F489545
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1074 | 499 | 1051 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0123949|Ga0496125_0123949_88_561 |
| Length | 157 |
| Sequence | MTSSKVEVRDSKVAEYVTVVIGGQLFGLPISRVQDVFMPERLTRVPLSSAEIAGVLNLRGRIVTVIDMRARLGLPRADGKPTMAVGVDLRGESYGLLIDHIGEVLRLADEGREENPVNLDPRMAKFAGGVHRLEGQLMVVLDVDRVLELAPKAALAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 2 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 3 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 4 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 5 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 6 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 7 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 8 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 9 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 10 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 11 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 12 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 13 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 136 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 222 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300033546 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 | Metagenome | Unclassified |
| 235 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 247 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 265 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 266 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 267 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 268 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 272 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 275 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 276 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 277 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 278 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 279 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 280 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 281 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 282 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 395 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 398 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 399 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 400 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 401 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 402 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 418 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 424 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 432 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 436 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 442 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 443 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 444 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 446 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 447 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 449 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 451 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 452 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 453 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 454 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 455 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 456 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 457 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 458 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 459 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 460 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 461 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 463 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 464 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 466 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 467 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 468 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 469 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 470 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 471 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 472 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 473 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 474 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 476 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 477 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 478 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 479 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 480 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 482 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 484 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 485 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 486 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 488 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 489 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 491 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 492 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 494 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 495 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 496 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 497 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 498 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 499 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.67 |
| Metatranscriptomes | 0.19 |
| Isolates | 2.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.92 |
| Nodule | 1.49 |
| Rhizoplane | 6.15 |
| Rhizosphere | 67.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014484 | 3300001979 | Bacteria | 2907 |
| 2 | JGI24739J22299_10004030 | 3300001989 | Bacteria | 5620 |
| 3 | JGI24737J22298_10002056 | 3300001990 | Bacteria | 7197 |
| 4 | JGI24737J22298_10129081 | 3300001990 | Bacteria | 747 |
| 5 | JGI24735J21928_10011719 | 3300002067 | Bacteria | 2777 |
| 6 | JGI24738J21930_10028233 | 3300002075 | Bacteria | 1148 |
| 7 | JGI24742J22300_10014917 | 3300002244 | Bacteria | 1306 |
| 8 | JGI25153J46596_10005700 | 3300003215 | Bacteria | 6493 |
| 9 | JGI25153J46596_10016618 | 3300003215 | Bacteria | 2937 |
| 10 | Ga0055526_1034174 | 3300003771 | Bacteria | 1394 |
| 11 | Ga0070658_10349330 | 3300005327 | Bacteria | 1266 |
| 12 | Ga0070658_10558937 | 3300005327 | Bacteria | 990 |
| 13 | Ga0070683_100810669 | 3300005329 | Bacteria | 897 |
| 14 | Ga0070690_100088327 | 3300005330 | Bacteria | 2037 |
| 15 | Ga0070670_100135329 | 3300005331 | Bacteria | 2129 |
| 16 | Ga0070670_101045608 | 3300005331 | Bacteria | 743 |
| 17 | Ga0070677_10198491 | 3300005333 | Bacteria | 966 |
| 18 | Ga0068869_100191234 | 3300005334 | Bacteria | 1609 |
| 19 | Ga0068869_100305143 | 3300005334 | Bacteria | 1286 |
| 20 | Ga0070666_10287949 | 3300005335 | Bacteria | 1168 |
| 21 | Ga0070666_10302793 | 3300005335 | Bacteria | 1138 |
| 22 | Ga0070666_10361107 | 3300005335 | Bacteria | 1040 |
| 23 | Ga0070680_100235800 | 3300005336 | Bacteria | 1546 |
| 24 | Ga0070680_100642863 | 3300005336 | Bacteria | 911 |
| 25 | Ga0068868_100019990 | 3300005338 | Bacteria | 5023 |
| 26 | Ga0068868_100377181 | 3300005338 | Bacteria | 1219 |
| 27 | Ga0068868_100552004 | 3300005338 | Bacteria | 1015 |
| 28 | Ga0068868_100790312 | 3300005338 | Bacteria | 855 |
| 29 | Ga0070660_100125899 | 3300005339 | Bacteria | 2047 |
| 30 | Ga0070660_100139170 | 3300005339 | Bacteria | 1946 |
| 31 | Ga0070660_100231275 | 3300005339 | Bacteria | 1504 |
| 32 | Ga0070660_101177496 | 3300005339 | Bacteria | 649 |
| 33 | Ga0070689_100084174 | 3300005340 | Bacteria | 2499 |
| 34 | Ga0070689_100181538 | 3300005340 | Bacteria | 1709 |
| 35 | Ga0070691_10471534 | 3300005341 | Bacteria | 720 |
| 36 | Ga0070687_100320155 | 3300005343 | Bacteria | 990 |
| 37 | Ga0070661_100473914 | 3300005344 | Bacteria | 999 |
| 38 | Ga0070692_10106970 | 3300005345 | Bacteria | 1542 |
| 39 | Ga0070668_100008596 | 3300005347 | Bacteria | 7584 |
| 40 | Ga0070668_100421026 | 3300005347 | Bacteria | 1143 |
| 41 | Ga0070668_101044669 | 3300005347 | Bacteria | 736 |
| 42 | Ga0070675_101028955 | 3300005354 | Bacteria | 756 |
| 43 | Ga0070674_100535367 | 3300005356 | Bacteria | 980 |
| 44 | Ga0070673_100379822 | 3300005364 | Bacteria | 1259 |
| 45 | Ga0070688_100109281 | 3300005365 | Bacteria | 1836 |
| 46 | Ga0070688_100187705 | 3300005365 | Bacteria | 1438 |
| 47 | Ga0070688_100509894 | 3300005365 | Bacteria | 909 |
| 48 | Ga0070659_100043012 | 3300005366 | Bacteria | 3532 |
| 49 | Ga0070659_100111198 | 3300005366 | Bacteria | 2212 |
| 50 | Ga0070659_100856234 | 3300005366 | Bacteria | 793 |
| 51 | Ga0070667_100143679 | 3300005367 | Bacteria | 2091 |
| 52 | Ga0070703_10027610 | 3300005406 | Bacteria | 1692 |
| 53 | Ga0070709_10399467 | 3300005434 | Bacteria | 1026 |
| 54 | Ga0070714_100002536 | 3300005435 | Bacteria | 13461 |
| 55 | Ga0070714_100055427 | 3300005435 | Bacteria | 3388 |
| 56 | Ga0070714_100407177 | 3300005435 | Bacteria | 1287 |
| 57 | Ga0070714_100680363 | 3300005435 | Bacteria | 992 |
| 58 | Ga0070713_100003570 | 3300005436 | Bacteria | 10274 |
| 59 | Ga0070713_100324064 | 3300005436 | Bacteria | 1423 |
| 60 | Ga0070713_100783350 | 3300005436 | Bacteria | 914 |
| 61 | Ga0070710_10002610 | 3300005437 | Bacteria | 8568 |
| 62 | Ga0070710_10065506 | 3300005437 | Bacteria | 2081 |
| 63 | Ga0070701_10303340 | 3300005438 | Bacteria | 982 |
| 64 | Ga0070711_100018537 | 3300005439 | Bacteria | 4447 |
| 65 | Ga0070711_100190218 | 3300005439 | Bacteria | 1577 |
| 66 | Ga0070705_100469736 | 3300005440 | Bacteria | 948 |
| 67 | Ga0070705_100572324 | 3300005440 | Bacteria | 869 |
| 68 | Ga0070700_100147481 | 3300005441 | Bacteria | 1605 |
| 69 | Ga0070700_100490873 | 3300005441 | Bacteria | 943 |
| 70 | Ga0070663_100191365 | 3300005455 | Bacteria | 1592 |
| 71 | Ga0070663_100200596 | 3300005455 | Bacteria | 1557 |
| 72 | Ga0070663_100447024 | 3300005455 | Bacteria | 1064 |
| 73 | Ga0070663_101083076 | 3300005455 | Bacteria | 700 |
| 74 | Ga0070678_100035710 | 3300005456 | Bacteria | 3473 |
| 75 | Ga0070678_100060695 | 3300005456 | Bacteria | 2784 |
| 76 | Ga0070678_100179814 | 3300005456 | Bacteria | 1730 |
| 77 | Ga0070678_100269806 | 3300005456 | Bacteria | 1434 |
| 78 | Ga0070678_100328286 | 3300005456 | Bacteria | 1308 |
| 79 | Ga0070678_100412705 | 3300005456 | Bacteria | 1175 |
| 80 | Ga0070678_100424534 | 3300005456 | Bacteria | 1160 |
| 81 | Ga0070678_100533871 | 3300005456 | Bacteria | 1039 |
| 82 | Ga0070662_100068160 | 3300005457 | Bacteria | 2615 |
| 83 | Ga0070662_100741424 | 3300005457 | Bacteria | 833 |
| 84 | Ga0070681_10170449 | 3300005458 | Bacteria | 2099 |
| 85 | Ga0070681_10641950 | 3300005458 | Bacteria | 976 |
| 86 | Ga0070685_10068454 | 3300005466 | Bacteria | 2097 |
| 87 | Ga0070698_100275574 | 3300005471 | Bacteria | 1614 |
| 88 | Ga0070698_100871735 | 3300005471 | Bacteria | 845 |
| 89 | Ga0070699_100361620 | 3300005518 | Bacteria | 1308 |
| 90 | Ga0070699_101554062 | 3300005518 | Bacteria | 606 |
| 91 | Ga0070697_100000384 | 3300005536 | Bacteria | 34537 |
| 92 | Ga0070697_100092326 | 3300005536 | Bacteria | 2504 |
| 93 | Ga0070697_100603834 | 3300005536 | Bacteria | 964 |
| 94 | Ga0068853_100006456 | 3300005539 | Bacteria | 9323 |
| 95 | Ga0068853_100010388 | 3300005539 | Bacteria | 7532 |
| 96 | Ga0068853_100040041 | 3300005539 | Bacteria | 3997 |
| 97 | Ga0068853_100421512 | 3300005539 | Bacteria | 1251 |
| 98 | Ga0068853_100488873 | 3300005539 | Bacteria | 1161 |
| 99 | Ga0070672_100255182 | 3300005543 | Bacteria | 1478 |
| 100 | Ga0070672_100323731 | 3300005543 | Bacteria | 1311 |
| 101 | Ga0070672_100498318 | 3300005543 | Bacteria | 1053 |
| 102 | Ga0070672_100657671 | 3300005543 | Bacteria | 915 |
| 103 | Ga0070686_100170627 | 3300005544 | Bacteria | 1538 |
| 104 | Ga0070695_100016132 | 3300005545 | Bacteria | 4517 |
| 105 | Ga0070696_100299323 | 3300005546 | Bacteria | 1231 |
| 106 | Ga0070693_100142838 | 3300005547 | Bacteria | 1508 |
| 107 | Ga0070693_100277759 | 3300005547 | Bacteria | 1120 |
| 108 | Ga0070665_100133394 | 3300005548 | Bacteria | 2485 |
| 109 | Ga0070665_101810541 | 3300005548 | Bacteria | 617 |
| 110 | Ga0068855_100038648 | 3300005563 | Bacteria | 5670 |
| 111 | Ga0068855_100076604 | 3300005563 | Bacteria | 3881 |
| 112 | Ga0068855_100094616 | 3300005563 | Bacteria | 3444 |
| 113 | Ga0068855_100254602 | 3300005563 | Bacteria | 1957 |
| 114 | Ga0068855_100722267 | 3300005563 | Bacteria | 1064 |
| 115 | Ga0068855_101476773 | 3300005563 | Bacteria | 699 |
| 116 | Ga0070664_100278900 | 3300005564 | Bacteria | 1507 |
| 117 | Ga0070664_100305066 | 3300005564 | Bacteria | 1439 |
| 118 | Ga0070664_100555127 | 3300005564 | Bacteria | 1062 |
| 119 | Ga0070664_100829001 | 3300005564 | Bacteria | 865 |
| 120 | Ga0068857_100027957 | 3300005577 | Bacteria | 4973 |
| 121 | Ga0068857_100048760 | 3300005577 | Bacteria | 3758 |
| 122 | Ga0068857_100140897 | 3300005577 | Bacteria | 2179 |
| 123 | Ga0068854_100007431 | 3300005578 | Bacteria | 7000 |
| 124 | Ga0068854_100777806 | 3300005578 | Bacteria | 832 |
| 125 | Ga0068854_101073385 | 3300005578 | Bacteria | 716 |
| 126 | Ga0068856_100029161 | 3300005614 | Bacteria | 5390 |
| 127 | Ga0068856_100045204 | 3300005614 | Bacteria | 4335 |
| 128 | Ga0068856_100092169 | 3300005614 | Bacteria | 3015 |
| 129 | Ga0068856_100135913 | 3300005614 | Bacteria | 2464 |
| 130 | Ga0070702_100042891 | 3300005615 | Bacteria | 2546 |
| 131 | Ga0070702_100075220 | 3300005615 | Bacteria | 2006 |
| 132 | Ga0070702_100225410 | 3300005615 | Bacteria | 1256 |
| 133 | Ga0068852_100032359 | 3300005616 | Bacteria | 4329 |
| 134 | Ga0068852_100102155 | 3300005616 | Bacteria | 2590 |
| 135 | Ga0068852_100112799 | 3300005616 | Bacteria | 2474 |
| 136 | Ga0068852_100131914 | 3300005616 | Bacteria | 2302 |
| 137 | Ga0068852_100137079 | 3300005616 | Bacteria | 2260 |
| 138 | Ga0068852_100188789 | 3300005616 | Bacteria | 1943 |
| 139 | Ga0068852_100194999 | 3300005616 | Bacteria | 1913 |
| 140 | Ga0068852_100656478 | 3300005616 | Bacteria | 1057 |
| 141 | Ga0068859_100419536 | 3300005617 | Bacteria | 1434 |
| 142 | Ga0068859_100678715 | 3300005617 | Bacteria | 1121 |
| 143 | Ga0068859_100840332 | 3300005617 | Bacteria | 1004 |
| 144 | Ga0068864_100130491 | 3300005618 | Bacteria | 2257 |
| 145 | Ga0068861_100270675 | 3300005719 | Bacteria | 1458 |
| 146 | Ga0068861_100987566 | 3300005719 | Bacteria | 803 |
| 147 | Ga0068851_10002363 | 3300005834 | Bacteria | 8300 |
| 148 | Ga0068851_10059989 | 3300005834 | Bacteria | 1947 |
| 149 | Ga0068870_10386111 | 3300005840 | Bacteria | 908 |
| 150 | Ga0068870_10491058 | 3300005840 | Bacteria | 817 |
| 151 | Ga0068858_100095306 | 3300005842 | Bacteria | 2773 |
| 152 | Ga0068858_100146461 | 3300005842 | Bacteria | 2218 |
| 153 | Ga0068860_100631031 | 3300005843 | Bacteria | 1078 |
| 154 | Ga0068860_100898856 | 3300005843 | Bacteria | 901 |
| 155 | Ga0068860_101257128 | 3300005843 | Bacteria | 761 |
| 156 | Ga0068862_100046068 | 3300005844 | Bacteria | 3722 |
| 157 | Ga0068862_100433741 | 3300005844 | Bacteria | 1235 |
| 158 | Ga0081455_10004895 | 3300005937 | Bacteria | 14842 |
| 159 | Ga0081455_10028806 | 3300005937 | Bacteria | 5070 |
| 160 | Ga0081455_10044688 | 3300005937 | Bacteria | 3861 |
| 161 | Ga0081538_10004197 | 3300005981 | Bacteria | 13365 |
| 162 | Ga0081538_10010846 | 3300005981 | Bacteria | 7435 |
| 163 | Ga0081540_1009947 | 3300005983 | Bacteria | 6485 |
| 164 | Ga0081540_1036194 | 3300005983 | Bacteria | 2636 |
| 165 | Ga0081539_10009687 | 3300005985 | Bacteria | 7979 |
| 166 | Ga0081539_10055644 | 3300005985 | Bacteria | 2200 |
| 167 | Ga0070717_10005959 | 3300006028 | Bacteria | 8927 |
| 168 | Ga0070717_11697386 | 3300006028 | Bacteria | 572 |
| 169 | Ga0075365_10053696 | 3300006038 | Bacteria | 2670 |
| 170 | Ga0075365_10071356 | 3300006038 | Bacteria | 2338 |
| 171 | Ga0075365_10113217 | 3300006038 | Bacteria | 1866 |
| 172 | Ga0075365_10235331 | 3300006038 | Bacteria | 1286 |
| 173 | Ga0075365_10317951 | 3300006038 | Bacteria | 1096 |
| 174 | Ga0075365_11247432 | 3300006038 | Bacteria | 523 |
| 175 | Ga0075368_10003871 | 3300006042 | Bacteria | 5037 |
| 176 | Ga0075368_10113045 | 3300006042 | Bacteria | 1120 |
| 177 | Ga0075368_10217343 | 3300006042 | Bacteria | 811 |
| 178 | Ga0075363_100012017 | 3300006048 | Bacteria | 4163 |
| 179 | Ga0075363_100106657 | 3300006048 | Bacteria | 1554 |
| 180 | Ga0075364_10034716 | 3300006051 | Bacteria | 3256 |
| 181 | Ga0075364_10133291 | 3300006051 | Bacteria | 1668 |
| 182 | Ga0075364_10146891 | 3300006051 | Bacteria | 1588 |
| 183 | Ga0075364_10286629 | 3300006051 | Bacteria | 1120 |
| 184 | Ga0075432_10051629 | 3300006058 | Bacteria | 1451 |
| 185 | Ga0070715_10000598 | 3300006163 | Bacteria | 9517 |
| 186 | Ga0070715_10448896 | 3300006163 | Bacteria | 727 |
| 187 | Ga0070716_100012954 | 3300006173 | Bacteria | 4238 |
| 188 | Ga0070716_100046882 | 3300006173 | Bacteria | 2435 |
| 189 | Ga0070716_100135925 | 3300006173 | Bacteria | 1561 |
| 190 | Ga0070712_100020443 | 3300006175 | Bacteria | 4332 |
| 191 | Ga0070712_100057804 | 3300006175 | Bacteria | 2726 |
| 192 | Ga0070712_100126974 | 3300006175 | Bacteria | 1928 |
| 193 | Ga0075362_10128720 | 3300006177 | Bacteria | 1202 |
| 194 | Ga0075362_10149866 | 3300006177 | Bacteria | 1119 |
| 195 | Ga0075367_10007569 | 3300006178 | Bacteria | 5571 |
| 196 | Ga0075367_10015181 | 3300006178 | Bacteria | 4181 |
| 197 | Ga0075367_10023304 | 3300006178 | Bacteria | 3482 |
| 198 | Ga0075367_10065607 | 3300006178 | Bacteria | 2174 |
| 199 | Ga0075367_10194994 | 3300006178 | Bacteria | 1265 |
| 200 | Ga0075369_10008323 | 3300006186 | Bacteria | 3988 |
| 201 | Ga0075369_10046833 | 3300006186 | Bacteria | 1863 |
| 202 | Ga0075369_10053273 | 3300006186 | Bacteria | 1755 |
| 203 | Ga0075369_10210636 | 3300006186 | Bacteria | 898 |
| 204 | Ga0075369_10485200 | 3300006186 | Bacteria | 587 |
| 205 | Ga0075366_10030117 | 3300006195 | Bacteria | 3190 |
| 206 | Ga0075366_10212951 | 3300006195 | Bacteria | 1176 |
| 207 | Ga0075366_10270108 | 3300006195 | Bacteria | 1038 |
| 208 | Ga0075366_10451629 | 3300006195 | Bacteria | 793 |
| 209 | Ga0097621_100065762 | 3300006237 | Bacteria | 2985 |
| 210 | Ga0097621_100361881 | 3300006237 | Bacteria | 1292 |
| 211 | Ga0075370_10012433 | 3300006353 | Bacteria | 4497 |
| 212 | Ga0075370_10072760 | 3300006353 | Bacteria | 1968 |
| 213 | Ga0075370_10163329 | 3300006353 | Bacteria | 1307 |
| 214 | Ga0075370_10645190 | 3300006353 | Bacteria | 642 |
| 215 | Ga0075428_100031165 | 3300006844 | Bacteria | 5897 |
| 216 | Ga0075428_100146156 | 3300006844 | Bacteria | 2569 |
| 217 | Ga0075434_100303051 | 3300006871 | Bacteria | 1618 |
| 218 | Ga0075434_101101209 | 3300006871 | Bacteria | 807 |
| 219 | Ga0068865_100411756 | 3300006881 | Bacteria | 1109 |
| 220 | Ga0075436_100000569 | 3300006914 | Bacteria | 24112 |
| 221 | Ga0097620_100419532 | 3300006931 | Bacteria | 1434 |
| 222 | Ga0097620_100678711 | 3300006931 | Bacteria | 1121 |
| 223 | Ga0097620_100840303 | 3300006931 | Bacteria | 1004 |
| 224 | Ga0075435_100015953 | 3300007076 | Bacteria | 5657 |
| 225 | Ga0075435_100252215 | 3300007076 | Bacteria | 1502 |
| 226 | Ga0105240_10003411 | 3300009093 | Bacteria | 24689 |
| 227 | Ga0105240_10015393 | 3300009093 | Bacteria | 10397 |
| 228 | Ga0105240_10029865 | 3300009093 | Bacteria | 7094 |
| 229 | Ga0105240_10857771 | 3300009093 | Bacteria | 980 |
| 230 | Ga0105245_11776089 | 3300009098 | Bacteria | 669 |
| 231 | Ga0105247_10708510 | 3300009101 | Bacteria | 758 |
| 232 | Ga0114129_10202878 | 3300009147 | Bacteria | 2685 |
| 233 | Ga0105243_10116001 | 3300009148 | Bacteria | 2249 |
| 234 | Ga0105243_10460636 | 3300009148 | Bacteria | 1195 |
| 235 | Ga0105243_10788911 | 3300009148 | Bacteria | 935 |
| 236 | Ga0105241_10002479 | 3300009174 | Bacteria | 13874 |
| 237 | Ga0105241_10369543 | 3300009174 | Bacteria | 1250 |
| 238 | Ga0105241_10546218 | 3300009174 | Bacteria | 1040 |
| 239 | Ga0105242_10317021 | 3300009176 | Bacteria | 1429 |
| 240 | Ga0105242_11398900 | 3300009176 | Bacteria | 727 |
| 241 | Ga0105248_10238832 | 3300009177 | Bacteria | 2045 |
| 242 | Ga0105248_10679666 | 3300009177 | Bacteria | 1161 |
| 243 | Ga0105237_10050884 | 3300009545 | Bacteria | 4163 |
| 244 | Ga0105237_10109537 | 3300009545 | Bacteria | 2754 |
| 245 | Ga0105237_10348303 | 3300009545 | Bacteria | 1486 |
| 246 | Ga0105237_10773650 | 3300009545 | Bacteria | 967 |
| 247 | Ga0105237_11121505 | 3300009545 | Bacteria | 793 |
| 248 | Ga0105238_10005788 | 3300009551 | Bacteria | 12235 |
| 249 | Ga0105238_10010373 | 3300009551 | Bacteria | 9351 |
| 250 | Ga0105238_10190515 | 3300009551 | Bacteria | 2027 |
| 251 | Ga0105238_10369234 | 3300009551 | Bacteria | 1425 |
| 252 | Ga0105238_10749485 | 3300009551 | Bacteria | 990 |
| 253 | Ga0105249_10604954 | 3300009553 | Bacteria | 1151 |
| 254 | Ga0105249_10813825 | 3300009553 | Bacteria | 998 |
| 255 | Ga0105249_10816608 | 3300009553 | Bacteria | 997 |
| 256 | Ga0105249_10940915 | 3300009553 | Bacteria | 932 |
| 257 | Ga0105249_11734260 | 3300009553 | Bacteria | 697 |
| 258 | Ga0099796_10015145 | 3300010159 | Bacteria | 2247 |
| 259 | Ga0099796_10161445 | 3300010159 | Bacteria | 888 |
| 260 | Ga0099796_10217887 | 3300010159 | Bacteria | 781 |
| 261 | Ga0099796_10300179 | 3300010159 | Bacteria | 680 |
| 262 | Ga0105239_10006751 | 3300010375 | Bacteria | 13254 |
| 263 | Ga0105239_10038316 | 3300010375 | Bacteria | 5253 |
| 264 | Ga0105239_10052562 | 3300010375 | Bacteria | 4468 |
| 265 | Ga0105239_10109955 | 3300010375 | Bacteria | 3055 |
| 266 | Ga0105239_10111235 | 3300010375 | Bacteria | 3036 |
| 267 | Ga0105239_10534925 | 3300010375 | Bacteria | 1334 |
| 268 | Ga0105239_11803139 | 3300010375 | Bacteria | 709 |
| 269 | Ga0157322_1007909 | 3300012490 | Bacteria | 800 |
| 270 | Ga0157373_10107960 | 3300013100 | Bacteria | 1957 |
| 271 | Ga0157371_10395319 | 3300013102 | Bacteria | 1011 |
| 272 | Ga0157369_10170948 | 3300013105 | Bacteria | 2290 |
| 273 | Ga0157369_10216758 | 3300013105 | Bacteria | 2004 |
| 274 | Ga0157369_11321370 | 3300013105 | Bacteria | 735 |
| 275 | Ga0157374_10116742 | 3300013296 | Bacteria | 2572 |
| 276 | Ga0157374_10614723 | 3300013296 | Bacteria | 1097 |
| 277 | Ga0163162_10395168 | 3300013306 | Bacteria | 1515 |
| 278 | Ga0163162_11016984 | 3300013306 | Bacteria | 937 |
| 279 | Ga0163162_11022040 | 3300013306 | Bacteria | 935 |
| 280 | Ga0157372_10126018 | 3300013307 | Bacteria | 2944 |
| 281 | Ga0157372_10524511 | 3300013307 | Bacteria | 1381 |
| 282 | Ga0157372_10849016 | 3300013307 | Bacteria | 1060 |
| 283 | Ga0157375_10343143 | 3300013308 | Bacteria | 1659 |
| 284 | Ga0157375_10546228 | 3300013308 | Bacteria | 1321 |
| 285 | Ga0157375_11723273 | 3300013308 | Bacteria | 742 |
| 286 | Ga0163163_10023747 | 3300014325 | Bacteria | 5825 |
| 287 | Ga0163163_10164609 | 3300014325 | Bacteria | 2263 |
| 288 | Ga0157377_10135851 | 3300014745 | Bacteria | 1507 |
| 289 | Ga0157379_10469693 | 3300014968 | Bacteria | 1163 |
| 290 | Ga0157379_12215248 | 3300014968 | Bacteria | 546 |
| 291 | Ga0157376_10784459 | 3300014969 | Bacteria | 964 |
| 292 | Ga0163161_10615013 | 3300017792 | Bacteria | 897 |
| 293 | Ga0206354_11275229 | 3300020081 | Bacteria | 657 |
| 294 | Ga0214542_1044186 | 3300021321 | Bacteria | 1015 |
| 295 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 296 | Ga0214545_1000094 | 3300021324 | Bacteria | 98180 |
| 297 | Ga0213876_10048881 | 3300021384 | Bacteria | 2234 |
| 298 | Ga0209677_107376 | 3300025253 | Bacteria | 2351 |
| 299 | Ga0209233_1013039 | 3300025261 | Bacteria | 2387 |
| 300 | Ga0209455_1003873 | 3300025272 | Bacteria | 5107 |
| 301 | Ga0209564_1002186 | 3300025295 | Bacteria | 16369 |
| 302 | Ga0209758_1003593 | 3300025297 | Bacteria | 13872 |
| 303 | Ga0209758_1009747 | 3300025297 | Bacteria | 5898 |
| 304 | Ga0209758_1013888 | 3300025297 | Bacteria | 4340 |
| 305 | Ga0207426_1070523 | 3300025302 | Bacteria | 976 |
| 306 | Ga0207697_10027745 | 3300025315 | Bacteria | 2315 |
| 307 | Ga0207656_10005300 | 3300025321 | Bacteria | 4551 |
| 308 | Ga0207656_10132704 | 3300025321 | Bacteria | 1168 |
| 309 | Ga0207656_10145009 | 3300025321 | Bacteria | 1121 |
| 310 | Ga0207653_10114445 | 3300025885 | Bacteria | 966 |
| 311 | Ga0207692_10001799 | 3300025898 | Bacteria | 8124 |
| 312 | Ga0207692_10031851 | 3300025898 | Bacteria | 2528 |
| 313 | Ga0207642_10104301 | 3300025899 | Bacteria | 1430 |
| 314 | Ga0207710_10120046 | 3300025900 | Bacteria | 1255 |
| 315 | Ga0207710_10182100 | 3300025900 | Bacteria | 1031 |
| 316 | Ga0207710_10191977 | 3300025900 | Bacteria | 1006 |
| 317 | Ga0207688_10449513 | 3300025901 | Bacteria | 803 |
| 318 | Ga0207680_10381862 | 3300025903 | Bacteria | 993 |
| 319 | Ga0207680_10425102 | 3300025903 | Bacteria | 941 |
| 320 | Ga0207680_10767300 | 3300025903 | Bacteria | 691 |
| 321 | Ga0207647_10102419 | 3300025904 | Bacteria | 1698 |
| 322 | Ga0207699_10002114 | 3300025906 | Bacteria | 9385 |
| 323 | Ga0207699_10365270 | 3300025906 | Bacteria | 1022 |
| 324 | Ga0207645_10189071 | 3300025907 | Bacteria | 1353 |
| 325 | Ga0207645_10197119 | 3300025907 | Bacteria | 1324 |
| 326 | Ga0207645_10597451 | 3300025907 | Bacteria | 749 |
| 327 | Ga0207643_10065231 | 3300025908 | Bacteria | 2085 |
| 328 | Ga0207705_10299799 | 3300025909 | Bacteria | 1233 |
| 329 | Ga0207684_10198374 | 3300025910 | Bacteria | 1731 |
| 330 | Ga0207654_10000488 | 3300025911 | Bacteria | 22690 |
| 331 | Ga0207654_10057785 | 3300025911 | Bacteria | 2256 |
| 332 | Ga0207654_10288715 | 3300025911 | Bacteria | 1112 |
| 333 | Ga0207707_10018804 | 3300025912 | Bacteria | 6026 |
| 334 | Ga0207695_10002499 | 3300025913 | Bacteria | 27042 |
| 335 | Ga0207695_10058053 | 3300025913 | Bacteria | 4018 |
| 336 | Ga0207695_10409973 | 3300025913 | Bacteria | 1239 |
| 337 | Ga0207695_10892444 | 3300025913 | Bacteria | 769 |
| 338 | Ga0207671_10055229 | 3300025914 | Bacteria | 2942 |
| 339 | Ga0207671_10121817 | 3300025914 | Bacteria | 1994 |
| 340 | Ga0207671_10137048 | 3300025914 | Bacteria | 1883 |
| 341 | Ga0207671_10463576 | 3300025914 | Bacteria | 1010 |
| 342 | Ga0207671_11299722 | 3300025914 | Bacteria | 566 |
| 343 | Ga0207693_10001912 | 3300025915 | Bacteria | 18227 |
| 344 | Ga0207693_10072112 | 3300025915 | Bacteria | 2704 |
| 345 | Ga0207693_10093765 | 3300025915 | Bacteria | 2353 |
| 346 | Ga0207693_10455177 | 3300025915 | Bacteria | 1000 |
| 347 | Ga0207663_10000468 | 3300025916 | Bacteria | 17526 |
| 348 | Ga0207663_10154598 | 3300025916 | Bacteria | 1612 |
| 349 | Ga0207663_10257974 | 3300025916 | Bacteria | 1286 |
| 350 | Ga0207660_10238664 | 3300025917 | Bacteria | 1431 |
| 351 | Ga0207660_10366625 | 3300025917 | Bacteria | 1156 |
| 352 | Ga0207657_10233817 | 3300025919 | Bacteria | 1469 |
| 353 | Ga0207649_10284882 | 3300025920 | Bacteria | 1203 |
| 354 | Ga0207652_10018004 | 3300025921 | Bacteria | 5789 |
| 355 | Ga0207652_10256139 | 3300025921 | Bacteria | 1578 |
| 356 | Ga0207681_10458110 | 3300025923 | Bacteria | 1038 |
| 357 | Ga0207681_10952791 | 3300025923 | Bacteria | 719 |
| 358 | Ga0207694_10000258 | 3300025924 | Bacteria | 50514 |
| 359 | Ga0207694_10014516 | 3300025924 | Bacteria | 5939 |
| 360 | Ga0207694_10022364 | 3300025924 | Bacteria | 4796 |
| 361 | Ga0207694_10094707 | 3300025924 | Bacteria | 2360 |
| 362 | Ga0207694_10424206 | 3300025924 | Bacteria | 1108 |
| 363 | Ga0207650_10504971 | 3300025925 | Bacteria | 1011 |
| 364 | Ga0207650_10877158 | 3300025925 | Bacteria | 762 |
| 365 | Ga0207659_10245962 | 3300025926 | Bacteria | 1449 |
| 366 | Ga0207659_10532585 | 3300025926 | Bacteria | 997 |
| 367 | Ga0207687_10020017 | 3300025927 | Bacteria | 4438 |
| 368 | Ga0207687_10317180 | 3300025927 | Bacteria | 1261 |
| 369 | Ga0207687_10738533 | 3300025927 | Bacteria | 837 |
| 370 | Ga0207700_10019468 | 3300025928 | Bacteria | 4586 |
| 371 | Ga0207700_11244980 | 3300025928 | Bacteria | 664 |
| 372 | Ga0207664_10040288 | 3300025929 | Bacteria | 3632 |
| 373 | Ga0207664_10140530 | 3300025929 | Bacteria | 2042 |
| 374 | Ga0207664_10404642 | 3300025929 | Bacteria | 1214 |
| 375 | Ga0207664_10597581 | 3300025929 | Bacteria | 991 |
| 376 | Ga0207644_10308486 | 3300025931 | Bacteria | 1277 |
| 377 | Ga0207690_10318298 | 3300025932 | Bacteria | 1222 |
| 378 | Ga0207706_10086261 | 3300025933 | Bacteria | 2759 |
| 379 | Ga0207686_10923331 | 3300025934 | Bacteria | 705 |
| 380 | Ga0207709_10167030 | 3300025935 | Bacteria | 1541 |
| 381 | Ga0207709_10247442 | 3300025935 | Bacteria | 1300 |
| 382 | Ga0207709_10287287 | 3300025935 | Bacteria | 1217 |
| 383 | Ga0207709_10660633 | 3300025935 | Bacteria | 833 |
| 384 | Ga0207670_10066434 | 3300025936 | Bacteria | 2478 |
| 385 | Ga0207704_10014231 | 3300025938 | Bacteria | 4012 |
| 386 | Ga0207704_11148251 | 3300025938 | Bacteria | 661 |
| 387 | Ga0207665_10000791 | 3300025939 | Bacteria | 21348 |
| 388 | Ga0207665_10040549 | 3300025939 | Bacteria | 3107 |
| 389 | Ga0207691_10451481 | 3300025940 | Bacteria | 1094 |
| 390 | Ga0207691_10538870 | 3300025940 | Bacteria | 990 |
| 391 | Ga0207691_11005299 | 3300025940 | Bacteria | 696 |
| 392 | Ga0207711_10238277 | 3300025941 | Bacteria | 1668 |
| 393 | Ga0207711_11651921 | 3300025941 | Bacteria | 584 |
| 394 | Ga0207689_10237062 | 3300025942 | Bacteria | 1508 |
| 395 | Ga0207689_10618340 | 3300025942 | Bacteria | 912 |
| 396 | Ga0207661_10657041 | 3300025944 | Bacteria | 964 |
| 397 | Ga0207667_10007013 | 3300025949 | Bacteria | 13611 |
| 398 | Ga0207667_10009886 | 3300025949 | Bacteria | 11193 |
| 399 | Ga0207667_10010097 | 3300025949 | Bacteria | 11066 |
| 400 | Ga0207667_10144533 | 3300025949 | Bacteria | 2449 |
| 401 | Ga0207667_11585982 | 3300025949 | Bacteria | 624 |
| 402 | Ga0207651_10121574 | 3300025960 | Bacteria | 1981 |
| 403 | Ga0207651_10510769 | 3300025960 | Bacteria | 1040 |
| 404 | Ga0207712_11081005 | 3300025961 | Bacteria | 714 |
| 405 | Ga0207668_10005343 | 3300025972 | Bacteria | 7557 |
| 406 | Ga0207668_10045426 | 3300025972 | Bacteria | 2995 |
| 407 | Ga0207668_10523470 | 3300025972 | Bacteria | 1023 |
| 408 | Ga0207640_10014499 | 3300025981 | Bacteria | 4540 |
| 409 | Ga0207640_10019478 | 3300025981 | Bacteria | 4009 |
| 410 | Ga0207658_11593968 | 3300025986 | Bacteria | 597 |
| 411 | Ga0207677_10070393 | 3300026023 | Bacteria | 2465 |
| 412 | Ga0207677_10247794 | 3300026023 | Bacteria | 1445 |
| 413 | Ga0207677_10777377 | 3300026023 | Bacteria | 855 |
| 414 | Ga0207703_10145874 | 3300026035 | Bacteria | 2058 |
| 415 | Ga0207703_10179462 | 3300026035 | Bacteria | 1868 |
| 416 | Ga0207703_10689005 | 3300026035 | Bacteria | 971 |
| 417 | Ga0207703_10699017 | 3300026035 | Bacteria | 964 |
| 418 | Ga0207639_10004848 | 3300026041 | Bacteria | 9069 |
| 419 | Ga0207639_10005744 | 3300026041 | Bacteria | 8402 |
| 420 | Ga0207639_10035786 | 3300026041 | Bacteria | 3675 |
| 421 | Ga0207639_10093845 | 3300026041 | Bacteria | 2407 |
| 422 | Ga0207639_10686529 | 3300026041 | Bacteria | 949 |
| 423 | Ga0207678_10034872 | 3300026067 | Bacteria | 4382 |
| 424 | Ga0207678_10146025 | 3300026067 | Bacteria | 2019 |
| 425 | Ga0207678_10221370 | 3300026067 | Bacteria | 1620 |
| 426 | Ga0207678_10712932 | 3300026067 | Bacteria | 883 |
| 427 | Ga0207708_10281862 | 3300026075 | Bacteria | 1347 |
| 428 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 429 | Ga0207702_10750891 | 3300026078 | Bacteria | 963 |
| 430 | Ga0207641_10317453 | 3300026088 | Bacteria | 1476 |
| 431 | Ga0207648_10508952 | 3300026089 | Bacteria | 1102 |
| 432 | Ga0207676_10056842 | 3300026095 | Bacteria | 3078 |
| 433 | Ga0207676_10321145 | 3300026095 | Bacteria | 1421 |
| 434 | Ga0207676_10757073 | 3300026095 | Bacteria | 945 |
| 435 | Ga0207674_10023277 | 3300026116 | Bacteria | 6637 |
| 436 | Ga0207674_10036549 | 3300026116 | Bacteria | 5115 |
| 437 | Ga0207675_100470650 | 3300026118 | Bacteria | 1247 |
| 438 | Ga0207683_10013150 | 3300026121 | Bacteria | 7061 |
| 439 | Ga0207683_10063276 | 3300026121 | Bacteria | 3259 |
| 440 | Ga0207683_10623762 | 3300026121 | Bacteria | 998 |
| 441 | Ga0207698_10016031 | 3300026142 | Bacteria | 5040 |
| 442 | Ga0207698_10149202 | 3300026142 | Bacteria | 2027 |
| 443 | Ga0207698_10157168 | 3300026142 | Bacteria | 1983 |
| 444 | Ga0207698_10815399 | 3300026142 | Bacteria | 936 |
| 445 | Ga0209179_1005879 | 3300027512 | Bacteria | 1946 |
| 446 | Ga0209813_10081247 | 3300027866 | Bacteria | 1072 |
| 447 | Ga0209813_10086754 | 3300027866 | Bacteria | 1044 |
| 448 | Ga0209813_10141147 | 3300027866 | Bacteria | 855 |
| 449 | Ga0207428_10195964 | 3300027907 | Bacteria | 1521 |
| 450 | Ga0268266_10080191 | 3300028379 | Bacteria | 2843 |
| 451 | Ga0268266_10086045 | 3300028379 | Bacteria | 2747 |
| 452 | Ga0268266_10353347 | 3300028379 | Bacteria | 1381 |
| 453 | Ga0268266_10529147 | 3300028379 | Bacteria | 1128 |
| 454 | Ga0268266_11064957 | 3300028379 | Bacteria | 782 |
| 455 | Ga0268265_10061284 | 3300028380 | Bacteria | 2886 |
| 456 | Ga0268265_10121783 | 3300028380 | Bacteria | 2150 |
| 457 | Ga0268265_10215400 | 3300028380 | Bacteria | 1676 |
| 458 | Ga0268265_10662327 | 3300028380 | Bacteria | 1004 |
| 459 | Ga0268264_10284455 | 3300028381 | Bacteria | 1550 |
| 460 | Ga0268264_10831907 | 3300028381 | Bacteria | 924 |
| 461 | Ga0268264_10949356 | 3300028381 | Bacteria | 865 |
| 462 | Ga0307517_10160582 | 3300028786 | Bacteria | 1510 |
| 463 | Ga0307515_10060735 | 3300028794 | Bacteria | 5382 |
| 464 | Ga0307515_10125784 | 3300028794 | Bacteria | 2865 |
| 465 | Ga0265330_10068015 | 3300031235 | Bacteria | 1543 |
| 466 | Ga0265332_10239349 | 3300031238 | Bacteria | 751 |
| 467 | Ga0265325_10040179 | 3300031241 | Bacteria | 2458 |
| 468 | Ga0265325_10056360 | 3300031241 | Bacteria | 2007 |
| 469 | Ga0265340_10043557 | 3300031247 | Bacteria | 2199 |
| 470 | Ga0265339_10006205 | 3300031249 | Bacteria | 7870 |
| 471 | Ga0265339_10221853 | 3300031249 | Bacteria | 924 |
| 472 | Ga0265316_10055990 | 3300031344 | Bacteria | 3082 |
| 473 | Ga0265316_10751967 | 3300031344 | Bacteria | 685 |
| 474 | Ga0307513_10234990 | 3300031456 | Bacteria | 1643 |
| 475 | Ga0307513_10395212 | 3300031456 | Bacteria | 1118 |
| 476 | Ga0307513_10719133 | 3300031456 | Bacteria | 704 |
| 477 | Ga0307513_10778702 | 3300031456 | Bacteria | 662 |
| 478 | Ga0307509_10323905 | 3300031507 | Bacteria | 1276 |
| 479 | Ga0307509_10850076 | 3300031507 | Bacteria | 577 |
| 480 | Ga0265313_10038538 | 3300031595 | Bacteria | 2379 |
| 481 | Ga0307508_10000154 | 3300031616 | Bacteria | 82824 |
| 482 | Ga0307508_10006872 | 3300031616 | Bacteria | 10640 |
| 483 | Ga0307508_10044377 | 3300031616 | Bacteria | 3977 |
| 484 | Ga0307508_10050452 | 3300031616 | Bacteria | 3704 |
| 485 | Ga0307508_10156036 | 3300031616 | Bacteria | 1886 |
| 486 | Ga0265314_10022217 | 3300031711 | Bacteria | 4862 |
| 487 | Ga0265314_10113472 | 3300031711 | Bacteria | 1718 |
| 488 | Ga0265314_10120398 | 3300031711 | Bacteria | 1653 |
| 489 | Ga0265342_10004062 | 3300031712 | Bacteria | 11674 |
| 490 | Ga0265342_10019741 | 3300031712 | Bacteria | 4336 |
| 491 | Ga0265342_10110628 | 3300031712 | Bacteria | 1555 |
| 492 | Ga0307516_10073486 | 3300031730 | Bacteria | 3276 |
| 493 | Ga0307516_10384296 | 3300031730 | Bacteria | 1065 |
| 494 | Ga0307516_10412146 | 3300031730 | Bacteria | 1009 |
| 495 | Ga0307405_10261428 | 3300031731 | Bacteria | 1293 |
| 496 | Ga0307405_10490481 | 3300031731 | Bacteria | 983 |
| 497 | Ga0307405_11504341 | 3300031731 | Bacteria | 591 |
| 498 | Ga0307412_11432364 | 3300031911 | Bacteria | 626 |
| 499 | Ga0307409_100756929 | 3300031995 | Bacteria | 975 |
| 500 | Ga0307409_100991804 | 3300031995 | Bacteria | 858 |
| 501 | Ga0307416_100569624 | 3300032002 | Bacteria | 1208 |
| 502 | Ga0307414_10230161 | 3300032004 | Bacteria | 1528 |
| 503 | Ga0307414_10521770 | 3300032004 | Bacteria | 1054 |
| 504 | Ga0307415_100509834 | 3300032126 | Bacteria | 1053 |
| 505 | Ga0307415_100671707 | 3300032126 | Bacteria | 931 |
| 506 | Ga0307415_102283177 | 3300032126 | Bacteria | 530 |
| 507 | Ga0307510_10035129 | 3300033180 | Bacteria | 5602 |
| 508 | Ga0307510_10123405 | 3300033180 | Bacteria | 2287 |
| 509 | Ga0307510_10296363 | 3300033180 | Bacteria | 1081 |
| 510 | Ga0316213_1002512 | 3300033546 | Bacteria | 1234 |
| 511 | Ga0373930_0039630 | 3300034816 | Bacteria | 999 |
| 512 | Ga0373938_0029635 | 3300034957 | Bacteria | 1163 |
| 513 | Ga0373940_0093274 | 3300035088 | Bacteria | 905 |
| 514 | Ga0373952_0007320 | 3300035092 | Bacteria | 2066 |
| 515 | Ga0373923_0213759 | 3300035111 | Bacteria | 895 |
| 516 | Ga0373932_0046080 | 3300035112 | Bacteria | 1277 |
| 517 | Ga0373932_0342432 | 3300035112 | Bacteria | 567 |
| 518 | Ga0373936_0004495 | 3300035113 | Bacteria | 5276 |
| 519 | Ga0373936_0008591 | 3300035113 | Bacteria | 3846 |
| 520 | Ga0373936_0183992 | 3300035113 | Bacteria | 917 |
| 521 | Ga0373941_0050413 | 3300035115 | Bacteria | 1321 |
| 522 | Ga0373941_0395687 | 3300035115 | Bacteria | 570 |
| 523 | Ga0373945_0013000 | 3300035116 | Bacteria | 2773 |
| 524 | Ga0373954_0131333 | 3300035118 | Bacteria | 1219 |
| 525 | Ga0373956_0031554 | 3300035119 | Bacteria | 2323 |
| 526 | Ga0373957_0134480 | 3300035120 | Bacteria | 1008 |
| 527 | Ga0373943_0003586 | 3300035170 | Bacteria | 7061 |
| 528 | Ga0373946_0514223 | 3300035171 | Bacteria | 615 |
| 529 | Ga0373946_0717648 | 3300035171 | Bacteria | 523 |
| 530 | Ga0373955_0070764 | 3300035172 | Bacteria | 1950 |
| 531 | Ga0373955_0458847 | 3300035172 | Bacteria | 777 |
| 532 | Ga0373955_0523022 | 3300035172 | Bacteria | 725 |
| 533 | Ga0373924_0008812 | 3300035410 | Bacteria | 3679 |
| 534 | Ga0373931_0000507 | 3300035691 | Bacteria | 15939 |
| 535 | Ga0373931_0234557 | 3300035691 | Bacteria | 1110 |
| 536 | Ga0373935_0322151 | 3300035692 | Bacteria | 1097 |
| 537 | Ga0373927_0003207 | 3300035695 | Bacteria | 11783 |
| 538 | Ga0373927_0029468 | 3300035695 | Bacteria | 3578 |
| 539 | Ga0373933_0000278 | 3300035724 | Bacteria | 33265 |
| 540 | Ga0373947_0027809 | 3300035725 | Bacteria | 3312 |
| 541 | Ga0373937_0040577 | 3300036401 | Bacteria | 4242 |
| 542 | Ga0373937_0451735 | 3300036401 | Bacteria | 1220 |
| 543 | Ga0372808_020118 | 3300036459 | Bacteria | 959 |
| 544 | Ga0373925_0006083 | 3300037068 | Bacteria | 8927 |
| 545 | Ga0373925_0278169 | 3300037068 | Bacteria | 1348 |
| 546 | Ga0373925_0587153 | 3300037068 | Bacteria | 917 |
| 547 | Ga0373925_0649613 | 3300037068 | Bacteria | 869 |
| 548 | Ga0395900_0134282 | 3300037418 | Bacteria | 2535 |
| 549 | Ga0395898_0005012 | 3300037466 | Bacteria | 14376 |
| 550 | Ga0395898_0443014 | 3300037466 | Bacteria | 1237 |
| 551 | Ga0436364_0079550 | 3300037853 | Bacteria | 1003 |
| 552 | Ga0395901_0153112 | 3300038443 | Bacteria | 2422 |
| 553 | Ga0395901_0174892 | 3300038443 | Bacteria | 2252 |
| 554 | Ga0395901_1754424 | 3300038443 | Bacteria | 571 |
| 555 | Ga0436365_1314085 | 3300039437 | Bacteria | 2401 |
| 556 | Ga0436365_1574673 | 3300039437 | Bacteria | 1559 |
| 557 | Ga0436360_0641463 | 3300039438 | Bacteria | 2383 |
| 558 | Ga0436361_0429619 | 3300039447 | Bacteria | 718 |
| 559 | Ga0436363_0241633 | 3300039450 | Bacteria | 1052 |
| 560 | Ga0436363_0444982 | 3300039450 | Bacteria | 642 |
| 561 | Ga0436363_1053886 | 3300039450 | Bacteria | 556 |
| 562 | Ga0439465_0037505 | 3300041413 | Bacteria | 1559 |
| 563 | Ga0439465_0118360 | 3300041413 | Bacteria | 927 |
| 564 | Ga0439465_0332166 | 3300041413 | Bacteria | 572 |
| 565 | Ga0451791_1090847 | 3300041451 | Bacteria | 1824 |
| 566 | Ga0451791_1192174 | 3300041451 | Bacteria | 756 |
| 567 | Ga0451800_1308288 | 3300041459 | Bacteria | 762 |
| 568 | Ga0451804_0808098 | 3300041463 | Bacteria | 613 |
| 569 | Ga0451833_0609030 | 3300041491 | Bacteria | 876 |
| 570 | Ga0451851_0648074 | 3300041507 | Bacteria | 569 |
| 571 | Ga0451853_1533967 | 3300041512 | Bacteria | 1018 |
| 572 | Ga0451853_3299164 | 3300041512 | Bacteria | 1291 |
| 573 | Ga0439431_0022287 | 3300041997 | Bacteria | 1526 |
| 574 | Ga0439445_0045575 | 3300042004 | Bacteria | 1174 |
| 575 | Ga0450905_028721 | 3300042142 | Bacteria | 850 |
| 576 | Ga0439434_0047398 | 3300042435 | Bacteria | 1328 |
| 577 | Ga0439459_0006825 | 3300042438 | Bacteria | 1912 |
| 578 | Ga0466966_0538676 | 3300044684 | Bacteria | 702 |
| 579 | Ga0466963_0056480 | 3300044694 | Bacteria | 2612 |
| 580 | Ga0466964_0038463 | 3300044706 | Bacteria | 1924 |
| 581 | Ga0466970_0487314 | 3300044765 | Bacteria | 709 |
| 582 | Ga0466957_0249422 | 3300044842 | Bacteria | 1180 |
| 583 | Ga0466957_0301379 | 3300044842 | Bacteria | 1077 |
| 584 | Ga0466960_0674131 | 3300044901 | Bacteria | 619 |
| 585 | Ga0466959_0234345 | 3300045049 | Bacteria | 1270 |
| 586 | Ga0451576_0068989 | 3300045051 | Bacteria | 3679 |
| 587 | Ga0451576_0114449 | 3300045051 | Bacteria | 2808 |
| 588 | Ga0451576_1808318 | 3300045051 | Bacteria | 631 |
| 589 | Ga0466967_0034197 | 3300045976 | Bacteria | 4311 |
| 590 | Ga0466967_0522965 | 3300045976 | Bacteria | 1166 |
| 591 | Ga0466967_0944765 | 3300045976 | Bacteria | 858 |
| 592 | Ga0495617_015362 | 3300046452 | Bacteria | 2595 |
| 593 | Ga0495592_0012627 | 3300046454 | Bacteria | 6420 |
| 594 | Ga0495592_0905318 | 3300046454 | Bacteria | 518 |
| 595 | Ga0495603_0001599 | 3300046455 | Bacteria | 13286 |
| 596 | Ga0495603_0050821 | 3300046455 | Bacteria | 2464 |
| 597 | Ga0495603_0205660 | 3300046455 | Bacteria | 1137 |
| 598 | Ga0495603_0718349 | 3300046455 | Bacteria | 571 |
| 599 | Ga0495591_036772 | 3300046458 | Bacteria | 1423 |
| 600 | Ga0495629_0000314 | 3300046459 | Bacteria | 41394 |
| 601 | Ga0495629_0077007 | 3300046459 | Bacteria | 2328 |
| 602 | Ga0495638_0025730 | 3300046460 | Bacteria | 3820 |
| 603 | Ga0495638_0065201 | 3300046460 | Bacteria | 2242 |
| 604 | Ga0495638_0341623 | 3300046460 | Bacteria | 793 |
| 605 | Ga0495641_0002314 | 3300046461 | Bacteria | 15168 |
| 606 | Ga0495651_0092239 | 3300046462 | Bacteria | 2269 |
| 607 | Ga0495651_0139413 | 3300046462 | Bacteria | 1760 |
| 608 | Ga0495653_0034870 | 3300046463 | Bacteria | 3974 |
| 609 | Ga0495653_0195948 | 3300046463 | Bacteria | 1375 |
| 610 | Ga0495653_0224516 | 3300046463 | Bacteria | 1261 |
| 611 | Ga0495580_0002541 | 3300046472 | Bacteria | 15893 |
| 612 | Ga0495580_0447853 | 3300046472 | Bacteria | 866 |
| 613 | Ga0495582_0006906 | 3300046473 | Bacteria | 6310 |
| 614 | Ga0495582_0204540 | 3300046473 | Bacteria | 1128 |
| 615 | Ga0495605_0124399 | 3300046474 | Bacteria | 1167 |
| 616 | Ga0495639_0017614 | 3300046475 | Bacteria | 3104 |
| 617 | Ga0495639_0443551 | 3300046475 | Bacteria | 659 |
| 618 | Ga0495662_0000638 | 3300046476 | Bacteria | 16370 |
| 619 | Ga0495662_0216931 | 3300046476 | Bacteria | 943 |
| 620 | Ga0495664_0013161 | 3300046477 | Bacteria | 4692 |
| 621 | Ga0495664_0070544 | 3300046477 | Bacteria | 2086 |
| 622 | Ga0495664_0362889 | 3300046477 | Bacteria | 872 |
| 623 | Ga0495584_0029858 | 3300046491 | Bacteria | 2762 |
| 624 | Ga0495584_0094580 | 3300046491 | Bacteria | 1508 |
| 625 | Ga0495584_0239778 | 3300046491 | Bacteria | 922 |
| 626 | Ga0495585_0132551 | 3300046492 | Bacteria | 1310 |
| 627 | Ga0495594_0002386 | 3300046499 | Bacteria | 9784 |
| 628 | Ga0495594_0125281 | 3300046499 | Bacteria | 1453 |
| 629 | Ga0495596_0215009 | 3300046500 | Bacteria | 746 |
| 630 | Ga0495607_0015387 | 3300046501 | Bacteria | 4960 |
| 631 | Ga0495607_0070643 | 3300046501 | Bacteria | 1950 |
| 632 | Ga0495583_0086025 | 3300046506 | Bacteria | 1360 |
| 633 | Ga0495608_0157236 | 3300046511 | Bacteria | 1446 |
| 634 | Ga0495608_0268295 | 3300046511 | Bacteria | 1061 |
| 635 | Ga0495610_0029189 | 3300046512 | Bacteria | 2908 |
| 636 | Ga0495610_0134507 | 3300046512 | Bacteria | 1070 |
| 637 | Ga0495616_0069232 | 3300046513 | Bacteria | 1711 |
| 638 | Ga0495618_0610785 | 3300046514 | Bacteria | 648 |
| 639 | Ga0495628_0014010 | 3300046516 | Bacteria | 6732 |
| 640 | Ga0495628_0892245 | 3300046516 | Bacteria | 617 |
| 641 | Ga0495630_0002415 | 3300046517 | Bacteria | 12968 |
| 642 | Ga0495630_0129744 | 3300046517 | Bacteria | 1914 |
| 643 | Ga0495630_0268357 | 3300046517 | Bacteria | 1304 |
| 644 | Ga0495631_0043987 | 3300046518 | Bacteria | 1969 |
| 645 | Ga0495631_0203453 | 3300046518 | Bacteria | 846 |
| 646 | Ga0495631_0430056 | 3300046518 | Bacteria | 562 |
| 647 | Ga0495632_0030178 | 3300046519 | Bacteria | 2817 |
| 648 | Ga0495632_0311209 | 3300046519 | Bacteria | 697 |
| 649 | Ga0495643_0030807 | 3300046522 | Bacteria | 2991 |
| 650 | Ga0495644_0033247 | 3300046523 | Bacteria | 1948 |
| 651 | Ga0495644_0124037 | 3300046523 | Bacteria | 983 |
| 652 | Ga0495644_0219953 | 3300046523 | Bacteria | 734 |
| 653 | Ga0495648_0002388 | 3300046524 | Bacteria | 17441 |
| 654 | Ga0495648_0028489 | 3300046524 | Bacteria | 3719 |
| 655 | Ga0495648_0049753 | 3300046524 | Bacteria | 2566 |
| 656 | Ga0495648_0154277 | 3300046524 | Bacteria | 1194 |
| 657 | Ga0495663_0024099 | 3300046525 | Bacteria | 1767 |
| 658 | Ga0495666_0016798 | 3300046526 | Bacteria | 3644 |
| 659 | Ga0495652_0108615 | 3300046529 | Bacteria | 2235 |
| 660 | Ga0495654_0196737 | 3300046530 | Bacteria | 865 |
| 661 | Ga0495665_0001211 | 3300046531 | Bacteria | 13779 |
| 662 | Ga0495665_0344056 | 3300046531 | Bacteria | 760 |
| 663 | Ga0495640_0000308 | 3300046533 | Bacteria | 33750 |
| 664 | Ga0495640_0302454 | 3300046533 | Bacteria | 993 |
| 665 | Ga0495586_0026603 | 3300046535 | Bacteria | 3095 |
| 666 | Ga0495587_0111857 | 3300046536 | Bacteria | 1568 |
| 667 | Ga0495598_0009519 | 3300046537 | Bacteria | 2300 |
| 668 | Ga0495609_0084307 | 3300046538 | Bacteria | 1387 |
| 669 | Ga0495609_0103033 | 3300046538 | Bacteria | 1235 |
| 670 | Ga0495609_0200769 | 3300046538 | Bacteria | 833 |
| 671 | Ga0495621_0031680 | 3300046539 | Bacteria | 1815 |
| 672 | Ga0495621_0116962 | 3300046539 | Bacteria | 1027 |
| 673 | Ga0495597_0046750 | 3300046542 | Bacteria | 1917 |
| 674 | Ga0495645_0249377 | 3300046543 | Bacteria | 1181 |
| 675 | Ga0495645_0466506 | 3300046543 | Bacteria | 794 |
| 676 | Ga0495645_0499969 | 3300046543 | Bacteria | 760 |
| 677 | Ga0495622_0071870 | 3300046557 | Bacteria | 1596 |
| 678 | Ga0495622_0174901 | 3300046557 | Bacteria | 964 |
| 679 | Ga0495622_0362936 | 3300046557 | Bacteria | 626 |
| 680 | Ga0495633_0156261 | 3300046558 | Bacteria | 1052 |
| 681 | Ga0495667_0004819 | 3300046559 | Bacteria | 9123 |
| 682 | Ga0495667_0059343 | 3300046559 | Bacteria | 2511 |
| 683 | Ga0495656_0066657 | 3300046615 | Bacteria | 1586 |
| 684 | Ga0495656_0069224 | 3300046615 | Bacteria | 1562 |
| 685 | Ga0495656_0081697 | 3300046615 | Bacteria | 1459 |
| 686 | Ga0495656_0295093 | 3300046615 | Bacteria | 829 |
| 687 | Ga0495634_0001740 | 3300046642 | Bacteria | 18853 |
| 688 | Ga0495611_0143953 | 3300046648 | Bacteria | 1113 |
| 689 | Ga0495611_0208445 | 3300046648 | Bacteria | 910 |
| 690 | Ga0495611_0312613 | 3300046648 | Bacteria | 723 |
| 691 | Ga0495625_0204925 | 3300046660 | Bacteria | 1299 |
| 692 | Ga0495625_0355895 | 3300046660 | Bacteria | 924 |
| 693 | Ga0495625_0479201 | 3300046660 | Bacteria | 764 |
| 694 | Ga0495635_0123691 | 3300046663 | Bacteria | 1764 |
| 695 | Ga0495635_0146903 | 3300046663 | Bacteria | 1605 |
| 696 | Ga0495635_0485421 | 3300046663 | Bacteria | 814 |
| 697 | Ga0495661_0009160 | 3300046665 | Bacteria | 6803 |
| 698 | Ga0495661_0244073 | 3300046665 | Bacteria | 920 |
| 699 | Ga0495588_0032601 | 3300046674 | Bacteria | 2626 |
| 700 | Ga0495657_0036953 | 3300046675 | Bacteria | 3370 |
| 701 | Ga0495657_0112932 | 3300046675 | Bacteria | 1719 |
| 702 | Ga0495657_0307756 | 3300046675 | Bacteria | 944 |
| 703 | Ga0495599_0835795 | 3300046678 | Bacteria | 524 |
| 704 | Ga0495623_0145241 | 3300046679 | Bacteria | 1407 |
| 705 | Ga0495646_0011359 | 3300046680 | Bacteria | 5655 |
| 706 | Ga0495646_0203373 | 3300046680 | Bacteria | 1078 |
| 707 | Ga0495646_0382475 | 3300046680 | Bacteria | 734 |
| 708 | Ga0495646_0396963 | 3300046680 | Bacteria | 717 |
| 709 | Ga0495647_0018313 | 3300046681 | Bacteria | 2491 |
| 710 | Ga0495658_0003427 | 3300046683 | Bacteria | 7848 |
| 711 | Ga0495658_0352552 | 3300046683 | Bacteria | 935 |
| 712 | Ga0495669_0273973 | 3300046684 | Bacteria | 811 |
| 713 | Ga0495669_0595724 | 3300046684 | Bacteria | 538 |
| 714 | Ga0495613_0102117 | 3300046689 | Bacteria | 2070 |
| 715 | Ga0495613_0272386 | 3300046689 | Bacteria | 1177 |
| 716 | Ga0495624_0001854 | 3300046690 | Bacteria | 16126 |
| 717 | Ga0495624_0424921 | 3300046690 | Bacteria | 797 |
| 718 | Ga0495670_0012591 | 3300046691 | Bacteria | 4160 |
| 719 | Ga0495670_0025017 | 3300046691 | Bacteria | 2952 |
| 720 | Ga0495670_0160616 | 3300046691 | Bacteria | 1180 |
| 721 | Ga0495671_0038681 | 3300046692 | Bacteria | 2410 |
| 722 | Ga0495671_0159050 | 3300046692 | Bacteria | 1099 |
| 723 | Ga0495671_0264401 | 3300046692 | Bacteria | 829 |
| 724 | Ga0495649_0355860 | 3300046694 | Bacteria | 739 |
| 725 | Ga0495649_0397405 | 3300046694 | Bacteria | 692 |
| 726 | Ga0495589_0104610 | 3300046794 | Bacteria | 1368 |
| 727 | Ga0495589_0118679 | 3300046794 | Bacteria | 1274 |
| 728 | Ga0495600_0064379 | 3300046809 | Bacteria | 2397 |
| 729 | Ga0495660_0083768 | 3300046810 | Bacteria | 1668 |
| 730 | Ga0495660_0113507 | 3300046810 | Bacteria | 1380 |
| 731 | Ga0495581_0323932 | 3300047315 | Bacteria | 900 |
| 732 | Ga0495581_0584952 | 3300047315 | Bacteria | 647 |
| 733 | Ga0495581_0850386 | 3300047315 | Bacteria | 522 |
| 734 | Ga0495604_0321855 | 3300047317 | Bacteria | 1033 |
| 735 | Ga0495604_0388890 | 3300047317 | Bacteria | 920 |
| 736 | Ga0495674_0004710 | 3300047319 | Bacteria | 13122 |
| 737 | Ga0495674_0235964 | 3300047319 | Bacteria | 1508 |
| 738 | Ga0495672_0041351 | 3300047320 | Bacteria | 2789 |
| 739 | Ga0495672_0126634 | 3300047320 | Bacteria | 1350 |
| 740 | Ga0495672_0208956 | 3300047320 | Bacteria | 971 |
| 741 | Ga0495672_0442487 | 3300047320 | Bacteria | 587 |
| 742 | Ga0495676_0008153 | 3300047321 | Bacteria | 9610 |
| 743 | Ga0495676_0055342 | 3300047321 | Bacteria | 3146 |
| 744 | Ga0495680_0158558 | 3300047322 | Bacteria | 1645 |
| 745 | Ga0495675_0735044 | 3300047444 | Bacteria | 550 |
| 746 | Ga0495685_064697 | 3300047447 | Bacteria | 1229 |
| 747 | Ga0495673_0013795 | 3300047469 | Bacteria | 4224 |
| 748 | Ga0495681_0074459 | 3300047470 | Bacteria | 1531 |
| 749 | Ga0495681_0390061 | 3300047470 | Bacteria | 522 |
| 750 | Ga0495684_0011224 | 3300047471 | Bacteria | 6925 |
| 751 | Ga0495686_0057579 | 3300047472 | Bacteria | 2425 |
| 752 | Ga0495686_0333487 | 3300047472 | Bacteria | 828 |
| 753 | Ga0495593_0000481 | 3300047673 | Bacteria | 22413 |
| 754 | Ga0495593_0169061 | 3300047673 | Bacteria | 1102 |
| 755 | Ga0495593_0603206 | 3300047673 | Bacteria | 551 |
| 756 | Ga0495602_0054541 | 3300048088 | Bacteria | 3528 |
| 757 | Ga0495602_0429898 | 3300048088 | Bacteria | 936 |
| 758 | Ga0495602_0529729 | 3300048088 | Bacteria | 819 |
| 759 | Ga0495602_0785887 | 3300048088 | Bacteria | 640 |
| 760 | Ga0495614_0017575 | 3300048089 | Bacteria | 3106 |
| 761 | Ga0495615_0028618 | 3300048090 | Bacteria | 1316 |
| 762 | Ga0495626_0032344 | 3300048091 | Bacteria | 2513 |
| 763 | Ga0496100_0058462 | 3300048903 | Bacteria | 2530 |
| 764 | Ga0496100_0251157 | 3300048903 | Bacteria | 1308 |
| 765 | Ga0496100_0611023 | 3300048903 | Bacteria | 847 |
| 766 | Ga0496100_0651483 | 3300048903 | Bacteria | 820 |
| 767 | Ga0496100_1592339 | 3300048903 | Bacteria | 516 |
| 768 | Ga0496101_0043782 | 3300048904 | Bacteria | 3200 |
| 769 | Ga0496101_0733389 | 3300048904 | Bacteria | 780 |
| 770 | Ga0496102_0069429 | 3300048905 | Bacteria | 3234 |
| 771 | Ga0496102_0234656 | 3300048905 | Bacteria | 1729 |
| 772 | Ga0496102_0280548 | 3300048905 | Bacteria | 1570 |
| 773 | Ga0496102_1068035 | 3300048905 | Bacteria | 727 |
| 774 | Ga0496102_1150558 | 3300048905 | Bacteria | 695 |
| 775 | Ga0496103_0028323 | 3300048906 | Bacteria | 3399 |
| 776 | Ga0496103_0051103 | 3300048906 | Bacteria | 2558 |
| 777 | Ga0496103_0779846 | 3300048906 | Bacteria | 603 |
| 778 | Ga0496104_0075770 | 3300048907 | Bacteria | 3203 |
| 779 | Ga0496104_0077792 | 3300048907 | Bacteria | 3161 |
| 780 | Ga0496104_0079354 | 3300048907 | Bacteria | 3128 |
| 781 | Ga0496104_0648129 | 3300048907 | Bacteria | 965 |
| 782 | Ga0496105_0019080 | 3300048908 | Bacteria | 5526 |
| 783 | Ga0496105_0046648 | 3300048908 | Bacteria | 3576 |
| 784 | Ga0496105_0312470 | 3300048908 | Bacteria | 1261 |
| 785 | Ga0496106_0024683 | 3300048909 | Bacteria | 4471 |
| 786 | Ga0496106_0073135 | 3300048909 | Bacteria | 2622 |
| 787 | Ga0496106_0089373 | 3300048909 | Bacteria | 2375 |
| 788 | Ga0496106_0174208 | 3300048909 | Bacteria | 1706 |
| 789 | Ga0496106_0486683 | 3300048909 | Bacteria | 991 |
| 790 | Ga0496106_0502864 | 3300048909 | Bacteria | 973 |
| 791 | Ga0496107_0026235 | 3300048910 | Bacteria | 4129 |
| 792 | Ga0496107_0591544 | 3300048910 | Bacteria | 820 |
| 793 | Ga0496107_1045338 | 3300048910 | Bacteria | 591 |
| 794 | Ga0496108_0017334 | 3300048911 | Bacteria | 5890 |
| 795 | Ga0496108_0025132 | 3300048911 | Bacteria | 4907 |
| 796 | Ga0496108_0113647 | 3300048911 | Bacteria | 2317 |
| 797 | Ga0496109_0082847 | 3300048912 | Bacteria | 2957 |
| 798 | Ga0496109_0711930 | 3300048912 | Bacteria | 942 |
| 799 | Ga0496110_0007419 | 3300048913 | Bacteria | 8756 |
| 800 | Ga0496110_0025242 | 3300048913 | Bacteria | 5076 |
| 801 | Ga0496110_0227914 | 3300048913 | Bacteria | 1694 |
| 802 | Ga0496110_0327908 | 3300048913 | Bacteria | 1394 |
| 803 | Ga0496111_0149776 | 3300048914 | Bacteria | 1730 |
| 804 | Ga0496111_0179988 | 3300048914 | Bacteria | 1571 |
| 805 | Ga0496111_0317300 | 3300048914 | Bacteria | 1154 |
| 806 | Ga0496111_0428200 | 3300048914 | Bacteria | 977 |
| 807 | Ga0496112_0012429 | 3300048915 | Bacteria | 7827 |
| 808 | Ga0496112_0013478 | 3300048915 | Bacteria | 7548 |
| 809 | Ga0496113_0058911 | 3300048916 | Bacteria | 2891 |
| 810 | Ga0496113_0101602 | 3300048916 | Bacteria | 2229 |
| 811 | Ga0496113_0277194 | 3300048916 | Bacteria | 1340 |
| 812 | Ga0496113_0518721 | 3300048916 | Bacteria | 956 |
| 813 | Ga0496114_0002910 | 3300048917 | Bacteria | 13118 |
| 814 | Ga0496114_0336034 | 3300048917 | Bacteria | 1336 |
| 815 | Ga0496114_0348104 | 3300048917 | Bacteria | 1310 |
| 816 | Ga0496114_0404184 | 3300048917 | Bacteria | 1209 |
| 817 | Ga0496114_1192695 | 3300048917 | Bacteria | 647 |
| 818 | Ga0496114_1312969 | 3300048917 | Bacteria | 610 |
| 819 | Ga0496115_0011971 | 3300048918 | Bacteria | 6518 |
| 820 | Ga0496115_0055681 | 3300048918 | Bacteria | 3177 |
| 821 | Ga0496115_0056553 | 3300048918 | Bacteria | 3153 |
| 822 | Ga0496115_0084225 | 3300048918 | Bacteria | 2592 |
| 823 | Ga0496115_0105999 | 3300048918 | Bacteria | 2307 |
| 824 | Ga0496116_0010029 | 3300048919 | Bacteria | 7990 |
| 825 | Ga0496116_0139548 | 3300048919 | Bacteria | 1366 |
| 826 | Ga0496116_0261328 | 3300048919 | Bacteria | 853 |
| 827 | Ga0496117_0041250 | 3300048920 | Bacteria | 3384 |
| 828 | Ga0496117_0042436 | 3300048920 | Bacteria | 3319 |
| 829 | Ga0496117_0049616 | 3300048920 | Bacteria | 2983 |
| 830 | Ga0496117_0095600 | 3300048920 | Bacteria | 1898 |
| 831 | Ga0496117_0169105 | 3300048920 | Bacteria | 1271 |
| 832 | Ga0496118_0088324 | 3300048921 | Bacteria | 2144 |
| 833 | Ga0496118_0093375 | 3300048921 | Bacteria | 2061 |
| 834 | Ga0496118_0108921 | 3300048921 | Bacteria | 1845 |
| 835 | Ga0496118_0202844 | 3300048921 | Bacteria | 1172 |
| 836 | Ga0496118_0315208 | 3300048921 | Bacteria | 851 |
| 837 | Ga0496119_0119087 | 3300048922 | Bacteria | 1454 |
| 838 | Ga0496119_0161662 | 3300048922 | Bacteria | 1190 |
| 839 | Ga0496119_0256276 | 3300048922 | Bacteria | 880 |
| 840 | Ga0496120_0069814 | 3300048923 | Bacteria | 1934 |
| 841 | Ga0496121_0021536 | 3300048924 | Bacteria | 6308 |
| 842 | Ga0496121_0029380 | 3300048924 | Bacteria | 5084 |
| 843 | Ga0496121_0036768 | 3300048924 | Bacteria | 4358 |
| 844 | Ga0496121_0054773 | 3300048924 | Bacteria | 3329 |
| 845 | Ga0496121_0078393 | 3300048924 | Bacteria | 2626 |
| 846 | Ga0496121_0090891 | 3300048924 | Bacteria | 2385 |
| 847 | Ga0496121_0132894 | 3300048924 | Bacteria | 1859 |
| 848 | Ga0496121_0150187 | 3300048924 | Bacteria | 1715 |
| 849 | Ga0496121_0230802 | 3300048924 | Bacteria | 1296 |
| 850 | Ga0496121_0260930 | 3300048924 | Bacteria | 1196 |
| 851 | Ga0496121_0272816 | 3300048924 | Bacteria | 1161 |
| 852 | Ga0496121_0415061 | 3300048924 | Bacteria | 877 |
| 853 | Ga0496122_0057566 | 3300048925 | Bacteria | 2885 |
| 854 | Ga0496122_0063227 | 3300048925 | Bacteria | 2703 |
| 855 | Ga0496123_0039147 | 3300048926 | Bacteria | 3320 |
| 856 | Ga0496123_0091822 | 3300048926 | Bacteria | 1799 |
| 857 | Ga0496123_0202866 | 3300048926 | Bacteria | 1015 |
| 858 | Ga0496124_0168515 | 3300048927 | Bacteria | 1699 |
| 859 | Ga0496124_0224144 | 3300048927 | Bacteria | 1411 |
| 860 | Ga0496124_0239059 | 3300048927 | Bacteria | 1352 |
| 861 | Ga0496124_0272567 | 3300048927 | Bacteria | 1238 |
| 862 | Ga0496124_0294612 | 3300048927 | Bacteria | 1175 |
| 863 | Ga0496124_0297418 | 3300048927 | Bacteria | 1168 |
| 864 | Ga0496124_0472205 | 3300048927 | Bacteria | 849 |
| 865 | Ga0496124_0476272 | 3300048927 | Bacteria | 844 |
| 866 | Ga0496125_0001626 | 3300048928 | Bacteria | 31655 |
| 867 | Ga0496125_0008236 | 3300048928 | Bacteria | 10953 |
| 868 | Ga0496125_0017706 | 3300048928 | Bacteria | 6782 |
| 869 | Ga0496125_0022912 | 3300048928 | Bacteria | 5785 |
| 870 | Ga0496125_0092356 | 3300048928 | Bacteria | 2263 |
| 871 | Ga0496125_0123949 | 3300048928 | Bacteria | 1836 |
| 872 | Ga0496125_0137094 | 3300048928 | Bacteria | 1709 |
| 873 | Ga0496126_0024468 | 3300048929 | Bacteria | 5830 |
| 874 | Ga0496126_0080538 | 3300048929 | Bacteria | 2882 |
| 875 | Ga0496126_0157128 | 3300048929 | Bacteria | 1945 |
| 876 | Ga0496126_0302057 | 3300048929 | Bacteria | 1320 |
| 877 | Ga0496126_0308671 | 3300048929 | Bacteria | 1303 |
| 878 | Ga0496126_0311675 | 3300048929 | Bacteria | 1295 |
| 879 | Ga0496126_0810501 | 3300048929 | Bacteria | 717 |
| 880 | Ga0496126_1036089 | 3300048929 | Bacteria | 613 |
| 881 | Ga0496126_1289889 | 3300048929 | Bacteria | 532 |
| 882 | Ga0495678_085819 | 3300049459 | Bacteria | 1120 |
| 883 | Ga0495682_0358696 | 3300049460 | Bacteria | 513 |
| 884 | Ga0501033_0009293 | 3300049570 | Bacteria | 7573 |
| 885 | Ga0501036_0664985 | 3300049572 | Bacteria | 862 |
| 886 | Ga0501036_1130074 | 3300049572 | Bacteria | 639 |
| 887 | Ga0501037_0167347 | 3300049573 | Bacteria | 1564 |
| 888 | Ga0501037_0650780 | 3300049573 | Bacteria | 704 |
| 889 | Ga0501037_0717448 | 3300049573 | Bacteria | 664 |
| 890 | Ga0501037_0744407 | 3300049573 | Bacteria | 650 |
| 891 | Ga0501038_0014330 | 3300049574 | Bacteria | 7224 |
| 892 | Ga0501038_0089156 | 3300049574 | Bacteria | 2588 |
| 893 | Ga0501042_0287651 | 3300049578 | Bacteria | 1187 |
| 894 | Ga0501047_0144537 | 3300049581 | Bacteria | 2256 |
| 895 | Ga0501047_0512204 | 3300049581 | Bacteria | 1026 |
| 896 | Ga0501067_0343257 | 3300049583 | Bacteria | 832 |
| 897 | Ga0501070_0040314 | 3300049586 | Bacteria | 3894 |
| 898 | Ga0501072_0012390 | 3300049588 | Bacteria | 6515 |
| 899 | Ga0501072_0917789 | 3300049588 | Bacteria | 684 |
| 900 | Ga0501073_0105524 | 3300049589 | Bacteria | 1955 |
| 901 | Ga0501073_0361359 | 3300049589 | Bacteria | 1003 |
| 902 | Ga0501081_0756140 | 3300049743 | Bacteria | 730 |
| 903 | Ga0501081_1159958 | 3300049743 | Bacteria | 585 |
| 904 | Ga0501083_0126731 | 3300049744 | Bacteria | 1674 |
| 905 | Ga0501044_0057309 | 3300049823 | Bacteria | 3998 |
| 906 | Ga0501044_0072024 | 3300049823 | Bacteria | 3514 |
| 907 | Ga0501044_0317607 | 3300049823 | Bacteria | 1483 |
| 908 | nmdc:mga03683_172340_c1 | 3300050489 | Bacteria | 984 |
| 909 | nmdc:mga03n38_111289_c1 | 3300050490 | Bacteria | 1334 |
| 910 | nmdc:mga03n38_11321_c1 | 3300050490 | Bacteria | 3318 |
| 911 | nmdc:mga03n38_314514_c1 | 3300050490 | Bacteria | 844 |
| 912 | nmdc:mga00v17_121269_c1 | 3300050491 | Bacteria | 1665 |
| 913 | nmdc:mga00v17_184422_c1 | 3300050491 | Bacteria | 1347 |
| 914 | nmdc:mga00v17_246573_c1 | 3300050491 | Bacteria | 1158 |
| 915 | nmdc:mga00v17_5831_c1 | 3300050491 | Bacteria | 6504 |
| 916 | nmdc:mga0yw44_109944_c1 | 3300050492 | Bacteria | 1765 |
| 917 | nmdc:mga0yw44_120592_c1 | 3300050492 | Bacteria | 1689 |
| 918 | nmdc:mga0yw44_136880_c1 | 3300050492 | Bacteria | 1590 |
| 919 | nmdc:mga0yw44_304513_c1 | 3300050492 | Bacteria | 1068 |
| 920 | nmdc:mga0k408_217138_c1 | 3300050493 | Bacteria | 1142 |
| 921 | nmdc:mga0k408_246872_c1 | 3300050493 | Bacteria | 1066 |
| 922 | nmdc:mga0k408_401442_c1 | 3300050493 | Bacteria | 816 |
| 923 | nmdc:mga06z11_114040_c1 | 3300050494 | Bacteria | 1500 |
| 924 | nmdc:mga06z11_141014_c1 | 3300050494 | Bacteria | 1363 |
| 925 | nmdc:mga06z11_306400_c1 | 3300050494 | Bacteria | 945 |
| 926 | nmdc:mga06z11_43113_c1 | 3300050494 | Bacteria | 2268 |
| 927 | nmdc:mga06z11_741_c1 | 3300050494 | Bacteria | 11909 |
| 928 | nmdc:mga04h51_35336_c1 | 3300050495 | Bacteria | 1602 |
| 929 | nmdc:mga04h51_76536_c1 | 3300050495 | Bacteria | 1179 |
| 930 | nmdc:mga04h51_80413_c1 | 3300050495 | Bacteria | 1155 |
| 931 | nmdc:mga04h51_86276_c1 | 3300050495 | Bacteria | 1123 |
| 932 | nmdc:mga07m45_132211_c1 | 3300050496 | Bacteria | 1444 |
| 933 | nmdc:mga07m45_313406_c1 | 3300050496 | Bacteria | 912 |
| 934 | nmdc:mga07m45_66691_c1 | 3300050496 | Bacteria | 2045 |
| 935 | nmdc:mga07m45_77493_c1 | 3300050496 | Bacteria | 1896 |
| 936 | nmdc:mga05p37_276277_c1 | 3300050507 | Bacteria | 2006 |
| 937 | nmdc:mga09592_699481_c1 | 3300050508 | Bacteria | 863 |
| 938 | nmdc:mga08y16_139533_c1 | 3300050511 | Bacteria | 2520 |
| 939 | nmdc:mga0n895_193701_c1 | 3300050512 | Bacteria | 2064 |
| 940 | nmdc:mga0n895_382008_c1 | 3300050512 | Bacteria | 1425 |
| 941 | nmdc:mga0rr50_16434_c1 | 3300050513 | Bacteria | 4916 |
| 942 | nmdc:mga08x19_42743_c1 | 3300050514 | Bacteria | 2890 |
| 943 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 944 | nmdc:mga0sz30_60596_c1 | 3300050516 | Bacteria | 1616 |
| 945 | Ga0495601_0011690 | 3300053077 | Bacteria | 5261 |
| 946 | Ga0495601_0107429 | 3300053077 | Bacteria | 1805 |
| 947 | Ga0495612_0154990 | 3300053078 | Bacteria | 998 |
| 948 | Ga0500610_0113084 | 3300053079 | Bacteria | 1394 |
| 949 | Ga0500635_0002258 | 3300053080 | Bacteria | 4743 |
| 950 | Ga0495655_0008263 | 3300053083 | Bacteria | 1970 |
| 951 | Ga0495655_0224873 | 3300053083 | Bacteria | 622 |
| 952 | Ga0495595_0015650 | 3300053084 | Bacteria | 3236 |
| 953 | Ga0495619_0028557 | 3300053085 | Bacteria | 3599 |
| 954 | Ga0495619_0046476 | 3300053085 | Bacteria | 2854 |
| 955 | Ga0495619_0085770 | 3300053085 | Bacteria | 2127 |
| 956 | Ga0500578_0243714 | 3300053086 | Bacteria | 1085 |
| 957 | Ga0500578_0421519 | 3300053086 | Bacteria | 765 |
| 958 | Ga0500643_011537 | 3300053087 | Bacteria | 3219 |
| 959 | Ga0500643_053658 | 3300053087 | Bacteria | 1146 |
| 960 | Ga0500581_059361 | 3300053089 | Bacteria | 1939 |
| 961 | Ga0500583_0020359 | 3300053092 | Bacteria | 2738 |
| 962 | Ga0500583_0113242 | 3300053092 | Bacteria | 1337 |
| 963 | Ga0500651_0017310 | 3300053093 | Bacteria | 4443 |
| 964 | Ga0500651_0227644 | 3300053093 | Bacteria | 1091 |
| 965 | Ga0500566_0003522 | 3300053094 | Bacteria | 9339 |
| 966 | Ga0500566_0004243 | 3300053094 | Bacteria | 8554 |
| 967 | Ga0500566_0045772 | 3300053094 | Bacteria | 2517 |
| 968 | Ga0500640_015757 | 3300053095 | Bacteria | 3174 |
| 969 | Ga0500641_0110079 | 3300053096 | Bacteria | 1185 |
| 970 | Ga0500641_0186920 | 3300053096 | Bacteria | 888 |
| 971 | Ga0500641_0409145 | 3300053096 | Bacteria | 532 |
| 972 | Ga0500650_0028315 | 3300053098 | Bacteria | 2528 |
| 973 | Ga0500554_038573 | 3300053102 | Bacteria | 1454 |
| 974 | Ga0500556_0000011 | 3300053104 | Bacteria | 253393 |
| 975 | Ga0500556_0204775 | 3300053104 | Bacteria | 779 |
| 976 | Ga0500557_057223 | 3300053105 | Bacteria | 1261 |
| 977 | Ga0500557_174339 | 3300053105 | Bacteria | 701 |
| 978 | Ga0500562_016870 | 3300053108 | Bacteria | 1878 |
| 979 | Ga0500569_005295 | 3300053109 | Bacteria | 2764 |
| 980 | Ga0500572_000463 | 3300053111 | Bacteria | 14085 |
| 981 | Ga0500582_023586 | 3300053114 | Bacteria | 1793 |
| 982 | Ga0500592_000478 | 3300053116 | Bacteria | 6661 |
| 983 | Ga0500592_054724 | 3300053116 | Bacteria | 650 |
| 984 | Ga0500593_010665 | 3300053117 | Bacteria | 3863 |
| 985 | Ga0500593_103072 | 3300053117 | Bacteria | 1187 |
| 986 | Ga0500595_012046 | 3300053119 | Bacteria | 3355 |
| 987 | Ga0500607_045971 | 3300053121 | Bacteria | 2341 |
| 988 | Ga0500608_001779 | 3300053122 | Bacteria | 7697 |
| 989 | Ga0500608_007682 | 3300053122 | Bacteria | 4478 |
| 990 | Ga0500608_257807 | 3300053122 | Bacteria | 675 |
| 991 | Ga0500614_001185 | 3300053123 | Bacteria | 6390 |
| 992 | Ga0500614_040385 | 3300053123 | Bacteria | 1184 |
| 993 | Ga0500618_072359 | 3300053125 | Bacteria | 773 |
| 994 | Ga0500642_0000030 | 3300053130 | Bacteria | 115114 |
| 995 | Ga0500642_0004109 | 3300053130 | Bacteria | 4500 |
| 996 | Ga0500652_000542 | 3300053131 | Bacteria | 13211 |
| 997 | Ga0500658_0029816 | 3300053134 | Bacteria | 2124 |
| 998 | Ga0500658_0115079 | 3300053134 | Bacteria | 1187 |
| 999 | Ga0500658_0133937 | 3300053134 | Bacteria | 1107 |
| 1000 | Ga0500559_0000272 | 3300053136 | Bacteria | 40384 |
| 1001 | Ga0500559_0001304 | 3300053136 | Bacteria | 14396 |
| 1002 | Ga0500559_0044429 | 3300053136 | Bacteria | 1943 |
| 1003 | Ga0500568_0000246 | 3300053139 | Bacteria | 46161 |
| 1004 | Ga0500568_0086735 | 3300053139 | Bacteria | 1183 |
| 1005 | Ga0500568_0230451 | 3300053139 | Bacteria | 676 |
| 1006 | Ga0500577_0000382 | 3300053142 | Bacteria | 11308 |
| 1007 | Ga0500577_0069543 | 3300053142 | Bacteria | 1377 |
| 1008 | Ga0500586_000521 | 3300053145 | Bacteria | 7722 |
| 1009 | Ga0500588_0065705 | 3300053146 | Bacteria | 1175 |
| 1010 | Ga0500588_0150164 | 3300053146 | Bacteria | 842 |
| 1011 | Ga0500589_021101 | 3300053147 | Bacteria | 2983 |
| 1012 | Ga0500590_024521 | 3300053148 | Bacteria | 3131 |
| 1013 | Ga0500590_140130 | 3300053148 | Bacteria | 1106 |
| 1014 | Ga0500603_000142 | 3300053150 | Bacteria | 17305 |
| 1015 | Ga0500603_005139 | 3300053150 | Bacteria | 2806 |
| 1016 | Ga0500603_009208 | 3300053150 | Bacteria | 2205 |
| 1017 | Ga0500604_0016748 | 3300053151 | Bacteria | 2021 |
| 1018 | Ga0500604_0019842 | 3300053151 | Bacteria | 1886 |
| 1019 | Ga0500616_0000026 | 3300053153 | Bacteria | 454314 |
| 1020 | Ga0500616_0312525 | 3300053153 | Bacteria | 649 |
| 1021 | Ga0500620_006506 | 3300053155 | Bacteria | 2808 |
| 1022 | Ga0500622_0004455 | 3300053156 | Bacteria | 8787 |
| 1023 | Ga0500622_0014319 | 3300053156 | Bacteria | 4260 |
| 1024 | Ga0500622_0050483 | 3300053156 | Bacteria | 2143 |
| 1025 | Ga0500627_0048238 | 3300053158 | Bacteria | 1849 |
| 1026 | Ga0500630_011616 | 3300053159 | Bacteria | 4335 |
| 1027 | Ga0500634_0023185 | 3300053161 | Bacteria | 3373 |
| 1028 | Ga0500634_0087074 | 3300053161 | Bacteria | 1595 |
| 1029 | Ga0500638_010149 | 3300053162 | Bacteria | 4108 |
| 1030 | Ga0500638_055515 | 3300053162 | Bacteria | 1909 |
| 1031 | Ga0500639_000217 | 3300053163 | Bacteria | 28559 |
| 1032 | Ga0500639_023025 | 3300053163 | Bacteria | 3290 |
| 1033 | Ga0500639_224567 | 3300053163 | Bacteria | 779 |
| 1034 | Ga0500636_0009756 | 3300053177 | Bacteria | 5592 |
| 1035 | Ga0500636_0022787 | 3300053177 | Bacteria | 3701 |
| 1036 | Ga0500636_0147855 | 3300053177 | Bacteria | 1293 |
| 1037 | Ga0500637_0030787 | 3300053178 | Bacteria | 2988 |
| 1038 | Ga0500567_058777 | 3300053723 | Bacteria | 1729 |
| 1039 | Ga0500576_009243 | 3300053725 | Bacteria | 4319 |
| 1040 | Ga0500645_041308 | 3300053730 | Bacteria | 1362 |
| 1041 | Ga0500645_049796 | 3300053730 | Bacteria | 1224 |
| 1042 | Ga0500596_004450 | 3300053735 | Bacteria | 2566 |
| 1043 | Ga0500596_042555 | 3300053735 | Bacteria | 727 |
| 1044 | Ga0500601_013495 | 3300053737 | Bacteria | 925 |
| 1045 | Ga0501084_0217796 | 3300054114 | Bacteria | 1611 |
| 1046 | Ga0500661_002512 | 3300055283 | Bacteria | 3463 |
| 1047 | Ga0500661_079024 | 3300055283 | Bacteria | 608 |
| 1048 | Ga0590075_199073 | 3300059424 | Bacteria | 530 |
| 1049 | Ga0501082_0435310 | 3300060353 | Bacteria | 1145 |
| 1050 | Ga0466962_0414162 | 3300061719 | Bacteria | 676 |
| 1051 | Ga0530510_1033557 | 3300061734 | Bacteria | 629 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_1053886 | Ga0436363_1053886_58_474 | 138 |
| 2 | 3300046454 | Ga0495592_0905318 | Ga0495592_0905318_89_505 | 138 |
| 3 | 3300046557 | Ga0495622_0071870 | Ga0495622_0071870_1132_1548 | 138 |
| 4 | 3300048903 | Ga0496100_1592339 | Ga0496100_1592339_32_448 | 138 |
| 5 | 3300048924 | Ga0496121_0021536 | Ga0496121_0021536_15_431 | 138 |
| 6 | 3300050493 | nmdc:mga0k408_401442_c1 | nmdc:mga0k408_401442_c1_13_429 | 138 |
| 7 | 3300050496 | nmdc:mga07m45_313406_c1 | nmdc:mga07m45_313406_c1_474_890 | 138 |
| 8 | 3300053083 | Ga0495655_0224873 | Ga0495655_0224873_195_611 | 138 |
| 9 | 3300053105 | Ga0500557_057223 | Ga0500557_057223_835_1251 | 138 |
| 10 | 3300053735 | Ga0500596_042555 | Ga0500596_042555_260_679 | 138 |
| 11 | 3300031235 | Ga0265330_10068015 | Ga0265330_100680153 | 142 |
| 12 | 3300031238 | Ga0265332_10239349 | Ga0265332_102393492 | 142 |
| 13 | 3300031241 | Ga0265325_10056360 | Ga0265325_100563602 | 142 |
| 14 | 3300031344 | Ga0265316_10751967 | Ga0265316_107519671 | 142 |
| 15 | 3300031595 | Ga0265313_10038538 | Ga0265313_100385382 | 142 |
| 16 | 3300005458 | Ga0070681_10641950 | Ga0070681_106419502 | 145 |
| 17 | 3300039447 | Ga0436361_0429619 | Ga0436361_0429619_253_690 | 145 |
| 18 | 3300046455 | Ga0495603_0718349 | Ga0495603_0718349_114_554 | 145 |
| 19 | 3300046523 | Ga0495644_0219953 | Ga0495644_0219953_17_454 | 145 |
| 20 | 3300048909 | Ga0496106_0174208 | Ga0496106_0174208_1251_1688 | 145 |
| 21 | 3300049743 | Ga0501081_1159958 | Ga0501081_1159958_15_455 | 145 |
| 22 | 3300053163 | Ga0500639_224567 | Ga0500639_224567_310_750 | 145 |
| 23 | iso_pu_bacteria | 2906626472 | 2906633031 | 145 |
| 24 | 3300039437 | Ga0436365_1314085 | Ga0436365_1314085_1855_2301 | 146 |
| 25 | 3300005440 | Ga0070705_100469736 | Ga0070705_1004697361 | 150 |
| 26 | 3300005536 | Ga0070697_100000384 | Ga0070697_10000038436 | 150 |
| 27 | 3300005545 | Ga0070695_100016132 | Ga0070695_1000161324 | 150 |
| 28 | 3300006173 | Ga0070716_100135925 | Ga0070716_1001359253 | 150 |
| 29 | 3300006914 | Ga0075436_100000569 | Ga0075436_1000005698 | 150 |
| 30 | 3300007076 | Ga0075435_100015953 | Ga0075435_1000159534 | 150 |
| 31 | 3300025939 | Ga0207665_10040549 | Ga0207665_100405495 | 150 |
| 32 | 3300044694 | Ga0466963_0056480 | Ga0466963_0056480_485_946 | 150 |
| 33 | 3300044842 | Ga0466957_0301379 | Ga0466957_0301379_565_1026 | 150 |
| 34 | 3300045976 | Ga0466967_0034197 | Ga0466967_0034197_1361_1822 | 150 |
| 35 | 3300050513 | nmdc:mga0rr50_16434_c1 | nmdc:mga0rr50_16434_c1_2380_2832 | 150 |
| 36 | 3300050514 | nmdc:mga08x19_6_c1 | nmdc:mga08x19_6_c1_150406_150858 | 150 |
| 37 | 3300005435 | Ga0070714_100055427 | Ga0070714_1000554272 | 151 |
| 38 | 3300005518 | Ga0070699_101554062 | Ga0070699_1015540621 | 151 |
| 39 | 3300006038 | Ga0075365_10053696 | Ga0075365_100536963 | 151 |
| 40 | 3300006042 | Ga0075368_10003871 | Ga0075368_100038713 | 151 |
| 41 | 3300006048 | Ga0075363_100012017 | Ga0075363_1000120173 | 151 |
| 42 | 3300006051 | Ga0075364_10034716 | Ga0075364_100347164 | 151 |
| 43 | 3300006178 | Ga0075367_10015181 | Ga0075367_100151813 | 151 |
| 44 | 3300006178 | Ga0075367_10065607 | Ga0075367_100656073 | 151 |
| 45 | 3300006186 | Ga0075369_10008323 | Ga0075369_100083235 | 151 |
| 46 | 3300006186 | Ga0075369_10210636 | Ga0075369_102106362 | 151 |
| 47 | 3300006195 | Ga0075366_10030117 | Ga0075366_100301173 | 151 |
| 48 | 3300006353 | Ga0075370_10012433 | Ga0075370_100124332 | 151 |
| 49 | 3300027866 | Ga0209813_10081247 | Ga0209813_100812472 | 151 |
| 50 | 3300027866 | Ga0209813_10086754 | Ga0209813_100867542 | 151 |
| 51 | 3300046519 | Ga0495632_0311209 | Ga0495632_0311209_101_568 | 151 |
| 52 | 3300048905 | Ga0496102_1068035 | Ga0496102_1068035_70_564 | 151 |
| 53 | 3300048909 | Ga0496106_0073135 | Ga0496106_0073135_1643_2137 | 151 |
| 54 | 3300048919 | Ga0496116_0010029 | Ga0496116_0010029_4045_4539 | 151 |
| 55 | 3300048920 | Ga0496117_0042436 | Ga0496117_0042436_2612_3106 | 151 |
| 56 | 3300048921 | Ga0496118_0093375 | Ga0496118_0093375_1211_1705 | 151 |
| 57 | 3300048926 | Ga0496123_0091822 | Ga0496123_0091822_177_671 | 151 |
| 58 | 3300048927 | Ga0496124_0476272 | Ga0496124_0476272_134_628 | 151 |
| 59 | 3300048928 | Ga0496125_0017706 | Ga0496125_0017706_1280_1774 | 151 |
| 60 | 3300049589 | Ga0501073_0105524 | Ga0501073_0105524_1232_1699 | 151 |
| 61 | 3300050490 | nmdc:mga03n38_111289_c1 | nmdc:mga03n38_111289_c1_326_793 | 151 |
| 62 | 3300050491 | nmdc:mga00v17_184422_c1 | nmdc:mga00v17_184422_c1_565_1032 | 151 |
| 63 | 3300050491 | nmdc:mga00v17_5831_c1 | nmdc:mga00v17_5831_c1_3883_4377 | 151 |
| 64 | 3300050492 | nmdc:mga0yw44_109944_c1 | nmdc:mga0yw44_109944_c1_1184_1651 | 151 |
| 65 | 3300050493 | nmdc:mga0k408_246872_c1 | nmdc:mga0k408_246872_c1_361_828 | 151 |
| 66 | 3300050494 | nmdc:mga06z11_114040_c1 | nmdc:mga06z11_114040_c1_448_942 | 151 |
| 67 | 3300050494 | nmdc:mga06z11_43113_c1 | nmdc:mga06z11_43113_c1_1691_2158 | 151 |
| 68 | 3300050495 | nmdc:mga04h51_76536_c1 | nmdc:mga04h51_76536_c1_173_667 | 151 |
| 69 | 3300050495 | nmdc:mga04h51_86276_c1 | nmdc:mga04h51_86276_c1_238_705 | 151 |
| 70 | 3300050496 | nmdc:mga07m45_77493_c1 | nmdc:mga07m45_77493_c1_1313_1780 | 151 |
| 71 | 3300050516 | nmdc:mga0sz30_60596_c1 | nmdc:mga0sz30_60596_c1_342_836 | 151 |
| 72 | 3300053134 | Ga0500658_0133937 | Ga0500658_0133937_360_827 | 151 |
| 73 | iso_pu_bacteria | 2922386360 | 2922392782 | 151 |
| 74 | iso_pu_bacteria | 3005483717 | 3005489001 | 151 |
| 75 | iso_pu_bacteria | 3005587118 | 3005593994 | 151 |
| 76 | iso_pu_bacteria | 8056673599 | 8056676927 | 151 |
| 77 | iso_pu_bacteria | 8056689827 | 8056694054 | 151 |
| 78 | 3300036459 | Ga0372808_020118 | Ga0372808_020118_456_938 | 152 |
| 79 | 3300049743 | Ga0501081_0756140 | Ga0501081_0756140_185_643 | 152 |
| 80 | 3300054114 | Ga0501084_0217796 | Ga0501084_0217796_1005_1475 | 152 |
| 81 | iso_pu_bacteria | 2617270741 | 2617377415 | 152 |
| 82 | iso_pu_bacteria | 2721755755 | 2723841881 | 152 |
| 83 | iso_pu_bacteria | 2721755755 | 2723848466 | 152 |
| 84 | iso_pu_bacteria | 2889033259 | 2889036959 | 152 |
| 85 | iso_pu_bacteria | 2922361189 | 2922363646 | 152 |
| 86 | iso_pu_bacteria | 2922386360 | 2922388807 | 152 |
| 87 | iso_pu_bacteria | 8006964411 | 8006969437 | 152 |
| 88 | iso_pu_bacteria | 8006964411 | 8006972733 | 152 |
| 89 | iso_pu_bacteria | 8019555841 | 8019559903 | 152 |
| 90 | iso_pu_bacteria | 8019565922 | 8019570007 | 152 |
| 91 | iso_pu_bacteria | 8056689827 | 8056691879 | 152 |
| 92 | 3300005347 | Ga0070668_101044669 | Ga0070668_1010446691 | 153 |
| 93 | 3300005436 | Ga0070713_100324064 | Ga0070713_1003240642 | 153 |
| 94 | 3300005455 | Ga0070663_100447024 | Ga0070663_1004470242 | 153 |
| 95 | 3300006038 | Ga0075365_10235331 | Ga0075365_102353312 | 153 |
| 96 | 3300006051 | Ga0075364_10286629 | Ga0075364_102866292 | 153 |
| 97 | 3300026067 | Ga0207678_10034872 | Ga0207678_100348722 | 153 |
| 98 | 3300028794 | Ga0307515_10125784 | Ga0307515_101257842 | 153 |
| 99 | 3300045051 | Ga0451576_0068989 | Ga0451576_0068989_2887_3354 | 153 |
| 100 | 3300045051 | Ga0451576_0114449 | Ga0451576_0114449_985_1452 | 153 |
| 101 | 3300046460 | Ga0495638_0025730 | Ga0495638_0025730_2630_3124 | 153 |
| 102 | 3300046501 | Ga0495607_0015387 | Ga0495607_0015387_1972_2466 | 153 |
| 103 | 3300046506 | Ga0495583_0086025 | Ga0495583_0086025_35_529 | 153 |
| 104 | 3300046512 | Ga0495610_0029189 | Ga0495610_0029189_1072_1566 | 153 |
| 105 | 3300046513 | Ga0495616_0069232 | Ga0495616_0069232_430_924 | 153 |
| 106 | 3300046518 | Ga0495631_0043987 | Ga0495631_0043987_160_651 | 153 |
| 107 | 3300046519 | Ga0495632_0030178 | Ga0495632_0030178_1499_1993 | 153 |
| 108 | 3300046522 | Ga0495643_0030807 | Ga0495643_0030807_895_1389 | 153 |
| 109 | 3300046524 | Ga0495648_0049753 | Ga0495648_0049753_160_654 | 153 |
| 110 | 3300046542 | Ga0495597_0046750 | Ga0495597_0046750_1342_1836 | 153 |
| 111 | 3300046665 | Ga0495661_0009160 | Ga0495661_0009160_5307_5801 | 153 |
| 112 | 3300046691 | Ga0495670_0025017 | Ga0495670_0025017_1530_2024 | 153 |
| 113 | 3300046692 | Ga0495671_0038681 | Ga0495671_0038681_42_536 | 153 |
| 114 | 3300046810 | Ga0495660_0083768 | Ga0495660_0083768_945_1439 | 153 |
| 115 | 3300047320 | Ga0495672_0126634 | Ga0495672_0126634_469_966 | 153 |
| 116 | 3300047472 | Ga0495686_0333487 | Ga0495686_0333487_175_669 | 153 |
| 117 | 3300047673 | Ga0495593_0603206 | Ga0495593_0603206_33_524 | 153 |
| 118 | 3300048919 | Ga0496116_0261328 | Ga0496116_0261328_160_654 | 153 |
| 119 | 3300048920 | Ga0496117_0041250 | Ga0496117_0041250_1352_1846 | 153 |
| 120 | 3300048921 | Ga0496118_0088324 | Ga0496118_0088324_1220_1714 | 153 |
| 121 | 3300048923 | Ga0496120_0069814 | Ga0496120_0069814_1195_1689 | 153 |
| 122 | 3300048925 | Ga0496122_0063227 | Ga0496122_0063227_1003_1497 | 153 |
| 123 | 3300048926 | Ga0496123_0039147 | Ga0496123_0039147_1534_2028 | 153 |
| 124 | 3300048928 | Ga0496125_0022912 | Ga0496125_0022912_129_626 | 153 |
| 125 | 3300048929 | Ga0496126_0302057 | Ga0496126_0302057_667_1161 | 153 |
| 126 | 3300049459 | Ga0495678_085819 | Ga0495678_085819_256_750 | 153 |
| 127 | 3300053087 | Ga0500643_011537 | Ga0500643_011537_94_588 | 153 |
| 128 | 3300053089 | Ga0500581_059361 | Ga0500581_059361_751_1242 | 153 |
| 129 | 3300053096 | Ga0500641_0110079 | Ga0500641_0110079_562_1056 | 153 |
| 130 | 3300053098 | Ga0500650_0028315 | Ga0500650_0028315_1606_2100 | 153 |
| 131 | 3300053104 | Ga0500556_0000011 | Ga0500556_0000011_135268_135759 | 153 |
| 132 | 3300053108 | Ga0500562_016870 | Ga0500562_016870_1099_1593 | 153 |
| 133 | 3300053109 | Ga0500569_005295 | Ga0500569_005295_1199_1693 | 153 |
| 134 | 3300053116 | Ga0500592_000478 | Ga0500592_000478_2174_2665 | 153 |
| 135 | 3300053117 | Ga0500593_010665 | Ga0500593_010665_1866_2357 | 153 |
| 136 | 3300053130 | Ga0500642_0000030 | Ga0500642_0000030_36081_36575 | 153 |
| 137 | 3300053131 | Ga0500652_000542 | Ga0500652_000542_10995_11492 | 153 |
| 138 | 3300053134 | Ga0500658_0029816 | Ga0500658_0029816_1502_1996 | 153 |
| 139 | 3300053139 | Ga0500568_0000246 | Ga0500568_0000246_10167_10661 | 153 |
| 140 | 3300053142 | Ga0500577_0069543 | Ga0500577_0069543_181_672 | 153 |
| 141 | 3300053146 | Ga0500588_0150164 | Ga0500588_0150164_93_587 | 153 |
| 142 | 3300053151 | Ga0500604_0016748 | Ga0500604_0016748_390_884 | 153 |
| 143 | 3300053153 | Ga0500616_0000026 | Ga0500616_0000026_212867_213358 | 153 |
| 144 | 3300053156 | Ga0500622_0004455 | Ga0500622_0004455_843_1340 | 153 |
| 145 | 3300053161 | Ga0500634_0023185 | Ga0500634_0023185_2488_2982 | 153 |
| 146 | iso_pu_bacteria | 2889033259 | 2889035208 | 153 |
| 147 | 3300003215 | JGI25153J46596_10016618 | JGI25153J46596_100166181 | 154 |
| 148 | 3300014325 | Ga0163163_10164609 | Ga0163163_101646092 | 154 |
| 149 | 3300025297 | Ga0209758_1003593 | Ga0209758_10035932 | 154 |
| 150 | 3300048906 | Ga0496103_0028323 | Ga0496103_0028323_2587_3054 | 154 |
| 151 | 3300048921 | Ga0496118_0202844 | Ga0496118_0202844_641_1135 | 154 |
| 152 | 3300053121 | Ga0500607_045971 | Ga0500607_045971_1192_1686 | 154 |
| 153 | 3300053136 | Ga0500559_0000272 | Ga0500559_0000272_4521_5015 | 154 |
| 154 | 3300003215 | JGI25153J46596_10005700 | JGI25153J46596_100057002 | 155 |
| 155 | 3300005327 | Ga0070658_10349330 | Ga0070658_103493302 | 155 |
| 156 | 3300005335 | Ga0070666_10302793 | Ga0070666_103027932 | 155 |
| 157 | 3300005344 | Ga0070661_100473914 | Ga0070661_1004739141 | 155 |
| 158 | 3300005366 | Ga0070659_100111198 | Ga0070659_1001111982 | 155 |
| 159 | 3300005435 | Ga0070714_100407177 | Ga0070714_1004071773 | 155 |
| 160 | 3300005548 | Ga0070665_101810541 | Ga0070665_1018105411 | 155 |
| 161 | 3300005563 | Ga0068855_100094616 | Ga0068855_1000946162 | 155 |
| 162 | 3300005564 | Ga0070664_100829001 | Ga0070664_1008290012 | 155 |
| 163 | 3300005578 | Ga0068854_101073385 | Ga0068854_1010733852 | 155 |
| 164 | 3300005614 | Ga0068856_100092169 | Ga0068856_1000921692 | 155 |
| 165 | 3300005616 | Ga0068852_100032359 | Ga0068852_1000323592 | 155 |
| 166 | 3300005840 | Ga0068870_10386111 | Ga0068870_103861111 | 155 |
| 167 | 3300005843 | Ga0068860_101257128 | Ga0068860_1012571282 | 155 |
| 168 | 3300005983 | Ga0081540_1009947 | Ga0081540_10099474 | 155 |
| 169 | 3300005985 | Ga0081539_10055644 | Ga0081539_100556441 | 155 |
| 170 | 3300006028 | Ga0070717_11697386 | Ga0070717_116973861 | 155 |
| 171 | 3300006177 | Ga0075362_10128720 | Ga0075362_101287201 | 155 |
| 172 | 3300006195 | Ga0075366_10270108 | Ga0075366_102701082 | 155 |
| 173 | 3300006353 | Ga0075370_10163329 | Ga0075370_101633292 | 155 |
| 174 | 3300009551 | Ga0105238_10369234 | Ga0105238_103692342 | 155 |
| 175 | 3300025297 | Ga0209758_1013888 | Ga0209758_10138882 | 155 |
| 176 | 3300025903 | Ga0207680_10425102 | Ga0207680_104251022 | 155 |
| 177 | 3300025909 | Ga0207705_10299799 | Ga0207705_102997992 | 155 |
| 178 | 3300025920 | Ga0207649_10284882 | Ga0207649_102848822 | 155 |
| 179 | 3300025929 | Ga0207664_10404642 | Ga0207664_104046421 | 155 |
| 180 | 3300025932 | Ga0207690_10318298 | Ga0207690_103182982 | 155 |
| 181 | 3300025940 | Ga0207691_10451481 | Ga0207691_104514812 | 155 |
| 182 | 3300025949 | Ga0207667_10144533 | Ga0207667_101445332 | 155 |
| 183 | 3300025986 | Ga0207658_11593968 | Ga0207658_115939682 | 155 |
| 184 | 3300026067 | Ga0207678_10221370 | Ga0207678_102213703 | 155 |
| 185 | 3300026078 | Ga0207702_10750891 | Ga0207702_107508911 | 155 |
| 186 | 3300028381 | Ga0268264_10949356 | Ga0268264_109493562 | 155 |
| 187 | 3300031241 | Ga0265325_10040179 | Ga0265325_100401793 | 155 |
| 188 | 3300031247 | Ga0265340_10043557 | Ga0265340_100435573 | 155 |
| 189 | 3300031249 | Ga0265339_10221853 | Ga0265339_102218532 | 155 |
| 190 | 3300031344 | Ga0265316_10055990 | Ga0265316_100559903 | 155 |
| 191 | 3300031711 | Ga0265314_10022217 | Ga0265314_100222173 | 155 |
| 192 | 3300031711 | Ga0265314_10120398 | Ga0265314_101203981 | 155 |
| 193 | 3300031712 | Ga0265342_10110628 | Ga0265342_101106282 | 155 |
| 194 | 3300031731 | Ga0307405_10261428 | Ga0307405_102614282 | 155 |
| 195 | 3300032002 | Ga0307416_100569624 | Ga0307416_1005696243 | 155 |
| 196 | 3300035111 | Ga0373923_0213759 | Ga0373923_0213759_145_630 | 155 |
| 197 | 3300035118 | Ga0373954_0131333 | Ga0373954_0131333_526_996 | 155 |
| 198 | 3300035172 | Ga0373955_0070764 | Ga0373955_0070764_1168_1653 | 155 |
| 199 | 3300035692 | Ga0373935_0322151 | Ga0373935_0322151_423_908 | 155 |
| 200 | 3300035725 | Ga0373947_0027809 | Ga0373947_0027809_2379_2864 | 155 |
| 201 | 3300036401 | Ga0373937_0451735 | Ga0373937_0451735_526_996 | 155 |
| 202 | 3300037853 | Ga0436364_0079550 | Ga0436364_0079550_287_757 | 155 |
| 203 | 3300039437 | Ga0436365_1574673 | Ga0436365_1574673_316_786 | 155 |
| 204 | 3300041413 | Ga0439465_0332166 | Ga0439465_0332166_31_501 | 155 |
| 205 | 3300041463 | Ga0451804_0808098 | Ga0451804_0808098_102_572 | 155 |
| 206 | 3300041491 | Ga0451833_0609030 | Ga0451833_0609030_155_625 | 155 |
| 207 | 3300045976 | Ga0466967_0522965 | Ga0466967_0522965_605_1072 | 155 |
| 208 | 3300046460 | Ga0495638_0341623 | Ga0495638_0341623_176_646 | 155 |
| 209 | 3300046475 | Ga0495639_0443551 | Ga0495639_0443551_164_634 | 155 |
| 210 | 3300046477 | Ga0495664_0362889 | Ga0495664_0362889_52_537 | 155 |
| 211 | 3300046511 | Ga0495608_0157236 | Ga0495608_0157236_289_759 | 155 |
| 212 | 3300046514 | Ga0495618_0610785 | Ga0495618_0610785_29_499 | 155 |
| 213 | 3300046516 | Ga0495628_0892245 | Ga0495628_0892245_102_572 | 155 |
| 214 | 3300046518 | Ga0495631_0430056 | Ga0495631_0430056_20_490 | 155 |
| 215 | 3300046536 | Ga0495587_0111857 | Ga0495587_0111857_902_1372 | 155 |
| 216 | 3300046543 | Ga0495645_0499969 | Ga0495645_0499969_153_623 | 155 |
| 217 | 3300046559 | Ga0495667_0059343 | Ga0495667_0059343_1883_2353 | 155 |
| 218 | 3300046660 | Ga0495625_0355895 | Ga0495625_0355895_18_488 | 155 |
| 219 | 3300046683 | Ga0495658_0352552 | Ga0495658_0352552_119_589 | 155 |
| 220 | 3300046689 | Ga0495613_0272386 | Ga0495613_0272386_22_507 | 155 |
| 221 | 3300047315 | Ga0495581_0584952 | Ga0495581_0584952_69_554 | 155 |
| 222 | 3300047322 | Ga0495680_0158558 | Ga0495680_0158558_233_703 | 155 |
| 223 | 3300048088 | Ga0495602_0054541 | Ga0495602_0054541_1443_1913 | 155 |
| 224 | 3300048091 | Ga0495626_0032344 | Ga0495626_0032344_1581_2069 | 155 |
| 225 | 3300048903 | Ga0496100_0651483 | Ga0496100_0651483_239_709 | 155 |
| 226 | 3300048917 | Ga0496114_0348104 | Ga0496114_0348104_70_540 | 155 |
| 227 | 3300048919 | Ga0496116_0139548 | Ga0496116_0139548_691_1194 | 155 |
| 228 | 3300048920 | Ga0496117_0049616 | Ga0496117_0049616_781_1284 | 155 |
| 229 | 3300048921 | Ga0496118_0108921 | Ga0496118_0108921_794_1297 | 155 |
| 230 | 3300048922 | Ga0496119_0256276 | Ga0496119_0256276_214_717 | 155 |
| 231 | 3300048924 | Ga0496121_0078393 | Ga0496121_0078393_1419_1922 | 155 |
| 232 | 3300048927 | Ga0496124_0297418 | Ga0496124_0297418_295_768 | 155 |
| 233 | 3300048928 | Ga0496125_0123949 | Ga0496125_0123949_88_561 | 155 |
| 234 | 3300049588 | Ga0501072_0012390 | Ga0501072_0012390_1637_2113 | 155 |
| 235 | 3300049588 | Ga0501072_0917789 | Ga0501072_0917789_200_670 | 155 |
| 236 | 3300053094 | Ga0500566_0045772 | Ga0500566_0045772_492_965 | 155 |
| 237 | 3300053148 | Ga0500590_140130 | Ga0500590_140130_261_734 | 155 |
| 238 | 3300053178 | Ga0500637_0030787 | Ga0500637_0030787_2152_2625 | 155 |
| 239 | 3300055283 | Ga0500661_002512 | Ga0500661_002512_723_1196 | 155 |
| 240 | 3300060353 | Ga0501082_0435310 | Ga0501082_0435310_272_748 | 155 |
| 241 | iso_pu_bacteria | 2523231067 | 2523469444 | 155 |
| 242 | 3300001979 | JGI24740J21852_10014484 | JGI24740J21852_100144842 | 156 |
| 243 | 3300001989 | JGI24739J22299_10004030 | JGI24739J22299_100040301 | 156 |
| 244 | 3300001990 | JGI24737J22298_10002056 | JGI24737J22298_100020569 | 156 |
| 245 | 3300001990 | JGI24737J22298_10129081 | JGI24737J22298_101290812 | 156 |
| 246 | 3300002067 | JGI24735J21928_10011719 | JGI24735J21928_100117194 | 156 |
| 247 | 3300002075 | JGI24738J21930_10028233 | JGI24738J21930_100282332 | 156 |
| 248 | 3300002244 | JGI24742J22300_10014917 | JGI24742J22300_100149172 | 156 |
| 249 | 3300003771 | Ga0055526_1034174 | Ga0055526_10341743 | 156 |
| 250 | 3300005327 | Ga0070658_10558937 | Ga0070658_105589371 | 156 |
| 251 | 3300005329 | Ga0070683_100810669 | Ga0070683_1008106691 | 156 |
| 252 | 3300005330 | Ga0070690_100088327 | Ga0070690_1000883273 | 156 |
| 253 | 3300005331 | Ga0070670_100135329 | Ga0070670_1001353293 | 156 |
| 254 | 3300005331 | Ga0070670_101045608 | Ga0070670_1010456081 | 156 |
| 255 | 3300005333 | Ga0070677_10198491 | Ga0070677_101984912 | 156 |
| 256 | 3300005334 | Ga0068869_100191234 | Ga0068869_1001912342 | 156 |
| 257 | 3300005334 | Ga0068869_100305143 | Ga0068869_1003051432 | 156 |
| 258 | 3300005335 | Ga0070666_10287949 | Ga0070666_102879492 | 156 |
| 259 | 3300005335 | Ga0070666_10361107 | Ga0070666_103611072 | 156 |
| 260 | 3300005336 | Ga0070680_100235800 | Ga0070680_1002358001 | 156 |
| 261 | 3300005336 | Ga0070680_100642863 | Ga0070680_1006428632 | 156 |
| 262 | 3300005338 | Ga0068868_100019990 | Ga0068868_1000199902 | 156 |
| 263 | 3300005338 | Ga0068868_100377181 | Ga0068868_1003771812 | 156 |
| 264 | 3300005338 | Ga0068868_100552004 | Ga0068868_1005520042 | 156 |
| 265 | 3300005338 | Ga0068868_100790312 | Ga0068868_1007903122 | 156 |
| 266 | 3300005339 | Ga0070660_100125899 | Ga0070660_1001258992 | 156 |
| 267 | 3300005339 | Ga0070660_100139170 | Ga0070660_1001391702 | 156 |
| 268 | 3300005339 | Ga0070660_100231275 | Ga0070660_1002312752 | 156 |
| 269 | 3300005339 | Ga0070660_101177496 | Ga0070660_1011774962 | 156 |
| 270 | 3300005340 | Ga0070689_100084174 | Ga0070689_1000841742 | 156 |
| 271 | 3300005340 | Ga0070689_100181538 | Ga0070689_1001815382 | 156 |
| 272 | 3300005341 | Ga0070691_10471534 | Ga0070691_104715341 | 156 |
| 273 | 3300005343 | Ga0070687_100320155 | Ga0070687_1003201552 | 156 |
| 274 | 3300005345 | Ga0070692_10106970 | Ga0070692_101069701 | 156 |
| 275 | 3300005347 | Ga0070668_100008596 | Ga0070668_1000085969 | 156 |
| 276 | 3300005347 | Ga0070668_100421026 | Ga0070668_1004210262 | 156 |
| 277 | 3300005354 | Ga0070675_101028955 | Ga0070675_1010289551 | 156 |
| 278 | 3300005356 | Ga0070674_100535367 | Ga0070674_1005353672 | 156 |
| 279 | 3300005364 | Ga0070673_100379822 | Ga0070673_1003798222 | 156 |
| 280 | 3300005365 | Ga0070688_100109281 | Ga0070688_1001092812 | 156 |
| 281 | 3300005365 | Ga0070688_100187705 | Ga0070688_1001877052 | 156 |
| 282 | 3300005365 | Ga0070688_100509894 | Ga0070688_1005098942 | 156 |
| 283 | 3300005366 | Ga0070659_100043012 | Ga0070659_1000430125 | 156 |
| 284 | 3300005366 | Ga0070659_100856234 | Ga0070659_1008562342 | 156 |
| 285 | 3300005367 | Ga0070667_100143679 | Ga0070667_1001436792 | 156 |
| 286 | 3300005406 | Ga0070703_10027610 | Ga0070703_100276102 | 156 |
| 287 | 3300005434 | Ga0070709_10399467 | Ga0070709_103994672 | 156 |
| 288 | 3300005435 | Ga0070714_100002536 | Ga0070714_1000025365 | 156 |
| 289 | 3300005435 | Ga0070714_100680363 | Ga0070714_1006803632 | 156 |
| 290 | 3300005436 | Ga0070713_100003570 | Ga0070713_1000035703 | 156 |
| 291 | 3300005436 | Ga0070713_100783350 | Ga0070713_1007833502 | 156 |
| 292 | 3300005437 | Ga0070710_10002610 | Ga0070710_100026102 | 156 |
| 293 | 3300005437 | Ga0070710_10065506 | Ga0070710_100655063 | 156 |
| 294 | 3300005438 | Ga0070701_10303340 | Ga0070701_103033402 | 156 |
| 295 | 3300005439 | Ga0070711_100018537 | Ga0070711_1000185373 | 156 |
| 296 | 3300005439 | Ga0070711_100190218 | Ga0070711_1001902181 | 156 |
| 297 | 3300005440 | Ga0070705_100572324 | Ga0070705_1005723242 | 156 |
| 298 | 3300005441 | Ga0070700_100147481 | Ga0070700_1001474812 | 156 |
| 299 | 3300005441 | Ga0070700_100490873 | Ga0070700_1004908731 | 156 |
| 300 | 3300005455 | Ga0070663_100191365 | Ga0070663_1001913653 | 156 |
| 301 | 3300005455 | Ga0070663_100200596 | Ga0070663_1002005962 | 156 |
| 302 | 3300005455 | Ga0070663_101083076 | Ga0070663_1010830761 | 156 |
| 303 | 3300005456 | Ga0070678_100035710 | Ga0070678_1000357104 | 156 |
| 304 | 3300005456 | Ga0070678_100060695 | Ga0070678_1000606952 | 156 |
| 305 | 3300005456 | Ga0070678_100179814 | Ga0070678_1001798143 | 156 |
| 306 | 3300005456 | Ga0070678_100269806 | Ga0070678_1002698062 | 156 |
| 307 | 3300005456 | Ga0070678_100328286 | Ga0070678_1003282862 | 156 |
| 308 | 3300005456 | Ga0070678_100412705 | Ga0070678_1004127052 | 156 |
| 309 | 3300005456 | Ga0070678_100424534 | Ga0070678_1004245342 | 156 |
| 310 | 3300005456 | Ga0070678_100533871 | Ga0070678_1005338712 | 156 |
| 311 | 3300005457 | Ga0070662_100068160 | Ga0070662_1000681602 | 156 |
| 312 | 3300005457 | Ga0070662_100741424 | Ga0070662_1007414242 | 156 |
| 313 | 3300005458 | Ga0070681_10170449 | Ga0070681_101704492 | 156 |
| 314 | 3300005466 | Ga0070685_10068454 | Ga0070685_100684543 | 156 |
| 315 | 3300005471 | Ga0070698_100275574 | Ga0070698_1002755743 | 156 |
| 316 | 3300005471 | Ga0070698_100871735 | Ga0070698_1008717352 | 156 |
| 317 | 3300005518 | Ga0070699_100361620 | Ga0070699_1003616202 | 156 |
| 318 | 3300005536 | Ga0070697_100092326 | Ga0070697_1000923262 | 156 |
| 319 | 3300005536 | Ga0070697_100603834 | Ga0070697_1006038342 | 156 |
| 320 | 3300005539 | Ga0068853_100006456 | Ga0068853_1000064567 | 156 |
| 321 | 3300005539 | Ga0068853_100010388 | Ga0068853_1000103885 | 156 |
| 322 | 3300005539 | Ga0068853_100040041 | Ga0068853_1000400412 | 156 |
| 323 | 3300005539 | Ga0068853_100421512 | Ga0068853_1004215122 | 156 |
| 324 | 3300005539 | Ga0068853_100488873 | Ga0068853_1004888732 | 156 |
| 325 | 3300005543 | Ga0070672_100255182 | Ga0070672_1002551822 | 156 |
| 326 | 3300005543 | Ga0070672_100323731 | Ga0070672_1003237313 | 156 |
| 327 | 3300005543 | Ga0070672_100498318 | Ga0070672_1004983182 | 156 |
| 328 | 3300005543 | Ga0070672_100657671 | Ga0070672_1006576712 | 156 |
| 329 | 3300005544 | Ga0070686_100170627 | Ga0070686_1001706272 | 156 |
| 330 | 3300005546 | Ga0070696_100299323 | Ga0070696_1002993232 | 156 |
| 331 | 3300005547 | Ga0070693_100142838 | Ga0070693_1001428383 | 156 |
| 332 | 3300005547 | Ga0070693_100277759 | Ga0070693_1002777591 | 156 |
| 333 | 3300005548 | Ga0070665_100133394 | Ga0070665_1001333942 | 156 |
| 334 | 3300005563 | Ga0068855_100038648 | Ga0068855_1000386483 | 156 |
| 335 | 3300005563 | Ga0068855_100076604 | Ga0068855_1000766042 | 156 |
| 336 | 3300005563 | Ga0068855_100254602 | Ga0068855_1002546022 | 156 |
| 337 | 3300005563 | Ga0068855_100722267 | Ga0068855_1007222671 | 156 |
| 338 | 3300005563 | Ga0068855_101476773 | Ga0068855_1014767731 | 156 |
| 339 | 3300005564 | Ga0070664_100278900 | Ga0070664_1002789002 | 156 |
| 340 | 3300005564 | Ga0070664_100305066 | Ga0070664_1003050662 | 156 |
| 341 | 3300005564 | Ga0070664_100555127 | Ga0070664_1005551272 | 156 |
| 342 | 3300005577 | Ga0068857_100027957 | Ga0068857_1000279573 | 156 |
| 343 | 3300005577 | Ga0068857_100048760 | Ga0068857_1000487602 | 156 |
| 344 | 3300005577 | Ga0068857_100140897 | Ga0068857_1001408972 | 156 |
| 345 | 3300005578 | Ga0068854_100007431 | Ga0068854_1000074317 | 156 |
| 346 | 3300005578 | Ga0068854_100777806 | Ga0068854_1007778062 | 156 |
| 347 | 3300005614 | Ga0068856_100029161 | Ga0068856_1000291612 | 156 |
| 348 | 3300005614 | Ga0068856_100045204 | Ga0068856_1000452042 | 156 |
| 349 | 3300005614 | Ga0068856_100135913 | Ga0068856_1001359132 | 156 |
| 350 | 3300005615 | Ga0070702_100042891 | Ga0070702_1000428912 | 156 |
| 351 | 3300005615 | Ga0070702_100075220 | Ga0070702_1000752202 | 156 |
| 352 | 3300005615 | Ga0070702_100225410 | Ga0070702_1002254102 | 156 |
| 353 | 3300005616 | Ga0068852_100102155 | Ga0068852_1001021552 | 156 |
| 354 | 3300005616 | Ga0068852_100112799 | Ga0068852_1001127992 | 156 |
| 355 | 3300005616 | Ga0068852_100131914 | Ga0068852_1001319144 | 156 |
| 356 | 3300005616 | Ga0068852_100137079 | Ga0068852_1001370792 | 156 |
| 357 | 3300005616 | Ga0068852_100188789 | Ga0068852_1001887892 | 156 |
| 358 | 3300005616 | Ga0068852_100194999 | Ga0068852_1001949991 | 156 |
| 359 | 3300005616 | Ga0068852_100656478 | Ga0068852_1006564782 | 156 |
| 360 | 3300005617 | Ga0068859_100419536 | Ga0068859_1004195362 | 156 |
| 361 | 3300005617 | Ga0068859_100678715 | Ga0068859_1006787153 | 156 |
| 362 | 3300005617 | Ga0068859_100840332 | Ga0068859_1008403322 | 156 |
| 363 | 3300005618 | Ga0068864_100130491 | Ga0068864_1001304913 | 156 |
| 364 | 3300005719 | Ga0068861_100270675 | Ga0068861_1002706752 | 156 |
| 365 | 3300005719 | Ga0068861_100987566 | Ga0068861_1009875662 | 156 |
| 366 | 3300005834 | Ga0068851_10002363 | Ga0068851_100023638 | 156 |
| 367 | 3300005834 | Ga0068851_10059989 | Ga0068851_100599893 | 156 |
| 368 | 3300005840 | Ga0068870_10491058 | Ga0068870_104910582 | 156 |
| 369 | 3300005842 | Ga0068858_100095306 | Ga0068858_1000953062 | 156 |
| 370 | 3300005842 | Ga0068858_100146461 | Ga0068858_1001464612 | 156 |
| 371 | 3300005843 | Ga0068860_100631031 | Ga0068860_1006310312 | 156 |
| 372 | 3300005843 | Ga0068860_100898856 | Ga0068860_1008988562 | 156 |
| 373 | 3300005844 | Ga0068862_100046068 | Ga0068862_1000460682 | 156 |
| 374 | 3300005844 | Ga0068862_100433741 | Ga0068862_1004337412 | 156 |
| 375 | 3300005937 | Ga0081455_10004895 | Ga0081455_100048952 | 156 |
| 376 | 3300005937 | Ga0081455_10028806 | Ga0081455_100288061 | 156 |
| 377 | 3300005937 | Ga0081455_10044688 | Ga0081455_100446882 | 156 |
| 378 | 3300005981 | Ga0081538_10004197 | Ga0081538_100041978 | 156 |
| 379 | 3300005981 | Ga0081538_10010846 | Ga0081538_100108462 | 156 |
| 380 | 3300005983 | Ga0081540_1036194 | Ga0081540_10361943 | 156 |
| 381 | 3300005985 | Ga0081539_10009687 | Ga0081539_100096877 | 156 |
| 382 | 3300006028 | Ga0070717_10005959 | Ga0070717_100059599 | 156 |
| 383 | 3300006038 | Ga0075365_10071356 | Ga0075365_100713564 | 156 |
| 384 | 3300006038 | Ga0075365_10113217 | Ga0075365_101132173 | 156 |
| 385 | 3300006038 | Ga0075365_10317951 | Ga0075365_103179512 | 156 |
| 386 | 3300006038 | Ga0075365_11247432 | Ga0075365_112474321 | 156 |
| 387 | 3300006042 | Ga0075368_10113045 | Ga0075368_101130452 | 156 |
| 388 | 3300006042 | Ga0075368_10217343 | Ga0075368_102173432 | 156 |
| 389 | 3300006048 | Ga0075363_100106657 | Ga0075363_1001066572 | 156 |
| 390 | 3300006051 | Ga0075364_10133291 | Ga0075364_101332912 | 156 |
| 391 | 3300006051 | Ga0075364_10146891 | Ga0075364_101468912 | 156 |
| 392 | 3300006058 | Ga0075432_10051629 | Ga0075432_100516292 | 156 |
| 393 | 3300006163 | Ga0070715_10000598 | Ga0070715_100005988 | 156 |
| 394 | 3300006163 | Ga0070715_10448896 | Ga0070715_104488961 | 156 |
| 395 | 3300006173 | Ga0070716_100012954 | Ga0070716_1000129541 | 156 |
| 396 | 3300006173 | Ga0070716_100046882 | Ga0070716_1000468822 | 156 |
| 397 | 3300006175 | Ga0070712_100020443 | Ga0070712_1000204433 | 156 |
| 398 | 3300006175 | Ga0070712_100057804 | Ga0070712_1000578043 | 156 |
| 399 | 3300006175 | Ga0070712_100126974 | Ga0070712_1001269743 | 156 |
| 400 | 3300006177 | Ga0075362_10149866 | Ga0075362_101498663 | 156 |
| 401 | 3300006178 | Ga0075367_10007569 | Ga0075367_100075692 | 156 |
| 402 | 3300006178 | Ga0075367_10023304 | Ga0075367_100233042 | 156 |
| 403 | 3300006178 | Ga0075367_10194994 | Ga0075367_101949942 | 156 |
| 404 | 3300006186 | Ga0075369_10046833 | Ga0075369_100468333 | 156 |
| 405 | 3300006186 | Ga0075369_10053273 | Ga0075369_100532733 | 156 |
| 406 | 3300006186 | Ga0075369_10485200 | Ga0075369_104852001 | 156 |
| 407 | 3300006195 | Ga0075366_10212951 | Ga0075366_102129512 | 156 |
| 408 | 3300006195 | Ga0075366_10451629 | Ga0075366_104516292 | 156 |
| 409 | 3300006237 | Ga0097621_100065762 | Ga0097621_1000657622 | 156 |
| 410 | 3300006237 | Ga0097621_100361881 | Ga0097621_1003618812 | 156 |
| 411 | 3300006353 | Ga0075370_10072760 | Ga0075370_100727602 | 156 |
| 412 | 3300006353 | Ga0075370_10645190 | Ga0075370_106451902 | 156 |
| 413 | 3300006844 | Ga0075428_100031165 | Ga0075428_1000311652 | 156 |
| 414 | 3300006844 | Ga0075428_100146156 | Ga0075428_1001461563 | 156 |
| 415 | 3300006871 | Ga0075434_100303051 | Ga0075434_1003030512 | 156 |
| 416 | 3300006871 | Ga0075434_101101209 | Ga0075434_1011012092 | 156 |
| 417 | 3300006881 | Ga0068865_100411756 | Ga0068865_1004117562 | 156 |
| 418 | 3300006931 | Ga0097620_100419532 | Ga0097620_1004195322 | 156 |
| 419 | 3300006931 | Ga0097620_100678711 | Ga0097620_1006787113 | 156 |
| 420 | 3300006931 | Ga0097620_100840303 | Ga0097620_1008403032 | 156 |
| 421 | 3300007076 | Ga0075435_100252215 | Ga0075435_1002522152 | 156 |
| 422 | 3300009093 | Ga0105240_10003411 | Ga0105240_100034115 | 156 |
| 423 | 3300009093 | Ga0105240_10015393 | Ga0105240_100153937 | 156 |
| 424 | 3300009093 | Ga0105240_10029865 | Ga0105240_100298652 | 156 |
| 425 | 3300009093 | Ga0105240_10857771 | Ga0105240_108577712 | 156 |
| 426 | 3300009098 | Ga0105245_11776089 | Ga0105245_117760892 | 156 |
| 427 | 3300009101 | Ga0105247_10708510 | Ga0105247_107085102 | 156 |
| 428 | 3300009147 | Ga0114129_10202878 | Ga0114129_102028783 | 156 |
| 429 | 3300009148 | Ga0105243_10116001 | Ga0105243_101160013 | 156 |
| 430 | 3300009148 | Ga0105243_10460636 | Ga0105243_104606362 | 156 |
| 431 | 3300009148 | Ga0105243_10788911 | Ga0105243_107889112 | 156 |
| 432 | 3300009174 | Ga0105241_10002479 | Ga0105241_100024794 | 156 |
| 433 | 3300009174 | Ga0105241_10369543 | Ga0105241_103695431 | 156 |
| 434 | 3300009174 | Ga0105241_10546218 | Ga0105241_105462182 | 156 |
| 435 | 3300009176 | Ga0105242_10317021 | Ga0105242_103170212 | 156 |
| 436 | 3300009176 | Ga0105242_11398900 | Ga0105242_113989002 | 156 |
| 437 | 3300009177 | Ga0105248_10238832 | Ga0105248_102388322 | 156 |
| 438 | 3300009177 | Ga0105248_10679666 | Ga0105248_106796661 | 156 |
| 439 | 3300009545 | Ga0105237_10050884 | Ga0105237_100508843 | 156 |
| 440 | 3300009545 | Ga0105237_10109537 | Ga0105237_101095373 | 156 |
| 441 | 3300009545 | Ga0105237_10348303 | Ga0105237_103483033 | 156 |
| 442 | 3300009545 | Ga0105237_10773650 | Ga0105237_107736502 | 156 |
| 443 | 3300009545 | Ga0105237_11121505 | Ga0105237_111215052 | 156 |
| 444 | 3300009551 | Ga0105238_10005788 | Ga0105238_100057884 | 156 |
| 445 | 3300009551 | Ga0105238_10010373 | Ga0105238_100103735 | 156 |
| 446 | 3300009551 | Ga0105238_10190515 | Ga0105238_101905152 | 156 |
| 447 | 3300009551 | Ga0105238_10749485 | Ga0105238_107494852 | 156 |
| 448 | 3300009553 | Ga0105249_10604954 | Ga0105249_106049541 | 156 |
| 449 | 3300009553 | Ga0105249_10813825 | Ga0105249_108138251 | 156 |
| 450 | 3300009553 | Ga0105249_10816608 | Ga0105249_108166082 | 156 |
| 451 | 3300009553 | Ga0105249_10940915 | Ga0105249_109409152 | 156 |
| 452 | 3300009553 | Ga0105249_11734260 | Ga0105249_117342602 | 156 |
| 453 | 3300010159 | Ga0099796_10015145 | Ga0099796_100151452 | 156 |
| 454 | 3300010159 | Ga0099796_10161445 | Ga0099796_101614451 | 156 |
| 455 | 3300010159 | Ga0099796_10217887 | Ga0099796_102178871 | 156 |
| 456 | 3300010159 | Ga0099796_10300179 | Ga0099796_103001791 | 156 |
| 457 | 3300010375 | Ga0105239_10006751 | Ga0105239_100067515 | 156 |
| 458 | 3300010375 | Ga0105239_10038316 | Ga0105239_100383167 | 156 |
| 459 | 3300010375 | Ga0105239_10052562 | Ga0105239_100525624 | 156 |
| 460 | 3300010375 | Ga0105239_10109955 | Ga0105239_101099552 | 156 |
| 461 | 3300010375 | Ga0105239_10111235 | Ga0105239_101112353 | 156 |
| 462 | 3300010375 | Ga0105239_10534925 | Ga0105239_105349251 | 156 |
| 463 | 3300010375 | Ga0105239_11803139 | Ga0105239_118031392 | 156 |
| 464 | 3300012490 | Ga0157322_1007909 | Ga0157322_10079091 | 156 |
| 465 | 3300013100 | Ga0157373_10107960 | Ga0157373_101079602 | 156 |
| 466 | 3300013102 | Ga0157371_10395319 | Ga0157371_103953192 | 156 |
| 467 | 3300013105 | Ga0157369_10170948 | Ga0157369_101709481 | 156 |
| 468 | 3300013105 | Ga0157369_10216758 | Ga0157369_102167582 | 156 |
| 469 | 3300013105 | Ga0157369_11321370 | Ga0157369_113213701 | 156 |
| 470 | 3300013296 | Ga0157374_10116742 | Ga0157374_101167423 | 156 |
| 471 | 3300013296 | Ga0157374_10614723 | Ga0157374_106147232 | 156 |
| 472 | 3300013306 | Ga0163162_10395168 | Ga0163162_103951682 | 156 |
| 473 | 3300013306 | Ga0163162_11016984 | Ga0163162_110169841 | 156 |
| 474 | 3300013306 | Ga0163162_11022040 | Ga0163162_110220402 | 156 |
| 475 | 3300013307 | Ga0157372_10126018 | Ga0157372_101260184 | 156 |
| 476 | 3300013307 | Ga0157372_10524511 | Ga0157372_105245111 | 156 |
| 477 | 3300013307 | Ga0157372_10849016 | Ga0157372_108490162 | 156 |
| 478 | 3300013308 | Ga0157375_10343143 | Ga0157375_103431433 | 156 |
| 479 | 3300013308 | Ga0157375_10546228 | Ga0157375_105462283 | 156 |
| 480 | 3300013308 | Ga0157375_11723273 | Ga0157375_117232732 | 156 |
| 481 | 3300014325 | Ga0163163_10023747 | Ga0163163_100237472 | 156 |
| 482 | 3300014745 | Ga0157377_10135851 | Ga0157377_101358512 | 156 |
| 483 | 3300014968 | Ga0157379_10469693 | Ga0157379_104696932 | 156 |
| 484 | 3300014968 | Ga0157379_12215248 | Ga0157379_122152481 | 156 |
| 485 | 3300014969 | Ga0157376_10784459 | Ga0157376_107844592 | 156 |
| 486 | 3300017792 | Ga0163161_10615013 | Ga0163161_106150132 | 156 |
| 487 | 3300020081 | Ga0206354_11275229 | Ga0206354_112752291 | 156 |
| 488 | 3300021321 | Ga0214542_1044186 | Ga0214542_10441862 | 156 |
| 489 | 3300021324 | Ga0214545_1000009 | Ga0214545_1000009182 | 156 |
| 490 | 3300021324 | Ga0214545_1000094 | Ga0214545_100009496 | 156 |
| 491 | 3300021384 | Ga0213876_10048881 | Ga0213876_100488812 | 156 |
| 492 | 3300025253 | Ga0209677_107376 | Ga0209677_1073762 | 156 |
| 493 | 3300025261 | Ga0209233_1013039 | Ga0209233_10130392 | 156 |
| 494 | 3300025272 | Ga0209455_1003873 | Ga0209455_10038732 | 156 |
| 495 | 3300025295 | Ga0209564_1002186 | Ga0209564_100218616 | 156 |
| 496 | 3300025297 | Ga0209758_1009747 | Ga0209758_10097478 | 156 |
| 497 | 3300025302 | Ga0207426_1070523 | Ga0207426_10705232 | 156 |
| 498 | 3300025315 | Ga0207697_10027745 | Ga0207697_100277453 | 156 |
| 499 | 3300025321 | Ga0207656_10005300 | Ga0207656_100053002 | 156 |
| 500 | 3300025321 | Ga0207656_10132704 | Ga0207656_101327042 | 156 |
| 501 | 3300025321 | Ga0207656_10145009 | Ga0207656_101450092 | 156 |
| 502 | 3300025885 | Ga0207653_10114445 | Ga0207653_101144452 | 156 |
| 503 | 3300025898 | Ga0207692_10001799 | Ga0207692_100017994 | 156 |
| 504 | 3300025898 | Ga0207692_10031851 | Ga0207692_100318512 | 156 |
| 505 | 3300025899 | Ga0207642_10104301 | Ga0207642_101043012 | 156 |
| 506 | 3300025900 | Ga0207710_10120046 | Ga0207710_101200462 | 156 |
| 507 | 3300025900 | Ga0207710_10182100 | Ga0207710_101821002 | 156 |
| 508 | 3300025900 | Ga0207710_10191977 | Ga0207710_101919772 | 156 |
| 509 | 3300025901 | Ga0207688_10449513 | Ga0207688_104495132 | 156 |
| 510 | 3300025903 | Ga0207680_10381862 | Ga0207680_103818622 | 156 |
| 511 | 3300025903 | Ga0207680_10767300 | Ga0207680_107673001 | 156 |
| 512 | 3300025904 | Ga0207647_10102419 | Ga0207647_101024192 | 156 |
| 513 | 3300025906 | Ga0207699_10002114 | Ga0207699_100021142 | 156 |
| 514 | 3300025906 | Ga0207699_10365270 | Ga0207699_103652702 | 156 |
| 515 | 3300025907 | Ga0207645_10189071 | Ga0207645_101890712 | 156 |
| 516 | 3300025907 | Ga0207645_10197119 | Ga0207645_101971192 | 156 |
| 517 | 3300025907 | Ga0207645_10597451 | Ga0207645_105974512 | 156 |
| 518 | 3300025908 | Ga0207643_10065231 | Ga0207643_100652312 | 156 |
| 519 | 3300025910 | Ga0207684_10198374 | Ga0207684_101983741 | 156 |
| 520 | 3300025911 | Ga0207654_10000488 | Ga0207654_100004883 | 156 |
| 521 | 3300025911 | Ga0207654_10057785 | Ga0207654_100577852 | 156 |
| 522 | 3300025911 | Ga0207654_10288715 | Ga0207654_102887152 | 156 |
| 523 | 3300025912 | Ga0207707_10018804 | Ga0207707_100188042 | 156 |
| 524 | 3300025913 | Ga0207695_10002499 | Ga0207695_1000249920 | 156 |
| 525 | 3300025913 | Ga0207695_10058053 | Ga0207695_100580533 | 156 |
| 526 | 3300025913 | Ga0207695_10409973 | Ga0207695_104099732 | 156 |
| 527 | 3300025913 | Ga0207695_10892444 | Ga0207695_108924441 | 156 |
| 528 | 3300025914 | Ga0207671_10055229 | Ga0207671_100552292 | 156 |
| 529 | 3300025914 | Ga0207671_10121817 | Ga0207671_101218172 | 156 |
| 530 | 3300025914 | Ga0207671_10137048 | Ga0207671_101370483 | 156 |
| 531 | 3300025914 | Ga0207671_10463576 | Ga0207671_104635762 | 156 |
| 532 | 3300025914 | Ga0207671_11299722 | Ga0207671_112997221 | 156 |
| 533 | 3300025915 | Ga0207693_10001912 | Ga0207693_1000191213 | 156 |
| 534 | 3300025915 | Ga0207693_10072112 | Ga0207693_100721123 | 156 |
| 535 | 3300025915 | Ga0207693_10093765 | Ga0207693_100937652 | 156 |
| 536 | 3300025915 | Ga0207693_10455177 | Ga0207693_104551772 | 156 |
| 537 | 3300025916 | Ga0207663_10000468 | Ga0207663_100004686 | 156 |
| 538 | 3300025916 | Ga0207663_10154598 | Ga0207663_101545983 | 156 |
| 539 | 3300025916 | Ga0207663_10257974 | Ga0207663_102579742 | 156 |
| 540 | 3300025917 | Ga0207660_10238664 | Ga0207660_102386641 | 156 |
| 541 | 3300025917 | Ga0207660_10366625 | Ga0207660_103666252 | 156 |
| 542 | 3300025919 | Ga0207657_10233817 | Ga0207657_102338172 | 156 |
| 543 | 3300025921 | Ga0207652_10018004 | Ga0207652_100180043 | 156 |
| 544 | 3300025921 | Ga0207652_10256139 | Ga0207652_102561392 | 156 |
| 545 | 3300025923 | Ga0207681_10458110 | Ga0207681_104581102 | 156 |
| 546 | 3300025923 | Ga0207681_10952791 | Ga0207681_109527911 | 156 |
| 547 | 3300025924 | Ga0207694_10000258 | Ga0207694_1000025846 | 156 |
| 548 | 3300025924 | Ga0207694_10014516 | Ga0207694_100145166 | 156 |
| 549 | 3300025924 | Ga0207694_10022364 | Ga0207694_100223644 | 156 |
| 550 | 3300025924 | Ga0207694_10094707 | Ga0207694_100947073 | 156 |
| 551 | 3300025924 | Ga0207694_10424206 | Ga0207694_104242062 | 156 |
| 552 | 3300025925 | Ga0207650_10504971 | Ga0207650_105049712 | 156 |
| 553 | 3300025925 | Ga0207650_10877158 | Ga0207650_108771582 | 156 |
| 554 | 3300025926 | Ga0207659_10245962 | Ga0207659_102459623 | 156 |
| 555 | 3300025926 | Ga0207659_10532585 | Ga0207659_105325852 | 156 |
| 556 | 3300025927 | Ga0207687_10020017 | Ga0207687_100200172 | 156 |
| 557 | 3300025927 | Ga0207687_10317180 | Ga0207687_103171802 | 156 |
| 558 | 3300025927 | Ga0207687_10738533 | Ga0207687_107385331 | 156 |
| 559 | 3300025928 | Ga0207700_10019468 | Ga0207700_100194683 | 156 |
| 560 | 3300025928 | Ga0207700_11244980 | Ga0207700_112449802 | 156 |
| 561 | 3300025929 | Ga0207664_10040288 | Ga0207664_100402882 | 156 |
| 562 | 3300025929 | Ga0207664_10140530 | Ga0207664_101405301 | 156 |
| 563 | 3300025929 | Ga0207664_10597581 | Ga0207664_105975812 | 156 |
| 564 | 3300025931 | Ga0207644_10308486 | Ga0207644_103084863 | 156 |
| 565 | 3300025933 | Ga0207706_10086261 | Ga0207706_100862612 | 156 |
| 566 | 3300025934 | Ga0207686_10923331 | Ga0207686_109233311 | 156 |
| 567 | 3300025935 | Ga0207709_10167030 | Ga0207709_101670302 | 156 |
| 568 | 3300025935 | Ga0207709_10247442 | Ga0207709_102474422 | 156 |
| 569 | 3300025935 | Ga0207709_10287287 | Ga0207709_102872872 | 156 |
| 570 | 3300025935 | Ga0207709_10660633 | Ga0207709_106606332 | 156 |
| 571 | 3300025936 | Ga0207670_10066434 | Ga0207670_100664343 | 156 |
| 572 | 3300025938 | Ga0207704_10014231 | Ga0207704_100142313 | 156 |
| 573 | 3300025938 | Ga0207704_11148251 | Ga0207704_111482511 | 156 |
| 574 | 3300025939 | Ga0207665_10000791 | Ga0207665_100007919 | 156 |
| 575 | 3300025940 | Ga0207691_10538870 | Ga0207691_105388702 | 156 |
| 576 | 3300025940 | Ga0207691_11005299 | Ga0207691_110052991 | 156 |
| 577 | 3300025941 | Ga0207711_10238277 | Ga0207711_102382772 | 156 |
| 578 | 3300025941 | Ga0207711_11651921 | Ga0207711_116519211 | 156 |
| 579 | 3300025942 | Ga0207689_10237062 | Ga0207689_102370623 | 156 |
| 580 | 3300025942 | Ga0207689_10618340 | Ga0207689_106183402 | 156 |
| 581 | 3300025944 | Ga0207661_10657041 | Ga0207661_106570411 | 156 |
| 582 | 3300025949 | Ga0207667_10007013 | Ga0207667_1000701310 | 156 |
| 583 | 3300025949 | Ga0207667_10009886 | Ga0207667_1000988610 | 156 |
| 584 | 3300025949 | Ga0207667_10010097 | Ga0207667_100100975 | 156 |
| 585 | 3300025949 | Ga0207667_11585982 | Ga0207667_115859822 | 156 |
| 586 | 3300025960 | Ga0207651_10121574 | Ga0207651_101215742 | 156 |
| 587 | 3300025960 | Ga0207651_10510769 | Ga0207651_105107692 | 156 |
| 588 | 3300025961 | Ga0207712_11081005 | Ga0207712_110810052 | 156 |
| 589 | 3300025972 | Ga0207668_10005343 | Ga0207668_100053439 | 156 |
| 590 | 3300025972 | Ga0207668_10045426 | Ga0207668_100454262 | 156 |
| 591 | 3300025972 | Ga0207668_10523470 | Ga0207668_105234702 | 156 |
| 592 | 3300025981 | Ga0207640_10014499 | Ga0207640_100144992 | 156 |
| 593 | 3300025981 | Ga0207640_10019478 | Ga0207640_100194782 | 156 |
| 594 | 3300026023 | Ga0207677_10070393 | Ga0207677_100703933 | 156 |
| 595 | 3300026023 | Ga0207677_10247794 | Ga0207677_102477942 | 156 |
| 596 | 3300026023 | Ga0207677_10777377 | Ga0207677_107773771 | 156 |
| 597 | 3300026035 | Ga0207703_10145874 | Ga0207703_101458743 | 156 |
| 598 | 3300026035 | Ga0207703_10179462 | Ga0207703_101794622 | 156 |
| 599 | 3300026035 | Ga0207703_10689005 | Ga0207703_106890051 | 156 |
| 600 | 3300026035 | Ga0207703_10699017 | Ga0207703_106990172 | 156 |
| 601 | 3300026041 | Ga0207639_10004848 | Ga0207639_100048487 | 156 |
| 602 | 3300026041 | Ga0207639_10005744 | Ga0207639_100057445 | 156 |
| 603 | 3300026041 | Ga0207639_10035786 | Ga0207639_100357862 | 156 |
| 604 | 3300026041 | Ga0207639_10093845 | Ga0207639_100938452 | 156 |
| 605 | 3300026041 | Ga0207639_10686529 | Ga0207639_106865291 | 156 |
| 606 | 3300026067 | Ga0207678_10146025 | Ga0207678_101460252 | 156 |
| 607 | 3300026067 | Ga0207678_10712932 | Ga0207678_107129322 | 156 |
| 608 | 3300026075 | Ga0207708_10281862 | Ga0207708_102818622 | 156 |
| 609 | 3300026078 | Ga0207702_10000006 | Ga0207702_1000000617 | 156 |
| 610 | 3300026088 | Ga0207641_10317453 | Ga0207641_103174532 | 156 |
| 611 | 3300026089 | Ga0207648_10508952 | Ga0207648_105089522 | 156 |
| 612 | 3300026095 | Ga0207676_10056842 | Ga0207676_100568422 | 156 |
| 613 | 3300026095 | Ga0207676_10321145 | Ga0207676_103211452 | 156 |
| 614 | 3300026095 | Ga0207676_10757073 | Ga0207676_107570731 | 156 |
| 615 | 3300026116 | Ga0207674_10023277 | Ga0207674_100232774 | 156 |
| 616 | 3300026116 | Ga0207674_10036549 | Ga0207674_100365493 | 156 |
| 617 | 3300026118 | Ga0207675_100470650 | Ga0207675_1004706501 | 156 |
| 618 | 3300026121 | Ga0207683_10013150 | Ga0207683_100131502 | 156 |
| 619 | 3300026121 | Ga0207683_10063276 | Ga0207683_100632761 | 156 |
| 620 | 3300026121 | Ga0207683_10623762 | Ga0207683_106237622 | 156 |
| 621 | 3300026142 | Ga0207698_10016031 | Ga0207698_100160311 | 156 |
| 622 | 3300026142 | Ga0207698_10149202 | Ga0207698_101492023 | 156 |
| 623 | 3300026142 | Ga0207698_10157168 | Ga0207698_101571681 | 156 |
| 624 | 3300026142 | Ga0207698_10815399 | Ga0207698_108153992 | 156 |
| 625 | 3300027512 | Ga0209179_1005879 | Ga0209179_10058792 | 156 |
| 626 | 3300027866 | Ga0209813_10141147 | Ga0209813_101411472 | 156 |
| 627 | 3300027907 | Ga0207428_10195964 | Ga0207428_101959641 | 156 |
| 628 | 3300028379 | Ga0268266_10080191 | Ga0268266_100801912 | 156 |
| 629 | 3300028379 | Ga0268266_10086045 | Ga0268266_100860452 | 156 |
| 630 | 3300028379 | Ga0268266_10353347 | Ga0268266_103533471 | 156 |
| 631 | 3300028379 | Ga0268266_10529147 | Ga0268266_105291472 | 156 |
| 632 | 3300028379 | Ga0268266_11064957 | Ga0268266_110649571 | 156 |
| 633 | 3300028380 | Ga0268265_10061284 | Ga0268265_100612842 | 156 |
| 634 | 3300028380 | Ga0268265_10121783 | Ga0268265_101217832 | 156 |
| 635 | 3300028380 | Ga0268265_10215400 | Ga0268265_102154003 | 156 |
| 636 | 3300028380 | Ga0268265_10662327 | Ga0268265_106623271 | 156 |
| 637 | 3300028381 | Ga0268264_10284455 | Ga0268264_102844551 | 156 |
| 638 | 3300028381 | Ga0268264_10831907 | Ga0268264_108319072 | 156 |
| 639 | 3300028786 | Ga0307517_10160582 | Ga0307517_101605822 | 156 |
| 640 | 3300028794 | Ga0307515_10060735 | Ga0307515_100607355 | 156 |
| 641 | 3300031249 | Ga0265339_10006205 | Ga0265339_100062057 | 156 |
| 642 | 3300031456 | Ga0307513_10234990 | Ga0307513_102349902 | 156 |
| 643 | 3300031456 | Ga0307513_10395212 | Ga0307513_103952121 | 156 |
| 644 | 3300031456 | Ga0307513_10719133 | Ga0307513_107191331 | 156 |
| 645 | 3300031456 | Ga0307513_10778702 | Ga0307513_107787021 | 156 |
| 646 | 3300031507 | Ga0307509_10323905 | Ga0307509_103239051 | 156 |
| 647 | 3300031507 | Ga0307509_10850076 | Ga0307509_108500761 | 156 |
| 648 | 3300031616 | Ga0307508_10000154 | Ga0307508_1000015463 | 156 |
| 649 | 3300031616 | Ga0307508_10006872 | Ga0307508_1000687213 | 156 |
| 650 | 3300031616 | Ga0307508_10044377 | Ga0307508_100443772 | 156 |
| 651 | 3300031616 | Ga0307508_10050452 | Ga0307508_100504523 | 156 |
| 652 | 3300031616 | Ga0307508_10156036 | Ga0307508_101560362 | 156 |
| 653 | 3300031711 | Ga0265314_10113472 | Ga0265314_101134722 | 156 |
| 654 | 3300031712 | Ga0265342_10004062 | Ga0265342_100040627 | 156 |
| 655 | 3300031712 | Ga0265342_10019741 | Ga0265342_100197413 | 156 |
| 656 | 3300031730 | Ga0307516_10073486 | Ga0307516_100734865 | 156 |
| 657 | 3300031730 | Ga0307516_10384296 | Ga0307516_103842962 | 156 |
| 658 | 3300031730 | Ga0307516_10412146 | Ga0307516_104121462 | 156 |
| 659 | 3300031731 | Ga0307405_10490481 | Ga0307405_104904812 | 156 |
| 660 | 3300031731 | Ga0307405_11504341 | Ga0307405_115043411 | 156 |
| 661 | 3300031911 | Ga0307412_11432364 | Ga0307412_114323641 | 156 |
| 662 | 3300031995 | Ga0307409_100756929 | Ga0307409_1007569291 | 156 |
| 663 | 3300031995 | Ga0307409_100991804 | Ga0307409_1009918041 | 156 |
| 664 | 3300032004 | Ga0307414_10230161 | Ga0307414_102301612 | 156 |
| 665 | 3300032004 | Ga0307414_10521770 | Ga0307414_105217702 | 156 |
| 666 | 3300032126 | Ga0307415_100509834 | Ga0307415_1005098342 | 156 |
| 667 | 3300032126 | Ga0307415_100671707 | Ga0307415_1006717071 | 156 |
| 668 | 3300032126 | Ga0307415_102283177 | Ga0307415_1022831771 | 156 |
| 669 | 3300033180 | Ga0307510_10035129 | Ga0307510_100351298 | 156 |
| 670 | 3300033180 | Ga0307510_10123405 | Ga0307510_101234053 | 156 |
| 671 | 3300033180 | Ga0307510_10296363 | Ga0307510_102963631 | 156 |
| 672 | 3300033546 | Ga0316213_1002512 | Ga0316213_10025122 | 156 |
| 673 | 3300034816 | Ga0373930_0039630 | Ga0373930_0039630_451_924 | 156 |
| 674 | 3300034957 | Ga0373938_0029635 | Ga0373938_0029635_487_957 | 156 |
| 675 | 3300035088 | Ga0373940_0093274 | Ga0373940_0093274_94_564 | 156 |
| 676 | 3300035092 | Ga0373952_0007320 | Ga0373952_0007320_939_1409 | 156 |
| 677 | 3300035112 | Ga0373932_0046080 | Ga0373932_0046080_546_1019 | 156 |
| 678 | 3300035112 | Ga0373932_0342432 | Ga0373932_0342432_15_485 | 156 |
| 679 | 3300035113 | Ga0373936_0004495 | Ga0373936_0004495_2231_2728 | 156 |
| 680 | 3300035113 | Ga0373936_0008591 | Ga0373936_0008591_832_1317 | 156 |
| 681 | 3300035113 | Ga0373936_0183992 | Ga0373936_0183992_142_615 | 156 |
| 682 | 3300035115 | Ga0373941_0050413 | Ga0373941_0050413_475_948 | 156 |
| 683 | 3300035115 | Ga0373941_0395687 | Ga0373941_0395687_77_547 | 156 |
| 684 | 3300035116 | Ga0373945_0013000 | Ga0373945_0013000_468_965 | 156 |
| 685 | 3300035119 | Ga0373956_0031554 | Ga0373956_0031554_1165_1653 | 156 |
| 686 | 3300035120 | Ga0373957_0134480 | Ga0373957_0134480_110_598 | 156 |
| 687 | 3300035170 | Ga0373943_0003586 | Ga0373943_0003586_1191_1688 | 156 |
| 688 | 3300035171 | Ga0373946_0514223 | Ga0373946_0514223_63_536 | 156 |
| 689 | 3300035171 | Ga0373946_0717648 | Ga0373946_0717648_33_506 | 156 |
| 690 | 3300035172 | Ga0373955_0458847 | Ga0373955_0458847_162_632 | 156 |
| 691 | 3300035172 | Ga0373955_0523022 | Ga0373955_0523022_184_654 | 156 |
| 692 | 3300035410 | Ga0373924_0008812 | Ga0373924_0008812_1401_1901 | 156 |
| 693 | 3300035691 | Ga0373931_0000507 | Ga0373931_0000507_8999_9472 | 156 |
| 694 | 3300035691 | Ga0373931_0234557 | Ga0373931_0234557_566_1036 | 156 |
| 695 | 3300035695 | Ga0373927_0003207 | Ga0373927_0003207_1403_1903 | 156 |
| 696 | 3300035695 | Ga0373927_0029468 | Ga0373927_0029468_1818_2288 | 156 |
| 697 | 3300035724 | Ga0373933_0000278 | Ga0373933_0000278_6986_7456 | 156 |
| 698 | 3300036401 | Ga0373937_0040577 | Ga0373937_0040577_1006_1506 | 156 |
| 699 | 3300037068 | Ga0373925_0006083 | Ga0373925_0006083_772_1269 | 156 |
| 700 | 3300037068 | Ga0373925_0278169 | Ga0373925_0278169_133_603 | 156 |
| 701 | 3300037068 | Ga0373925_0587153 | Ga0373925_0587153_282_752 | 156 |
| 702 | 3300037068 | Ga0373925_0649613 | Ga0373925_0649613_58_528 | 156 |
| 703 | 3300037418 | Ga0395900_0134282 | Ga0395900_0134282_642_1112 | 156 |
| 704 | 3300037466 | Ga0395898_0005012 | Ga0395898_0005012_2887_3357 | 156 |
| 705 | 3300037466 | Ga0395898_0443014 | Ga0395898_0443014_271_741 | 156 |
| 706 | 3300038443 | Ga0395901_0153112 | Ga0395901_0153112_744_1214 | 156 |
| 707 | 3300038443 | Ga0395901_0174892 | Ga0395901_0174892_1155_1625 | 156 |
| 708 | 3300038443 | Ga0395901_1754424 | Ga0395901_1754424_85_555 | 156 |
| 709 | 3300039438 | Ga0436360_0641463 | Ga0436360_0641463_172_642 | 156 |
| 710 | 3300039450 | Ga0436363_0241633 | Ga0436363_0241633_326_796 | 156 |
| 711 | 3300039450 | Ga0436363_0444982 | Ga0436363_0444982_12_482 | 156 |
| 712 | 3300041413 | Ga0439465_0037505 | Ga0439465_0037505_1070_1546 | 156 |
| 713 | 3300041413 | Ga0439465_0118360 | Ga0439465_0118360_160_630 | 156 |
| 714 | 3300041451 | Ga0451791_1090847 | Ga0451791_1090847_526_999 | 156 |
| 715 | 3300041451 | Ga0451791_1192174 | Ga0451791_1192174_135_605 | 156 |
| 716 | 3300041459 | Ga0451800_1308288 | Ga0451800_1308288_254_727 | 156 |
| 717 | 3300041507 | Ga0451851_0648074 | Ga0451851_0648074_23_493 | 156 |
| 718 | 3300041512 | Ga0451853_1533967 | Ga0451853_1533967_396_869 | 156 |
| 719 | 3300041512 | Ga0451853_3299164 | Ga0451853_3299164_311_784 | 156 |
| 720 | 3300041997 | Ga0439431_0022287 | Ga0439431_0022287_659_1135 | 156 |
| 721 | 3300042004 | Ga0439445_0045575 | Ga0439445_0045575_642_1112 | 156 |
| 722 | 3300042142 | Ga0450905_028721 | Ga0450905_028721_43_513 | 156 |
| 723 | 3300042435 | Ga0439434_0047398 | Ga0439434_0047398_744_1214 | 156 |
| 724 | 3300042438 | Ga0439459_0006825 | Ga0439459_0006825_575_1048 | 156 |
| 725 | 3300044684 | Ga0466966_0538676 | Ga0466966_0538676_172_648 | 156 |
| 726 | 3300044706 | Ga0466964_0038463 | Ga0466964_0038463_1065_1544 | 156 |
| 727 | 3300044765 | Ga0466970_0487314 | Ga0466970_0487314_196_669 | 156 |
| 728 | 3300044842 | Ga0466957_0249422 | Ga0466957_0249422_384_863 | 156 |
| 729 | 3300044901 | Ga0466960_0674131 | Ga0466960_0674131_129_599 | 156 |
| 730 | 3300045049 | Ga0466959_0234345 | Ga0466959_0234345_237_710 | 156 |
| 731 | 3300045051 | Ga0451576_1808318 | Ga0451576_1808318_105_575 | 156 |
| 732 | 3300045976 | Ga0466967_0944765 | Ga0466967_0944765_242_712 | 156 |
| 733 | 3300046452 | Ga0495617_015362 | Ga0495617_015362_247_720 | 156 |
| 734 | 3300046454 | Ga0495592_0012627 | Ga0495592_0012627_2979_3476 | 156 |
| 735 | 3300046455 | Ga0495603_0001599 | Ga0495603_0001599_11387_11884 | 156 |
| 736 | 3300046455 | Ga0495603_0050821 | Ga0495603_0050821_532_1005 | 156 |
| 737 | 3300046455 | Ga0495603_0205660 | Ga0495603_0205660_241_711 | 156 |
| 738 | 3300046458 | Ga0495591_036772 | Ga0495591_036772_561_1031 | 156 |
| 739 | 3300046459 | Ga0495629_0000314 | Ga0495629_0000314_23186_23686 | 156 |
| 740 | 3300046459 | Ga0495629_0077007 | Ga0495629_0077007_332_802 | 156 |
| 741 | 3300046460 | Ga0495638_0065201 | Ga0495638_0065201_800_1273 | 156 |
| 742 | 3300046461 | Ga0495641_0002314 | Ga0495641_0002314_9324_9821 | 156 |
| 743 | 3300046462 | Ga0495651_0092239 | Ga0495651_0092239_1187_1687 | 156 |
| 744 | 3300046462 | Ga0495651_0139413 | Ga0495651_0139413_324_794 | 156 |
| 745 | 3300046463 | Ga0495653_0034870 | Ga0495653_0034870_3180_3677 | 156 |
| 746 | 3300046463 | Ga0495653_0195948 | Ga0495653_0195948_414_884 | 156 |
| 747 | 3300046463 | Ga0495653_0224516 | Ga0495653_0224516_329_802 | 156 |
| 748 | 3300046472 | Ga0495580_0002541 | Ga0495580_0002541_6439_6939 | 156 |
| 749 | 3300046472 | Ga0495580_0447853 | Ga0495580_0447853_361_831 | 156 |
| 750 | 3300046473 | Ga0495582_0006906 | Ga0495582_0006906_5020_5517 | 156 |
| 751 | 3300046473 | Ga0495582_0204540 | Ga0495582_0204540_293_766 | 156 |
| 752 | 3300046474 | Ga0495605_0124399 | Ga0495605_0124399_504_974 | 156 |
| 753 | 3300046475 | Ga0495639_0017614 | Ga0495639_0017614_2288_2758 | 156 |
| 754 | 3300046476 | Ga0495662_0000638 | Ga0495662_0000638_14471_14968 | 156 |
| 755 | 3300046476 | Ga0495662_0216931 | Ga0495662_0216931_52_525 | 156 |
| 756 | 3300046477 | Ga0495664_0013161 | Ga0495664_0013161_1594_2091 | 156 |
| 757 | 3300046477 | Ga0495664_0070544 | Ga0495664_0070544_833_1303 | 156 |
| 758 | 3300046491 | Ga0495584_0029858 | Ga0495584_0029858_912_1382 | 156 |
| 759 | 3300046491 | Ga0495584_0094580 | Ga0495584_0094580_229_702 | 156 |
| 760 | 3300046491 | Ga0495584_0239778 | Ga0495584_0239778_221_715 | 156 |
| 761 | 3300046492 | Ga0495585_0132551 | Ga0495585_0132551_456_929 | 156 |
| 762 | 3300046499 | Ga0495594_0002386 | Ga0495594_0002386_6055_6552 | 156 |
| 763 | 3300046499 | Ga0495594_0125281 | Ga0495594_0125281_47_517 | 156 |
| 764 | 3300046500 | Ga0495596_0215009 | Ga0495596_0215009_58_531 | 156 |
| 765 | 3300046501 | Ga0495607_0070643 | Ga0495607_0070643_1197_1670 | 156 |
| 766 | 3300046511 | Ga0495608_0268295 | Ga0495608_0268295_152_649 | 156 |
| 767 | 3300046512 | Ga0495610_0134507 | Ga0495610_0134507_153_626 | 156 |
| 768 | 3300046516 | Ga0495628_0014010 | Ga0495628_0014010_2513_3013 | 156 |
| 769 | 3300046517 | Ga0495630_0002415 | Ga0495630_0002415_9575_10075 | 156 |
| 770 | 3300046517 | Ga0495630_0129744 | Ga0495630_0129744_111_581 | 156 |
| 771 | 3300046517 | Ga0495630_0268357 | Ga0495630_0268357_368_841 | 156 |
| 772 | 3300046518 | Ga0495631_0203453 | Ga0495631_0203453_235_705 | 156 |
| 773 | 3300046523 | Ga0495644_0033247 | Ga0495644_0033247_422_895 | 156 |
| 774 | 3300046523 | Ga0495644_0124037 | Ga0495644_0124037_145_615 | 156 |
| 775 | 3300046524 | Ga0495648_0002388 | Ga0495648_0002388_3151_3621 | 156 |
| 776 | 3300046524 | Ga0495648_0028489 | Ga0495648_0028489_2819_3289 | 156 |
| 777 | 3300046524 | Ga0495648_0154277 | Ga0495648_0154277_199_672 | 156 |
| 778 | 3300046525 | Ga0495663_0024099 | Ga0495663_0024099_436_909 | 156 |
| 779 | 3300046526 | Ga0495666_0016798 | Ga0495666_0016798_599_1096 | 156 |
| 780 | 3300046529 | Ga0495652_0108615 | Ga0495652_0108615_167_664 | 156 |
| 781 | 3300046530 | Ga0495654_0196737 | Ga0495654_0196737_193_663 | 156 |
| 782 | 3300046531 | Ga0495665_0001211 | Ga0495665_0001211_1403_1900 | 156 |
| 783 | 3300046531 | Ga0495665_0344056 | Ga0495665_0344056_263_733 | 156 |
| 784 | 3300046533 | Ga0495640_0000308 | Ga0495640_0000308_23380_23880 | 156 |
| 785 | 3300046533 | Ga0495640_0302454 | Ga0495640_0302454_176_649 | 156 |
| 786 | 3300046535 | Ga0495586_0026603 | Ga0495586_0026603_1475_1963 | 156 |
| 787 | 3300046537 | Ga0495598_0009519 | Ga0495598_0009519_1217_1690 | 156 |
| 788 | 3300046538 | Ga0495609_0084307 | Ga0495609_0084307_589_1059 | 156 |
| 789 | 3300046538 | Ga0495609_0103033 | Ga0495609_0103033_339_809 | 156 |
| 790 | 3300046538 | Ga0495609_0200769 | Ga0495609_0200769_304_774 | 156 |
| 791 | 3300046539 | Ga0495621_0031680 | Ga0495621_0031680_673_1143 | 156 |
| 792 | 3300046539 | Ga0495621_0116962 | Ga0495621_0116962_58_531 | 156 |
| 793 | 3300046543 | Ga0495645_0249377 | Ga0495645_0249377_615_1088 | 156 |
| 794 | 3300046543 | Ga0495645_0466506 | Ga0495645_0466506_22_495 | 156 |
| 795 | 3300046557 | Ga0495622_0174901 | Ga0495622_0174901_323_793 | 156 |
| 796 | 3300046557 | Ga0495622_0362936 | Ga0495622_0362936_86_583 | 156 |
| 797 | 3300046558 | Ga0495633_0156261 | Ga0495633_0156261_469_939 | 156 |
| 798 | 3300046559 | Ga0495667_0004819 | Ga0495667_0004819_2739_3239 | 156 |
| 799 | 3300046615 | Ga0495656_0066657 | Ga0495656_0066657_510_983 | 156 |
| 800 | 3300046615 | Ga0495656_0069224 | Ga0495656_0069224_891_1361 | 156 |
| 801 | 3300046615 | Ga0495656_0081697 | Ga0495656_0081697_429_899 | 156 |
| 802 | 3300046615 | Ga0495656_0295093 | Ga0495656_0295093_188_658 | 156 |
| 803 | 3300046642 | Ga0495634_0001740 | Ga0495634_0001740_5387_5884 | 156 |
| 804 | 3300046648 | Ga0495611_0143953 | Ga0495611_0143953_250_729 | 156 |
| 805 | 3300046648 | Ga0495611_0208445 | Ga0495611_0208445_13_486 | 156 |
| 806 | 3300046648 | Ga0495611_0312613 | Ga0495611_0312613_52_522 | 156 |
| 807 | 3300046660 | Ga0495625_0204925 | Ga0495625_0204925_301_771 | 156 |
| 808 | 3300046660 | Ga0495625_0479201 | Ga0495625_0479201_159_629 | 156 |
| 809 | 3300046663 | Ga0495635_0123691 | Ga0495635_0123691_166_699 | 156 |
| 810 | 3300046663 | Ga0495635_0146903 | Ga0495635_0146903_981_1451 | 156 |
| 811 | 3300046663 | Ga0495635_0485421 | Ga0495635_0485421_32_508 | 156 |
| 812 | 3300046665 | Ga0495661_0244073 | Ga0495661_0244073_426_896 | 156 |
| 813 | 3300046674 | Ga0495588_0032601 | Ga0495588_0032601_1994_2464 | 156 |
| 814 | 3300046675 | Ga0495657_0036953 | Ga0495657_0036953_2311_2799 | 156 |
| 815 | 3300046675 | Ga0495657_0112932 | Ga0495657_0112932_487_999 | 156 |
| 816 | 3300046675 | Ga0495657_0307756 | Ga0495657_0307756_183_656 | 156 |
| 817 | 3300046678 | Ga0495599_0835795 | Ga0495599_0835795_17_514 | 156 |
| 818 | 3300046679 | Ga0495623_0145241 | Ga0495623_0145241_164_661 | 156 |
| 819 | 3300046680 | Ga0495646_0011359 | Ga0495646_0011359_4167_4667 | 156 |
| 820 | 3300046680 | Ga0495646_0203373 | Ga0495646_0203373_396_887 | 156 |
| 821 | 3300046680 | Ga0495646_0382475 | Ga0495646_0382475_81_566 | 156 |
| 822 | 3300046680 | Ga0495646_0396963 | Ga0495646_0396963_100_573 | 156 |
| 823 | 3300046681 | Ga0495647_0018313 | Ga0495647_0018313_799_1296 | 156 |
| 824 | 3300046683 | Ga0495658_0003427 | Ga0495658_0003427_5949_6446 | 156 |
| 825 | 3300046684 | Ga0495669_0273973 | Ga0495669_0273973_307_780 | 156 |
| 826 | 3300046684 | Ga0495669_0595724 | Ga0495669_0595724_46_519 | 156 |
| 827 | 3300046689 | Ga0495613_0102117 | Ga0495613_0102117_799_1296 | 156 |
| 828 | 3300046690 | Ga0495624_0001854 | Ga0495624_0001854_135_632 | 156 |
| 829 | 3300046690 | Ga0495624_0424921 | Ga0495624_0424921_89_559 | 156 |
| 830 | 3300046691 | Ga0495670_0012591 | Ga0495670_0012591_291_761 | 156 |
| 831 | 3300046691 | Ga0495670_0160616 | Ga0495670_0160616_203_676 | 156 |
| 832 | 3300046692 | Ga0495671_0159050 | Ga0495671_0159050_90_563 | 156 |
| 833 | 3300046692 | Ga0495671_0264401 | Ga0495671_0264401_146_616 | 156 |
| 834 | 3300046694 | Ga0495649_0355860 | Ga0495649_0355860_208_681 | 156 |
| 835 | 3300046694 | Ga0495649_0397405 | Ga0495649_0397405_21_518 | 156 |
| 836 | 3300046794 | Ga0495589_0104610 | Ga0495589_0104610_746_1216 | 156 |
| 837 | 3300046794 | Ga0495589_0118679 | Ga0495589_0118679_648_1118 | 156 |
| 838 | 3300046809 | Ga0495600_0064379 | Ga0495600_0064379_1885_2376 | 156 |
| 839 | 3300046810 | Ga0495660_0113507 | Ga0495660_0113507_889_1359 | 156 |
| 840 | 3300047315 | Ga0495581_0323932 | Ga0495581_0323932_81_551 | 156 |
| 841 | 3300047315 | Ga0495581_0850386 | Ga0495581_0850386_39_509 | 156 |
| 842 | 3300047317 | Ga0495604_0321855 | Ga0495604_0321855_421_894 | 156 |
| 843 | 3300047317 | Ga0495604_0388890 | Ga0495604_0388890_237_746 | 156 |
| 844 | 3300047319 | Ga0495674_0004710 | Ga0495674_0004710_10076_10573 | 156 |
| 845 | 3300047319 | Ga0495674_0235964 | Ga0495674_0235964_460_930 | 156 |
| 846 | 3300047320 | Ga0495672_0041351 | Ga0495672_0041351_338_850 | 156 |
| 847 | 3300047320 | Ga0495672_0208956 | Ga0495672_0208956_454_930 | 156 |
| 848 | 3300047320 | Ga0495672_0442487 | Ga0495672_0442487_34_504 | 156 |
| 849 | 3300047321 | Ga0495676_0008153 | Ga0495676_0008153_6011_6484 | 156 |
| 850 | 3300047321 | Ga0495676_0055342 | Ga0495676_0055342_1247_1744 | 156 |
| 851 | 3300047444 | Ga0495675_0735044 | Ga0495675_0735044_21_491 | 156 |
| 852 | 3300047447 | Ga0495685_064697 | Ga0495685_064697_568_1041 | 156 |
| 853 | 3300047469 | Ga0495673_0013795 | Ga0495673_0013795_648_1139 | 156 |
| 854 | 3300047470 | Ga0495681_0074459 | Ga0495681_0074459_661_1167 | 156 |
| 855 | 3300047470 | Ga0495681_0390061 | Ga0495681_0390061_17_487 | 156 |
| 856 | 3300047471 | Ga0495684_0011224 | Ga0495684_0011224_1072_1569 | 156 |
| 857 | 3300047472 | Ga0495686_0057579 | Ga0495686_0057579_1152_1631 | 156 |
| 858 | 3300047673 | Ga0495593_0000481 | Ga0495593_0000481_20642_21139 | 156 |
| 859 | 3300047673 | Ga0495593_0169061 | Ga0495593_0169061_449_982 | 156 |
| 860 | 3300048088 | Ga0495602_0429898 | Ga0495602_0429898_345_818 | 156 |
| 861 | 3300048088 | Ga0495602_0529729 | Ga0495602_0529729_189_746 | 156 |
| 862 | 3300048088 | Ga0495602_0785887 | Ga0495602_0785887_94_591 | 156 |
| 863 | 3300048089 | Ga0495614_0017575 | Ga0495614_0017575_2322_2822 | 156 |
| 864 | 3300048090 | Ga0495615_0028618 | Ga0495615_0028618_386_859 | 156 |
| 865 | 3300048903 | Ga0496100_0058462 | Ga0496100_0058462_1075_1548 | 156 |
| 866 | 3300048903 | Ga0496100_0251157 | Ga0496100_0251157_721_1194 | 156 |
| 867 | 3300048903 | Ga0496100_0611023 | Ga0496100_0611023_277_750 | 156 |
| 868 | 3300048904 | Ga0496101_0043782 | Ga0496101_0043782_2305_2778 | 156 |
| 869 | 3300048904 | Ga0496101_0733389 | Ga0496101_0733389_196_666 | 156 |
| 870 | 3300048905 | Ga0496102_0069429 | Ga0496102_0069429_1955_2425 | 156 |
| 871 | 3300048905 | Ga0496102_0234656 | Ga0496102_0234656_214_687 | 156 |
| 872 | 3300048905 | Ga0496102_0280548 | Ga0496102_0280548_321_794 | 156 |
| 873 | 3300048905 | Ga0496102_1150558 | Ga0496102_1150558_204_674 | 156 |
| 874 | 3300048906 | Ga0496103_0051103 | Ga0496103_0051103_167_640 | 156 |
| 875 | 3300048906 | Ga0496103_0779846 | Ga0496103_0779846_115_585 | 156 |
| 876 | 3300048907 | Ga0496104_0075770 | Ga0496104_0075770_2478_2948 | 156 |
| 877 | 3300048907 | Ga0496104_0077792 | Ga0496104_0077792_895_1365 | 156 |
| 878 | 3300048907 | Ga0496104_0079354 | Ga0496104_0079354_1856_2329 | 156 |
| 879 | 3300048907 | Ga0496104_0648129 | Ga0496104_0648129_233_703 | 156 |
| 880 | 3300048908 | Ga0496105_0019080 | Ga0496105_0019080_2716_3189 | 156 |
| 881 | 3300048908 | Ga0496105_0046648 | Ga0496105_0046648_2133_2603 | 156 |
| 882 | 3300048908 | Ga0496105_0312470 | Ga0496105_0312470_765_1235 | 156 |
| 883 | 3300048909 | Ga0496106_0024683 | Ga0496106_0024683_3412_3882 | 156 |
| 884 | 3300048909 | Ga0496106_0089373 | Ga0496106_0089373_1483_1956 | 156 |
| 885 | 3300048909 | Ga0496106_0486683 | Ga0496106_0486683_169_639 | 156 |
| 886 | 3300048909 | Ga0496106_0502864 | Ga0496106_0502864_17_490 | 156 |
| 887 | 3300048910 | Ga0496107_0026235 | Ga0496107_0026235_1534_2007 | 156 |
| 888 | 3300048910 | Ga0496107_0591544 | Ga0496107_0591544_15_488 | 156 |
| 889 | 3300048910 | Ga0496107_1045338 | Ga0496107_1045338_43_516 | 156 |
| 890 | 3300048911 | Ga0496108_0017334 | Ga0496108_0017334_1660_2133 | 156 |
| 891 | 3300048911 | Ga0496108_0025132 | Ga0496108_0025132_2970_3443 | 156 |
| 892 | 3300048911 | Ga0496108_0113647 | Ga0496108_0113647_198_668 | 156 |
| 893 | 3300048912 | Ga0496109_0082847 | Ga0496109_0082847_1039_1509 | 156 |
| 894 | 3300048912 | Ga0496109_0711930 | Ga0496109_0711930_285_755 | 156 |
| 895 | 3300048913 | Ga0496110_0007419 | Ga0496110_0007419_596_1069 | 156 |
| 896 | 3300048913 | Ga0496110_0025242 | Ga0496110_0025242_2537_3007 | 156 |
| 897 | 3300048913 | Ga0496110_0227914 | Ga0496110_0227914_923_1393 | 156 |
| 898 | 3300048913 | Ga0496110_0327908 | Ga0496110_0327908_315_785 | 156 |
| 899 | 3300048914 | Ga0496111_0149776 | Ga0496111_0149776_141_614 | 156 |
| 900 | 3300048914 | Ga0496111_0179988 | Ga0496111_0179988_899_1372 | 156 |
| 901 | 3300048914 | Ga0496111_0317300 | Ga0496111_0317300_563_1033 | 156 |
| 902 | 3300048914 | Ga0496111_0428200 | Ga0496111_0428200_294_767 | 156 |
| 903 | 3300048915 | Ga0496112_0012429 | Ga0496112_0012429_2994_3464 | 156 |
| 904 | 3300048915 | Ga0496112_0013478 | Ga0496112_0013478_3042_3512 | 156 |
| 905 | 3300048916 | Ga0496113_0058911 | Ga0496113_0058911_429_899 | 156 |
| 906 | 3300048916 | Ga0496113_0101602 | Ga0496113_0101602_149_619 | 156 |
| 907 | 3300048916 | Ga0496113_0277194 | Ga0496113_0277194_740_1213 | 156 |
| 908 | 3300048916 | Ga0496113_0518721 | Ga0496113_0518721_12_482 | 156 |
| 909 | 3300048917 | Ga0496114_0002910 | Ga0496114_0002910_7506_7979 | 156 |
| 910 | 3300048917 | Ga0496114_0336034 | Ga0496114_0336034_840_1313 | 156 |
| 911 | 3300048917 | Ga0496114_0404184 | Ga0496114_0404184_467_937 | 156 |
| 912 | 3300048917 | Ga0496114_1192695 | Ga0496114_1192695_99_572 | 156 |
| 913 | 3300048917 | Ga0496114_1312969 | Ga0496114_1312969_130_600 | 156 |
| 914 | 3300048918 | Ga0496115_0011971 | Ga0496115_0011971_1473_1946 | 156 |
| 915 | 3300048918 | Ga0496115_0055681 | Ga0496115_0055681_1034_1504 | 156 |
| 916 | 3300048918 | Ga0496115_0056553 | Ga0496115_0056553_410_880 | 156 |
| 917 | 3300048918 | Ga0496115_0084225 | Ga0496115_0084225_1839_2309 | 156 |
| 918 | 3300048918 | Ga0496115_0105999 | Ga0496115_0105999_234_707 | 156 |
| 919 | 3300048920 | Ga0496117_0095600 | Ga0496117_0095600_410_886 | 156 |
| 920 | 3300048920 | Ga0496117_0169105 | Ga0496117_0169105_173_652 | 156 |
| 921 | 3300048921 | Ga0496118_0315208 | Ga0496118_0315208_49_522 | 156 |
| 922 | 3300048922 | Ga0496119_0119087 | Ga0496119_0119087_364_834 | 156 |
| 923 | 3300048922 | Ga0496119_0161662 | Ga0496119_0161662_405_887 | 156 |
| 924 | 3300048924 | Ga0496121_0029380 | Ga0496121_0029380_449_919 | 156 |
| 925 | 3300048924 | Ga0496121_0036768 | Ga0496121_0036768_675_1154 | 156 |
| 926 | 3300048924 | Ga0496121_0054773 | Ga0496121_0054773_806_1282 | 156 |
| 927 | 3300048924 | Ga0496121_0090891 | Ga0496121_0090891_854_1327 | 156 |
| 928 | 3300048924 | Ga0496121_0132894 | Ga0496121_0132894_1259_1738 | 156 |
| 929 | 3300048924 | Ga0496121_0150187 | Ga0496121_0150187_618_1091 | 156 |
| 930 | 3300048924 | Ga0496121_0230802 | Ga0496121_0230802_154_624 | 156 |
| 931 | 3300048924 | Ga0496121_0260930 | Ga0496121_0260930_592_1071 | 156 |
| 932 | 3300048924 | Ga0496121_0272816 | Ga0496121_0272816_642_1112 | 156 |
| 933 | 3300048924 | Ga0496121_0415061 | Ga0496121_0415061_220_693 | 156 |
| 934 | 3300048925 | Ga0496122_0057566 | Ga0496122_0057566_415_891 | 156 |
| 935 | 3300048926 | Ga0496123_0202866 | Ga0496123_0202866_510_983 | 156 |
| 936 | 3300048927 | Ga0496124_0168515 | Ga0496124_0168515_1185_1673 | 156 |
| 937 | 3300048927 | Ga0496124_0224144 | Ga0496124_0224144_261_740 | 156 |
| 938 | 3300048927 | Ga0496124_0239059 | Ga0496124_0239059_770_1240 | 156 |
| 939 | 3300048927 | Ga0496124_0272567 | Ga0496124_0272567_123_593 | 156 |
| 940 | 3300048927 | Ga0496124_0294612 | Ga0496124_0294612_553_1023 | 156 |
| 941 | 3300048927 | Ga0496124_0472205 | Ga0496124_0472205_218_697 | 156 |
| 942 | 3300048928 | Ga0496125_0001626 | Ga0496125_0001626_6472_6948 | 156 |
| 943 | 3300048928 | Ga0496125_0008236 | Ga0496125_0008236_7356_7832 | 156 |
| 944 | 3300048928 | Ga0496125_0092356 | Ga0496125_0092356_312_791 | 156 |
| 945 | 3300048928 | Ga0496125_0137094 | Ga0496125_0137094_611_1081 | 156 |
| 946 | 3300048929 | Ga0496126_0024468 | Ga0496126_0024468_5242_5718 | 156 |
| 947 | 3300048929 | Ga0496126_0080538 | Ga0496126_0080538_280_750 | 156 |
| 948 | 3300048929 | Ga0496126_0157128 | Ga0496126_0157128_1088_1567 | 156 |
| 949 | 3300048929 | Ga0496126_0308671 | Ga0496126_0308671_341_811 | 156 |
| 950 | 3300048929 | Ga0496126_0311675 | Ga0496126_0311675_723_1193 | 156 |
| 951 | 3300048929 | Ga0496126_0810501 | Ga0496126_0810501_141_614 | 156 |
| 952 | 3300048929 | Ga0496126_1036089 | Ga0496126_1036089_92_568 | 156 |
| 953 | 3300048929 | Ga0496126_1289889 | Ga0496126_1289889_11_484 | 156 |
| 954 | 3300049460 | Ga0495682_0358696 | Ga0495682_0358696_18_491 | 156 |
| 955 | 3300049570 | Ga0501033_0009293 | Ga0501033_0009293_5003_5473 | 156 |
| 956 | 3300049572 | Ga0501036_0664985 | Ga0501036_0664985_37_522 | 156 |
| 957 | 3300049572 | Ga0501036_1130074 | Ga0501036_1130074_95_565 | 156 |
| 958 | 3300049573 | Ga0501037_0167347 | Ga0501037_0167347_525_995 | 156 |
| 959 | 3300049573 | Ga0501037_0650780 | Ga0501037_0650780_134_604 | 156 |
| 960 | 3300049573 | Ga0501037_0717448 | Ga0501037_0717448_91_564 | 156 |
| 961 | 3300049573 | Ga0501037_0744407 | Ga0501037_0744407_31_516 | 156 |
| 962 | 3300049574 | Ga0501038_0014330 | Ga0501038_0014330_6374_6859 | 156 |
| 963 | 3300049574 | Ga0501038_0089156 | Ga0501038_0089156_485_955 | 156 |
| 964 | 3300049578 | Ga0501042_0287651 | Ga0501042_0287651_21_491 | 156 |
| 965 | 3300049581 | Ga0501047_0144537 | Ga0501047_0144537_159_644 | 156 |
| 966 | 3300049581 | Ga0501047_0512204 | Ga0501047_0512204_233_718 | 156 |
| 967 | 3300049583 | Ga0501067_0343257 | Ga0501067_0343257_264_737 | 156 |
| 968 | 3300049586 | Ga0501070_0040314 | Ga0501070_0040314_2576_3061 | 156 |
| 969 | 3300049589 | Ga0501073_0361359 | Ga0501073_0361359_29_502 | 156 |
| 970 | 3300049744 | Ga0501083_0126731 | Ga0501083_0126731_148_618 | 156 |
| 971 | 3300049823 | Ga0501044_0057309 | Ga0501044_0057309_418_891 | 156 |
| 972 | 3300049823 | Ga0501044_0072024 | Ga0501044_0072024_2321_2806 | 156 |
| 973 | 3300049823 | Ga0501044_0317607 | Ga0501044_0317607_385_870 | 156 |
| 974 | 3300050489 | nmdc:mga03683_172340_c1 | nmdc:mga03683_172340_c1_504_974 | 156 |
| 975 | 3300050490 | nmdc:mga03n38_11321_c1 | nmdc:mga03n38_11321_c1_1008_1478 | 156 |
| 976 | 3300050490 | nmdc:mga03n38_314514_c1 | nmdc:mga03n38_314514_c1_354_824 | 156 |
| 977 | 3300050491 | nmdc:mga00v17_121269_c1 | nmdc:mga00v17_121269_c1_812_1285 | 156 |
| 978 | 3300050491 | nmdc:mga00v17_246573_c1 | nmdc:mga00v17_246573_c1_652_1122 | 156 |
| 979 | 3300050492 | nmdc:mga0yw44_120592_c1 | nmdc:mga0yw44_120592_c1_323_796 | 156 |
| 980 | 3300050492 | nmdc:mga0yw44_136880_c1 | nmdc:mga0yw44_136880_c1_439_909 | 156 |
| 981 | 3300050492 | nmdc:mga0yw44_304513_c1 | nmdc:mga0yw44_304513_c1_583_1053 | 156 |
| 982 | 3300050493 | nmdc:mga0k408_217138_c1 | nmdc:mga0k408_217138_c1_661_1131 | 156 |
| 983 | 3300050494 | nmdc:mga06z11_141014_c1 | nmdc:mga06z11_141014_c1_165_638 | 156 |
| 984 | 3300050494 | nmdc:mga06z11_306400_c1 | nmdc:mga06z11_306400_c1_335_805 | 156 |
| 985 | 3300050494 | nmdc:mga06z11_741_c1 | nmdc:mga06z11_741_c1_5480_5950 | 156 |
| 986 | 3300050495 | nmdc:mga04h51_35336_c1 | nmdc:mga04h51_35336_c1_186_659 | 156 |
| 987 | 3300050495 | nmdc:mga04h51_80413_c1 | nmdc:mga04h51_80413_c1_212_682 | 156 |
| 988 | 3300050496 | nmdc:mga07m45_132211_c1 | nmdc:mga07m45_132211_c1_58_531 | 156 |
| 989 | 3300050496 | nmdc:mga07m45_66691_c1 | nmdc:mga07m45_66691_c1_1386_1856 | 156 |
| 990 | 3300050507 | nmdc:mga05p37_276277_c1 | nmdc:mga05p37_276277_c1_1069_1539 | 156 |
| 991 | 3300050508 | nmdc:mga09592_699481_c1 | nmdc:mga09592_699481_c1_378_848 | 156 |
| 992 | 3300050511 | nmdc:mga08y16_139533_c1 | nmdc:mga08y16_139533_c1_155_625 | 156 |
| 993 | 3300050512 | nmdc:mga0n895_193701_c1 | nmdc:mga0n895_193701_c1_886_1356 | 156 |
| 994 | 3300050512 | nmdc:mga0n895_382008_c1 | nmdc:mga0n895_382008_c1_722_1192 | 156 |
| 995 | 3300050514 | nmdc:mga08x19_42743_c1 | nmdc:mga08x19_42743_c1_773_1243 | 156 |
| 996 | 3300053077 | Ga0495601_0011690 | Ga0495601_0011690_1061_1531 | 156 |
| 997 | 3300053077 | Ga0495601_0107429 | Ga0495601_0107429_477_947 | 156 |
| 998 | 3300053078 | Ga0495612_0154990 | Ga0495612_0154990_302_790 | 156 |
| 999 | 3300053079 | Ga0500610_0113084 | Ga0500610_0113084_529_999 | 156 |
| 1000 | 3300053080 | Ga0500635_0002258 | Ga0500635_0002258_2533_3003 | 156 |
| 1001 | 3300053083 | Ga0495655_0008263 | Ga0495655_0008263_813_1286 | 156 |
| 1002 | 3300053084 | Ga0495595_0015650 | Ga0495595_0015650_170_643 | 156 |
| 1003 | 3300053085 | Ga0495619_0028557 | Ga0495619_0028557_360_857 | 156 |
| 1004 | 3300053085 | Ga0495619_0046476 | Ga0495619_0046476_1661_2131 | 156 |
| 1005 | 3300053085 | Ga0495619_0085770 | Ga0495619_0085770_1478_1951 | 156 |
| 1006 | 3300053086 | Ga0500578_0243714 | Ga0500578_0243714_424_933 | 156 |
| 1007 | 3300053086 | Ga0500578_0421519 | Ga0500578_0421519_247_717 | 156 |
| 1008 | 3300053087 | Ga0500643_053658 | Ga0500643_053658_91_564 | 156 |
| 1009 | 3300053092 | Ga0500583_0020359 | Ga0500583_0020359_804_1307 | 156 |
| 1010 | 3300053092 | Ga0500583_0113242 | Ga0500583_0113242_718_1188 | 156 |
| 1011 | 3300053093 | Ga0500651_0017310 | Ga0500651_0017310_236_745 | 156 |
| 1012 | 3300053093 | Ga0500651_0227644 | Ga0500651_0227644_375_866 | 156 |
| 1013 | 3300053094 | Ga0500566_0003522 | Ga0500566_0003522_3392_3883 | 156 |
| 1014 | 3300053094 | Ga0500566_0004243 | Ga0500566_0004243_7934_8419 | 156 |
| 1015 | 3300053095 | Ga0500640_015757 | Ga0500640_015757_1725_2195 | 156 |
| 1016 | 3300053096 | Ga0500641_0186920 | Ga0500641_0186920_55_564 | 156 |
| 1017 | 3300053096 | Ga0500641_0409145 | Ga0500641_0409145_47_520 | 156 |
| 1018 | 3300053102 | Ga0500554_038573 | Ga0500554_038573_536_1012 | 156 |
| 1019 | 3300053104 | Ga0500556_0204775 | Ga0500556_0204775_68_583 | 156 |
| 1020 | 3300053105 | Ga0500557_174339 | Ga0500557_174339_73_543 | 156 |
| 1021 | 3300053111 | Ga0500572_000463 | Ga0500572_000463_713_1183 | 156 |
| 1022 | 3300053114 | Ga0500582_023586 | Ga0500582_023586_663_1133 | 156 |
| 1023 | 3300053116 | Ga0500592_054724 | Ga0500592_054724_136_606 | 156 |
| 1024 | 3300053117 | Ga0500593_103072 | Ga0500593_103072_371_841 | 156 |
| 1025 | 3300053119 | Ga0500595_012046 | Ga0500595_012046_101_577 | 156 |
| 1026 | 3300053122 | Ga0500608_001779 | Ga0500608_001779_5614_6105 | 156 |
| 1027 | 3300053122 | Ga0500608_007682 | Ga0500608_007682_3146_3616 | 156 |
| 1028 | 3300053122 | Ga0500608_257807 | Ga0500608_257807_33_509 | 156 |
| 1029 | 3300053123 | Ga0500614_001185 | Ga0500614_001185_158_628 | 156 |
| 1030 | 3300053123 | Ga0500614_040385 | Ga0500614_040385_403_873 | 156 |
| 1031 | 3300053125 | Ga0500618_072359 | Ga0500618_072359_32_523 | 156 |
| 1032 | 3300053130 | Ga0500642_0004109 | Ga0500642_0004109_1028_1537 | 156 |
| 1033 | 3300053134 | Ga0500658_0115079 | Ga0500658_0115079_536_1009 | 156 |
| 1034 | 3300053136 | Ga0500559_0001304 | Ga0500559_0001304_12679_13149 | 156 |
| 1035 | 3300053136 | Ga0500559_0044429 | Ga0500559_0044429_1428_1898 | 156 |
| 1036 | 3300053139 | Ga0500568_0086735 | Ga0500568_0086735_14_529 | 156 |
| 1037 | 3300053139 | Ga0500568_0230451 | Ga0500568_0230451_120_593 | 156 |
| 1038 | 3300053142 | Ga0500577_0000382 | Ga0500577_0000382_5766_6236 | 156 |
| 1039 | 3300053145 | Ga0500586_000521 | Ga0500586_000521_5512_6006 | 156 |
| 1040 | 3300053146 | Ga0500588_0065705 | Ga0500588_0065705_640_1149 | 156 |
| 1041 | 3300053147 | Ga0500589_021101 | Ga0500589_021101_1063_1533 | 156 |
| 1042 | 3300053148 | Ga0500590_024521 | Ga0500590_024521_2356_2847 | 156 |
| 1043 | 3300053150 | Ga0500603_000142 | Ga0500603_000142_15061_15531 | 156 |
| 1044 | 3300053150 | Ga0500603_005139 | Ga0500603_005139_146_631 | 156 |
| 1045 | 3300053150 | Ga0500603_009208 | Ga0500603_009208_85_561 | 156 |
| 1046 | 3300053151 | Ga0500604_0019842 | Ga0500604_0019842_1099_1572 | 156 |
| 1047 | 3300053153 | Ga0500616_0312525 | Ga0500616_0312525_23_538 | 156 |
| 1048 | 3300053155 | Ga0500620_006506 | Ga0500620_006506_1202_1675 | 156 |
| 1049 | 3300053156 | Ga0500622_0014319 | Ga0500622_0014319_87_557 | 156 |
| 1050 | 3300053156 | Ga0500622_0050483 | Ga0500622_0050483_1060_1569 | 156 |
| 1051 | 3300053158 | Ga0500627_0048238 | Ga0500627_0048238_791_1279 | 156 |
| 1052 | 3300053159 | Ga0500630_011616 | Ga0500630_011616_1933_2418 | 156 |
| 1053 | 3300053161 | Ga0500634_0087074 | Ga0500634_0087074_254_760 | 156 |
| 1054 | 3300053162 | Ga0500638_010149 | Ga0500638_010149_1481_1957 | 156 |
| 1055 | 3300053162 | Ga0500638_055515 | Ga0500638_055515_247_726 | 156 |
| 1056 | 3300053163 | Ga0500639_000217 | Ga0500639_000217_27556_28026 | 156 |
| 1057 | 3300053163 | Ga0500639_023025 | Ga0500639_023025_1571_2041 | 156 |
| 1058 | 3300053177 | Ga0500636_0009756 | Ga0500636_0009756_4573_5064 | 156 |
| 1059 | 3300053177 | Ga0500636_0022787 | Ga0500636_0022787_324_797 | 156 |
| 1060 | 3300053177 | Ga0500636_0147855 | Ga0500636_0147855_324_800 | 156 |
| 1061 | 3300053723 | Ga0500567_058777 | Ga0500567_058777_442_936 | 156 |
| 1062 | 3300053725 | Ga0500576_009243 | Ga0500576_009243_1600_2070 | 156 |
| 1063 | 3300053730 | Ga0500645_041308 | Ga0500645_041308_380_850 | 156 |
| 1064 | 3300053730 | Ga0500645_049796 | Ga0500645_049796_706_1176 | 156 |
| 1065 | 3300053735 | Ga0500596_004450 | Ga0500596_004450_527_997 | 156 |
| 1066 | 3300053737 | Ga0500601_013495 | Ga0500601_013495_169_639 | 156 |
| 1067 | 3300055283 | Ga0500661_079024 | Ga0500661_079024_120_593 | 156 |
| 1068 | 3300059424 | Ga0590075_199073 | Ga0590075_199073_36_509 | 156 |
| 1069 | 3300061719 | Ga0466962_0414162 | Ga0466962_0414162_64_543 | 156 |
| 1070 | 3300061734 | Ga0530510_1033557 | Ga0530510_1033557_11_481 | 156 |
| 1071 | iso_pu_bacteria | 2602042107 | 2603861925 | 156 |
| 1072 | iso_pu_bacteria | 2857524615 | 2857530468 | 156 |
| 1073 | iso_pu_bacteria | 2893066018 | 2893069577 | 156 |
| 1074 | iso_pu_bacteria | 2919073203 | 2919077369 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jpb-assembly1.cif.gz_W | the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. | 0.9091 | 11 | 148 |
| 3ja6-assembly1.cif.gz_F | cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling | 0.9 | 11 | 148 |
| 2qdl-assembly2.cif.gz_B | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.8918 | 11 | 148 |
| 8c5v-assembly1.cif.gz_H | chemotaxis core signalling unit from e protein lysed e. coli cells | 0.8758 | 13 | 147 |
| 4jpb-assembly1.cif.gz_W | the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. | 0.8729 | 11 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8904 | 32 | 95 | 2.40.50.180 |
| 2qdlB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8843 | 33 | 99 | 2.40.50.180 |
| 2ch4W02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8796 | 32 | 99 | 2.40.50.180 |
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8657 | 32 | 95 | 2.40.50.180 |
| 1b3qA04 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8171 | 33 | 98 | 2.40.50.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522A6C7-F1-model_v4 | Chemotaxis protein CheW | 0.9701 | 16 | 148 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-F7QRN6-F1-model_v4 | Regulator of CheA protein activity CheW | 0.9684 | 19 | 156 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A2D9RKA8-F1-model_v4 | Chemotaxis protein CheW | 0.9672 | 11 | 155 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A285PID1-F1-model_v4 | CheW protein | 0.9664 | 2 | 147 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-G2KPX0-F1-model_v4 | CheW-like domain protein | 0.9652 | 8 | 147 |
GO:0005829
GO:0006935 GO:0007165 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar