F489538
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1074 | 568 | 2148 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100035992|Ga0070683_1000359924 |
| Length | 356 |
| Sequence | MKGTVLEPPPRGVPDDIETFSLGRTAAITDNARSPKASRFWRHGPVQRSRPGRDPKGRRLTMIPFDGELPPPFEIVEPAEWRAPIIFNSPHSGSVYPEDFLNASRIDLPTLRRSEDSFMDELIADLAAHGFPVVRVNFPRSYVDVNREPYELDPRMFAGRLPSFANTRSMRVAGGLGTIPRVVGDGQEIYRERLSVDDALTRVETLYKPYHRALRRLINRVHQSFGTVVVVDCHSMPSIGVSRDEPRRPDIVIGDRYGTSCAPLLPNRVEQTMSRLGYSVGRNKPYAGGFITEHYGNPASGLHAIQLELNRAIYMDERRREKGPRFAQVAADFAALADALATVPFGDLGPFQAAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 68 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 69 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 70 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 71 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 93 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 94 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 95 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 96 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 168 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 184 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 185 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 216 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 346 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 358 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 359 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 361 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 362 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 363 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 364 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 365 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 366 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 368 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 369 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 371 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 372 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 374 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 375 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 377 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 379 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 380 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 382 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 383 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 386 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 387 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 388 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 389 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 390 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 391 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 392 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 393 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 394 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 395 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 396 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 397 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 398 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 399 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 400 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 401 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 402 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 403 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 404 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 405 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 406 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 407 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 408 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 409 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 410 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 411 | 2791355199 | |||
| 412 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 413 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 414 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 415 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 416 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 417 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 418 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 419 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 420 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 421 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 422 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 423 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 424 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 425 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 426 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 427 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 428 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 429 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 430 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 431 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 432 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 433 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 434 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 435 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 436 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 437 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 438 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 439 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 440 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 441 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 442 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 443 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 444 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 445 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 446 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 447 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 448 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 449 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 450 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 451 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 452 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 453 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 454 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 455 | 2904699407 | |||
| 456 | 2906610324 | |||
| 457 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 458 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 459 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 460 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 461 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 462 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 463 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 464 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 465 | 2922368715 | |||
| 466 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 467 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 468 | 2922425934 | |||
| 469 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 470 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 471 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 472 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 473 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 474 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 475 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 476 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 477 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 478 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 479 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 480 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 481 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 482 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 483 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 484 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 485 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 486 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 487 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 488 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 489 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 490 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 491 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 492 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 493 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 494 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 495 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 496 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 497 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 498 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 499 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 500 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 501 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 502 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 503 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 504 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 505 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 506 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 507 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 508 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 509 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 510 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 511 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 512 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 513 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 514 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 515 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 516 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 517 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 518 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 519 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 520 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 521 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 522 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 523 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 524 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 525 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 526 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 527 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 528 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 529 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 530 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 531 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 532 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 533 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 534 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 535 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 536 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 537 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 538 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 539 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 540 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 541 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 542 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 543 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 544 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 545 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 546 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 547 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 548 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 549 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 550 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 551 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 552 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 553 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 554 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 555 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 556 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 557 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 558 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 559 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 560 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 561 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 562 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 563 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 564 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 565 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 566 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 567 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 568 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.26 |
| Metatranscriptomes | 0 |
| Isolates | 16.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.94 |
| Nodule | 14.53 |
| Rhizoplane | 7.54 |
| Rhizosphere | 59.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100035992 | 3300005329 | Bacteria | 4528 |
| 2 | JGI25406J46586_10006073 | 3300003203 | Bacteria | 5580 |
| 3 | JGI25153J46596_10004803 | 3300003215 | Bacteria | 7199 |
| 4 | JGI25153J46596_10028115 | 3300003215 | Bacteria | 1957 |
| 5 | JGI25160J50197_1024331 | 3300003354 | Bacteria | 1720 |
| 6 | JGI25404J52841_10001048 | 3300003659 | Bacteria | 4603 |
| 7 | Ga0055531_10020619 | 3300003794 | Bacteria | 2599 |
| 8 | Ga0055543_1012260 | 3300004625 | Bacteria | 1730 |
| 9 | Ga0065165_1030520 | 3300005262 | Bacteria | 1713 |
| 10 | Ga0070658_10011197 | 3300005327 | Bacteria | 7189 |
| 11 | Ga0070658_10064095 | 3300005327 | Bacteria | 2997 |
| 12 | Ga0070658_10355905 | 3300005327 | Bacteria | 1253 |
| 13 | Ga0070683_100046881 | 3300005329 | Bacteria | 3994 |
| 14 | Ga0070683_100110710 | 3300005329 | Bacteria | 2590 |
| 15 | Ga0070680_100020407 | 3300005336 | Bacteria | 5259 |
| 16 | Ga0070680_100034052 | 3300005336 | Bacteria | 4107 |
| 17 | Ga0070680_100104526 | 3300005336 | Bacteria | 2353 |
| 18 | Ga0070680_100132343 | 3300005336 | Bacteria | 2087 |
| 19 | Ga0070682_100294312 | 3300005337 | Bacteria | 1188 |
| 20 | Ga0068868_100235674 | 3300005338 | Bacteria | 1536 |
| 21 | Ga0070660_100019955 | 3300005339 | Bacteria | 4917 |
| 22 | Ga0070660_100052201 | 3300005339 | Bacteria | 3151 |
| 23 | Ga0070668_100110800 | 3300005347 | Bacteria | 2184 |
| 24 | Ga0070671_100166203 | 3300005355 | Bacteria | 1866 |
| 25 | Ga0070671_100307646 | 3300005355 | Bacteria | 1350 |
| 26 | Ga0070674_100170542 | 3300005356 | Bacteria | 1659 |
| 27 | Ga0070659_100128407 | 3300005366 | Bacteria | 2057 |
| 28 | Ga0070667_100143556 | 3300005367 | Bacteria | 2092 |
| 29 | Ga0070709_10009651 | 3300005434 | Bacteria | 5330 |
| 30 | Ga0070709_10056134 | 3300005434 | Bacteria | 2489 |
| 31 | Ga0070709_10116826 | 3300005434 | Bacteria | 1802 |
| 32 | Ga0070714_100169165 | 3300005435 | Bacteria | 1982 |
| 33 | Ga0070713_100007733 | 3300005436 | Bacteria | 7568 |
| 34 | Ga0070713_100044539 | 3300005436 | Bacteria | 3632 |
| 35 | Ga0070713_100056937 | 3300005436 | Bacteria | 3252 |
| 36 | Ga0070713_100593325 | 3300005436 | Bacteria | 1052 |
| 37 | Ga0070710_10000707 | 3300005437 | Bacteria | 15878 |
| 38 | Ga0070710_10015339 | 3300005437 | Bacteria | 3876 |
| 39 | Ga0070701_10146990 | 3300005438 | Bacteria | 1353 |
| 40 | Ga0070711_100006676 | 3300005439 | Bacteria | 6977 |
| 41 | Ga0070711_100016881 | 3300005439 | Bacteria | 4641 |
| 42 | Ga0070711_100067059 | 3300005439 | Bacteria | 2516 |
| 43 | Ga0070711_100380914 | 3300005439 | Bacteria | 1141 |
| 44 | Ga0070705_100096817 | 3300005440 | Bacteria | 1853 |
| 45 | Ga0070700_100420737 | 3300005441 | Bacteria | 1009 |
| 46 | Ga0070708_100685664 | 3300005445 | Bacteria | 965 |
| 47 | Ga0070663_100049756 | 3300005455 | Bacteria | 2978 |
| 48 | Ga0070678_100067611 | 3300005456 | Bacteria | 2660 |
| 49 | Ga0070678_100112722 | 3300005456 | Bacteria | 2130 |
| 50 | Ga0070681_10209901 | 3300005458 | Bacteria | 1863 |
| 51 | Ga0070698_100154937 | 3300005471 | Bacteria | 2237 |
| 52 | Ga0070679_100020129 | 3300005530 | Bacteria | 6502 |
| 53 | Ga0070679_100042976 | 3300005530 | Bacteria | 4501 |
| 54 | Ga0070679_100445048 | 3300005530 | Bacteria | 1240 |
| 55 | Ga0070684_100018149 | 3300005535 | Bacteria | 5789 |
| 56 | Ga0070684_100021264 | 3300005535 | Bacteria | 5395 |
| 57 | Ga0070684_100083447 | 3300005535 | Bacteria | 2831 |
| 58 | Ga0070684_100252410 | 3300005535 | Bacteria | 1612 |
| 59 | Ga0070697_100090441 | 3300005536 | Bacteria | 2530 |
| 60 | Ga0070697_100326297 | 3300005536 | Bacteria | 1322 |
| 61 | Ga0068853_100007083 | 3300005539 | Bacteria | 8970 |
| 62 | Ga0068853_100007085 | 3300005539 | Bacteria | 8969 |
| 63 | Ga0068853_100082352 | 3300005539 | Bacteria | 2818 |
| 64 | Ga0068853_100097672 | 3300005539 | Bacteria | 2593 |
| 65 | Ga0068853_100289547 | 3300005539 | Bacteria | 1512 |
| 66 | Ga0070665_100038638 | 3300005548 | Bacteria | 4798 |
| 67 | Ga0070665_100176196 | 3300005548 | Bacteria | 2139 |
| 68 | Ga0070665_100176978 | 3300005548 | Bacteria | 2134 |
| 69 | Ga0070665_100197527 | 3300005548 | Bacteria | 2012 |
| 70 | Ga0070665_100286751 | 3300005548 | Bacteria | 1648 |
| 71 | Ga0070665_100430113 | 3300005548 | Bacteria | 1329 |
| 72 | Ga0068855_100048105 | 3300005563 | Bacteria | 5035 |
| 73 | Ga0068855_100054394 | 3300005563 | Bacteria | 4704 |
| 74 | Ga0068855_100064837 | 3300005563 | Bacteria | 4260 |
| 75 | Ga0068855_100113485 | 3300005563 | Bacteria | 3108 |
| 76 | Ga0068855_100488585 | 3300005563 | Bacteria | 1339 |
| 77 | Ga0068855_100512354 | 3300005563 | Bacteria | 1302 |
| 78 | Ga0070664_100222862 | 3300005564 | Bacteria | 1688 |
| 79 | Ga0070664_100268983 | 3300005564 | Bacteria | 1535 |
| 80 | Ga0068857_100045081 | 3300005577 | Bacteria | 3912 |
| 81 | Ga0068857_100110228 | 3300005577 | Bacteria | 2473 |
| 82 | Ga0068854_100126267 | 3300005578 | Bacteria | 1948 |
| 83 | Ga0068856_100000522 | 3300005614 | Bacteria | 42457 |
| 84 | Ga0068856_100010527 | 3300005614 | Bacteria | 8980 |
| 85 | Ga0068856_100172156 | 3300005614 | Bacteria | 2177 |
| 86 | Ga0068856_100265444 | 3300005614 | Bacteria | 1732 |
| 87 | Ga0068856_100426722 | 3300005614 | Bacteria | 1346 |
| 88 | Ga0068852_100021761 | 3300005616 | Bacteria | 5129 |
| 89 | Ga0068852_100041617 | 3300005616 | Bacteria | 3884 |
| 90 | Ga0068852_100047847 | 3300005616 | Bacteria | 3651 |
| 91 | Ga0068852_100365435 | 3300005616 | Bacteria | 1412 |
| 92 | Ga0068864_100037310 | 3300005618 | Bacteria | 4147 |
| 93 | Ga0068864_100159098 | 3300005618 | Bacteria | 2052 |
| 94 | Ga0068864_100200349 | 3300005618 | Bacteria | 1833 |
| 95 | Ga0068861_100222100 | 3300005719 | Bacteria | 1597 |
| 96 | Ga0068861_100517647 | 3300005719 | Bacteria | 1081 |
| 97 | Ga0068863_100119367 | 3300005841 | Bacteria | 2514 |
| 98 | Ga0068858_100150021 | 3300005842 | Bacteria | 2192 |
| 99 | Ga0068858_100183632 | 3300005842 | Bacteria | 1975 |
| 100 | Ga0068858_100339526 | 3300005842 | Bacteria | 1437 |
| 101 | Ga0068860_100000441 | 3300005843 | Bacteria | 52446 |
| 102 | Ga0068860_100177701 | 3300005843 | Bacteria | 2057 |
| 103 | Ga0081455_10034005 | 3300005937 | Bacteria | 4573 |
| 104 | Ga0081455_10105365 | 3300005937 | Bacteria | 2254 |
| 105 | Ga0081540_1017509 | 3300005983 | Bacteria | 4433 |
| 106 | Ga0081540_1018219 | 3300005983 | Bacteria | 4316 |
| 107 | Ga0081540_1025852 | 3300005983 | Bacteria | 3367 |
| 108 | Ga0081540_1026432 | 3300005983 | Bacteria | 3313 |
| 109 | Ga0081540_1048367 | 3300005983 | Bacteria | 2131 |
| 110 | Ga0081540_1048528 | 3300005983 | Bacteria | 2126 |
| 111 | Ga0081539_10000425 | 3300005985 | Bacteria | 89942 |
| 112 | Ga0081539_10001114 | 3300005985 | Bacteria | 48756 |
| 113 | Ga0081539_10032892 | 3300005985 | Bacteria | 3168 |
| 114 | Ga0081539_10053402 | 3300005985 | Bacteria | 2263 |
| 115 | Ga0070717_10000325 | 3300006028 | Bacteria | 31034 |
| 116 | Ga0070717_10123243 | 3300006028 | Bacteria | 2222 |
| 117 | Ga0070717_10147620 | 3300006028 | Bacteria | 2032 |
| 118 | Ga0075365_10128266 | 3300006038 | Bacteria | 1754 |
| 119 | Ga0075365_10183961 | 3300006038 | Bacteria | 1461 |
| 120 | Ga0075363_100012045 | 3300006048 | Bacteria | 4157 |
| 121 | Ga0075363_100064202 | 3300006048 | Bacteria | 1983 |
| 122 | Ga0075363_100100340 | 3300006048 | Bacteria | 1601 |
| 123 | Ga0075364_10083494 | 3300006051 | Bacteria | 2114 |
| 124 | Ga0075364_10207465 | 3300006051 | Bacteria | 1328 |
| 125 | Ga0070715_10026071 | 3300006163 | Bacteria | 2321 |
| 126 | Ga0070716_100005608 | 3300006173 | Bacteria | 6093 |
| 127 | Ga0070716_100019072 | 3300006173 | Bacteria | 3581 |
| 128 | Ga0070712_100087985 | 3300006175 | Bacteria | 2268 |
| 129 | Ga0070712_100089696 | 3300006175 | Bacteria | 2249 |
| 130 | Ga0075362_10055144 | 3300006177 | Bacteria | 1788 |
| 131 | Ga0075367_10067480 | 3300006178 | Bacteria | 2144 |
| 132 | Ga0075367_10136013 | 3300006178 | Bacteria | 1520 |
| 133 | Ga0075367_10222803 | 3300006178 | Bacteria | 1181 |
| 134 | Ga0075369_10042648 | 3300006186 | Bacteria | 1945 |
| 135 | Ga0075366_10107625 | 3300006195 | Bacteria | 1676 |
| 136 | Ga0097621_100143110 | 3300006237 | Bacteria | 2045 |
| 137 | Ga0075370_10087982 | 3300006353 | Bacteria | 1790 |
| 138 | Ga0075370_10118448 | 3300006353 | Bacteria | 1540 |
| 139 | Ga0068871_100158319 | 3300006358 | Bacteria | 1935 |
| 140 | Ga0068871_100211502 | 3300006358 | Bacteria | 1677 |
| 141 | Ga0075434_100004469 | 3300006871 | Bacteria | 12614 |
| 142 | Ga0075434_100096067 | 3300006871 | Bacteria | 2969 |
| 143 | Ga0075434_100362343 | 3300006871 | Bacteria | 1471 |
| 144 | Ga0068865_100073449 | 3300006881 | Bacteria | 2432 |
| 145 | Ga0099825_1020668 | 3300006941 | Bacteria | 4628 |
| 146 | Ga0099824_1035813 | 3300006942 | Bacteria | 1485 |
| 147 | Ga0099822_1007626 | 3300006943 | Bacteria | 13973 |
| 148 | Ga0099822_1056766 | 3300006943 | Bacteria | 1415 |
| 149 | Ga0099823_1072928 | 3300006944 | Bacteria | 1483 |
| 150 | Ga0099794_10012991 | 3300007265 | Bacteria | 3613 |
| 151 | Ga0099795_10025691 | 3300007788 | Bacteria | 1977 |
| 152 | Ga0105240_10002968 | 3300009093 | Bacteria | 26700 |
| 153 | Ga0105240_10017804 | 3300009093 | Bacteria | 9563 |
| 154 | Ga0105240_10190410 | 3300009093 | Bacteria | 2413 |
| 155 | Ga0105240_10227269 | 3300009093 | Bacteria | 2171 |
| 156 | Ga0105240_10407263 | 3300009093 | Bacteria | 1530 |
| 157 | Ga0105247_10043858 | 3300009101 | Bacteria | 2741 |
| 158 | Ga0105241_10001388 | 3300009174 | Bacteria | 18512 |
| 159 | Ga0105248_10269872 | 3300009177 | Bacteria | 1916 |
| 160 | Ga0105248_10496058 | 3300009177 | Bacteria | 1376 |
| 161 | Ga0105237_10020853 | 3300009545 | Bacteria | 6748 |
| 162 | Ga0105237_10123107 | 3300009545 | Bacteria | 2588 |
| 163 | Ga0105237_10208382 | 3300009545 | Bacteria | 1955 |
| 164 | Ga0105237_10237353 | 3300009545 | Bacteria | 1824 |
| 165 | Ga0105237_10341691 | 3300009545 | Bacteria | 1501 |
| 166 | Ga0105238_10010451 | 3300009551 | Bacteria | 9315 |
| 167 | Ga0105238_10025037 | 3300009551 | Bacteria | 6083 |
| 168 | Ga0105238_10066453 | 3300009551 | Bacteria | 3607 |
| 169 | Ga0105238_10334186 | 3300009551 | Bacteria | 1502 |
| 170 | Ga0105238_10451722 | 3300009551 | Bacteria | 1282 |
| 171 | Ga0105238_10680530 | 3300009551 | Bacteria | 1040 |
| 172 | Ga0105249_10194985 | 3300009553 | Bacteria | 1979 |
| 173 | Ga0105249_10361636 | 3300009553 | Bacteria | 1473 |
| 174 | Ga0099796_10038085 | 3300010159 | Bacteria | 1611 |
| 175 | Ga0099796_10082867 | 3300010159 | Bacteria | 1179 |
| 176 | Ga0105239_10131032 | 3300010375 | Bacteria | 2789 |
| 177 | Ga0105239_10201586 | 3300010375 | Bacteria | 2229 |
| 178 | Ga0105239_10276817 | 3300010375 | Bacteria | 1888 |
| 179 | Ga0157371_10015904 | 3300013102 | Bacteria | 5627 |
| 180 | Ga0157370_10108237 | 3300013104 | Bacteria | 2599 |
| 181 | Ga0157370_10124721 | 3300013104 | Bacteria | 2404 |
| 182 | Ga0157370_10180609 | 3300013104 | Bacteria | 1961 |
| 183 | Ga0157369_10009007 | 3300013105 | Bacteria | 11431 |
| 184 | Ga0157369_10009927 | 3300013105 | Bacteria | 10878 |
| 185 | Ga0157369_10218728 | 3300013105 | Bacteria | 1994 |
| 186 | Ga0157369_10343522 | 3300013105 | Bacteria | 1550 |
| 187 | Ga0157374_10041978 | 3300013296 | Bacteria | 4218 |
| 188 | Ga0163162_10149747 | 3300013306 | Bacteria | 2450 |
| 189 | Ga0157372_10079888 | 3300013307 | Bacteria | 3700 |
| 190 | Ga0157372_10310985 | 3300013307 | Bacteria | 1834 |
| 191 | Ga0157372_10363327 | 3300013307 | Bacteria | 1687 |
| 192 | Ga0157372_10418999 | 3300013307 | Bacteria | 1561 |
| 193 | Ga0157372_10453038 | 3300013307 | Bacteria | 1495 |
| 194 | Ga0157375_10133986 | 3300013308 | Bacteria | 2599 |
| 195 | Ga0157375_10212208 | 3300013308 | Bacteria | 2094 |
| 196 | Ga0163163_10081730 | 3300014325 | Bacteria | 3233 |
| 197 | Ga0163163_10230508 | 3300014325 | Bacteria | 1901 |
| 198 | Ga0157377_10091376 | 3300014745 | Bacteria | 1798 |
| 199 | Ga0157376_10110571 | 3300014969 | Bacteria | 2418 |
| 200 | Ga0157376_10311911 | 3300014969 | Bacteria | 1493 |
| 201 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 202 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 203 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 204 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 205 | Ga0213872_10019823 | 3300021361 | Bacteria | 3097 |
| 206 | Ga0213874_10013098 | 3300021377 | Bacteria | 2141 |
| 207 | Ga0213874_10013163 | 3300021377 | Bacteria | 2137 |
| 208 | Ga0213876_10001735 | 3300021384 | Bacteria | 13237 |
| 209 | Ga0228598_1032947 | 3300024227 | Bacteria | 1021 |
| 210 | Ga0209677_100470 | 3300025253 | Bacteria | 23130 |
| 211 | Ga0209455_1007332 | 3300025272 | Bacteria | 3128 |
| 212 | Ga0209564_1008389 | 3300025295 | Bacteria | 5104 |
| 213 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 214 | Ga0209758_1001683 | 3300025297 | Bacteria | 24919 |
| 215 | Ga0209758_1002332 | 3300025297 | Bacteria | 19594 |
| 216 | Ga0209758_1006430 | 3300025297 | Bacteria | 8450 |
| 217 | Ga0209758_1037291 | 3300025297 | Bacteria | 1881 |
| 218 | Ga0209050_1022586 | 3300025298 | Bacteria | 2249 |
| 219 | Ga0207426_1003263 | 3300025302 | Bacteria | 9067 |
| 220 | Ga0209257_1001741 | 3300025304 | Bacteria | 24170 |
| 221 | Ga0207656_10034217 | 3300025321 | Bacteria | 2121 |
| 222 | Ga0207692_10005117 | 3300025898 | Bacteria | 5231 |
| 223 | Ga0207692_10008782 | 3300025898 | Bacteria | 4196 |
| 224 | Ga0207692_10063539 | 3300025898 | Bacteria | 1919 |
| 225 | Ga0207710_10011534 | 3300025900 | Bacteria | 3719 |
| 226 | Ga0207710_10072188 | 3300025900 | Bacteria | 1585 |
| 227 | Ga0207710_10126377 | 3300025900 | Bacteria | 1225 |
| 228 | Ga0207680_10164264 | 3300025903 | Bacteria | 1491 |
| 229 | Ga0207685_10003939 | 3300025905 | Bacteria | 3692 |
| 230 | Ga0207685_10015299 | 3300025905 | Bacteria | 2428 |
| 231 | Ga0207699_10000740 | 3300025906 | Bacteria | 15576 |
| 232 | Ga0207699_10006844 | 3300025906 | Bacteria | 5545 |
| 233 | Ga0207699_10055566 | 3300025906 | Bacteria | 2356 |
| 234 | Ga0207705_10038645 | 3300025909 | Bacteria | 3418 |
| 235 | Ga0207684_10262085 | 3300025910 | Bacteria | 1491 |
| 236 | Ga0207654_10000729 | 3300025911 | Bacteria | 18348 |
| 237 | Ga0207654_10184902 | 3300025911 | Bacteria | 1362 |
| 238 | Ga0207707_10000541 | 3300025912 | Bacteria | 38481 |
| 239 | Ga0207707_10000582 | 3300025912 | Bacteria | 37091 |
| 240 | Ga0207707_10064900 | 3300025912 | Bacteria | 3179 |
| 241 | Ga0207695_10000478 | 3300025913 | Bacteria | 86076 |
| 242 | Ga0207695_10004497 | 3300025913 | Bacteria | 18978 |
| 243 | Ga0207695_10018101 | 3300025913 | Bacteria | 8154 |
| 244 | Ga0207695_10031949 | 3300025913 | Bacteria | 5766 |
| 245 | Ga0207671_10003084 | 3300025914 | Bacteria | 17008 |
| 246 | Ga0207671_10030076 | 3300025914 | Bacteria | 4051 |
| 247 | Ga0207671_10044416 | 3300025914 | Bacteria | 3287 |
| 248 | Ga0207671_10156052 | 3300025914 | Bacteria | 1765 |
| 249 | Ga0207671_10162138 | 3300025914 | Bacteria | 1732 |
| 250 | Ga0207671_10183495 | 3300025914 | Bacteria | 1629 |
| 251 | Ga0207693_10005512 | 3300025915 | Bacteria | 10533 |
| 252 | Ga0207693_10008208 | 3300025915 | Bacteria | 8554 |
| 253 | Ga0207693_10014476 | 3300025915 | Bacteria | 6340 |
| 254 | Ga0207693_10090801 | 3300025915 | Bacteria | 2394 |
| 255 | Ga0207693_10105078 | 3300025915 | Bacteria | 2214 |
| 256 | Ga0207693_10288729 | 3300025915 | Bacteria | 1285 |
| 257 | Ga0207663_10000425 | 3300025916 | Bacteria | 18308 |
| 258 | Ga0207663_10057794 | 3300025916 | Bacteria | 2445 |
| 259 | Ga0207663_10072056 | 3300025916 | Bacteria | 2232 |
| 260 | Ga0207663_10110833 | 3300025916 | Bacteria | 1862 |
| 261 | Ga0207663_10138454 | 3300025916 | Bacteria | 1692 |
| 262 | Ga0207660_10022911 | 3300025917 | Bacteria | 4211 |
| 263 | Ga0207660_10074692 | 3300025917 | Bacteria | 2475 |
| 264 | Ga0207657_10002950 | 3300025919 | Bacteria | 18254 |
| 265 | Ga0207657_10136726 | 3300025919 | Bacteria | 2005 |
| 266 | Ga0207649_10123275 | 3300025920 | Bacteria | 1750 |
| 267 | Ga0207652_10004959 | 3300025921 | Bacteria | 10782 |
| 268 | Ga0207652_10005910 | 3300025921 | Bacteria | 9899 |
| 269 | Ga0207652_10138958 | 3300025921 | Bacteria | 2171 |
| 270 | Ga0207681_10136395 | 3300025923 | Bacteria | 1822 |
| 271 | Ga0207681_10277034 | 3300025923 | Bacteria | 1319 |
| 272 | Ga0207694_10000849 | 3300025924 | Bacteria | 27168 |
| 273 | Ga0207694_10015749 | 3300025924 | Bacteria | 5703 |
| 274 | Ga0207694_10159501 | 3300025924 | Bacteria | 1821 |
| 275 | Ga0207694_10433030 | 3300025924 | Bacteria | 1096 |
| 276 | Ga0207687_10320813 | 3300025927 | Bacteria | 1254 |
| 277 | Ga0207700_10004824 | 3300025928 | Bacteria | 8005 |
| 278 | Ga0207700_10107598 | 3300025928 | Bacteria | 2238 |
| 279 | Ga0207700_10308074 | 3300025928 | Bacteria | 1369 |
| 280 | Ga0207664_10150991 | 3300025929 | Bacteria | 1973 |
| 281 | Ga0207664_10293691 | 3300025929 | Bacteria | 1429 |
| 282 | Ga0207644_10160881 | 3300025931 | Bacteria | 1745 |
| 283 | Ga0207644_10200252 | 3300025931 | Bacteria | 1575 |
| 284 | Ga0207690_10112687 | 3300025932 | Bacteria | 1962 |
| 285 | Ga0207690_10151692 | 3300025932 | Bacteria | 1718 |
| 286 | Ga0207669_10014908 | 3300025937 | Bacteria | 3909 |
| 287 | Ga0207704_10009478 | 3300025938 | Bacteria | 4700 |
| 288 | Ga0207665_10003367 | 3300025939 | Bacteria | 10702 |
| 289 | Ga0207665_10003573 | 3300025939 | Bacteria | 10395 |
| 290 | Ga0207691_10412079 | 3300025940 | Bacteria | 1152 |
| 291 | Ga0207711_10293994 | 3300025941 | Bacteria | 1497 |
| 292 | Ga0207689_10155732 | 3300025942 | Bacteria | 1884 |
| 293 | Ga0207689_10174428 | 3300025942 | Bacteria | 1773 |
| 294 | Ga0207689_10343299 | 3300025942 | Bacteria | 1240 |
| 295 | Ga0207661_10000109 | 3300025944 | Bacteria | 52179 |
| 296 | Ga0207661_10081608 | 3300025944 | Bacteria | 2671 |
| 297 | Ga0207667_10021686 | 3300025949 | Bacteria | 7116 |
| 298 | Ga0207667_10083996 | 3300025949 | Bacteria | 3297 |
| 299 | Ga0207667_10123692 | 3300025949 | Bacteria | 2665 |
| 300 | Ga0207667_10125735 | 3300025949 | Bacteria | 2641 |
| 301 | Ga0207667_10215053 | 3300025949 | Bacteria | 1970 |
| 302 | Ga0207667_10432994 | 3300025949 | Bacteria | 1338 |
| 303 | Ga0207667_10481998 | 3300025949 | Bacteria | 1259 |
| 304 | Ga0207668_10015127 | 3300025972 | Bacteria | 4789 |
| 305 | Ga0207668_10405550 | 3300025972 | Bacteria | 1153 |
| 306 | Ga0207640_10053654 | 3300025981 | Bacteria | 2632 |
| 307 | Ga0207677_10067744 | 3300026023 | Bacteria | 2502 |
| 308 | Ga0207677_10080223 | 3300026023 | Bacteria | 2337 |
| 309 | Ga0207703_10087840 | 3300026035 | Bacteria | 2608 |
| 310 | Ga0207703_10104833 | 3300026035 | Bacteria | 2403 |
| 311 | Ga0207703_10253798 | 3300026035 | Bacteria | 1586 |
| 312 | Ga0207703_10425232 | 3300026035 | Bacteria | 1237 |
| 313 | Ga0207703_10471963 | 3300026035 | Bacteria | 1175 |
| 314 | Ga0207639_10007486 | 3300026041 | Bacteria | 7448 |
| 315 | Ga0207639_10032132 | 3300026041 | Bacteria | 3862 |
| 316 | Ga0207639_10223000 | 3300026041 | Bacteria | 1629 |
| 317 | Ga0207639_10260091 | 3300026041 | Bacteria | 1518 |
| 318 | Ga0207639_10312378 | 3300026041 | Bacteria | 1393 |
| 319 | Ga0207678_10046082 | 3300026067 | Bacteria | 3771 |
| 320 | Ga0207678_10148445 | 3300026067 | Bacteria | 2001 |
| 321 | Ga0207678_10195442 | 3300026067 | Bacteria | 1729 |
| 322 | Ga0207708_10106601 | 3300026075 | Bacteria | 2173 |
| 323 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 324 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 325 | Ga0207702_10254153 | 3300026078 | Bacteria | 1652 |
| 326 | Ga0207702_10681322 | 3300026078 | Bacteria | 1012 |
| 327 | Ga0207641_10574202 | 3300026088 | Bacteria | 1102 |
| 328 | Ga0207648_10106662 | 3300026089 | Bacteria | 2458 |
| 329 | Ga0207676_10059522 | 3300026095 | Bacteria | 3017 |
| 330 | Ga0207676_10284789 | 3300026095 | Bacteria | 1502 |
| 331 | Ga0207674_10012928 | 3300026116 | Bacteria | 9309 |
| 332 | Ga0207674_10057148 | 3300026116 | Bacteria | 3956 |
| 333 | Ga0207674_10065509 | 3300026116 | Bacteria | 3662 |
| 334 | Ga0207674_10108590 | 3300026116 | Bacteria | 2751 |
| 335 | Ga0207683_10117668 | 3300026121 | Bacteria | 2383 |
| 336 | Ga0207683_10220341 | 3300026121 | Bacteria | 1729 |
| 337 | Ga0207698_10063823 | 3300026142 | Bacteria | 2884 |
| 338 | Ga0207698_10159850 | 3300026142 | Bacteria | 1969 |
| 339 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 340 | Ga0209389_1000027 | 3300027296 | Bacteria | 146917 |
| 341 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 342 | Ga0209589_1000031 | 3300027357 | Bacteria | 147054 |
| 343 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 344 | Ga0209489_100057 | 3300027361 | Bacteria | 147398 |
| 345 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 346 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 347 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 348 | Ga0209588_1004211 | 3300027671 | Bacteria | 4044 |
| 349 | Ga0268266_10001346 | 3300028379 | Bacteria | 29681 |
| 350 | Ga0268266_10068805 | 3300028379 | Bacteria | 3066 |
| 351 | Ga0268266_10199533 | 3300028379 | Bacteria | 1830 |
| 352 | Ga0268266_10548464 | 3300028379 | Bacteria | 1107 |
| 353 | Ga0268265_10034105 | 3300028380 | Bacteria | 3707 |
| 354 | Ga0268265_10199546 | 3300028380 | Bacteria | 1734 |
| 355 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 356 | Ga0268264_10135286 | 3300028381 | Bacteria | 2190 |
| 357 | Ga0268264_10198150 | 3300028381 | Bacteria | 1835 |
| 358 | Ga0265337_1045356 | 3300028556 | Bacteria | 1251 |
| 359 | Ga0265336_10000348 | 3300028666 | Bacteria | 30334 |
| 360 | Ga0307517_10000176 | 3300028786 | Bacteria | 105402 |
| 361 | Ga0307515_10317759 | 3300028794 | Bacteria | 1226 |
| 362 | Ga0265338_10000018 | 3300028800 | Bacteria | 338910 |
| 363 | Ga0307511_10050299 | 3300030521 | Bacteria | 3358 |
| 364 | Ga0265332_10016978 | 3300031238 | Bacteria | 3211 |
| 365 | Ga0265328_10001180 | 3300031239 | Bacteria | 12085 |
| 366 | Ga0265339_10000383 | 3300031249 | Bacteria | 34934 |
| 367 | Ga0265316_10103031 | 3300031344 | Bacteria | 2167 |
| 368 | Ga0307509_10025042 | 3300031507 | Bacteria | 6669 |
| 369 | Ga0307509_10251156 | 3300031507 | Bacteria | 1552 |
| 370 | Ga0307509_10333330 | 3300031507 | Bacteria | 1248 |
| 371 | Ga0307508_10000029 | 3300031616 | Bacteria | 168411 |
| 372 | Ga0307508_10024413 | 3300031616 | Bacteria | 5486 |
| 373 | Ga0265314_10010200 | 3300031711 | Bacteria | 7866 |
| 374 | Ga0265314_10229713 | 3300031711 | Bacteria | 1077 |
| 375 | Ga0265342_10055988 | 3300031712 | Bacteria | 2339 |
| 376 | Ga0307516_10088341 | 3300031730 | Bacteria | 2932 |
| 377 | Ga0307516_10161240 | 3300031730 | Bacteria | 1992 |
| 378 | Ga0307412_10204058 | 3300031911 | Bacteria | 1503 |
| 379 | Ga0307409_100317876 | 3300031995 | Bacteria | 1456 |
| 380 | Ga0307414_10178805 | 3300032004 | Bacteria | 1704 |
| 381 | Ga0307415_100123019 | 3300032126 | Bacteria | 1949 |
| 382 | Ga0307507_10021924 | 3300033179 | Bacteria | 7087 |
| 383 | Ga0307510_10024826 | 3300033180 | Bacteria | 6921 |
| 384 | Ga0307510_10026321 | 3300033180 | Bacteria | 6688 |
| 385 | Ga0307510_10138078 | 3300033180 | Bacteria | 2089 |
| 386 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 387 | Ga0373926_0060001 | 3300035083 | Bacteria | 1385 |
| 388 | Ga0373934_0018347 | 3300035086 | Bacteria | 2676 |
| 389 | Ga0373934_0056364 | 3300035086 | Bacteria | 1563 |
| 390 | Ga0373923_0010360 | 3300035111 | Bacteria | 3389 |
| 391 | Ga0373923_0070889 | 3300035111 | Bacteria | 1496 |
| 392 | Ga0373932_0076262 | 3300035112 | Bacteria | 1050 |
| 393 | Ga0373936_0006737 | 3300035113 | Bacteria | 4323 |
| 394 | Ga0373936_0085224 | 3300035113 | Bacteria | 1319 |
| 395 | Ga0373936_0114482 | 3300035113 | Bacteria | 1147 |
| 396 | Ga0373945_0016664 | 3300035116 | Bacteria | 2481 |
| 397 | Ga0373953_0009510 | 3300035117 | Bacteria | 3349 |
| 398 | Ga0373954_0002278 | 3300035118 | Bacteria | 7991 |
| 399 | Ga0373954_0009920 | 3300035118 | Bacteria | 4193 |
| 400 | Ga0373956_0004148 | 3300035119 | Bacteria | 5813 |
| 401 | Ga0373956_0019733 | 3300035119 | Bacteria | 2861 |
| 402 | Ga0373957_0001409 | 3300035120 | Bacteria | 6498 |
| 403 | Ga0373957_0005477 | 3300035120 | Bacteria | 3937 |
| 404 | Ga0373957_0034103 | 3300035120 | Bacteria | 1883 |
| 405 | Ga0373943_0060746 | 3300035170 | Bacteria | 1887 |
| 406 | Ga0373946_0006137 | 3300035171 | Bacteria | 4353 |
| 407 | Ga0373946_0045097 | 3300035171 | Bacteria | 1823 |
| 408 | Ga0373946_0155733 | 3300035171 | Bacteria | 1069 |
| 409 | Ga0373955_0000395 | 3300035172 | Bacteria | 18509 |
| 410 | Ga0373955_0042757 | 3300035172 | Bacteria | 2434 |
| 411 | Ga0373924_0008165 | 3300035410 | Bacteria | 3794 |
| 412 | Ga0373924_0055653 | 3300035410 | Bacteria | 1646 |
| 413 | Ga0373924_0071304 | 3300035410 | Bacteria | 1466 |
| 414 | Ga0373931_0001048 | 3300035691 | Bacteria | 11695 |
| 415 | Ga0373931_0030584 | 3300035691 | Bacteria | 2773 |
| 416 | Ga0373931_0179784 | 3300035691 | Bacteria | 1252 |
| 417 | Ga0373935_0004219 | 3300035692 | Bacteria | 8427 |
| 418 | Ga0373927_0002702 | 3300035695 | Bacteria | 12926 |
| 419 | Ga0373927_0004563 | 3300035695 | Bacteria | 9675 |
| 420 | Ga0373927_0023782 | 3300035695 | Bacteria | 4010 |
| 421 | Ga0373927_0084381 | 3300035695 | Bacteria | 2060 |
| 422 | Ga0373927_0143006 | 3300035695 | Bacteria | 1565 |
| 423 | Ga0373933_0003364 | 3300035724 | Bacteria | 8915 |
| 424 | Ga0373933_0007313 | 3300035724 | Bacteria | 6024 |
| 425 | Ga0373933_0007540 | 3300035724 | Bacteria | 5945 |
| 426 | Ga0373933_0091286 | 3300035724 | Bacteria | 1879 |
| 427 | Ga0373947_0007364 | 3300035725 | Bacteria | 6372 |
| 428 | Ga0373947_0027701 | 3300035725 | Bacteria | 3317 |
| 429 | Ga0373947_0065680 | 3300035725 | Bacteria | 2213 |
| 430 | Ga0373947_0157668 | 3300035725 | Bacteria | 1466 |
| 431 | Ga0373937_0011914 | 3300036401 | Bacteria | 7630 |
| 432 | Ga0373937_0022128 | 3300036401 | Bacteria | 5711 |
| 433 | Ga0373937_0049502 | 3300036401 | Bacteria | 3848 |
| 434 | Ga0373925_0007592 | 3300037068 | Bacteria | 7899 |
| 435 | Ga0373925_0018541 | 3300037068 | Bacteria | 5059 |
| 436 | Ga0373925_0034208 | 3300037068 | Bacteria | 3745 |
| 437 | Ga0373925_0049760 | 3300037068 | Bacteria | 3124 |
| 438 | Ga0373925_0092541 | 3300037068 | Bacteria | 2313 |
| 439 | Ga0373925_0104706 | 3300037068 | Bacteria | 2179 |
| 440 | Ga0395900_0007140 | 3300037418 | Bacteria | 11574 |
| 441 | Ga0395900_0044885 | 3300037418 | Bacteria | 4552 |
| 442 | Ga0395900_0105951 | 3300037418 | Bacteria | 2888 |
| 443 | Ga0395898_0067033 | 3300037466 | Bacteria | 3476 |
| 444 | Ga0395898_0138367 | 3300037466 | Bacteria | 2331 |
| 445 | Ga0395905_0028290 | 3300037471 | Bacteria | 5283 |
| 446 | Ga0395905_0246935 | 3300037471 | Bacteria | 1667 |
| 447 | Ga0395905_0547190 | 3300037471 | Bacteria | 1059 |
| 448 | Ga0436364_0776445 | 3300037853 | Bacteria | 2528 |
| 449 | Ga0395901_0129075 | 3300038443 | Bacteria | 2657 |
| 450 | Ga0436365_0657970 | 3300039437 | Bacteria | 1203 |
| 451 | Ga0436365_0931463 | 3300039437 | Bacteria | 1210 |
| 452 | Ga0436365_1364744 | 3300039437 | Bacteria | 1882 |
| 453 | Ga0436365_1778823 | 3300039437 | Bacteria | 2251 |
| 454 | Ga0436360_0202944 | 3300039438 | Bacteria | 1417 |
| 455 | Ga0436361_0764338 | 3300039447 | Bacteria | 2381 |
| 456 | Ga0436361_1007400 | 3300039447 | Bacteria | 4239 |
| 457 | Ga0436363_0187212 | 3300039450 | Bacteria | 5083 |
| 458 | Ga0436363_1164297 | 3300039450 | Bacteria | 3420 |
| 459 | Ga0436363_1664076 | 3300039450 | Bacteria | 1800 |
| 460 | Ga0451839_1296627 | 3300041496 | Bacteria | 1039 |
| 461 | Ga0451849_1550937 | 3300041505 | Bacteria | 1913 |
| 462 | Ga0466969_0038171 | 3300044656 | Bacteria | 2418 |
| 463 | Ga0466972_0000177 | 3300044658 | Bacteria | 49318 |
| 464 | Ga0466972_0005224 | 3300044658 | Bacteria | 6498 |
| 465 | Ga0466965_0032138 | 3300044683 | Bacteria | 2563 |
| 466 | Ga0466965_0199123 | 3300044683 | Bacteria | 1062 |
| 467 | Ga0466966_0000474 | 3300044684 | Bacteria | 25834 |
| 468 | Ga0466961_0000023 | 3300044693 | Bacteria | 97134 |
| 469 | Ga0466961_0115673 | 3300044693 | Bacteria | 1686 |
| 470 | Ga0466968_0006075 | 3300044735 | Bacteria | 4535 |
| 471 | Ga0466968_0041477 | 3300044735 | Bacteria | 1943 |
| 472 | Ga0466957_0119170 | 3300044842 | Bacteria | 1681 |
| 473 | Ga0466957_0312438 | 3300044842 | Bacteria | 1058 |
| 474 | Ga0466959_0000726 | 3300045049 | Bacteria | 19220 |
| 475 | Ga0466967_0189767 | 3300045976 | Bacteria | 1942 |
| 476 | Ga0466967_0628871 | 3300045976 | Bacteria | 1060 |
| 477 | Ga0495592_0020908 | 3300046454 | Bacteria | 4978 |
| 478 | Ga0495592_0021820 | 3300046454 | Bacteria | 4871 |
| 479 | Ga0495592_0084009 | 3300046454 | Bacteria | 2298 |
| 480 | Ga0495592_0301622 | 3300046454 | Bacteria | 1041 |
| 481 | Ga0495603_0001935 | 3300046455 | Bacteria | 12200 |
| 482 | Ga0495603_0006284 | 3300046455 | Bacteria | 7104 |
| 483 | Ga0495603_0020664 | 3300046455 | Bacteria | 3988 |
| 484 | Ga0495603_0049526 | 3300046455 | Bacteria | 2501 |
| 485 | Ga0495603_0062862 | 3300046455 | Bacteria | 2191 |
| 486 | Ga0495603_0118366 | 3300046455 | Bacteria | 1544 |
| 487 | Ga0495603_0224158 | 3300046455 | Bacteria | 1084 |
| 488 | Ga0495629_0000416 | 3300046459 | Bacteria | 35794 |
| 489 | Ga0495629_0000655 | 3300046459 | Bacteria | 27984 |
| 490 | Ga0495641_0002593 | 3300046461 | Bacteria | 14172 |
| 491 | Ga0495641_0101626 | 3300046461 | Bacteria | 1283 |
| 492 | Ga0495651_0010752 | 3300046462 | Bacteria | 7037 |
| 493 | Ga0495651_0144620 | 3300046462 | Bacteria | 1720 |
| 494 | Ga0495653_0004854 | 3300046463 | Bacteria | 10903 |
| 495 | Ga0495653_0259246 | 3300046463 | Bacteria | 1150 |
| 496 | Ga0495650_0025806 | 3300046471 | Bacteria | 2746 |
| 497 | Ga0495580_0055436 | 3300046472 | Bacteria | 2793 |
| 498 | Ga0495582_0032876 | 3300046473 | Bacteria | 2850 |
| 499 | Ga0495639_0001046 | 3300046475 | Bacteria | 12485 |
| 500 | Ga0495639_0084132 | 3300046475 | Bacteria | 1485 |
| 501 | Ga0495639_0129966 | 3300046475 | Bacteria | 1205 |
| 502 | Ga0495662_0003282 | 3300046476 | Bacteria | 8189 |
| 503 | Ga0495664_0114940 | 3300046477 | Bacteria | 1626 |
| 504 | Ga0495585_0113023 | 3300046492 | Bacteria | 1442 |
| 505 | Ga0495585_0147552 | 3300046492 | Bacteria | 1228 |
| 506 | Ga0495594_0051840 | 3300046499 | Bacteria | 2258 |
| 507 | Ga0495606_0066283 | 3300046507 | Bacteria | 2290 |
| 508 | Ga0495608_0107848 | 3300046511 | Bacteria | 1791 |
| 509 | Ga0495618_0110921 | 3300046514 | Bacteria | 1756 |
| 510 | Ga0495620_0117244 | 3300046515 | Bacteria | 1052 |
| 511 | Ga0495628_0011825 | 3300046516 | Bacteria | 7365 |
| 512 | Ga0495628_0030845 | 3300046516 | Bacteria | 4339 |
| 513 | Ga0495628_0117808 | 3300046516 | Bacteria | 2039 |
| 514 | Ga0495628_0136125 | 3300046516 | Bacteria | 1877 |
| 515 | Ga0495630_0009444 | 3300046517 | Bacteria | 7014 |
| 516 | Ga0495643_0014428 | 3300046522 | Bacteria | 4701 |
| 517 | Ga0495648_0000640 | 3300046524 | Bacteria | 37287 |
| 518 | Ga0495666_0016886 | 3300046526 | Bacteria | 3634 |
| 519 | Ga0495666_0030220 | 3300046526 | Bacteria | 2661 |
| 520 | Ga0495642_0121770 | 3300046528 | Bacteria | 1120 |
| 521 | Ga0495652_0026522 | 3300046529 | Bacteria | 5118 |
| 522 | Ga0495652_0082257 | 3300046529 | Bacteria | 2654 |
| 523 | Ga0495665_0003441 | 3300046531 | Bacteria | 8598 |
| 524 | Ga0495665_0056047 | 3300046531 | Bacteria | 2081 |
| 525 | Ga0495640_0045167 | 3300046533 | Bacteria | 3058 |
| 526 | Ga0495640_0045731 | 3300046533 | Bacteria | 3037 |
| 527 | Ga0495640_0073507 | 3300046533 | Bacteria | 2289 |
| 528 | Ga0495640_0085105 | 3300046533 | Bacteria | 2096 |
| 529 | Ga0495586_0085300 | 3300046535 | Bacteria | 1740 |
| 530 | Ga0495587_0007940 | 3300046536 | Bacteria | 6854 |
| 531 | Ga0495587_0011794 | 3300046536 | Bacteria | 5526 |
| 532 | Ga0495587_0016331 | 3300046536 | Bacteria | 4619 |
| 533 | Ga0495598_0010333 | 3300046537 | Bacteria | 2234 |
| 534 | Ga0495598_0023933 | 3300046537 | Bacteria | 1650 |
| 535 | Ga0495621_0078806 | 3300046539 | Bacteria | 1225 |
| 536 | Ga0495645_0002973 | 3300046543 | Bacteria | 11471 |
| 537 | Ga0495645_0133459 | 3300046543 | Bacteria | 1738 |
| 538 | Ga0495622_0023686 | 3300046557 | Bacteria | 2863 |
| 539 | Ga0495622_0026482 | 3300046557 | Bacteria | 2707 |
| 540 | Ga0495622_0088749 | 3300046557 | Bacteria | 1421 |
| 541 | Ga0495667_0032457 | 3300046559 | Bacteria | 3499 |
| 542 | Ga0495667_0036654 | 3300046559 | Bacteria | 3271 |
| 543 | Ga0495667_0044661 | 3300046559 | Bacteria | 2934 |
| 544 | Ga0495667_0060623 | 3300046559 | Bacteria | 2481 |
| 545 | Ga0495656_0118066 | 3300046615 | Bacteria | 1248 |
| 546 | Ga0495656_0127886 | 3300046615 | Bacteria | 1206 |
| 547 | Ga0495668_0073358 | 3300046616 | Bacteria | 1880 |
| 548 | Ga0495668_0191459 | 3300046616 | Bacteria | 1120 |
| 549 | Ga0495634_0000602 | 3300046642 | Bacteria | 34812 |
| 550 | Ga0495634_0074164 | 3300046642 | Bacteria | 2236 |
| 551 | Ga0495634_0159003 | 3300046642 | Bacteria | 1425 |
| 552 | Ga0495634_0223408 | 3300046642 | Bacteria | 1161 |
| 553 | Ga0495635_0000380 | 3300046663 | Bacteria | 28177 |
| 554 | Ga0495635_0012975 | 3300046663 | Bacteria | 5832 |
| 555 | Ga0495635_0042493 | 3300046663 | Bacteria | 3138 |
| 556 | Ga0495635_0243080 | 3300046663 | Bacteria | 1214 |
| 557 | Ga0495659_0030136 | 3300046664 | Bacteria | 1886 |
| 558 | Ga0495588_0003413 | 3300046674 | Bacteria | 6905 |
| 559 | Ga0495657_0005248 | 3300046675 | Bacteria | 10255 |
| 560 | Ga0495657_0019627 | 3300046675 | Bacteria | 4875 |
| 561 | Ga0495657_0050390 | 3300046675 | Bacteria | 2799 |
| 562 | Ga0495599_0004515 | 3300046678 | Bacteria | 8252 |
| 563 | Ga0495599_0025467 | 3300046678 | Bacteria | 3703 |
| 564 | Ga0495599_0026173 | 3300046678 | Bacteria | 3655 |
| 565 | Ga0495599_0079124 | 3300046678 | Bacteria | 2053 |
| 566 | Ga0495623_0002235 | 3300046679 | Bacteria | 12884 |
| 567 | Ga0495623_0015456 | 3300046679 | Bacteria | 4934 |
| 568 | Ga0495646_0046242 | 3300046680 | Bacteria | 2654 |
| 569 | Ga0495646_0048567 | 3300046680 | Bacteria | 2577 |
| 570 | Ga0495646_0070850 | 3300046680 | Bacteria | 2052 |
| 571 | Ga0495646_0131009 | 3300046680 | Bacteria | 1412 |
| 572 | Ga0495647_0021626 | 3300046681 | Bacteria | 2317 |
| 573 | Ga0495647_0030022 | 3300046681 | Bacteria | 2014 |
| 574 | Ga0495658_0005105 | 3300046683 | Bacteria | 6451 |
| 575 | Ga0495658_0053507 | 3300046683 | Bacteria | 2293 |
| 576 | Ga0495669_0076437 | 3300046684 | Bacteria | 1533 |
| 577 | Ga0495613_0032956 | 3300046689 | Bacteria | 3849 |
| 578 | Ga0495613_0057599 | 3300046689 | Bacteria | 2853 |
| 579 | Ga0495624_0003072 | 3300046690 | Bacteria | 12498 |
| 580 | Ga0495589_0157788 | 3300046794 | Bacteria | 1081 |
| 581 | Ga0495600_0029981 | 3300046809 | Bacteria | 3523 |
| 582 | Ga0495600_0035125 | 3300046809 | Bacteria | 3255 |
| 583 | Ga0495600_0114920 | 3300046809 | Bacteria | 1752 |
| 584 | Ga0495581_0020748 | 3300047315 | Bacteria | 3810 |
| 585 | Ga0495581_0036506 | 3300047315 | Bacteria | 2843 |
| 586 | Ga0495581_0097104 | 3300047315 | Bacteria | 1711 |
| 587 | Ga0495581_0198853 | 3300047315 | Bacteria | 1172 |
| 588 | Ga0495604_0007336 | 3300047317 | Bacteria | 8732 |
| 589 | Ga0495604_0008886 | 3300047317 | Bacteria | 7941 |
| 590 | Ga0495604_0054854 | 3300047317 | Bacteria | 3073 |
| 591 | Ga0495604_0127221 | 3300047317 | Bacteria | 1835 |
| 592 | Ga0495604_0201844 | 3300047317 | Bacteria | 1379 |
| 593 | Ga0495674_0008020 | 3300047319 | Bacteria | 10083 |
| 594 | Ga0495674_0022101 | 3300047319 | Bacteria | 5871 |
| 595 | Ga0495674_0066148 | 3300047319 | Bacteria | 3137 |
| 596 | Ga0495674_0160752 | 3300047319 | Bacteria | 1879 |
| 597 | Ga0495674_0305009 | 3300047319 | Bacteria | 1300 |
| 598 | Ga0495672_0124289 | 3300047320 | Bacteria | 1367 |
| 599 | Ga0495676_0069277 | 3300047321 | Bacteria | 2722 |
| 600 | Ga0495676_0122028 | 3300047321 | Bacteria | 1894 |
| 601 | Ga0495676_0123320 | 3300047321 | Bacteria | 1881 |
| 602 | Ga0495680_0002016 | 3300047322 | Bacteria | 21294 |
| 603 | Ga0495680_0025159 | 3300047322 | Bacteria | 4930 |
| 604 | Ga0495680_0085244 | 3300047322 | Bacteria | 2379 |
| 605 | Ga0495680_0261857 | 3300047322 | Bacteria | 1223 |
| 606 | Ga0495675_0001856 | 3300047444 | Bacteria | 12578 |
| 607 | Ga0495675_0127716 | 3300047444 | Bacteria | 1581 |
| 608 | Ga0495679_059730 | 3300047446 | Bacteria | 1121 |
| 609 | Ga0495681_0121593 | 3300047470 | Bacteria | 1120 |
| 610 | Ga0495684_0000294 | 3300047471 | Bacteria | 40596 |
| 611 | Ga0495684_0096973 | 3300047471 | Bacteria | 2231 |
| 612 | Ga0495684_0138880 | 3300047471 | Bacteria | 1822 |
| 613 | Ga0495593_0000022 | 3300047673 | Bacteria | 69741 |
| 614 | Ga0495593_0000744 | 3300047673 | Bacteria | 18938 |
| 615 | Ga0495602_0062578 | 3300048088 | Bacteria | 3228 |
| 616 | Ga0495602_0155583 | 3300048088 | Bacteria | 1790 |
| 617 | Ga0496100_0027259 | 3300048903 | Bacteria | 3512 |
| 618 | Ga0496100_0079153 | 3300048903 | Bacteria | 2214 |
| 619 | Ga0496101_0063193 | 3300048904 | Bacteria | 2694 |
| 620 | Ga0496101_0088147 | 3300048904 | Bacteria | 2304 |
| 621 | Ga0496101_0106347 | 3300048904 | Bacteria | 2107 |
| 622 | Ga0496101_0116245 | 3300048904 | Bacteria | 2018 |
| 623 | Ga0496102_0014293 | 3300048905 | Bacteria | 6898 |
| 624 | Ga0496102_0059266 | 3300048905 | Bacteria | 3500 |
| 625 | Ga0496102_0076480 | 3300048905 | Bacteria | 3079 |
| 626 | Ga0496102_0334862 | 3300048905 | Bacteria | 1425 |
| 627 | Ga0496103_0101444 | 3300048906 | Bacteria | 1822 |
| 628 | Ga0496104_0000948 | 3300048907 | Bacteria | 24943 |
| 629 | Ga0496104_0002005 | 3300048907 | Bacteria | 17670 |
| 630 | Ga0496104_0023320 | 3300048907 | Bacteria | 5689 |
| 631 | Ga0496104_0033610 | 3300048907 | Bacteria | 4779 |
| 632 | Ga0496104_0235301 | 3300048907 | Bacteria | 1744 |
| 633 | Ga0496105_0001280 | 3300048908 | Bacteria | 17590 |
| 634 | Ga0496105_0009772 | 3300048908 | Bacteria | 7513 |
| 635 | Ga0496105_0011036 | 3300048908 | Bacteria | 7121 |
| 636 | Ga0496105_0012416 | 3300048908 | Bacteria | 6743 |
| 637 | Ga0496105_0391803 | 3300048908 | Bacteria | 1104 |
| 638 | Ga0496106_0001262 | 3300048909 | Bacteria | 18951 |
| 639 | Ga0496106_0003691 | 3300048909 | Bacteria | 11418 |
| 640 | Ga0496106_0014884 | 3300048909 | Bacteria | 5755 |
| 641 | Ga0496106_0137472 | 3300048909 | Bacteria | 1920 |
| 642 | Ga0496106_0139912 | 3300048909 | Bacteria | 1903 |
| 643 | Ga0496106_0151458 | 3300048909 | Bacteria | 1830 |
| 644 | Ga0496106_0489794 | 3300048909 | Bacteria | 988 |
| 645 | Ga0496107_0021225 | 3300048910 | Bacteria | 4590 |
| 646 | Ga0496108_0000479 | 3300048911 | Bacteria | 32030 |
| 647 | Ga0496108_0084458 | 3300048911 | Bacteria | 2694 |
| 648 | Ga0496108_0141737 | 3300048911 | Bacteria | 2071 |
| 649 | Ga0496108_0155553 | 3300048911 | Bacteria | 1974 |
| 650 | Ga0496108_0199656 | 3300048911 | Bacteria | 1735 |
| 651 | Ga0496108_0247223 | 3300048911 | Bacteria | 1551 |
| 652 | Ga0496109_0000910 | 3300048912 | Bacteria | 24624 |
| 653 | Ga0496109_0009376 | 3300048912 | Bacteria | 8339 |
| 654 | Ga0496109_0117615 | 3300048912 | Bacteria | 2474 |
| 655 | Ga0496109_0142527 | 3300048912 | Bacteria | 2241 |
| 656 | Ga0496109_0147156 | 3300048912 | Bacteria | 2204 |
| 657 | Ga0496109_0155298 | 3300048912 | Bacteria | 2143 |
| 658 | Ga0496109_0166533 | 3300048912 | Bacteria | 2067 |
| 659 | Ga0496109_0168061 | 3300048912 | Bacteria | 2057 |
| 660 | Ga0496109_0293113 | 3300048912 | Bacteria | 1534 |
| 661 | Ga0496110_0025120 | 3300048913 | Bacteria | 5087 |
| 662 | Ga0496110_0056560 | 3300048913 | Bacteria | 3452 |
| 663 | Ga0496110_0101486 | 3300048913 | Bacteria | 2579 |
| 664 | Ga0496110_0105664 | 3300048913 | Bacteria | 2526 |
| 665 | Ga0496110_0118704 | 3300048913 | Bacteria | 2382 |
| 666 | Ga0496110_0206343 | 3300048913 | Bacteria | 1786 |
| 667 | Ga0496111_0000112 | 3300048914 | Bacteria | 35886 |
| 668 | Ga0496111_0034388 | 3300048914 | Bacteria | 3619 |
| 669 | Ga0496111_0116502 | 3300048914 | Bacteria | 1970 |
| 670 | Ga0496111_0259119 | 3300048914 | Bacteria | 1290 |
| 671 | Ga0496111_0452236 | 3300048914 | Bacteria | 947 |
| 672 | Ga0496112_0000022 | 3300048915 | Bacteria | 156255 |
| 673 | Ga0496112_0023710 | 3300048915 | Bacteria | 5870 |
| 674 | Ga0496112_0032020 | 3300048915 | Bacteria | 5104 |
| 675 | Ga0496112_0034500 | 3300048915 | Bacteria | 4924 |
| 676 | Ga0496112_0043988 | 3300048915 | Bacteria | 4373 |
| 677 | Ga0496112_0118773 | 3300048915 | Bacteria | 2614 |
| 678 | Ga0496112_0170514 | 3300048915 | Bacteria | 2141 |
| 679 | Ga0496112_0261545 | 3300048915 | Bacteria | 1680 |
| 680 | Ga0496112_0266577 | 3300048915 | Bacteria | 1661 |
| 681 | Ga0496112_0402327 | 3300048915 | Bacteria | 1309 |
| 682 | Ga0496112_0539679 | 3300048915 | Bacteria | 1100 |
| 683 | Ga0496113_0000762 | 3300048916 | Bacteria | 16562 |
| 684 | Ga0496113_0009540 | 3300048916 | Bacteria | 6365 |
| 685 | Ga0496113_0072238 | 3300048916 | Bacteria | 2625 |
| 686 | Ga0496113_0108196 | 3300048916 | Bacteria | 2161 |
| 687 | Ga0496113_0129870 | 3300048916 | Bacteria | 1976 |
| 688 | Ga0496114_0009367 | 3300048917 | Bacteria | 7773 |
| 689 | Ga0496114_0245788 | 3300048917 | Bacteria | 1574 |
| 690 | Ga0496115_0014569 | 3300048918 | Bacteria | 5952 |
| 691 | Ga0496115_0032437 | 3300048918 | Bacteria | 4121 |
| 692 | Ga0496115_0033888 | 3300048918 | Bacteria | 4034 |
| 693 | Ga0496115_0081033 | 3300048918 | Bacteria | 2643 |
| 694 | Ga0496115_0189664 | 3300048918 | Bacteria | 1698 |
| 695 | Ga0496115_0238742 | 3300048918 | Bacteria | 1498 |
| 696 | Ga0496115_0422078 | 3300048918 | Bacteria | 1080 |
| 697 | Ga0496116_0077687 | 3300048919 | Bacteria | 2073 |
| 698 | Ga0496117_0043940 | 3300048920 | Bacteria | 3241 |
| 699 | Ga0496117_0088506 | 3300048920 | Bacteria | 2003 |
| 700 | Ga0496118_0036454 | 3300048921 | Bacteria | 3976 |
| 701 | Ga0496118_0083539 | 3300048921 | Bacteria | 2232 |
| 702 | Ga0496118_0136393 | 3300048921 | Bacteria | 1565 |
| 703 | Ga0496119_0068858 | 3300048922 | Bacteria | 2082 |
| 704 | Ga0496119_0123246 | 3300048922 | Bacteria | 1422 |
| 705 | Ga0496119_0127019 | 3300048922 | Bacteria | 1394 |
| 706 | Ga0496120_0022888 | 3300048923 | Bacteria | 3923 |
| 707 | Ga0496121_0000254 | 3300048924 | Bacteria | 113314 |
| 708 | Ga0496121_0002114 | 3300048924 | Bacteria | 31228 |
| 709 | Ga0496121_0011243 | 3300048924 | Bacteria | 9975 |
| 710 | Ga0496121_0012395 | 3300048924 | Bacteria | 9307 |
| 711 | Ga0496121_0055262 | 3300048924 | Bacteria | 3309 |
| 712 | Ga0496121_0090630 | 3300048924 | Bacteria | 2389 |
| 713 | Ga0496121_0113432 | 3300048924 | Bacteria | 2062 |
| 714 | Ga0496121_0128284 | 3300048924 | Bacteria | 1903 |
| 715 | Ga0496121_0222224 | 3300048924 | Bacteria | 1329 |
| 716 | Ga0496124_0001351 | 3300048927 | Bacteria | 36722 |
| 717 | Ga0496124_0054938 | 3300048927 | Bacteria | 3368 |
| 718 | Ga0496125_0025529 | 3300048928 | Bacteria | 5408 |
| 719 | Ga0496125_0065882 | 3300048928 | Bacteria | 2866 |
| 720 | Ga0496125_0099784 | 3300048928 | Bacteria | 2143 |
| 721 | Ga0496126_0007801 | 3300048929 | Bacteria | 11669 |
| 722 | Ga0496126_0012548 | 3300048929 | Bacteria | 8674 |
| 723 | Ga0496126_0022598 | 3300048929 | Bacteria | 6113 |
| 724 | Ga0496126_0024830 | 3300048929 | Bacteria | 5779 |
| 725 | Ga0496126_0026051 | 3300048929 | Bacteria | 5614 |
| 726 | Ga0496126_0049875 | 3300048929 | Bacteria | 3819 |
| 727 | Ga0496126_0155068 | 3300048929 | Bacteria | 1960 |
| 728 | Ga0496126_0222802 | 3300048929 | Bacteria | 1583 |
| 729 | Ga0496126_0368862 | 3300048929 | Bacteria | 1171 |
| 730 | Ga0501031_0001005 | 3300049568 | Bacteria | 17104 |
| 731 | Ga0501031_0020264 | 3300049568 | Bacteria | 4335 |
| 732 | Ga0501032_0000161 | 3300049569 | Bacteria | 54292 |
| 733 | Ga0501032_0017757 | 3300049569 | Bacteria | 4993 |
| 734 | Ga0501032_0053496 | 3300049569 | Bacteria | 2718 |
| 735 | Ga0501033_0000111 | 3300049570 | Bacteria | 78688 |
| 736 | Ga0501033_0000672 | 3300049570 | Bacteria | 31550 |
| 737 | Ga0501034_0000072 | 3300049571 | Bacteria | 179824 |
| 738 | Ga0501034_0071554 | 3300049571 | Bacteria | 3477 |
| 739 | Ga0501034_0144499 | 3300049571 | Bacteria | 2356 |
| 740 | Ga0501034_0260391 | 3300049571 | Bacteria | 1677 |
| 741 | Ga0501036_0011119 | 3300049572 | Bacteria | 7443 |
| 742 | Ga0501036_0053940 | 3300049572 | Bacteria | 3403 |
| 743 | Ga0501036_0073036 | 3300049572 | Bacteria | 2900 |
| 744 | Ga0501036_0129667 | 3300049572 | Bacteria | 2129 |
| 745 | Ga0501036_0446357 | 3300049572 | Bacteria | 1078 |
| 746 | Ga0501037_0000030 | 3300049573 | Bacteria | 136148 |
| 747 | Ga0501037_0055311 | 3300049573 | Bacteria | 2901 |
| 748 | Ga0501037_0062319 | 3300049573 | Bacteria | 2718 |
| 749 | Ga0501037_0126387 | 3300049573 | Bacteria | 1835 |
| 750 | Ga0501038_0000060 | 3300049574 | Bacteria | 92314 |
| 751 | Ga0501038_0003347 | 3300049574 | Bacteria | 14952 |
| 752 | Ga0501038_0019562 | 3300049574 | Bacteria | 6101 |
| 753 | Ga0501038_0023061 | 3300049574 | Bacteria | 5569 |
| 754 | Ga0501038_0144142 | 3300049574 | Bacteria | 1946 |
| 755 | Ga0501038_0203591 | 3300049574 | Bacteria | 1587 |
| 756 | Ga0501039_0003983 | 3300049575 | Bacteria | 11104 |
| 757 | Ga0501039_0014332 | 3300049575 | Bacteria | 6069 |
| 758 | Ga0501039_0155791 | 3300049575 | Bacteria | 1794 |
| 759 | Ga0501040_0118117 | 3300049576 | Bacteria | 1859 |
| 760 | Ga0501042_0053990 | 3300049578 | Bacteria | 2866 |
| 761 | Ga0501042_0112143 | 3300049578 | Bacteria | 1963 |
| 762 | Ga0501043_0000357 | 3300049579 | Bacteria | 41554 |
| 763 | Ga0501046_0002205 | 3300049580 | Bacteria | 18409 |
| 764 | Ga0501046_0050507 | 3300049580 | Bacteria | 3286 |
| 765 | Ga0501046_0236188 | 3300049580 | Bacteria | 1349 |
| 766 | Ga0501047_0000140 | 3300049581 | Bacteria | 88265 |
| 767 | Ga0501047_0026961 | 3300049581 | Bacteria | 5533 |
| 768 | Ga0501047_0068547 | 3300049581 | Bacteria | 3416 |
| 769 | Ga0501047_0241726 | 3300049581 | Bacteria | 1656 |
| 770 | Ga0501047_0338958 | 3300049581 | Bacteria | 1341 |
| 771 | Ga0501048_0000812 | 3300049582 | Bacteria | 22948 |
| 772 | Ga0501048_0144939 | 3300049582 | Bacteria | 1680 |
| 773 | Ga0501067_0000697 | 3300049583 | Bacteria | 18107 |
| 774 | Ga0501067_0002459 | 3300049583 | Bacteria | 10222 |
| 775 | Ga0501067_0067838 | 3300049583 | Bacteria | 1975 |
| 776 | Ga0501068_0015057 | 3300049584 | Bacteria | 4434 |
| 777 | Ga0501069_0062846 | 3300049585 | Bacteria | 2073 |
| 778 | Ga0501069_0066501 | 3300049585 | Bacteria | 2016 |
| 779 | Ga0501070_0000602 | 3300049586 | Bacteria | 32900 |
| 780 | Ga0501070_0010155 | 3300049586 | Bacteria | 7969 |
| 781 | Ga0501070_0058337 | 3300049586 | Bacteria | 3199 |
| 782 | Ga0501070_0138152 | 3300049586 | Bacteria | 2012 |
| 783 | Ga0501070_0180023 | 3300049586 | Bacteria | 1740 |
| 784 | Ga0501072_0084380 | 3300049588 | Bacteria | 2518 |
| 785 | Ga0501072_0401974 | 3300049588 | Bacteria | 1086 |
| 786 | Ga0501073_0000009 | 3300049589 | Bacteria | 195649 |
| 787 | Ga0501073_0009578 | 3300049589 | Bacteria | 7144 |
| 788 | Ga0501073_0035565 | 3300049589 | Bacteria | 3539 |
| 789 | Ga0501073_0106062 | 3300049589 | Bacteria | 1950 |
| 790 | Ga0501074_0000137 | 3300049590 | Bacteria | 37950 |
| 791 | Ga0501077_0095551 | 3300049593 | Bacteria | 1884 |
| 792 | Ga0501079_0017212 | 3300049741 | Bacteria | 5519 |
| 793 | Ga0501079_0209186 | 3300049741 | Bacteria | 1524 |
| 794 | Ga0501080_0000088 | 3300049742 | Bacteria | 61753 |
| 795 | Ga0501080_0037211 | 3300049742 | Bacteria | 4543 |
| 796 | Ga0501080_0054964 | 3300049742 | Bacteria | 3708 |
| 797 | Ga0501083_0013621 | 3300049744 | Bacteria | 5684 |
| 798 | Ga0501083_0050365 | 3300049744 | Bacteria | 2803 |
| 799 | Ga0501035_0022354 | 3300049822 | Bacteria | 5807 |
| 800 | Ga0501035_0057070 | 3300049822 | Bacteria | 3481 |
| 801 | Ga0501035_0116770 | 3300049822 | Bacteria | 2335 |
| 802 | Ga0501035_0204141 | 3300049822 | Bacteria | 1694 |
| 803 | Ga0501035_0242617 | 3300049822 | Bacteria | 1532 |
| 804 | Ga0501035_0302376 | 3300049822 | Bacteria | 1347 |
| 805 | Ga0501044_0002346 | 3300049823 | Bacteria | 21600 |
| 806 | Ga0501044_0013964 | 3300049823 | Bacteria | 8676 |
| 807 | Ga0501044_0019722 | 3300049823 | Bacteria | 7205 |
| 808 | Ga0501044_0022171 | 3300049823 | Bacteria | 6770 |
| 809 | Ga0501045_0024317 | 3300049824 | Bacteria | 4348 |
| 810 | nmdc:mga03683_51497_c1 | 3300050489 | Bacteria | 1719 |
| 811 | nmdc:mga03n38_4303_c1 | 3300050490 | Bacteria | 4695 |
| 812 | nmdc:mga00v17_32663_c1 | 3300050491 | Bacteria | 3078 |
| 813 | nmdc:mga0yw44_13579_c1 | 3300050492 | Bacteria | 3996 |
| 814 | nmdc:mga0yw44_194539_c1 | 3300050492 | Bacteria | 1338 |
| 815 | nmdc:mga0yw44_78840_c1 | 3300050492 | Bacteria | 2060 |
| 816 | nmdc:mga0yw44_8656_c1 | 3300050492 | Bacteria | 5086 |
| 817 | nmdc:mga0yw44_93034_c1 | 3300050492 | Bacteria | 1909 |
| 818 | nmdc:mga0k408_6488_c1 | 3300050493 | Bacteria | 6235 |
| 819 | nmdc:mga06z11_182462_c1 | 3300050494 | Bacteria | 1211 |
| 820 | nmdc:mga06z11_21687_c1 | 3300050494 | Bacteria | 2989 |
| 821 | nmdc:mga06z11_47781_c1 | 3300050494 | Bacteria | 2175 |
| 822 | nmdc:mga06z11_7412_c1 | 3300050494 | Bacteria | 4511 |
| 823 | nmdc:mga04h51_43933_c1 | 3300050495 | Bacteria | 1471 |
| 824 | nmdc:mga07m45_19689_c1 | 3300050496 | Bacteria | 2864 |
| 825 | nmdc:mga07m45_25952_c1 | 3300050496 | Bacteria | 3218 |
| 826 | nmdc:mga05p37_338976_c1 | 3300050507 | Bacteria | 1773 |
| 827 | nmdc:mga0n895_2476_c1 | 3300050512 | Bacteria | 14436 |
| 828 | nmdc:mga0n895_47793_c1 | 3300050512 | Bacteria | 4185 |
| 829 | nmdc:mga0n895_95111_c1 | 3300050512 | Bacteria | 2984 |
| 830 | nmdc:mga0n895_95260_c1 | 3300050512 | Bacteria | 2981 |
| 831 | nmdc:mga0rr50_82341_c1 | 3300050513 | Bacteria | 2485 |
| 832 | nmdc:mga0sz30_59207_c1 | 3300050516 | Bacteria | 1634 |
| 833 | Ga0495601_0047714 | 3300053077 | Bacteria | 2697 |
| 834 | Ga0495601_0159031 | 3300053077 | Bacteria | 1476 |
| 835 | Ga0495612_0045607 | 3300053078 | Bacteria | 1794 |
| 836 | Ga0495595_0021212 | 3300053084 | Bacteria | 2835 |
| 837 | Ga0495595_0032285 | 3300053084 | Bacteria | 2358 |
| 838 | Ga0495619_0003855 | 3300053085 | Bacteria | 9655 |
| 839 | Ga0495619_0112518 | 3300053085 | Bacteria | 1861 |
| 840 | Ga0500578_0186649 | 3300053086 | Bacteria | 1275 |
| 841 | Ga0500651_0018002 | 3300053093 | Bacteria | 4369 |
| 842 | Ga0500651_0023015 | 3300053093 | Bacteria | 3898 |
| 843 | Ga0500566_0007702 | 3300053094 | Bacteria | 6385 |
| 844 | Ga0500566_0033416 | 3300053094 | Bacteria | 2997 |
| 845 | Ga0500566_0043140 | 3300053094 | Bacteria | 2599 |
| 846 | Ga0500566_0134479 | 3300053094 | Bacteria | 1319 |
| 847 | Ga0500640_002809 | 3300053095 | Bacteria | 5881 |
| 848 | Ga0500557_000057 | 3300053105 | Bacteria | 47849 |
| 849 | Ga0500557_090483 | 3300053105 | Bacteria | 1014 |
| 850 | Ga0500569_059070 | 3300053109 | Bacteria | 1179 |
| 851 | Ga0500572_000383 | 3300053111 | Bacteria | 15750 |
| 852 | Ga0500572_001892 | 3300053111 | Bacteria | 5274 |
| 853 | Ga0500595_004172 | 3300053119 | Bacteria | 6550 |
| 854 | Ga0500595_009841 | 3300053119 | Bacteria | 3837 |
| 855 | Ga0500595_022825 | 3300053119 | Bacteria | 2208 |
| 856 | Ga0500607_073306 | 3300053121 | Bacteria | 1762 |
| 857 | Ga0500608_068887 | 3300053122 | Bacteria | 1684 |
| 858 | Ga0500642_0000263 | 3300053130 | Bacteria | 19627 |
| 859 | Ga0500559_0000486 | 3300053136 | Bacteria | 28052 |
| 860 | Ga0500559_0049727 | 3300053136 | Bacteria | 1847 |
| 861 | Ga0500559_0051797 | 3300053136 | Bacteria | 1813 |
| 862 | Ga0500559_0055710 | 3300053136 | Bacteria | 1754 |
| 863 | Ga0500568_0037793 | 3300053139 | Bacteria | 1957 |
| 864 | Ga0500573_0045454 | 3300053140 | Bacteria | 2531 |
| 865 | Ga0500577_0000035 | 3300053142 | Bacteria | 31742 |
| 866 | Ga0500603_000335 | 3300053150 | Bacteria | 12321 |
| 867 | Ga0500603_000740 | 3300053150 | Bacteria | 7963 |
| 868 | Ga0500603_021454 | 3300053150 | Bacteria | 1589 |
| 869 | Ga0500603_035785 | 3300053150 | Bacteria | 1303 |
| 870 | Ga0500620_005833 | 3300053155 | Bacteria | 2890 |
| 871 | Ga0500630_016635 | 3300053159 | Bacteria | 3620 |
| 872 | Ga0500638_062254 | 3300053162 | Bacteria | 1792 |
| 873 | Ga0500639_001074 | 3300053163 | Bacteria | 13945 |
| 874 | Ga0500639_028645 | 3300053163 | Bacteria | 2943 |
| 875 | Ga0500636_0001378 | 3300053177 | Bacteria | 13188 |
| 876 | Ga0500636_0017028 | 3300053177 | Bacteria | 4287 |
| 877 | Ga0500636_0042827 | 3300053177 | Bacteria | 2675 |
| 878 | Ga0500636_0148333 | 3300053177 | Bacteria | 1290 |
| 879 | Ga0500576_113008 | 3300053725 | Bacteria | 1085 |
| 880 | Ga0500657_084075 | 3300053728 | Bacteria | 1359 |
| 881 | Ga0500645_065959 | 3300053730 | Bacteria | 1042 |
| 882 | Ga0500596_001060 | 3300053735 | Bacteria | 5540 |
| 883 | Ga0500596_004321 | 3300053735 | Bacteria | 2614 |
| 884 | Ga0500596_015230 | 3300053735 | Bacteria | 1155 |
| 885 | Ga0500601_001101 | 3300053737 | Bacteria | 3057 |
| 886 | Ga0500601_005147 | 3300053737 | Bacteria | 1430 |
| 887 | Ga0501084_0005438 | 3300054114 | Bacteria | 10447 |
| 888 | Ga0501084_0036315 | 3300054114 | Bacteria | 4116 |
| 889 | Ga0501082_0018483 | 3300060353 | Bacteria | 6004 |
| 890 | Ga0501082_0025748 | 3300060353 | Bacteria | 5069 |
| 891 | 2507504320 | 2507262055 | Bacteria | 8048963 |
| 892 | 2508545754 | 2508501009 | Bacteria | 7784016 |
| 893 | 2508694579 | 2508501042 | Bacteria | 8719808 |
| 894 | 2509151292 | 2508501128 | Bacteria | 8613869 |
| 895 | 2511398417 | 2511231028 | Bacteria | 8046582 |
| 896 | 2513624509 | 2513237092 | Bacteria | 8341956 |
| 897 | 2513638628 | 2513237094 | Bacteria | 8789602 |
| 898 | 2513649984 | 2513237095 | Bacteria | 8976980 |
| 899 | 2513655421 | 2513237096 | Bacteria | 8722461 |
| 900 | 2513716830 | 2513237104 | Bacteria | 10034502 |
| 901 | 2513860015 | 2513237137 | Bacteria | 9558895 |
| 902 | 2513916501 | 2513237145 | Bacteria | 8979722 |
| 903 | 2515624493 | 2515154112 | Bacteria | 8294334 |
| 904 | 2517104578 | 2517093001 | Bacteria | 9002274 |
| 905 | 2517889908 | 2517572143 | Bacteria | 9484767 |
| 906 | 2524470524 | 2524023210 | Bacteria | 9029266 |
| 907 | 2524532903 | 2524023228 | Bacteria | 10118060 |
| 908 | 2528850381 | 2528768022 | Bacteria | 10457665 |
| 909 | 2617374679 | 2617270741 | Bacteria | 8201522 |
| 910 | 2644290200 | 2643221651 | Bacteria | 4798932 |
| 911 | 2671121068 | 2667528175 | Bacteria | 7532676 |
| 912 | 2728749179 | 2728368998 | Bacteria | 8720350 |
| 913 | 2738746396 | 2738541281 | Bacteria | 5112672 |
| 914 | 2739355626 | 2738543032 | Bacteria | 5115625 |
| 915 | 2793059412 | 2791355196 | Bacteria | 7323613 |
| 916 | 2793068143 | 2791355197 | Bacteria | 8420563 |
| 917 | 2793078539 | |||
| 918 | 2818240984 | 2816332527 | Bacteria | 8933356 |
| 919 | 2824604435 | 2824600985 | Bacteria | 8488197 |
| 920 | 2824615024 | 2824609381 | Bacteria | 8672835 |
| 921 | 2824624923 | 2824617872 | Bacteria | 8814715 |
| 922 | 2824633219 | 2824626560 | Bacteria | 8813858 |
| 923 | 2824640945 | 2824635225 | Bacteria | 8785348 |
| 924 | 2824651053 | 2824644064 | Bacteria | 8743947 |
| 925 | 2824659192 | 2824653114 | Bacteria | 8493680 |
| 926 | 2824665215 | 2824661429 | Bacteria | 9877870 |
| 927 | 2824687118 | 2824679649 | Bacteria | 8248951 |
| 928 | 2824721057 | 2824714736 | Bacteria | 8717648 |
| 929 | 2824728264 | 2824723954 | Bacteria | 8758240 |
| 930 | 2824738358 | 2824732956 | Bacteria | 7810675 |
| 931 | 2824751277 | 2824746037 | Bacteria | 7911610 |
| 932 | 2841960691 | 2841957949 | Bacteria | 8652217 |
| 933 | 2842041792 | 2842038055 | Bacteria | 8002051 |
| 934 | 2842049834 | 2842045827 | Bacteria | 8006841 |
| 935 | 2847932085 | 2847930680 | Bacteria | 9342022 |
| 936 | 2849077049 | 2849076700 | Bacteria | 7039503 |
| 937 | 2857514665 | 2857509624 | Bacteria | 7472071 |
| 938 | 2874595724 | 2874590934 | Bacteria | 8299676 |
| 939 | 2874614994 | 2874612657 | Bacteria | 8252029 |
| 940 | 2874624213 | 2874620515 | Bacteria | 8290088 |
| 941 | 2874651644 | 2874645413 | Bacteria | 8214782 |
| 942 | 2876775919 | 2876771140 | Bacteria | 8287509 |
| 943 | 2876808657 | 2876808645 | Bacteria | 8824342 |
| 944 | 2876821539 | 2876818435 | Bacteria | 8274608 |
| 945 | 2879080010 | 2879074833 | Bacteria | 8279565 |
| 946 | 2879085762 | 2879083081 | Bacteria | 8587928 |
| 947 | 2879100593 | 2879099564 | Bacteria | 10442239 |
| 948 | 2879111929 | 2879110137 | Bacteria | 8907982 |
| 949 | 2879134092 | 2879127579 | Bacteria | 8294491 |
| 950 | 2879148577 | 2879142872 | Bacteria | 8267021 |
| 951 | 2881367712 | 2881364244 | Bacteria | 7710352 |
| 952 | 2881669304 | 2881665667 | Bacteria | 8175609 |
| 953 | 2885374493 | 2885366525 | Bacteria | 8326213 |
| 954 | 2885379437 | 2885374607 | Bacteria | 8927485 |
| 955 | 2888387623 | 2888378607 | Bacteria | 9652610 |
| 956 | 2888426838 | 2888419890 | Bacteria | 7857137 |
| 957 | 2889034123 | 2889033259 | Bacteria | 9099371 |
| 958 | 2903755849 | 2903748898 | Bacteria | 9972761 |
| 959 | 2904670924 | 2904666416 | Bacteria | 8226587 |
| 960 | 2904692641 | 2904690495 | Bacteria | 9412302 |
| 961 | 2904711110 | |||
| 962 | 2906612352 | |||
| 963 | 2906633093 | 2906626472 | Bacteria | 8826946 |
| 964 | 2906638320 | 2906635258 | Bacteria | 8601019 |
| 965 | 2906650117 | 2906643746 | Bacteria | 8722424 |
| 966 | 2906663395 | 2906660503 | Bacteria | 8595048 |
| 967 | 2908739774 | 2908739725 | Bacteria | 8628932 |
| 968 | 2908757852 | 2908756301 | Bacteria | 8864324 |
| 969 | 2908777160 | 2908775508 | Bacteria | 8092255 |
| 970 | 2922367521 | 2922361189 | Bacteria | 7436256 |
| 971 | 2922376606 | |||
| 972 | 2922391499 | 2922386360 | Bacteria | 7017218 |
| 973 | 2922398558 | 2922393267 | Bacteria | 8285685 |
| 974 | 2922426942 | |||
| 975 | 2929619890 | 2929615660 | Bacteria | 9193770 |
| 976 | 2929629202 | 2929624759 | Bacteria | 9339455 |
| 977 | 2932789667 | 2932784394 | Bacteria | 9704911 |
| 978 | 2932796664 | 2932794094 | Bacteria | 7915132 |
| 979 | 2932802556 | 2932801729 | Bacteria | 7987968 |
| 980 | 2932814827 | 2932809354 | Bacteria | 9135765 |
| 981 | 2932824316 | 2932818245 | Bacteria | 9955613 |
| 982 | 2932833956 | 2932828146 | Bacteria | 9745859 |
| 983 | 2933581808 | 2933577622 | Bacteria | 9116884 |
| 984 | 2935613265 | 2935608549 | Bacteria | 8203142 |
| 985 | 2935623654 | 2935616580 | Bacteria | 9032984 |
| 986 | 2935633100 | 2935630451 | Bacteria | 8169952 |
| 987 | 2935645041 | 2935638405 | Bacteria | 10015038 |
| 988 | 2935656621 | 2935648319 | Bacteria | 8801166 |
| 989 | 2935665455 | 2935656913 | Bacteria | 8965014 |
| 990 | 2935672090 | 2935665750 | Bacteria | 9571747 |
| 991 | 2935684104 | 2935675223 | Bacteria | 9928132 |
| 992 | 2935689153 | 2935684952 | Bacteria | 9590419 |
| 993 | 2935697587 | 2935694250 | Bacteria | 9291695 |
| 994 | 2935711387 | 2935703347 | Bacteria | 10242284 |
| 995 | 2935720099 | 2935713505 | Bacteria | 9608509 |
| 996 | 2935728284 | 2935722832 | Bacteria | 9608746 |
| 997 | 2935737119 | 2935732158 | Bacteria | 9706831 |
| 998 | 2935746820 | 2935741537 | Bacteria | 9707219 |
| 999 | 2935757787 | 2935750917 | Bacteria | 9590372 |
| 1000 | 2935764167 | 2935760218 | Bacteria | 9817913 |
| 1001 | 2935780106 | 2935777560 | Bacteria | 8077691 |
| 1002 | 2935790228 | 2935785616 | Bacteria | 7962367 |
| 1003 | 2935798730 | 2935793552 | Bacteria | 8012592 |
| 1004 | 2935808753 | 2935801545 | Bacteria | 9301974 |
| 1005 | 2935817550 | 2935810662 | Bacteria | 9401221 |
| 1006 | 2935824881 | 2935819856 | Bacteria | 8261050 |
| 1007 | 2935834113 | 2935827899 | Bacteria | 10038562 |
| 1008 | 2935844715 | 2935837841 | Bacteria | 9454360 |
| 1009 | 2935852101 | 2935847175 | Bacteria | 8228321 |
| 1010 | 2935861739 | 2935855204 | Bacteria | 9035059 |
| 1011 | 2935868625 | 2935864058 | Bacteria | 9784707 |
| 1012 | 2935879399 | 2935873716 | Bacteria | 9632195 |
| 1013 | 2935887004 | 2935883170 | Bacteria | 7964738 |
| 1014 | 2935911448 | 2935908558 | Bacteria | 8568796 |
| 1015 | 2935920983 | 2935916978 | Bacteria | 9113783 |
| 1016 | 2935928477 | 2935926038 | Bacteria | 8601059 |
| 1017 | 2935938122 | 2935934488 | Bacteria | 8602579 |
| 1018 | 2935945404 | 2935942939 | Bacteria | 8599779 |
| 1019 | 2935954090 | 2935951376 | Bacteria | 8602333 |
| 1020 | 2935965470 | 2935959822 | Bacteria | 7869783 |
| 1021 | 2935971642 | 2935967501 | Bacteria | 8603075 |
| 1022 | 2935980046 | 2935975950 | Bacteria | 8347125 |
| 1023 | 2935989474 | 2935984226 | Bacteria | 8302647 |
| 1024 | 2935998433 | 2935992306 | Bacteria | 9802711 |
| 1025 | 2936009106 | 2936002035 | Bacteria | 9362176 |
| 1026 | 2936019484 | 2936011229 | Bacteria | 8801034 |
| 1027 | 2936028106 | 2936019824 | Bacteria | 8804134 |
| 1028 | 2936036940 | 2936028420 | Bacteria | 8965941 |
| 1029 | 2936044347 | 2936037263 | Bacteria | 9446081 |
| 1030 | 2936054963 | 2936046547 | Bacteria | 8903709 |
| 1031 | 2936060730 | 2936055302 | Bacteria | 8785755 |
| 1032 | 2940563391 | 2940556831 | Bacteria | 9590747 |
| 1033 | 2941509598 | 2941507105 | Bacteria | 8166816 |
| 1034 | 2941517427 | 2941515067 | Bacteria | 8166720 |
| 1035 | 2941526620 | 2941523033 | Bacteria | 8169134 |
| 1036 | 2941531899 | 2941531003 | Bacteria | 7653939 |
| 1037 | 2941545390 | 2941538514 | Bacteria | 9402094 |
| 1038 | 3005476126 | 3005474847 | Bacteria | 9259049 |
| 1039 | 3005486013 | 3005483717 | Bacteria | 7877331 |
| 1040 | 3005592751 | 3005587118 | Bacteria | 7794411 |
| 1041 | 3005717414 | 3005710791 | Bacteria | 7622528 |
| 1042 | 8006929532 | 8006926726 | Bacteria | 6749210 |
| 1043 | 8006937439 | 8006933436 | Bacteria | 10410654 |
| 1044 | 8006977468 | 8006973647 | Bacteria | 10679141 |
| 1045 | 8006989993 | 8006984368 | Bacteria | 9651211 |
| 1046 | 8016519231 | 8016511872 | Bacteria | 9921665 |
| 1047 | 8016538669 | 8016530956 | Bacteria | 8155261 |
| 1048 | 8016542956 | 8016539877 | Bacteria | 8155419 |
| 1049 | 8016550335 | 8016548790 | Bacteria | 8155074 |
| 1050 | 8016558742 | 8016557553 | Bacteria | 8154380 |
| 1051 | 8016568353 | 8016566248 | Bacteria | 8158151 |
| 1052 | 8016581012 | 8016575299 | Bacteria | 8154085 |
| 1053 | 8016587716 | 8016583857 | Bacteria | 10421953 |
| 1054 | 8016596718 | 8016595262 | Bacteria | 8149947 |
| 1055 | 8016619388 | 8016613128 | Bacteria | 8794220 |
| 1056 | 8016630205 | 8016622563 | Bacteria | 7999408 |
| 1057 | 8016636945 | 8016630954 | Bacteria | 9217207 |
| 1058 | 8017066279 | 8017057580 | Bacteria | 10023680 |
| 1059 | 8019538341 | 8019530166 | Bacteria | 8155624 |
| 1060 | 8019541481 | 8019538911 | Bacteria | 7872763 |
| 1061 | 8019549146 | 8019547302 | Bacteria | 7996444 |
| 1062 | 8019561185 | 8019555841 | Bacteria | 9642137 |
| 1063 | 8019578344 | 8019576017 | Bacteria | 10049540 |
| 1064 | 8019596382 | 8019586578 | Bacteria | 10212056 |
| 1065 | 8019605319 | 8019597564 | Bacteria | 10041141 |
| 1066 | 8019623905 | 8019619141 | Bacteria | 9218857 |
| 1067 | 8019638134 | 8019629233 | Bacteria | 8687553 |
| 1068 | 8019641501 | 8019638758 | Bacteria | 9062356 |
| 1069 | 8019651542 | 8019648815 | Bacteria | 10014479 |
| 1070 | 8019666049 | 8019659431 | Bacteria | 8577854 |
| 1071 | 8019675568 | 8019668869 | Bacteria | 8791617 |
| 1072 | 8019695223 | 8019687851 | Bacteria | 8712826 |
| 1073 | 8055750358 | 8055742211 | Bacteria | 9226248 |
| 1074 | 8056691978 | 8056689827 | Bacteria | 6712655 |
| 1075 | Ga0070683_100035992 | |||
| 1076 | JGI25406J46586_10006073 | |||
| 1077 | JGI25153J46596_10004803 | |||
| 1078 | JGI25153J46596_10028115 | |||
| 1079 | JGI25160J50197_1024331 | |||
| 1080 | JGI25404J52841_10001048 | |||
| 1081 | Ga0055531_10020619 | |||
| 1082 | Ga0055543_1012260 | |||
| 1083 | Ga0065165_1030520 | |||
| 1084 | Ga0070658_10011197 | |||
| 1085 | Ga0070658_10064095 | |||
| 1086 | Ga0070658_10355905 | |||
| 1087 | Ga0070683_100046881 | |||
| 1088 | Ga0070683_100110710 | |||
| 1089 | Ga0070680_100020407 | |||
| 1090 | Ga0070680_100034052 | |||
| 1091 | Ga0070680_100104526 | |||
| 1092 | Ga0070680_100132343 | |||
| 1093 | Ga0070682_100294312 | |||
| 1094 | Ga0068868_100235674 | |||
| 1095 | Ga0070660_100019955 | |||
| 1096 | Ga0070660_100052201 | |||
| 1097 | Ga0070668_100110800 | |||
| 1098 | Ga0070671_100166203 | |||
| 1099 | Ga0070671_100307646 | |||
| 1100 | Ga0070674_100170542 | |||
| 1101 | Ga0070659_100128407 | |||
| 1102 | Ga0070667_100143556 | |||
| 1103 | Ga0070709_10009651 | |||
| 1104 | Ga0070709_10056134 | |||
| 1105 | Ga0070709_10116826 | |||
| 1106 | Ga0070714_100169165 | |||
| 1107 | Ga0070713_100007733 | |||
| 1108 | Ga0070713_100044539 | |||
| 1109 | Ga0070713_100056937 | |||
| 1110 | Ga0070713_100593325 | |||
| 1111 | Ga0070710_10000707 | |||
| 1112 | Ga0070710_10015339 | |||
| 1113 | Ga0070701_10146990 | |||
| 1114 | Ga0070711_100006676 | |||
| 1115 | Ga0070711_100016881 | |||
| 1116 | Ga0070711_100067059 | |||
| 1117 | Ga0070711_100380914 | |||
| 1118 | Ga0070705_100096817 | |||
| 1119 | Ga0070700_100420737 | |||
| 1120 | Ga0070708_100685664 | |||
| 1121 | Ga0070663_100049756 | |||
| 1122 | Ga0070678_100067611 | |||
| 1123 | Ga0070678_100112722 | |||
| 1124 | Ga0070681_10209901 | |||
| 1125 | Ga0070698_100154937 | |||
| 1126 | Ga0070679_100020129 | |||
| 1127 | Ga0070679_100042976 | |||
| 1128 | Ga0070679_100445048 | |||
| 1129 | Ga0070684_100018149 | |||
| 1130 | Ga0070684_100021264 | |||
| 1131 | Ga0070684_100083447 | |||
| 1132 | Ga0070684_100252410 | |||
| 1133 | Ga0070697_100090441 | |||
| 1134 | Ga0070697_100326297 | |||
| 1135 | Ga0068853_100007083 | |||
| 1136 | Ga0068853_100007085 | |||
| 1137 | Ga0068853_100082352 | |||
| 1138 | Ga0068853_100097672 | |||
| 1139 | Ga0068853_100289547 | |||
| 1140 | Ga0070665_100038638 | |||
| 1141 | Ga0070665_100176196 | |||
| 1142 | Ga0070665_100176978 | |||
| 1143 | Ga0070665_100197527 | |||
| 1144 | Ga0070665_100286751 | |||
| 1145 | Ga0070665_100430113 | |||
| 1146 | Ga0068855_100048105 | |||
| 1147 | Ga0068855_100054394 | |||
| 1148 | Ga0068855_100064837 | |||
| 1149 | Ga0068855_100113485 | |||
| 1150 | Ga0068855_100488585 | |||
| 1151 | Ga0068855_100512354 | |||
| 1152 | Ga0070664_100222862 | |||
| 1153 | Ga0070664_100268983 | |||
| 1154 | Ga0068857_100045081 | |||
| 1155 | Ga0068857_100110228 | |||
| 1156 | Ga0068854_100126267 | |||
| 1157 | Ga0068856_100000522 | |||
| 1158 | Ga0068856_100010527 | |||
| 1159 | Ga0068856_100172156 | |||
| 1160 | Ga0068856_100265444 | |||
| 1161 | Ga0068856_100426722 | |||
| 1162 | Ga0068852_100021761 | |||
| 1163 | Ga0068852_100041617 | |||
| 1164 | Ga0068852_100047847 | |||
| 1165 | Ga0068852_100365435 | |||
| 1166 | Ga0068864_100037310 | |||
| 1167 | Ga0068864_100159098 | |||
| 1168 | Ga0068864_100200349 | |||
| 1169 | Ga0068861_100222100 | |||
| 1170 | Ga0068861_100517647 | |||
| 1171 | Ga0068863_100119367 | |||
| 1172 | Ga0068858_100150021 | |||
| 1173 | Ga0068858_100183632 | |||
| 1174 | Ga0068858_100339526 | |||
| 1175 | Ga0068860_100000441 | |||
| 1176 | Ga0068860_100177701 | |||
| 1177 | Ga0081455_10034005 | |||
| 1178 | Ga0081455_10105365 | |||
| 1179 | Ga0081540_1017509 | |||
| 1180 | Ga0081540_1018219 | |||
| 1181 | Ga0081540_1025852 | |||
| 1182 | Ga0081540_1026432 | |||
| 1183 | Ga0081540_1048367 | |||
| 1184 | Ga0081540_1048528 | |||
| 1185 | Ga0081539_10000425 | |||
| 1186 | Ga0081539_10001114 | |||
| 1187 | Ga0081539_10032892 | |||
| 1188 | Ga0081539_10053402 | |||
| 1189 | Ga0070717_10000325 | |||
| 1190 | Ga0070717_10123243 | |||
| 1191 | Ga0070717_10147620 | |||
| 1192 | Ga0075365_10128266 | |||
| 1193 | Ga0075365_10183961 | |||
| 1194 | Ga0075363_100012045 | |||
| 1195 | Ga0075363_100064202 | |||
| 1196 | Ga0075363_100100340 | |||
| 1197 | Ga0075364_10083494 | |||
| 1198 | Ga0075364_10207465 | |||
| 1199 | Ga0070715_10026071 | |||
| 1200 | Ga0070716_100005608 | |||
| 1201 | Ga0070716_100019072 | |||
| 1202 | Ga0070712_100087985 | |||
| 1203 | Ga0070712_100089696 | |||
| 1204 | Ga0075362_10055144 | |||
| 1205 | Ga0075367_10067480 | |||
| 1206 | Ga0075367_10136013 | |||
| 1207 | Ga0075367_10222803 | |||
| 1208 | Ga0075369_10042648 | |||
| 1209 | Ga0075366_10107625 | |||
| 1210 | Ga0097621_100143110 | |||
| 1211 | Ga0075370_10087982 | |||
| 1212 | Ga0075370_10118448 | |||
| 1213 | Ga0068871_100158319 | |||
| 1214 | Ga0068871_100211502 | |||
| 1215 | Ga0075434_100004469 | |||
| 1216 | Ga0075434_100096067 | |||
| 1217 | Ga0075434_100362343 | |||
| 1218 | Ga0068865_100073449 | |||
| 1219 | Ga0099825_1020668 | |||
| 1220 | Ga0099824_1035813 | |||
| 1221 | Ga0099822_1007626 | |||
| 1222 | Ga0099822_1056766 | |||
| 1223 | Ga0099823_1072928 | |||
| 1224 | Ga0099794_10012991 | |||
| 1225 | Ga0099795_10025691 | |||
| 1226 | Ga0105240_10002968 | |||
| 1227 | Ga0105240_10017804 | |||
| 1228 | Ga0105240_10190410 | |||
| 1229 | Ga0105240_10227269 | |||
| 1230 | Ga0105240_10407263 | |||
| 1231 | Ga0105247_10043858 | |||
| 1232 | Ga0105241_10001388 | |||
| 1233 | Ga0105248_10269872 | |||
| 1234 | Ga0105248_10496058 | |||
| 1235 | Ga0105237_10020853 | |||
| 1236 | Ga0105237_10123107 | |||
| 1237 | Ga0105237_10208382 | |||
| 1238 | Ga0105237_10237353 | |||
| 1239 | Ga0105237_10341691 | |||
| 1240 | Ga0105238_10010451 | |||
| 1241 | Ga0105238_10025037 | |||
| 1242 | Ga0105238_10066453 | |||
| 1243 | Ga0105238_10334186 | |||
| 1244 | Ga0105238_10451722 | |||
| 1245 | Ga0105238_10680530 | |||
| 1246 | Ga0105249_10194985 | |||
| 1247 | Ga0105249_10361636 | |||
| 1248 | Ga0099796_10038085 | |||
| 1249 | Ga0099796_10082867 | |||
| 1250 | Ga0105239_10131032 | |||
| 1251 | Ga0105239_10201586 | |||
| 1252 | Ga0105239_10276817 | |||
| 1253 | Ga0157371_10015904 | |||
| 1254 | Ga0157370_10108237 | |||
| 1255 | Ga0157370_10124721 | |||
| 1256 | Ga0157370_10180609 | |||
| 1257 | Ga0157369_10009007 | |||
| 1258 | Ga0157369_10009927 | |||
| 1259 | Ga0157369_10218728 | |||
| 1260 | Ga0157369_10343522 | |||
| 1261 | Ga0157374_10041978 | |||
| 1262 | Ga0163162_10149747 | |||
| 1263 | Ga0157372_10079888 | |||
| 1264 | Ga0157372_10310985 | |||
| 1265 | Ga0157372_10363327 | |||
| 1266 | Ga0157372_10418999 | |||
| 1267 | Ga0157372_10453038 | |||
| 1268 | Ga0157375_10133986 | |||
| 1269 | Ga0157375_10212208 | |||
| 1270 | Ga0163163_10081730 | |||
| 1271 | Ga0163163_10230508 | |||
| 1272 | Ga0157377_10091376 | |||
| 1273 | Ga0157376_10110571 | |||
| 1274 | Ga0157376_10311911 | |||
| 1275 | Ga0214544_1000011 | |||
| 1276 | Ga0214542_1000009 | |||
| 1277 | Ga0214545_1000007 | |||
| 1278 | Ga0214543_1000020 | |||
| 1279 | Ga0213872_10019823 | |||
| 1280 | Ga0213874_10013098 | |||
| 1281 | Ga0213874_10013163 | |||
| 1282 | Ga0213876_10001735 | |||
| 1283 | Ga0228598_1032947 | |||
| 1284 | Ga0209677_100470 | |||
| 1285 | Ga0209455_1007332 | |||
| 1286 | Ga0209564_1008389 | |||
| 1287 | Ga0209758_1000106 | |||
| 1288 | Ga0209758_1001683 | |||
| 1289 | Ga0209758_1002332 | |||
| 1290 | Ga0209758_1006430 | |||
| 1291 | Ga0209758_1037291 | |||
| 1292 | Ga0209050_1022586 | |||
| 1293 | Ga0207426_1003263 | |||
| 1294 | Ga0209257_1001741 | |||
| 1295 | Ga0207656_10034217 | |||
| 1296 | Ga0207692_10005117 | |||
| 1297 | Ga0207692_10008782 | |||
| 1298 | Ga0207692_10063539 | |||
| 1299 | Ga0207710_10011534 | |||
| 1300 | Ga0207710_10072188 | |||
| 1301 | Ga0207710_10126377 | |||
| 1302 | Ga0207680_10164264 | |||
| 1303 | Ga0207685_10003939 | |||
| 1304 | Ga0207685_10015299 | |||
| 1305 | Ga0207699_10000740 | |||
| 1306 | Ga0207699_10006844 | |||
| 1307 | Ga0207699_10055566 | |||
| 1308 | Ga0207705_10038645 | |||
| 1309 | Ga0207684_10262085 | |||
| 1310 | Ga0207654_10000729 | |||
| 1311 | Ga0207654_10184902 | |||
| 1312 | Ga0207707_10000541 | |||
| 1313 | Ga0207707_10000582 | |||
| 1314 | Ga0207707_10064900 | |||
| 1315 | Ga0207695_10000478 | |||
| 1316 | Ga0207695_10004497 | |||
| 1317 | Ga0207695_10018101 | |||
| 1318 | Ga0207695_10031949 | |||
| 1319 | Ga0207671_10003084 | |||
| 1320 | Ga0207671_10030076 | |||
| 1321 | Ga0207671_10044416 | |||
| 1322 | Ga0207671_10156052 | |||
| 1323 | Ga0207671_10162138 | |||
| 1324 | Ga0207671_10183495 | |||
| 1325 | Ga0207693_10005512 | |||
| 1326 | Ga0207693_10008208 | |||
| 1327 | Ga0207693_10014476 | |||
| 1328 | Ga0207693_10090801 | |||
| 1329 | Ga0207693_10105078 | |||
| 1330 | Ga0207693_10288729 | |||
| 1331 | Ga0207663_10000425 | |||
| 1332 | Ga0207663_10057794 | |||
| 1333 | Ga0207663_10072056 | |||
| 1334 | Ga0207663_10110833 | |||
| 1335 | Ga0207663_10138454 | |||
| 1336 | Ga0207660_10022911 | |||
| 1337 | Ga0207660_10074692 | |||
| 1338 | Ga0207657_10002950 | |||
| 1339 | Ga0207657_10136726 | |||
| 1340 | Ga0207649_10123275 | |||
| 1341 | Ga0207652_10004959 | |||
| 1342 | Ga0207652_10005910 | |||
| 1343 | Ga0207652_10138958 | |||
| 1344 | Ga0207681_10136395 | |||
| 1345 | Ga0207681_10277034 | |||
| 1346 | Ga0207694_10000849 | |||
| 1347 | Ga0207694_10015749 | |||
| 1348 | Ga0207694_10159501 | |||
| 1349 | Ga0207694_10433030 | |||
| 1350 | Ga0207687_10320813 | |||
| 1351 | Ga0207700_10004824 | |||
| 1352 | Ga0207700_10107598 | |||
| 1353 | Ga0207700_10308074 | |||
| 1354 | Ga0207664_10150991 | |||
| 1355 | Ga0207664_10293691 | |||
| 1356 | Ga0207644_10160881 | |||
| 1357 | Ga0207644_10200252 | |||
| 1358 | Ga0207690_10112687 | |||
| 1359 | Ga0207690_10151692 | |||
| 1360 | Ga0207669_10014908 | |||
| 1361 | Ga0207704_10009478 | |||
| 1362 | Ga0207665_10003367 | |||
| 1363 | Ga0207665_10003573 | |||
| 1364 | Ga0207691_10412079 | |||
| 1365 | Ga0207711_10293994 | |||
| 1366 | Ga0207689_10155732 | |||
| 1367 | Ga0207689_10174428 | |||
| 1368 | Ga0207689_10343299 | |||
| 1369 | Ga0207661_10000109 | |||
| 1370 | Ga0207661_10081608 | |||
| 1371 | Ga0207667_10021686 | |||
| 1372 | Ga0207667_10083996 | |||
| 1373 | Ga0207667_10123692 | |||
| 1374 | Ga0207667_10125735 | |||
| 1375 | Ga0207667_10215053 | |||
| 1376 | Ga0207667_10432994 | |||
| 1377 | Ga0207667_10481998 | |||
| 1378 | Ga0207668_10015127 | |||
| 1379 | Ga0207668_10405550 | |||
| 1380 | Ga0207640_10053654 | |||
| 1381 | Ga0207677_10067744 | |||
| 1382 | Ga0207677_10080223 | |||
| 1383 | Ga0207703_10087840 | |||
| 1384 | Ga0207703_10104833 | |||
| 1385 | Ga0207703_10253798 | |||
| 1386 | Ga0207703_10425232 | |||
| 1387 | Ga0207703_10471963 | |||
| 1388 | Ga0207639_10007486 | |||
| 1389 | Ga0207639_10032132 | |||
| 1390 | Ga0207639_10223000 | |||
| 1391 | Ga0207639_10260091 | |||
| 1392 | Ga0207639_10312378 | |||
| 1393 | Ga0207678_10046082 | |||
| 1394 | Ga0207678_10148445 | |||
| 1395 | Ga0207678_10195442 | |||
| 1396 | Ga0207708_10106601 | |||
| 1397 | Ga0207702_10000003 | |||
| 1398 | Ga0207702_10000014 | |||
| 1399 | Ga0207702_10254153 | |||
| 1400 | Ga0207702_10681322 | |||
| 1401 | Ga0207641_10574202 | |||
| 1402 | Ga0207648_10106662 | |||
| 1403 | Ga0207676_10059522 | |||
| 1404 | Ga0207676_10284789 | |||
| 1405 | Ga0207674_10012928 | |||
| 1406 | Ga0207674_10057148 | |||
| 1407 | Ga0207674_10065509 | |||
| 1408 | Ga0207674_10108590 | |||
| 1409 | Ga0207683_10117668 | |||
| 1410 | Ga0207683_10220341 | |||
| 1411 | Ga0207698_10063823 | |||
| 1412 | Ga0207698_10159850 | |||
| 1413 | Ga0209389_1000016 | |||
| 1414 | Ga0209389_1000027 | |||
| 1415 | Ga0209589_1000005 | |||
| 1416 | Ga0209589_1000031 | |||
| 1417 | Ga0209489_100005 | |||
| 1418 | Ga0209489_100057 | |||
| 1419 | Ga0209489_100063 | |||
| 1420 | Ga0209700_100006 | |||
| 1421 | Ga0209700_100012 | |||
| 1422 | Ga0209588_1004211 | |||
| 1423 | Ga0268266_10001346 | |||
| 1424 | Ga0268266_10068805 | |||
| 1425 | Ga0268266_10199533 | |||
| 1426 | Ga0268266_10548464 | |||
| 1427 | Ga0268265_10034105 | |||
| 1428 | Ga0268265_10199546 | |||
| 1429 | Ga0268264_10000042 | |||
| 1430 | Ga0268264_10135286 | |||
| 1431 | Ga0268264_10198150 | |||
| 1432 | Ga0265337_1045356 | |||
| 1433 | Ga0265336_10000348 | |||
| 1434 | Ga0307517_10000176 | |||
| 1435 | Ga0307515_10317759 | |||
| 1436 | Ga0265338_10000018 | |||
| 1437 | Ga0307511_10050299 | |||
| 1438 | Ga0265332_10016978 | |||
| 1439 | Ga0265328_10001180 | |||
| 1440 | Ga0265339_10000383 | |||
| 1441 | Ga0265316_10103031 | |||
| 1442 | Ga0307509_10025042 | |||
| 1443 | Ga0307509_10251156 | |||
| 1444 | Ga0307509_10333330 | |||
| 1445 | Ga0307508_10000029 | |||
| 1446 | Ga0307508_10024413 | |||
| 1447 | Ga0265314_10010200 | |||
| 1448 | Ga0265314_10229713 | |||
| 1449 | Ga0265342_10055988 | |||
| 1450 | Ga0307516_10088341 | |||
| 1451 | Ga0307516_10161240 | |||
| 1452 | Ga0307412_10204058 | |||
| 1453 | Ga0307409_100317876 | |||
| 1454 | Ga0307414_10178805 | |||
| 1455 | Ga0307415_100123019 | |||
| 1456 | Ga0307507_10021924 | |||
| 1457 | Ga0307510_10024826 | |||
| 1458 | Ga0307510_10026321 | |||
| 1459 | Ga0307510_10138078 | |||
| 1460 | Ga0315911_1000005 | |||
| 1461 | Ga0373926_0060001 | |||
| 1462 | Ga0373934_0018347 | |||
| 1463 | Ga0373934_0056364 | |||
| 1464 | Ga0373923_0010360 | |||
| 1465 | Ga0373923_0070889 | |||
| 1466 | Ga0373932_0076262 | |||
| 1467 | Ga0373936_0006737 | |||
| 1468 | Ga0373936_0085224 | |||
| 1469 | Ga0373936_0114482 | |||
| 1470 | Ga0373945_0016664 | |||
| 1471 | Ga0373953_0009510 | |||
| 1472 | Ga0373954_0002278 | |||
| 1473 | Ga0373954_0009920 | |||
| 1474 | Ga0373956_0004148 | |||
| 1475 | Ga0373956_0019733 | |||
| 1476 | Ga0373957_0001409 | |||
| 1477 | Ga0373957_0005477 | |||
| 1478 | Ga0373957_0034103 | |||
| 1479 | Ga0373943_0060746 | |||
| 1480 | Ga0373946_0006137 | |||
| 1481 | Ga0373946_0045097 | |||
| 1482 | Ga0373946_0155733 | |||
| 1483 | Ga0373955_0000395 | |||
| 1484 | Ga0373955_0042757 | |||
| 1485 | Ga0373924_0008165 | |||
| 1486 | Ga0373924_0055653 | |||
| 1487 | Ga0373924_0071304 | |||
| 1488 | Ga0373931_0001048 | |||
| 1489 | Ga0373931_0030584 | |||
| 1490 | Ga0373931_0179784 | |||
| 1491 | Ga0373935_0004219 | |||
| 1492 | Ga0373927_0002702 | |||
| 1493 | Ga0373927_0004563 | |||
| 1494 | Ga0373927_0023782 | |||
| 1495 | Ga0373927_0084381 | |||
| 1496 | Ga0373927_0143006 | |||
| 1497 | Ga0373933_0003364 | |||
| 1498 | Ga0373933_0007313 | |||
| 1499 | Ga0373933_0007540 | |||
| 1500 | Ga0373933_0091286 | |||
| 1501 | Ga0373947_0007364 | |||
| 1502 | Ga0373947_0027701 | |||
| 1503 | Ga0373947_0065680 | |||
| 1504 | Ga0373947_0157668 | |||
| 1505 | Ga0373937_0011914 | |||
| 1506 | Ga0373937_0022128 | |||
| 1507 | Ga0373937_0049502 | |||
| 1508 | Ga0373925_0007592 | |||
| 1509 | Ga0373925_0018541 | |||
| 1510 | Ga0373925_0034208 | |||
| 1511 | Ga0373925_0049760 | |||
| 1512 | Ga0373925_0092541 | |||
| 1513 | Ga0373925_0104706 | |||
| 1514 | Ga0395900_0007140 | |||
| 1515 | Ga0395900_0044885 | |||
| 1516 | Ga0395900_0105951 | |||
| 1517 | Ga0395898_0067033 | |||
| 1518 | Ga0395898_0138367 | |||
| 1519 | Ga0395905_0028290 | |||
| 1520 | Ga0395905_0246935 | |||
| 1521 | Ga0395905_0547190 | |||
| 1522 | Ga0436364_0776445 | |||
| 1523 | Ga0395901_0129075 | |||
| 1524 | Ga0436365_0657970 | |||
| 1525 | Ga0436365_0931463 | |||
| 1526 | Ga0436365_1364744 | |||
| 1527 | Ga0436365_1778823 | |||
| 1528 | Ga0436360_0202944 | |||
| 1529 | Ga0436361_0764338 | |||
| 1530 | Ga0436361_1007400 | |||
| 1531 | Ga0436363_0187212 | |||
| 1532 | Ga0436363_1164297 | |||
| 1533 | Ga0436363_1664076 | |||
| 1534 | Ga0451839_1296627 | |||
| 1535 | Ga0451849_1550937 | |||
| 1536 | Ga0466969_0038171 | |||
| 1537 | Ga0466972_0000177 | |||
| 1538 | Ga0466972_0005224 | |||
| 1539 | Ga0466965_0032138 | |||
| 1540 | Ga0466965_0199123 | |||
| 1541 | Ga0466966_0000474 | |||
| 1542 | Ga0466961_0000023 | |||
| 1543 | Ga0466961_0115673 | |||
| 1544 | Ga0466968_0006075 | |||
| 1545 | Ga0466968_0041477 | |||
| 1546 | Ga0466957_0119170 | |||
| 1547 | Ga0466957_0312438 | |||
| 1548 | Ga0466959_0000726 | |||
| 1549 | Ga0466967_0189767 | |||
| 1550 | Ga0466967_0628871 | |||
| 1551 | Ga0495592_0020908 | |||
| 1552 | Ga0495592_0021820 | |||
| 1553 | Ga0495592_0084009 | |||
| 1554 | Ga0495592_0301622 | |||
| 1555 | Ga0495603_0001935 | |||
| 1556 | Ga0495603_0006284 | |||
| 1557 | Ga0495603_0020664 | |||
| 1558 | Ga0495603_0049526 | |||
| 1559 | Ga0495603_0062862 | |||
| 1560 | Ga0495603_0118366 | |||
| 1561 | Ga0495603_0224158 | |||
| 1562 | Ga0495629_0000416 | |||
| 1563 | Ga0495629_0000655 | |||
| 1564 | Ga0495641_0002593 | |||
| 1565 | Ga0495641_0101626 | |||
| 1566 | Ga0495651_0010752 | |||
| 1567 | Ga0495651_0144620 | |||
| 1568 | Ga0495653_0004854 | |||
| 1569 | Ga0495653_0259246 | |||
| 1570 | Ga0495650_0025806 | |||
| 1571 | Ga0495580_0055436 | |||
| 1572 | Ga0495582_0032876 | |||
| 1573 | Ga0495639_0001046 | |||
| 1574 | Ga0495639_0084132 | |||
| 1575 | Ga0495639_0129966 | |||
| 1576 | Ga0495662_0003282 | |||
| 1577 | Ga0495664_0114940 | |||
| 1578 | Ga0495585_0113023 | |||
| 1579 | Ga0495585_0147552 | |||
| 1580 | Ga0495594_0051840 | |||
| 1581 | Ga0495606_0066283 | |||
| 1582 | Ga0495608_0107848 | |||
| 1583 | Ga0495618_0110921 | |||
| 1584 | Ga0495620_0117244 | |||
| 1585 | Ga0495628_0011825 | |||
| 1586 | Ga0495628_0030845 | |||
| 1587 | Ga0495628_0117808 | |||
| 1588 | Ga0495628_0136125 | |||
| 1589 | Ga0495630_0009444 | |||
| 1590 | Ga0495643_0014428 | |||
| 1591 | Ga0495648_0000640 | |||
| 1592 | Ga0495666_0016886 | |||
| 1593 | Ga0495666_0030220 | |||
| 1594 | Ga0495642_0121770 | |||
| 1595 | Ga0495652_0026522 | |||
| 1596 | Ga0495652_0082257 | |||
| 1597 | Ga0495665_0003441 | |||
| 1598 | Ga0495665_0056047 | |||
| 1599 | Ga0495640_0045167 | |||
| 1600 | Ga0495640_0045731 | |||
| 1601 | Ga0495640_0073507 | |||
| 1602 | Ga0495640_0085105 | |||
| 1603 | Ga0495586_0085300 | |||
| 1604 | Ga0495587_0007940 | |||
| 1605 | Ga0495587_0011794 | |||
| 1606 | Ga0495587_0016331 | |||
| 1607 | Ga0495598_0010333 | |||
| 1608 | Ga0495598_0023933 | |||
| 1609 | Ga0495621_0078806 | |||
| 1610 | Ga0495645_0002973 | |||
| 1611 | Ga0495645_0133459 | |||
| 1612 | Ga0495622_0023686 | |||
| 1613 | Ga0495622_0026482 | |||
| 1614 | Ga0495622_0088749 | |||
| 1615 | Ga0495667_0032457 | |||
| 1616 | Ga0495667_0036654 | |||
| 1617 | Ga0495667_0044661 | |||
| 1618 | Ga0495667_0060623 | |||
| 1619 | Ga0495656_0118066 | |||
| 1620 | Ga0495656_0127886 | |||
| 1621 | Ga0495668_0073358 | |||
| 1622 | Ga0495668_0191459 | |||
| 1623 | Ga0495634_0000602 | |||
| 1624 | Ga0495634_0074164 | |||
| 1625 | Ga0495634_0159003 | |||
| 1626 | Ga0495634_0223408 | |||
| 1627 | Ga0495635_0000380 | |||
| 1628 | Ga0495635_0012975 | |||
| 1629 | Ga0495635_0042493 | |||
| 1630 | Ga0495635_0243080 | |||
| 1631 | Ga0495659_0030136 | |||
| 1632 | Ga0495588_0003413 | |||
| 1633 | Ga0495657_0005248 | |||
| 1634 | Ga0495657_0019627 | |||
| 1635 | Ga0495657_0050390 | |||
| 1636 | Ga0495599_0004515 | |||
| 1637 | Ga0495599_0025467 | |||
| 1638 | Ga0495599_0026173 | |||
| 1639 | Ga0495599_0079124 | |||
| 1640 | Ga0495623_0002235 | |||
| 1641 | Ga0495623_0015456 | |||
| 1642 | Ga0495646_0046242 | |||
| 1643 | Ga0495646_0048567 | |||
| 1644 | Ga0495646_0070850 | |||
| 1645 | Ga0495646_0131009 | |||
| 1646 | Ga0495647_0021626 | |||
| 1647 | Ga0495647_0030022 | |||
| 1648 | Ga0495658_0005105 | |||
| 1649 | Ga0495658_0053507 | |||
| 1650 | Ga0495669_0076437 | |||
| 1651 | Ga0495613_0032956 | |||
| 1652 | Ga0495613_0057599 | |||
| 1653 | Ga0495624_0003072 | |||
| 1654 | Ga0495589_0157788 | |||
| 1655 | Ga0495600_0029981 | |||
| 1656 | Ga0495600_0035125 | |||
| 1657 | Ga0495600_0114920 | |||
| 1658 | Ga0495581_0020748 | |||
| 1659 | Ga0495581_0036506 | |||
| 1660 | Ga0495581_0097104 | |||
| 1661 | Ga0495581_0198853 | |||
| 1662 | Ga0495604_0007336 | |||
| 1663 | Ga0495604_0008886 | |||
| 1664 | Ga0495604_0054854 | |||
| 1665 | Ga0495604_0127221 | |||
| 1666 | Ga0495604_0201844 | |||
| 1667 | Ga0495674_0008020 | |||
| 1668 | Ga0495674_0022101 | |||
| 1669 | Ga0495674_0066148 | |||
| 1670 | Ga0495674_0160752 | |||
| 1671 | Ga0495674_0305009 | |||
| 1672 | Ga0495672_0124289 | |||
| 1673 | Ga0495676_0069277 | |||
| 1674 | Ga0495676_0122028 | |||
| 1675 | Ga0495676_0123320 | |||
| 1676 | Ga0495680_0002016 | |||
| 1677 | Ga0495680_0025159 | |||
| 1678 | Ga0495680_0085244 | |||
| 1679 | Ga0495680_0261857 | |||
| 1680 | Ga0495675_0001856 | |||
| 1681 | Ga0495675_0127716 | |||
| 1682 | Ga0495679_059730 | |||
| 1683 | Ga0495681_0121593 | |||
| 1684 | Ga0495684_0000294 | |||
| 1685 | Ga0495684_0096973 | |||
| 1686 | Ga0495684_0138880 | |||
| 1687 | Ga0495593_0000022 | |||
| 1688 | Ga0495593_0000744 | |||
| 1689 | Ga0495602_0062578 | |||
| 1690 | Ga0495602_0155583 | |||
| 1691 | Ga0496100_0027259 | |||
| 1692 | Ga0496100_0079153 | |||
| 1693 | Ga0496101_0063193 | |||
| 1694 | Ga0496101_0088147 | |||
| 1695 | Ga0496101_0106347 | |||
| 1696 | Ga0496101_0116245 | |||
| 1697 | Ga0496102_0014293 | |||
| 1698 | Ga0496102_0059266 | |||
| 1699 | Ga0496102_0076480 | |||
| 1700 | Ga0496102_0334862 | |||
| 1701 | Ga0496103_0101444 | |||
| 1702 | Ga0496104_0000948 | |||
| 1703 | Ga0496104_0002005 | |||
| 1704 | Ga0496104_0023320 | |||
| 1705 | Ga0496104_0033610 | |||
| 1706 | Ga0496104_0235301 | |||
| 1707 | Ga0496105_0001280 | |||
| 1708 | Ga0496105_0009772 | |||
| 1709 | Ga0496105_0011036 | |||
| 1710 | Ga0496105_0012416 | |||
| 1711 | Ga0496105_0391803 | |||
| 1712 | Ga0496106_0001262 | |||
| 1713 | Ga0496106_0003691 | |||
| 1714 | Ga0496106_0014884 | |||
| 1715 | Ga0496106_0137472 | |||
| 1716 | Ga0496106_0139912 | |||
| 1717 | Ga0496106_0151458 | |||
| 1718 | Ga0496106_0489794 | |||
| 1719 | Ga0496107_0021225 | |||
| 1720 | Ga0496108_0000479 | |||
| 1721 | Ga0496108_0084458 | |||
| 1722 | Ga0496108_0141737 | |||
| 1723 | Ga0496108_0155553 | |||
| 1724 | Ga0496108_0199656 | |||
| 1725 | Ga0496108_0247223 | |||
| 1726 | Ga0496109_0000910 | |||
| 1727 | Ga0496109_0009376 | |||
| 1728 | Ga0496109_0117615 | |||
| 1729 | Ga0496109_0142527 | |||
| 1730 | Ga0496109_0147156 | |||
| 1731 | Ga0496109_0155298 | |||
| 1732 | Ga0496109_0166533 | |||
| 1733 | Ga0496109_0168061 | |||
| 1734 | Ga0496109_0293113 | |||
| 1735 | Ga0496110_0025120 | |||
| 1736 | Ga0496110_0056560 | |||
| 1737 | Ga0496110_0101486 | |||
| 1738 | Ga0496110_0105664 | |||
| 1739 | Ga0496110_0118704 | |||
| 1740 | Ga0496110_0206343 | |||
| 1741 | Ga0496111_0000112 | |||
| 1742 | Ga0496111_0034388 | |||
| 1743 | Ga0496111_0116502 | |||
| 1744 | Ga0496111_0259119 | |||
| 1745 | Ga0496111_0452236 | |||
| 1746 | Ga0496112_0000022 | |||
| 1747 | Ga0496112_0023710 | |||
| 1748 | Ga0496112_0032020 | |||
| 1749 | Ga0496112_0034500 | |||
| 1750 | Ga0496112_0043988 | |||
| 1751 | Ga0496112_0118773 | |||
| 1752 | Ga0496112_0170514 | |||
| 1753 | Ga0496112_0261545 | |||
| 1754 | Ga0496112_0266577 | |||
| 1755 | Ga0496112_0402327 | |||
| 1756 | Ga0496112_0539679 | |||
| 1757 | Ga0496113_0000762 | |||
| 1758 | Ga0496113_0009540 | |||
| 1759 | Ga0496113_0072238 | |||
| 1760 | Ga0496113_0108196 | |||
| 1761 | Ga0496113_0129870 | |||
| 1762 | Ga0496114_0009367 | |||
| 1763 | Ga0496114_0245788 | |||
| 1764 | Ga0496115_0014569 | |||
| 1765 | Ga0496115_0032437 | |||
| 1766 | Ga0496115_0033888 | |||
| 1767 | Ga0496115_0081033 | |||
| 1768 | Ga0496115_0189664 | |||
| 1769 | Ga0496115_0238742 | |||
| 1770 | Ga0496115_0422078 | |||
| 1771 | Ga0496116_0077687 | |||
| 1772 | Ga0496117_0043940 | |||
| 1773 | Ga0496117_0088506 | |||
| 1774 | Ga0496118_0036454 | |||
| 1775 | Ga0496118_0083539 | |||
| 1776 | Ga0496118_0136393 | |||
| 1777 | Ga0496119_0068858 | |||
| 1778 | Ga0496119_0123246 | |||
| 1779 | Ga0496119_0127019 | |||
| 1780 | Ga0496120_0022888 | |||
| 1781 | Ga0496121_0000254 | |||
| 1782 | Ga0496121_0002114 | |||
| 1783 | Ga0496121_0011243 | |||
| 1784 | Ga0496121_0012395 | |||
| 1785 | Ga0496121_0055262 | |||
| 1786 | Ga0496121_0090630 | |||
| 1787 | Ga0496121_0113432 | |||
| 1788 | Ga0496121_0128284 | |||
| 1789 | Ga0496121_0222224 | |||
| 1790 | Ga0496124_0001351 | |||
| 1791 | Ga0496124_0054938 | |||
| 1792 | Ga0496125_0025529 | |||
| 1793 | Ga0496125_0065882 | |||
| 1794 | Ga0496125_0099784 | |||
| 1795 | Ga0496126_0007801 | |||
| 1796 | Ga0496126_0012548 | |||
| 1797 | Ga0496126_0022598 | |||
| 1798 | Ga0496126_0024830 | |||
| 1799 | Ga0496126_0026051 | |||
| 1800 | Ga0496126_0049875 | |||
| 1801 | Ga0496126_0155068 | |||
| 1802 | Ga0496126_0222802 | |||
| 1803 | Ga0496126_0368862 | |||
| 1804 | Ga0501031_0001005 | |||
| 1805 | Ga0501031_0020264 | |||
| 1806 | Ga0501032_0000161 | |||
| 1807 | Ga0501032_0017757 | |||
| 1808 | Ga0501032_0053496 | |||
| 1809 | Ga0501033_0000111 | |||
| 1810 | Ga0501033_0000672 | |||
| 1811 | Ga0501034_0000072 | |||
| 1812 | Ga0501034_0071554 | |||
| 1813 | Ga0501034_0144499 | |||
| 1814 | Ga0501034_0260391 | |||
| 1815 | Ga0501036_0011119 | |||
| 1816 | Ga0501036_0053940 | |||
| 1817 | Ga0501036_0073036 | |||
| 1818 | Ga0501036_0129667 | |||
| 1819 | Ga0501036_0446357 | |||
| 1820 | Ga0501037_0000030 | |||
| 1821 | Ga0501037_0055311 | |||
| 1822 | Ga0501037_0062319 | |||
| 1823 | Ga0501037_0126387 | |||
| 1824 | Ga0501038_0000060 | |||
| 1825 | Ga0501038_0003347 | |||
| 1826 | Ga0501038_0019562 | |||
| 1827 | Ga0501038_0023061 | |||
| 1828 | Ga0501038_0144142 | |||
| 1829 | Ga0501038_0203591 | |||
| 1830 | Ga0501039_0003983 | |||
| 1831 | Ga0501039_0014332 | |||
| 1832 | Ga0501039_0155791 | |||
| 1833 | Ga0501040_0118117 | |||
| 1834 | Ga0501042_0053990 | |||
| 1835 | Ga0501042_0112143 | |||
| 1836 | Ga0501043_0000357 | |||
| 1837 | Ga0501046_0002205 | |||
| 1838 | Ga0501046_0050507 | |||
| 1839 | Ga0501046_0236188 | |||
| 1840 | Ga0501047_0000140 | |||
| 1841 | Ga0501047_0026961 | |||
| 1842 | Ga0501047_0068547 | |||
| 1843 | Ga0501047_0241726 | |||
| 1844 | Ga0501047_0338958 | |||
| 1845 | Ga0501048_0000812 | |||
| 1846 | Ga0501048_0144939 | |||
| 1847 | Ga0501067_0000697 | |||
| 1848 | Ga0501067_0002459 | |||
| 1849 | Ga0501067_0067838 | |||
| 1850 | Ga0501068_0015057 | |||
| 1851 | Ga0501069_0062846 | |||
| 1852 | Ga0501069_0066501 | |||
| 1853 | Ga0501070_0000602 | |||
| 1854 | Ga0501070_0010155 | |||
| 1855 | Ga0501070_0058337 | |||
| 1856 | Ga0501070_0138152 | |||
| 1857 | Ga0501070_0180023 | |||
| 1858 | Ga0501072_0084380 | |||
| 1859 | Ga0501072_0401974 | |||
| 1860 | Ga0501073_0000009 | |||
| 1861 | Ga0501073_0009578 | |||
| 1862 | Ga0501073_0035565 | |||
| 1863 | Ga0501073_0106062 | |||
| 1864 | Ga0501074_0000137 | |||
| 1865 | Ga0501077_0095551 | |||
| 1866 | Ga0501079_0017212 | |||
| 1867 | Ga0501079_0209186 | |||
| 1868 | Ga0501080_0000088 | |||
| 1869 | Ga0501080_0037211 | |||
| 1870 | Ga0501080_0054964 | |||
| 1871 | Ga0501083_0013621 | |||
| 1872 | Ga0501083_0050365 | |||
| 1873 | Ga0501035_0022354 | |||
| 1874 | Ga0501035_0057070 | |||
| 1875 | Ga0501035_0116770 | |||
| 1876 | Ga0501035_0204141 | |||
| 1877 | Ga0501035_0242617 | |||
| 1878 | Ga0501035_0302376 | |||
| 1879 | Ga0501044_0002346 | |||
| 1880 | Ga0501044_0013964 | |||
| 1881 | Ga0501044_0019722 | |||
| 1882 | Ga0501044_0022171 | |||
| 1883 | Ga0501045_0024317 | |||
| 1884 | nmdc:mga03683_51497_c1 | |||
| 1885 | nmdc:mga03n38_4303_c1 | |||
| 1886 | nmdc:mga00v17_32663_c1 | |||
| 1887 | nmdc:mga0yw44_13579_c1 | |||
| 1888 | nmdc:mga0yw44_194539_c1 | |||
| 1889 | nmdc:mga0yw44_78840_c1 | |||
| 1890 | nmdc:mga0yw44_8656_c1 | |||
| 1891 | nmdc:mga0yw44_93034_c1 | |||
| 1892 | nmdc:mga0k408_6488_c1 | |||
| 1893 | nmdc:mga06z11_182462_c1 | |||
| 1894 | nmdc:mga06z11_21687_c1 | |||
| 1895 | nmdc:mga06z11_47781_c1 | |||
| 1896 | nmdc:mga06z11_7412_c1 | |||
| 1897 | nmdc:mga04h51_43933_c1 | |||
| 1898 | nmdc:mga07m45_19689_c1 | |||
| 1899 | nmdc:mga07m45_25952_c1 | |||
| 1900 | nmdc:mga05p37_338976_c1 | |||
| 1901 | nmdc:mga0n895_2476_c1 | |||
| 1902 | nmdc:mga0n895_47793_c1 | |||
| 1903 | nmdc:mga0n895_95111_c1 | |||
| 1904 | nmdc:mga0n895_95260_c1 | |||
| 1905 | nmdc:mga0rr50_82341_c1 | |||
| 1906 | nmdc:mga0sz30_59207_c1 | |||
| 1907 | Ga0495601_0047714 | |||
| 1908 | Ga0495601_0159031 | |||
| 1909 | Ga0495612_0045607 | |||
| 1910 | Ga0495595_0021212 | |||
| 1911 | Ga0495595_0032285 | |||
| 1912 | Ga0495619_0003855 | |||
| 1913 | Ga0495619_0112518 | |||
| 1914 | Ga0500578_0186649 | |||
| 1915 | Ga0500651_0018002 | |||
| 1916 | Ga0500651_0023015 | |||
| 1917 | Ga0500566_0007702 | |||
| 1918 | Ga0500566_0033416 | |||
| 1919 | Ga0500566_0043140 | |||
| 1920 | Ga0500566_0134479 | |||
| 1921 | Ga0500640_002809 | |||
| 1922 | Ga0500557_000057 | |||
| 1923 | Ga0500557_090483 | |||
| 1924 | Ga0500569_059070 | |||
| 1925 | Ga0500572_000383 | |||
| 1926 | Ga0500572_001892 | |||
| 1927 | Ga0500595_004172 | |||
| 1928 | Ga0500595_009841 | |||
| 1929 | Ga0500595_022825 | |||
| 1930 | Ga0500607_073306 | |||
| 1931 | Ga0500608_068887 | |||
| 1932 | Ga0500642_0000263 | |||
| 1933 | Ga0500559_0000486 | |||
| 1934 | Ga0500559_0049727 | |||
| 1935 | Ga0500559_0051797 | |||
| 1936 | Ga0500559_0055710 | |||
| 1937 | Ga0500568_0037793 | |||
| 1938 | Ga0500573_0045454 | |||
| 1939 | Ga0500577_0000035 | |||
| 1940 | Ga0500603_000335 | |||
| 1941 | Ga0500603_000740 | |||
| 1942 | Ga0500603_021454 | |||
| 1943 | Ga0500603_035785 | |||
| 1944 | Ga0500620_005833 | |||
| 1945 | Ga0500630_016635 | |||
| 1946 | Ga0500638_062254 | |||
| 1947 | Ga0500639_001074 | |||
| 1948 | Ga0500639_028645 | |||
| 1949 | Ga0500636_0001378 | |||
| 1950 | Ga0500636_0017028 | |||
| 1951 | Ga0500636_0042827 | |||
| 1952 | Ga0500636_0148333 | |||
| 1953 | Ga0500576_113008 | |||
| 1954 | Ga0500657_084075 | |||
| 1955 | Ga0500645_065959 | |||
| 1956 | Ga0500596_001060 | |||
| 1957 | Ga0500596_004321 | |||
| 1958 | Ga0500596_015230 | |||
| 1959 | Ga0500601_001101 | |||
| 1960 | Ga0500601_005147 | |||
| 1961 | Ga0501084_0005438 | |||
| 1962 | Ga0501084_0036315 | |||
| 1963 | Ga0501082_0018483 | |||
| 1964 | Ga0501082_0025748 | |||
| 1965 | 2507504320 | |||
| 1966 | 2508545754 | |||
| 1967 | 2508694579 | |||
| 1968 | 2509151292 | |||
| 1969 | 2511398417 | |||
| 1970 | 2513624509 | |||
| 1971 | 2513638628 | |||
| 1972 | 2513649984 | |||
| 1973 | 2513655421 | |||
| 1974 | 2513716830 | |||
| 1975 | 2513860015 | |||
| 1976 | 2513916501 | |||
| 1977 | 2515624493 | |||
| 1978 | 2517104578 | |||
| 1979 | 2517889908 | |||
| 1980 | 2524470524 | |||
| 1981 | 2524532903 | |||
| 1982 | 2528850381 | |||
| 1983 | 2617374679 | |||
| 1984 | 2644290200 | |||
| 1985 | 2671121068 | |||
| 1986 | 2728749179 | |||
| 1987 | 2738746396 | |||
| 1988 | 2739355626 | |||
| 1989 | 2793059412 | |||
| 1990 | 2793068143 | |||
| 1991 | 2793078539 | |||
| 1992 | 2818240984 | |||
| 1993 | 2824604435 | |||
| 1994 | 2824615024 | |||
| 1995 | 2824624923 | |||
| 1996 | 2824633219 | |||
| 1997 | 2824640945 | |||
| 1998 | 2824651053 | |||
| 1999 | 2824659192 | |||
| 2000 | 2824665215 | |||
| 2001 | 2824687118 | |||
| 2002 | 2824721057 | |||
| 2003 | 2824728264 | |||
| 2004 | 2824738358 | |||
| 2005 | 2824751277 | |||
| 2006 | 2841960691 | |||
| 2007 | 2842041792 | |||
| 2008 | 2842049834 | |||
| 2009 | 2847932085 | |||
| 2010 | 2849077049 | |||
| 2011 | 2857514665 | |||
| 2012 | 2874595724 | |||
| 2013 | 2874614994 | |||
| 2014 | 2874624213 | |||
| 2015 | 2874651644 | |||
| 2016 | 2876775919 | |||
| 2017 | 2876808657 | |||
| 2018 | 2876821539 | |||
| 2019 | 2879080010 | |||
| 2020 | 2879085762 | |||
| 2021 | 2879100593 | |||
| 2022 | 2879111929 | |||
| 2023 | 2879134092 | |||
| 2024 | 2879148577 | |||
| 2025 | 2881367712 | |||
| 2026 | 2881669304 | |||
| 2027 | 2885374493 | |||
| 2028 | 2885379437 | |||
| 2029 | 2888387623 | |||
| 2030 | 2888426838 | |||
| 2031 | 2889034123 | |||
| 2032 | 2903755849 | |||
| 2033 | 2904670924 | |||
| 2034 | 2904692641 | |||
| 2035 | 2904711110 | |||
| 2036 | 2906612352 | |||
| 2037 | 2906633093 | |||
| 2038 | 2906638320 | |||
| 2039 | 2906650117 | |||
| 2040 | 2906663395 | |||
| 2041 | 2908739774 | |||
| 2042 | 2908757852 | |||
| 2043 | 2908777160 | |||
| 2044 | 2922367521 | |||
| 2045 | 2922376606 | |||
| 2046 | 2922391499 | |||
| 2047 | 2922398558 | |||
| 2048 | 2922426942 | |||
| 2049 | 2929619890 | |||
| 2050 | 2929629202 | |||
| 2051 | 2932789667 | |||
| 2052 | 2932796664 | |||
| 2053 | 2932802556 | |||
| 2054 | 2932814827 | |||
| 2055 | 2932824316 | |||
| 2056 | 2932833956 | |||
| 2057 | 2933581808 | |||
| 2058 | 2935613265 | |||
| 2059 | 2935623654 | |||
| 2060 | 2935633100 | |||
| 2061 | 2935645041 | |||
| 2062 | 2935656621 | |||
| 2063 | 2935665455 | |||
| 2064 | 2935672090 | |||
| 2065 | 2935684104 | |||
| 2066 | 2935689153 | |||
| 2067 | 2935697587 | |||
| 2068 | 2935711387 | |||
| 2069 | 2935720099 | |||
| 2070 | 2935728284 | |||
| 2071 | 2935737119 | |||
| 2072 | 2935746820 | |||
| 2073 | 2935757787 | |||
| 2074 | 2935764167 | |||
| 2075 | 2935780106 | |||
| 2076 | 2935790228 | |||
| 2077 | 2935798730 | |||
| 2078 | 2935808753 | |||
| 2079 | 2935817550 | |||
| 2080 | 2935824881 | |||
| 2081 | 2935834113 | |||
| 2082 | 2935844715 | |||
| 2083 | 2935852101 | |||
| 2084 | 2935861739 | |||
| 2085 | 2935868625 | |||
| 2086 | 2935879399 | |||
| 2087 | 2935887004 | |||
| 2088 | 2935911448 | |||
| 2089 | 2935920983 | |||
| 2090 | 2935928477 | |||
| 2091 | 2935938122 | |||
| 2092 | 2935945404 | |||
| 2093 | 2935954090 | |||
| 2094 | 2935965470 | |||
| 2095 | 2935971642 | |||
| 2096 | 2935980046 | |||
| 2097 | 2935989474 | |||
| 2098 | 2935998433 | |||
| 2099 | 2936009106 | |||
| 2100 | 2936019484 | |||
| 2101 | 2936028106 | |||
| 2102 | 2936036940 | |||
| 2103 | 2936044347 | |||
| 2104 | 2936054963 | |||
| 2105 | 2936060730 | |||
| 2106 | 2940563391 | |||
| 2107 | 2941509598 | |||
| 2108 | 2941517427 | |||
| 2109 | 2941526620 | |||
| 2110 | 2941531899 | |||
| 2111 | 2941545390 | |||
| 2112 | 3005476126 | |||
| 2113 | 3005486013 | |||
| 2114 | 3005592751 | |||
| 2115 | 3005717414 | |||
| 2116 | 8006929532 | |||
| 2117 | 8006937439 | |||
| 2118 | 8006977468 | |||
| 2119 | 8006989993 | |||
| 2120 | 8016519231 | |||
| 2121 | 8016538669 | |||
| 2122 | 8016542956 | |||
| 2123 | 8016550335 | |||
| 2124 | 8016558742 | |||
| 2125 | 8016568353 | |||
| 2126 | 8016581012 | |||
| 2127 | 8016587716 | |||
| 2128 | 8016596718 | |||
| 2129 | 8016619388 | |||
| 2130 | 8016630205 | |||
| 2131 | 8016636945 | |||
| 2132 | 8017066279 | |||
| 2133 | 8019538341 | |||
| 2134 | 8019541481 | |||
| 2135 | 8019549146 | |||
| 2136 | 8019561185 | |||
| 2137 | 8019578344 | |||
| 2138 | 8019596382 | |||
| 2139 | 8019605319 | |||
| 2140 | 8019623905 | |||
| 2141 | 8019638134 | |||
| 2142 | 8019641501 | |||
| 2143 | 8019651542 | |||
| 2144 | 8019666049 | |||
| 2145 | 8019675568 | |||
| 2146 | 8019695223 | |||
| 2147 | 8055750358 | |||
| 2148 | 8056691978 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q7s-assembly1.cif.gz_A | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8329 | 9 | 280 |
| 2q7s-assembly1.cif.gz_A | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8127 | 9 | 280 |
| 2q7s-assembly2.cif.gz_B | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8109 | 9 | 280 |
| 2q7s-assembly2.cif.gz_B | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.7864 | 9 | 280 |
| 2odf-assembly3.cif.gz_C | the crystal structure of gene product atu2144 from agrobacterium tumefaciens | 0.7553 | 9 | 281 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2q7sA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.8192 | 9 | 280 | 3.40.630.40 |
| 2q7sA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.799 | 9 | 280 | 3.40.630.40 |
| af_Q21515_35_411_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7219 | 144 | 174 | 3.40.50.1820 |
| 2odfB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.7206 | 12 | 282 | 3.40.630.40 |
| 2odfB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.7155 | 12 | 282 | 3.40.630.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327VBP4-F1-model_v4 | N-formylglutamate amidohydrolase | 0.8897 | 125 | 278 |
GO:0016787
|
| AF-A0A382QXK2-F1-model_v4 | N-formylglutamate amidohydrolase | 0.8855 | 152 | 283 |
|
| AF-A0A7K3FDL9-F1-model_v4 | deleted | 0.8851 | 135 | 254 |
|
| AF-A0A2G1YZ59-F1-model_v4 | N-formylglutamate amidohydrolase | 0.8753 | 155 | 282 |
GO:0016787
|
| AF-A0A2G1YT19-F1-model_v4 | deleted | 0.8745 | 130 | 281 |
|