | 342 |
| 770 | 3300005618 | Ga0068864_100059844 | Ga0068864_1000598442 | 342 |
| 771 | 3300005718 | Ga0068866_10031537 | Ga0068866_100315373 | 342 |
| 772 | 3300005834 | Ga0068851_10070467 | Ga0068851_100704672 | 342 |
| 773 | 3300005840 | Ga0068870_10019323 | Ga0068870_100193232 | 342 |
| 774 | 3300005841 | Ga0068863_100004080 | Ga0068863_10000408017 | 342 |
| 775 | 3300005841 | Ga0068863_100020280 | Ga0068863_1000202804 | 342 |
| 776 | 3300005842 | Ga0068858_100267452 | Ga0068858_1002674521 | 342 |
| 777 | 3300005843 | Ga0068860_100008704 | Ga0068860_1000087047 | 342 |
| 778 | 3300005844 | Ga0068862_100064589 | Ga0068862_1000645892 | 342 |
| 779 | 3300005985 | Ga0081539_10001948 | Ga0081539_100019489 | 342 |
| 780 | 3300005985 | Ga0081539_10006848 | Ga0081539_100068487 | 342 |
| 781 | 3300006237 | Ga0097621_100000109 | Ga0097621_1000001099 | 342 |
| 782 | 3300006237 | Ga0097621_100021751 | Ga0097621_1000217512 | 342 |
| 783 | 3300006237 | Ga0097621_100200092 | Ga0097621_1002000922 | 342 |
| 784 | 3300006358 | Ga0068871_100002333 | Ga0068871_1000023339 | 342 |
| 785 | 3300006358 | Ga0068871_100004004 | Ga0068871_1000040043 | 342 |
| 786 | 3300006931 | Ga0097620_100000003 | Ga0097620_1000000036 | 342 |
| 787 | 3300006931 | Ga0097620_100001878 | Ga0097620_1000018782 | 342 |
| 788 | 3300006931 | Ga0097620_100068033 | Ga0097620_1000680333 | 342 |
| 789 | 3300009093 | Ga0105240_10003561 | Ga0105240_100035618 | 342 |
| 790 | 3300009093 | Ga0105240_10111545 | Ga0105240_101115451 | 342 |
| 791 | 3300009098 | Ga0105245_10059034 | Ga0105245_100590344 | 342 |
| 792 | 3300009174 | Ga0105241_10001234 | Ga0105241_1000123418 | 342 |
| 793 | 3300009174 | Ga0105241_10002426 | Ga0105241_100024262 | 342 |
| 794 | 3300009176 | Ga0105242_10031800 | Ga0105242_100318002 | 342 |
| 795 | 3300009176 | Ga0105242_10073555 | Ga0105242_100735551 | 342 |
| 796 | 3300009176 | Ga0105242_10122574 | Ga0105242_101225743 | 342 |
| 797 | 3300009177 | Ga0105248_10002485 | Ga0105248_1000248518 | 342 |
| 798 | 3300009545 | Ga0105237_10002430 | Ga0105237_1000243021 | 342 |
| 799 | 3300009553 | Ga0105249_10107186 | Ga0105249_101071863 | 342 |
| 800 | 3300010375 | Ga0105239_10095902 | Ga0105239_100959022 | 342 |
| 801 | 3300013100 | Ga0157373_10012596 | Ga0157373_100125962 | 342 |
| 802 | 3300013100 | Ga0157373_10058387 | Ga0157373_100583872 | 342 |
| 803 | 3300013102 | Ga0157371_10021059 | Ga0157371_100210592 | 342 |
| 804 | 3300013102 | Ga0157371_10041967 | Ga0157371_100419672 | 342 |
| 805 | 3300013102 | Ga0157371_10186089 | Ga0157371_101860891 | 342 |
| 806 | 3300013104 | Ga0157370_10002572 | Ga0157370_1000257220 | 342 |
| 807 | 3300013105 | Ga0157369_10002663 | Ga0157369_1000266319 | 342 |
| 808 | 3300013105 | Ga0157369_10075372 | Ga0157369_100753723 | 342 |
| 809 | 3300013105 | Ga0157369_10113312 | Ga0157369_101133122 | 342 |
| 810 | 3300013296 | Ga0157374_10008165 | Ga0157374_100081655 | 342 |
| 811 | 3300013296 | Ga0157374_10044017 | Ga0157374_100440173 | 342 |
| 812 | 3300013296 | Ga0157374_10056493 | Ga0157374_100564932 | 342 |
| 813 | 3300013296 | Ga0157374_10079191 | Ga0157374_100791912 | 342 |
| 814 | 3300013296 | Ga0157374_10325504 | Ga0157374_103255042 | 342 |
| 815 | 3300013297 | Ga0157378_10024055 | Ga0157378_100240554 | 342 |
| 816 | 3300013297 | Ga0157378_10202165 | Ga0157378_102021652 | 342 |
| 817 | 3300013297 | Ga0157378_10211878 | Ga0157378_102118781 | 342 |
| 818 | 3300013297 | Ga0157378_10456758 | Ga0157378_104567581 | 342 |
| 819 | 3300013306 | Ga0163162_10000579 | Ga0163162_100005799 | 342 |
| 820 | 3300013306 | Ga0163162_10000612 | Ga0163162_1000061239 | 342 |
| 821 | 3300013306 | Ga0163162_10001718 | Ga0163162_100017183 | 342 |
| 822 | 3300013306 | Ga0163162_10007132 | Ga0163162_100071323 | 342 |
| 823 | 3300013306 | Ga0163162_10008479 | Ga0163162_1000847910 | 342 |
| 824 | 3300013306 | Ga0163162_10103157 | Ga0163162_101031572 | 342 |
| 825 | 3300013306 | Ga0163162_10129461 | Ga0163162_101294613 | 342 |
| 826 | 3300013306 | Ga0163162_10154466 | Ga0163162_101544661 | 342 |
| 827 | 3300013306 | Ga0163162_10500127 | Ga0163162_105001271 | 342 |
| 828 | 3300013308 | Ga0157375_10002298 | Ga0157375_100022988 | 342 |
| 829 | 3300013308 | Ga0157375_10063784 | Ga0157375_100637842 | 342 |
| 830 | 3300013308 | Ga0157375_10071325 | Ga0157375_100713253 | 342 |
| 831 | 3300013308 | Ga0157375_10103890 | Ga0157375_101038902 | 342 |
| 832 | 3300013308 | Ga0157375_10317584 | Ga0157375_103175842 | 342 |
| 833 | 3300013308 | Ga0157375_10345753 | Ga0157375_103457532 | 342 |
| 834 | 3300013308 | Ga0157375_10370833 | Ga0157375_103708331 | 342 |
| 835 | 3300014325 | Ga0163163_10000325 | Ga0163163_1000032540 | 342 |
| 836 | 3300014325 | Ga0163163_10000401 | Ga0163163_1000040132 | 342 |
| 837 | 3300014325 | Ga0163163_10131419 | Ga0163163_101314192 | 342 |
| 838 | 3300014745 | Ga0157377_10013802 | Ga0157377_100138022 | 342 |
| 839 | 3300014745 | Ga0157377_10042283 | Ga0157377_100422833 | 342 |
| 840 | 3300014745 | Ga0157377_10074302 | Ga0157377_100743022 | 342 |
| 841 | 3300014968 | Ga0157379_10027729 | Ga0157379_100277292 | 342 |
| 842 | 3300014968 | Ga0157379_10110109 | Ga0157379_101101093 | 342 |
| 843 | 3300014968 | Ga0157379_10186655 | Ga0157379_101866551 | 342 |
| 844 | 3300014969 | Ga0157376_10007180 | Ga0157376_100071802 | 342 |
| 845 | 3300014969 | Ga0157376_10026343 | Ga0157376_100263433 | 342 |
| 846 | 3300014969 | Ga0157376_10074918 | Ga0157376_100749183 | 342 |
| 847 | 3300014969 | Ga0157376_10111712 | Ga0157376_101117122 | 342 |
| 848 | 3300017792 | Ga0163161_10008477 | Ga0163161_100084773 | 342 |
| 849 | 3300017792 | Ga0163161_10031847 | Ga0163161_100318472 | 342 |
| 850 | 3300017792 | Ga0163161_10086648 | Ga0163161_100866482 | 342 |
| 851 | 3300025271 | Ga0207666_1006039 | Ga0207666_10060391 | 342 |
| 852 | 3300025903 | Ga0207680_10000021 | Ga0207680_1000002186 | 342 |
| 853 | 3300025903 | Ga0207680_10043510 | Ga0207680_100435102 | 342 |
| 854 | 3300025903 | Ga0207680_10099567 | Ga0207680_100995672 | 342 |
| 855 | 3300025904 | Ga0207647_10034227 | Ga0207647_100342272 | 342 |
| 856 | 3300025904 | Ga0207647_10059421 | Ga0207647_100594212 | 342 |
| 857 | 3300025911 | Ga0207654_10001146 | Ga0207654_100011462 | 342 |
| 858 | 3300025911 | Ga0207654_10001929 | Ga0207654_100019297 | 342 |
| 859 | 3300025912 | Ga0207707_10001895 | Ga0207707_100018956 | 342 |
| 860 | 3300025913 | Ga0207695_10041821 | Ga0207695_100418212 | 342 |
| 861 | 3300025914 | Ga0207671_10005577 | Ga0207671_1000557710 | 342 |
| 862 | 3300025917 | Ga0207660_10003317 | Ga0207660_100033176 | 342 |
| 863 | 3300025917 | Ga0207660_10083138 | Ga0207660_100831383 | 342 |
| 864 | 3300025917 | Ga0207660_10293697 | Ga0207660_102936971 | 342 |
| 865 | 3300025919 | Ga0207657_10000872 | Ga0207657_1000087219 | 342 |
| 866 | 3300025920 | Ga0207649_10002669 | Ga0207649_100026692 | 342 |
| 867 | 3300025920 | Ga0207649_10007975 | Ga0207649_100079754 | 342 |
| 868 | 3300025921 | Ga0207652_10001340 | Ga0207652_100013405 | 342 |
| 869 | 3300025923 | Ga0207681_10080269 | Ga0207681_100802692 | 342 |
| 870 | 3300025931 | Ga0207644_10019394 | Ga0207644_100193943 | 342 |
| 871 | 3300025931 | Ga0207644_10092644 | Ga0207644_100926442 | 342 |
| 872 | 3300025932 | Ga0207690_10007408 | Ga0207690_100074086 | 342 |
| 873 | 3300025933 | Ga0207706_10005563 | Ga0207706_100055633 | 342 |
| 874 | 3300025933 | Ga0207706_10007108 | Ga0207706_100071085 | 342 |
| 875 | 3300025933 | Ga0207706_10017416 | Ga0207706_100174165 | 342 |
| 876 | 3300025933 | Ga0207706_10288164 | Ga0207706_102881642 | 342 |
| 877 | 3300025934 | Ga0207686_10065257 | Ga0207686_100652571 | 342 |
| 878 | 3300025942 | Ga0207689_10007312 | Ga0207689_100073125 | 342 |
| 879 | 3300025942 | Ga0207689_10026457 | Ga0207689_100264572 | 342 |
| 880 | 3300025942 | Ga0207689_10041325 | Ga0207689_100413254 | 342 |
| 881 | 3300025942 | Ga0207689_10054156 | Ga0207689_100541562 | 342 |
| 882 | 3300025944 | Ga0207661_10022692 | Ga0207661_100226922 | 342 |
| 883 | 3300025944 | Ga0207661_10092258 | Ga0207661_100922583 | 342 |
| 884 | 3300025944 | Ga0207661_10153835 | Ga0207661_101538352 | 342 |
| 885 | 3300025945 | Ga0207679_10003411 | Ga0207679_100034116 | 342 |
| 886 | 3300025945 | Ga0207679_10008941 | Ga0207679_100089413 | 342 |
| 887 | 3300025945 | Ga0207679_10049474 | Ga0207679_100494743 | 342 |
| 888 | 3300025960 | Ga0207651_10002518 | Ga0207651_100025182 | 342 |
| 889 | 3300025960 | Ga0207651_10124628 | Ga0207651_101246283 | 342 |
| 890 | 3300025961 | Ga0207712_10004528 | Ga0207712_100045289 | 342 |
| 891 | 3300025972 | Ga0207668_10155070 | Ga0207668_101550701 | 342 |
| 892 | 3300025981 | Ga0207640_10037747 | Ga0207640_100377473 | 342 |
| 893 | 3300026023 | Ga0207677_10008822 | Ga0207677_100088222 | 342 |
| 894 | 3300026035 | Ga0207703_10005370 | Ga0207703_100053707 | 342 |
| 895 | 3300026041 | Ga0207639_10001239 | Ga0207639_100012395 | 342 |
| 896 | 3300026041 | Ga0207639_10001990 | Ga0207639_100019903 | 342 |
| 897 | 3300026041 | Ga0207639_10013623 | Ga0207639_100136237 | 342 |
| 898 | 3300026041 | Ga0207639_10022693 | Ga0207639_100226932 | 342 |
| 899 | 3300026041 | Ga0207639_10128966 | Ga0207639_101289663 | 342 |
| 900 | 3300026088 | Ga0207641_10000442 | Ga0207641_1000044258 | 342 |
| 901 | 3300026089 | Ga0207648_10021151 | Ga0207648_100211512 | 342 |
| 902 | 3300026089 | Ga0207648_10033840 | Ga0207648_100338404 | 342 |
| 903 | 3300026089 | Ga0207648_10261965 | Ga0207648_102619653 | 342 |
| 904 | 3300026095 | Ga0207676_10008995 | Ga0207676_100089953 | 342 |
| 905 | 3300026095 | Ga0207676_10026560 | Ga0207676_100265602 | 342 |
| 906 | 3300026095 | Ga0207676_10174654 | Ga0207676_101746543 | 342 |
| 907 | 3300026095 | Ga0207676_10274671 | Ga0207676_102746711 | 342 |
| 908 | 3300026116 | Ga0207674_10008317 | Ga0207674_100083174 | 342 |
| 909 | 3300026116 | Ga0207674_10014298 | Ga0207674_100142983 | 342 |
| 910 | 3300026116 | Ga0207674_10022907 | Ga0207674_100229077 | 342 |
| 911 | 3300026116 | Ga0207674_10093400 | Ga0207674_100934002 | 342 |
| 912 | 3300026121 | Ga0207683_10037479 | Ga0207683_100374793 | 342 |
| 913 | 3300026121 | Ga0207683_10076934 | Ga0207683_100769342 | 342 |
| 914 | 3300026121 | Ga0207683_10298054 | Ga0207683_102980541 | 342 |
| 915 | 3300026142 | Ga0207698_10036469 | Ga0207698_100364694 | 342 |
| 916 | 3300028379 | Ga0268266_10260800 | Ga0268266_102608002 | 342 |
| 917 | 3300028381 | Ga0268264_10001559 | Ga0268264_1000155916 | 342 |
| 918 | 3300028381 | Ga0268264_10053315 | Ga0268264_100533152 | 342 |
| 919 | 3300028381 | Ga0268264_10242039 | Ga0268264_102420392 | 342 |
| 920 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012518 | 342 |
| 921 | 3300032004 | Ga0307414_10140502 | Ga0307414_101405022 | 342 |
| 922 | 3300032004 | Ga0307414_10167145 | Ga0307414_101671451 | 342 |
| 923 | 3300035086 | Ga0373934_0018361 | Ga0373934_0018361_273_1304 | 342 |
| 924 | 3300035119 | Ga0373956_0062079 | Ga0373956_0062079_268_1299 | 342 |
| 925 | 3300035410 | Ga0373924_0074377 | Ga0373924_0074377_254_1285 | 342 |
| 926 | 3300035724 | Ga0373933_0191245 | Ga0373933_0191245_226_1257 | 342 |
| 927 | 3300036401 | Ga0373937_0042272 | Ga0373937_0042272_2302_3333 | 342 |
| 928 | 3300042876 | Ga0451577_0065168 | Ga0451577_0065168_1191_2228 | 342 |
| 929 | 3300044712 | Ga0453684_0091310 | Ga0453684_0091310_2294_3331 | 342 |
| 930 | 3300044712 | Ga0453684_0571710 | Ga0453684_0571710_70_1107 | 342 |
| 931 | 3300046459 | Ga0495629_0313205 | Ga0495629_0313205_10_1050 | 342 |
| 932 | 3300046511 | Ga0495608_0078413 | Ga0495608_0078413_595_1626 | 342 |
| 933 | 3300046514 | Ga0495618_0127766 | Ga0495618_0127766_202_1233 | 342 |
| 934 | 3300046516 | Ga0495628_0045482 | Ga0495628_0045482_665_1696 | 342 |
| 935 | 3300046517 | Ga0495630_0015688 | Ga0495630_0015688_1389_2420 | 342 |
| 936 | 3300046531 | Ga0495665_0075053 | Ga0495665_0075053_465_1505 | 342 |
| 937 | 3300046533 | Ga0495640_0151288 | Ga0495640_0151288_56_1087 | 342 |
| 938 | 3300046616 | Ga0495668_0000023 | Ga0495668_0000023_119576_120613 | 342 |
| 939 | 3300046642 | Ga0495634_0188854 | Ga0495634_0188854_217_1248 | 342 |
| 940 | 3300046680 | Ga0495646_0056812 | Ga0495646_0056812_1187_2218 | 342 |
| 941 | 3300046683 | Ga0495658_0009564 | Ga0495658_0009564_18_1058 | 342 |
| 942 | 3300046809 | Ga0495600_0219351 | Ga0495600_0219351_98_1138 | 342 |
| 943 | 3300047317 | Ga0495604_0048861 | Ga0495604_0048861_1732_2763 | 342 |
| 944 | 3300047319 | Ga0495674_0097513 | Ga0495674_0097513_765_1796 | 342 |
| 945 | 3300047319 | Ga0495674_0243048 | Ga0495674_0243048_179_1219 | 342 |
| 946 | 3300047322 | Ga0495680_0052668 | Ga0495680_0052668_678_1709 | 342 |
| 947 | 3300048088 | Ga0495602_0196201 | Ga0495602_0196201_472_1512 | 342 |
| 948 | 3300048905 | Ga0496102_0276044 | Ga0496102_0276044_55_1089 | 342 |
| 949 | 3300048907 | Ga0496104_0378445 | Ga0496104_0378445_198_1232 | 342 |
| 950 | 3300049571 | Ga0501034_0000152 | Ga0501034_0000152_115937_116971 | 342 |
| 951 | 3300049575 | Ga0501039_0181712 | Ga0501039_0181712_497_1537 | 342 |
| 952 | 3300049580 | Ga0501046_0032568 | Ga0501046_0032568_1357_2397 | 342 |
| 953 | 3300049581 | Ga0501047_0050222 | Ga0501047_0050222_2038_3078 | 342 |
| 954 | 3300049586 | Ga0501070_0026484 | Ga0501070_0026484_1148_2188 | 342 |
| 955 | 3300049587 | Ga0501071_0032292 | Ga0501071_0032292_2463_3503 | 342 |
| 956 | 3300049588 | Ga0501072_0120761 | Ga0501072_0120761_42_1073 | 342 |
| 957 | 3300049589 | Ga0501073_0009804 | Ga0501073_0009804_5094_6134 | 342 |
| 958 | 3300049590 | Ga0501074_0143642 | Ga0501074_0143642_639_1679 | 342 |
| 959 | 3300049649 | Ga0501198_001567 | Ga0501198_001567_1711_2742 | 342 |
| 960 | 3300049651 | Ga0501201_000708 | Ga0501201_000708_1500_2531 | 342 |
| 961 | 3300049658 | Ga0501211_005956 | Ga0501211_005956_71_1102 | 342 |
| 962 | 3300049663 | Ga0501223_000907 | Ga0501223_000907_138_1169 | 342 |
| 963 | 3300049669 | Ga0501235_003174 | Ga0501235_003174_313_1344 | 342 |
| 964 | 3300049688 | Ga0501259_000504 | Ga0501259_000504_1723_2754 | 342 |
| 965 | 3300049704 | Ga0501221_000752 | Ga0501221_000752_3065_4096 | 342 |
| 966 | 3300049705 | Ga0501225_0007520 | Ga0501225_0007520_1282_2313 | 342 |
| 967 | 3300049708 | Ga0501245_000835 | Ga0501245_000835_456_1487 | 342 |
| 968 | 3300049742 | Ga0501080_0299039 | Ga0501080_0299039_139_1188 | 342 |
| 969 | 3300049765 | Ga0501268_019853 | Ga0501268_019853_33_1061 | 342 |
| 970 | 3300049823 | Ga0501044_0021151 | Ga0501044_0021151_2620_3660 | 342 |
| 971 | 3300050512 | nmdc:mga0n895_78750_c1 | nmdc:mga0n895_78750_c1_255_1286 | 342 |
| 972 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_259748_260779 | 342 |
| 973 | 3300054114 | Ga0501084_0023012 | Ga0501084_0023012_3945_4985 | 342 |
| 974 | 3300060353 | Ga0501082_0059802 | Ga0501082_0059802_2128_3168 | 342 |
| 975 | 3300001904 | JGI24736J21556_1004228 | JGI24736J21556_10042283 | 343 |
| 976 | 3300005290 | Ga0065712_10086854 | Ga0065712_100868542 | 343 |
| 977 | 3300005329 | Ga0070683_100015725 | Ga0070683_1000157257 | 343 |
| 978 | 3300005329 | Ga0070683_100078532 | Ga0070683_1000785321 | 343 |
| 979 | 3300005331 | Ga0070670_100005023 | Ga0070670_1000050236 | 343 |
| 980 | 3300005331 | Ga0070670_100038908 | Ga0070670_1000389084 | 343 |
| 981 | 3300005331 | Ga0070670_100087294 | Ga0070670_1000872942 | 343 |
| 982 | 3300005338 | Ga0068868_100024924 | Ga0068868_1000249242 | 343 |
| 983 | 3300005344 | Ga0070661_100096116 | Ga0070661_1000961162 | 343 |
| 984 | 3300005355 | Ga0070671_100153844 | Ga0070671_1001538443 | 343 |
| 985 | 3300005366 | Ga0070659_100015884 | Ga0070659_1000158844 | 343 |
| 986 | 3300005367 | Ga0070667_100020920 | Ga0070667_1000209203 | 343 |
| 987 | 3300005548 | Ga0070665_100142955 | Ga0070665_1001429552 | 343 |
| 988 | 3300005564 | Ga0070664_100037259 | Ga0070664_1000372593 | 343 |
| 989 | 3300005616 | Ga0068852_100082859 | Ga0068852_1000828592 | 343 |
| 990 | 3300005616 | Ga0068852_100153405 | Ga0068852_1001534052 | 343 |
| 991 | 3300005616 | Ga0068852_100169896 | Ga0068852_1001698962 | 343 |
| 992 | 3300005616 | Ga0068852_100350968 | Ga0068852_1003509682 | 343 |
| 993 | 3300005617 | Ga0068859_100009053 | Ga0068859_10000905316 | 343 |
| 994 | 3300005617 | Ga0068859_100425651 | Ga0068859_1004256513 | 343 |
| 995 | 3300005618 | Ga0068864_100121541 | Ga0068864_1001215413 | 343 |
| 996 | 3300005718 | Ga0068866_10050954 | Ga0068866_100509542 | 343 |
| 997 | 3300005834 | Ga0068851_10009472 | Ga0068851_100094724 | 343 |
| 998 | 3300005841 | Ga0068863_100022024 | Ga0068863_1000220247 | 343 |
| 999 | 3300005843 | Ga0068860_100003395 | Ga0068860_10000339510 | 343 |
| 1000 | 3300005843 | Ga0068860_100017358 | Ga0068860_1000173585 | 343 |
| 1001 | 3300006931 | Ga0097620_100009053 | Ga0097620_10000905316 | 343 |
| 1002 | 3300006931 | Ga0097620_100425572 | Ga0097620_1004255723 | 343 |
| 1003 | 3300009093 | Ga0105240_10000011 | Ga0105240_10000011480 | 343 |
| 1004 | 3300009545 | Ga0105237_10249408 | Ga0105237_102494082 | 343 |
| 1005 | 3300009553 | Ga0105249_10116448 | Ga0105249_101164482 | 343 |
| 1006 | 3300010375 | Ga0105239_10004264 | Ga0105239_1000426411 | 343 |
| 1007 | 3300013105 | Ga0157369_10414016 | Ga0157369_104140162 | 343 |
| 1008 | 3300013296 | Ga0157374_10037083 | Ga0157374_100370833 | 343 |
| 1009 | 3300013296 | Ga0157374_10045228 | Ga0157374_100452283 | 343 |
| 1010 | 3300013296 | Ga0157374_10272271 | Ga0157374_102722711 | 343 |
| 1011 | 3300013297 | Ga0157378_10009840 | Ga0157378_100098405 | 343 |
| 1012 | 3300013297 | Ga0157378_10364872 | Ga0157378_103648722 | 343 |
| 1013 | 3300013306 | Ga0163162_10100604 | Ga0163162_101006043 | 343 |
| 1014 | 3300013306 | Ga0163162_10685843 | Ga0163162_106858431 | 343 |
| 1015 | 3300013307 | Ga0157372_10034953 | Ga0157372_100349532 | 343 |
| 1016 | 3300013307 | Ga0157372_10436106 | Ga0157372_104361061 | 343 |
| 1017 | 3300013307 | Ga0157372_10538576 | Ga0157372_105385762 | 343 |
| 1018 | 3300014325 | Ga0163163_10002269 | Ga0163163_100022699 | 343 |
| 1019 | 3300021384 | Ga0213876_10014861 | Ga0213876_100148613 | 343 |
| 1020 | 3300025904 | Ga0207647_10000025 | Ga0207647_1000002550 | 343 |
| 1021 | 3300025913 | Ga0207695_10000010 | Ga0207695_10000010871 | 343 |
| 1022 | 3300025919 | Ga0207657_10231445 | Ga0207657_102314452 | 343 |
| 1023 | 3300025920 | Ga0207649_10075138 | Ga0207649_100751382 | 343 |
| 1024 | 3300025921 | Ga0207652_10078746 | Ga0207652_100787462 | 343 |
| 1025 | 3300025925 | Ga0207650_10000730 | Ga0207650_100007303 | 343 |
| 1026 | 3300025925 | Ga0207650_10185231 | Ga0207650_101852311 | 343 |
| 1027 | 3300025925 | Ga0207650_10245322 | Ga0207650_102453221 | 343 |
| 1028 | 3300025925 | Ga0207650_10314606 | Ga0207650_103146061 | 343 |
| 1029 | 3300025926 | Ga0207659_10021036 | Ga0207659_100210364 | 343 |
| 1030 | 3300025932 | Ga0207690_10014109 | Ga0207690_100141093 | 343 |
| 1031 | 3300025940 | Ga0207691_10045725 | Ga0207691_100457253 | 343 |
| 1032 | 3300025944 | Ga0207661_10110271 | Ga0207661_101102713 | 343 |
| 1033 | 3300025945 | Ga0207679_10029132 | Ga0207679_100291325 | 343 |
| 1034 | 3300025986 | Ga0207658_10017648 | Ga0207658_100176484 | 343 |
| 1035 | 3300026023 | Ga0207677_10009528 | Ga0207677_100095285 | 343 |
| 1036 | 3300026041 | Ga0207639_10084413 | Ga0207639_100844132 | 343 |
| 1037 | 3300026088 | Ga0207641_10020809 | Ga0207641_100208096 | 343 |
| 1038 | 3300026095 | Ga0207676_10231403 | Ga0207676_102314032 | 343 |
| 1039 | 3300026116 | Ga0207674_10162543 | Ga0207674_101625433 | 343 |
| 1040 | 3300026121 | Ga0207683_10484752 | Ga0207683_104847521 | 343 |
| 1041 | 3300026142 | Ga0207698_10007926 | Ga0207698_100079266 | 343 |
| 1042 | 3300028379 | Ga0268266_10104009 | Ga0268266_101040092 | 343 |
| 1043 | 3300028794 | Ga0307515_10001257 | Ga0307515_1000125714 | 343 |
| 1044 | 3300031251 | Ga0265327_10000254 | Ga0265327_100002549 | 343 |
| 1045 | 3300031251 | Ga0265327_10024663 | Ga0265327_100246634 | 343 |
| 1046 | 3300031251 | Ga0265327_10048013 | Ga0265327_100480132 | 343 |
| 1047 | 3300031548 | Ga0307408_100395488 | Ga0307408_1003954881 | 343 |
| 1048 | 3300031731 | Ga0307405_10053369 | Ga0307405_100533693 | 343 |
| 1049 | 3300031901 | Ga0307406_10043066 | Ga0307406_100430664 | 343 |
| 1050 | 3300031903 | Ga0307407_10045860 | Ga0307407_100458603 | 343 |
| 1051 | 3300031911 | Ga0307412_10030722 | Ga0307412_100307223 | 343 |
| 1052 | 3300032002 | Ga0307416_100061289 | Ga0307416_1000612892 | 343 |
| 1053 | 3300032126 | Ga0307415_100022671 | Ga0307415_1000226713 | 343 |
| 1054 | 3300037471 | Ga0395905_0000565 | Ga0395905_0000565_45086_46120 | 343 |
| 1055 | 3300039437 | Ga0436365_0257946 | Ga0436365_0257946_10_1050 | 343 |
| 1056 | 3300039437 | Ga0436365_0473715 | Ga0436365_0473715_152_1189 | 343 |
| 1057 | 3300039437 | Ga0436365_0987978 | Ga0436365_0987978_54863_55903 | 343 |
| 1058 | 3300039437 | Ga0436365_1175459 | Ga0436365_1175459_682_1719 | 343 |
| 1059 | 3300045049 | Ga0466959_0115651 | Ga0466959_0115651_728_1759 | 343 |
| 1060 | 3300049571 | Ga0501034_0434242 | Ga0501034_0434242_129_1166 | 343 |
| 1061 | 3300049572 | Ga0501036_0173546 | Ga0501036_0173546_531_1568 | 343 |
| 1062 | 3300049573 | Ga0501037_0176095 | Ga0501037_0176095_295_1332 | 343 |
| 1063 | 3300049579 | Ga0501043_0073170 | Ga0501043_0073170_199_1230 | 343 |
| 1064 | 3300049649 | Ga0501198_001716 | Ga0501198_001716_229_1269 | 343 |
| 1065 | 3300049652 | Ga0501202_003368 | Ga0501202_003368_185_1225 | 343 |
| 1066 | 3300049669 | Ga0501235_039723 | Ga0501235_039723_17_1057 | 343 |
| 1067 | 3300049680 | Ga0501250_003742 | Ga0501250_003742_22_1056 | 343 |
| 1068 | 3300049708 | Ga0501245_000897 | Ga0501245_000897_2019_3053 | 343 |
| 1069 | 3300049763 | Ga0501266_003028 | Ga0501266_003028_422_1456 | 343 |
| 1070 | 3300049823 | Ga0501044_0062152 | Ga0501044_0062152_1178_2266 | 343 |
| 1071 | 3300049823 | Ga0501044_0149920 | Ga0501044_0149920_586_1623 | 343 |
| 1072 | 3300053090 | Ga0500646_0003741 | Ga0500646_0003741_2011_3048 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6n2o-assembly1.cif.gz_D | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.8812 | 23 | 339 |
| 6n2o-assembly1.cif.gz_D | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.8151 | 23 | 339 |
| 2c3u-assembly1.cif.gz_B | crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form | 0.8051 | 25 | 208 |
| 6cip-assembly2.cif.gz_C | pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound | 0.7861 | 49 | 225 |
| 5b47-assembly1.cif.gz_B-2 | 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex | 0.7851 | 24 | 339 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53181_117_260_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9306 | 86 | 223 | 3.40.50.970 |
| af_Q57957_74_243_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9244 | 82 | 205 | 3.40.50.970 |
| af_Q2FZ04_70_219_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9141 | 80 | 222 | 3.40.50.970 |
| af_O53181_117_260_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8875 | 86 | 223 | 3.40.50.970 |
| af_Q2FZ04_70_219_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8681 | 80 | 222 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383BPC6-F1-model_v4 | Thiamine pyrophosphate enzyme TPP-binding domain-containing protein | 0.9633 | 62 | 311 |
GO:0016625
GO:0030976 |
| AF-A0A383BPC6-F1-model_v4 | Thiamine pyrophosphate enzyme TPP-binding domain-containing protein | 0.9557 | 62 | 311 |
GO:0016625
GO:0030976 |
| AF-A0A3A1MKG0-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.9551 | 23 | 312 |
GO:0016625
GO:0030976 |
| AF-A0A2E1ZTC2-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.9471 | 99 | 343 |
GO:0016625
GO:0030976 |
| AF-A0A7V6H050-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.9443 | 22 | 224 |
GO:0016625
GO:0030976 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar