F489545

General Info

Members Datasets Scaffolds Average Seq Length
1074 499 1051 157

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0123949|Ga0496125_0123949_88_561
Length 157
Sequence MTSSKVEVRDSKVAEYVTVVIGGQLFGLPISRVQDVFMPERLTRVPLSSAEIAGVLNLRGRIVTVIDMRARLGLPRADGKPTMAVGVDLRGESYGLLIDHIGEVLRLADEGREENPVNLDPRMAKFAGGVHRLEGQLMVVLDVDRVLELAPKAALAA

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
3 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
6 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
7 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
8 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
9 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
10 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
11 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
12 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
13 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
136 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
235 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
236 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
268 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
269 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
270 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
271 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
272 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
275 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
276 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
279 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
280 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
281 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
282 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
309 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
310 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
311 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
312 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
315 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
316 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
319 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
320 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
324 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
325 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
326 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
327 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
328 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
329 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
330 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
331 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
332 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
333 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
334 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
335 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
336 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
339 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
342 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
343 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
344 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
345 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
346 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
347 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
348 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
349 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
350 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
351 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
352 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
353 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
354 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
355 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
356 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
357 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
365 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
366 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
367 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
368 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
369 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
373 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
374 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
392 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
393 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
394 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
395 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
402 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
403 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
411 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
412 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
415 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
416 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
417 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
418 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
424 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
425 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
426 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
427 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
428 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
429 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
430 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
431 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
432 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
433 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
434 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
435 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
436 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
437 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
440 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
441 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
442 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
443 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
444 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
445 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
446 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
447 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
448 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
449 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
450 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
451 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
452 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
453 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
454 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
455 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
456 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
457 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
458 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
459 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
460 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
461 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
462 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
463 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
464 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
465 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
466 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
467 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
468 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
469 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
470 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
471 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
472 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
473 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
474 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
475 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
476 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
477 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
478 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
479 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
480 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
481 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
482 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
483 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
484 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
485 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
486 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
487 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
488 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
489 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
490 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
491 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
492 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
493 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
494 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
495 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
496 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
497 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
498 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
499 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0.19
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.92
Nodule 1.49
Rhizoplane 6.15
Rhizosphere 67.13
Stem 0
Stem Tuber 0
Unclassified 9.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014484 3300001979 Bacteria 2907
2 JGI24739J22299_10004030 3300001989 Bacteria 5620
3 JGI24737J22298_10002056 3300001990 Bacteria 7197
4 JGI24737J22298_10129081 3300001990 Bacteria 747
5 JGI24735J21928_10011719 3300002067 Bacteria 2777
6 JGI24738J21930_10028233 3300002075 Bacteria 1148
7 JGI24742J22300_10014917 3300002244 Bacteria 1306
8 JGI25153J46596_10005700 3300003215 Bacteria 6493
9 JGI25153J46596_10016618 3300003215 Bacteria 2937
10 Ga0055526_1034174 3300003771 Bacteria 1394
11 Ga0070658_10349330 3300005327 Bacteria 1266
12 Ga0070658_10558937 3300005327 Bacteria 990
13 Ga0070683_100810669 3300005329 Bacteria 897
14 Ga0070690_100088327 3300005330 Bacteria 2037
15 Ga0070670_100135329 3300005331 Bacteria 2129
16 Ga0070670_101045608 3300005331 Bacteria 743
17 Ga0070677_10198491 3300005333 Bacteria 966
18 Ga0068869_100191234 3300005334 Bacteria 1609
19 Ga0068869_100305143 3300005334 Bacteria 1286
20 Ga0070666_10287949 3300005335 Bacteria 1168
21 Ga0070666_10302793 3300005335 Bacteria 1138
22 Ga0070666_10361107 3300005335 Bacteria 1040
23 Ga0070680_100235800 3300005336 Bacteria 1546
24 Ga0070680_100642863 3300005336 Bacteria 911
25 Ga0068868_100019990 3300005338 Bacteria 5023
26 Ga0068868_100377181 3300005338 Bacteria 1219
27 Ga0068868_100552004 3300005338 Bacteria 1015
28 Ga0068868_100790312 3300005338 Bacteria 855
29 Ga0070660_100125899 3300005339 Bacteria 2047
30 Ga0070660_100139170 3300005339 Bacteria 1946
31 Ga0070660_100231275 3300005339 Bacteria 1504
32 Ga0070660_101177496 3300005339 Bacteria 649
33 Ga0070689_100084174 3300005340 Bacteria 2499
34 Ga0070689_100181538 3300005340 Bacteria 1709
35 Ga0070691_10471534 3300005341 Bacteria 720
36 Ga0070687_100320155 3300005343 Bacteria 990
37 Ga0070661_100473914 3300005344 Bacteria 999
38 Ga0070692_10106970 3300005345 Bacteria 1542
39 Ga0070668_100008596 3300005347 Bacteria 7584
40 Ga0070668_100421026 3300005347 Bacteria 1143
41 Ga0070668_101044669 3300005347 Bacteria 736
42 Ga0070675_101028955 3300005354 Bacteria 756
43 Ga0070674_100535367 3300005356 Bacteria 980
44 Ga0070673_100379822 3300005364 Bacteria 1259
45 Ga0070688_100109281 3300005365 Bacteria 1836
46 Ga0070688_100187705 3300005365 Bacteria 1438
47 Ga0070688_100509894 3300005365 Bacteria 909
48 Ga0070659_100043012 3300005366 Bacteria 3532
49 Ga0070659_100111198 3300005366 Bacteria 2212
50 Ga0070659_100856234 3300005366 Bacteria 793
51 Ga0070667_100143679 3300005367 Bacteria 2091
52 Ga0070703_10027610 3300005406 Bacteria 1692
53 Ga0070709_10399467 3300005434 Bacteria 1026
54 Ga0070714_100002536 3300005435 Bacteria 13461
55 Ga0070714_100055427 3300005435 Bacteria 3388
56 Ga0070714_100407177 3300005435 Bacteria 1287
57 Ga0070714_100680363 3300005435 Bacteria 992
58 Ga0070713_100003570 3300005436 Bacteria 10274
59 Ga0070713_100324064 3300005436 Bacteria 1423
60 Ga0070713_100783350 3300005436 Bacteria 914
61 Ga0070710_10002610 3300005437 Bacteria 8568
62 Ga0070710_10065506 3300005437 Bacteria 2081
63 Ga0070701_10303340 3300005438 Bacteria 982
64 Ga0070711_100018537 3300005439 Bacteria 4447
65 Ga0070711_100190218 3300005439 Bacteria 1577
66 Ga0070705_100469736 3300005440 Bacteria 948
67 Ga0070705_100572324 3300005440 Bacteria 869
68 Ga0070700_100147481 3300005441 Bacteria 1605
69 Ga0070700_100490873 3300005441 Bacteria 943
70 Ga0070663_100191365 3300005455 Bacteria 1592
71 Ga0070663_100200596 3300005455 Bacteria 1557
72 Ga0070663_100447024 3300005455 Bacteria 1064
73 Ga0070663_101083076 3300005455 Bacteria 700
74 Ga0070678_100035710 3300005456 Bacteria 3473
75 Ga0070678_100060695 3300005456 Bacteria 2784
76 Ga0070678_100179814 3300005456 Bacteria 1730
77 Ga0070678_100269806 3300005456 Bacteria 1434
78 Ga0070678_100328286 3300005456 Bacteria 1308
79 Ga0070678_100412705 3300005456 Bacteria 1175
80 Ga0070678_100424534 3300005456 Bacteria 1160
81 Ga0070678_100533871 3300005456 Bacteria 1039
82 Ga0070662_100068160 3300005457 Bacteria 2615
83 Ga0070662_100741424 3300005457 Bacteria 833
84 Ga0070681_10170449 3300005458 Bacteria 2099
85 Ga0070681_10641950 3300005458 Bacteria 976
86 Ga0070685_10068454 3300005466 Bacteria 2097
87 Ga0070698_100275574 3300005471 Bacteria 1614
88 Ga0070698_100871735 3300005471 Bacteria 845
89 Ga0070699_100361620 3300005518 Bacteria 1308
90 Ga0070699_101554062 3300005518 Bacteria 606
91 Ga0070697_100000384 3300005536 Bacteria 34537
92 Ga0070697_100092326 3300005536 Bacteria 2504
93 Ga0070697_100603834 3300005536 Bacteria 964
94 Ga0068853_100006456 3300005539 Bacteria 9323
95 Ga0068853_100010388 3300005539 Bacteria 7532
96 Ga0068853_100040041 3300005539 Bacteria 3997
97 Ga0068853_100421512 3300005539 Bacteria 1251
98 Ga0068853_100488873 3300005539 Bacteria 1161
99 Ga0070672_100255182 3300005543 Bacteria 1478
100 Ga0070672_100323731 3300005543 Bacteria 1311
101 Ga0070672_100498318 3300005543 Bacteria 1053
102 Ga0070672_100657671 3300005543 Bacteria 915
103 Ga0070686_100170627 3300005544 Bacteria 1538
104 Ga0070695_100016132 3300005545 Bacteria 4517
105 Ga0070696_100299323 3300005546 Bacteria 1231
106 Ga0070693_100142838 3300005547 Bacteria 1508
107 Ga0070693_100277759 3300005547 Bacteria 1120
108 Ga0070665_100133394 3300005548 Bacteria 2485
109 Ga0070665_101810541 3300005548 Bacteria 617
110 Ga0068855_100038648 3300005563 Bacteria 5670
111 Ga0068855_100076604 3300005563 Bacteria 3881
112 Ga0068855_100094616 3300005563 Bacteria 3444
113 Ga0068855_100254602 3300005563 Bacteria 1957
114 Ga0068855_100722267 3300005563 Bacteria 1064
115 Ga0068855_101476773 3300005563 Bacteria 699
116 Ga0070664_100278900 3300005564 Bacteria 1507
117 Ga0070664_100305066 3300005564 Bacteria 1439
118 Ga0070664_100555127 3300005564 Bacteria 1062
119 Ga0070664_100829001 3300005564 Bacteria 865
120 Ga0068857_100027957 3300005577 Bacteria 4973
121 Ga0068857_100048760 3300005577 Bacteria 3758
122 Ga0068857_100140897 3300005577 Bacteria 2179
123 Ga0068854_100007431 3300005578 Bacteria 7000
124 Ga0068854_100777806 3300005578 Bacteria 832
125 Ga0068854_101073385 3300005578 Bacteria 716
126 Ga0068856_100029161 3300005614 Bacteria 5390
127 Ga0068856_100045204 3300005614 Bacteria 4335
128 Ga0068856_100092169 3300005614 Bacteria 3015
129 Ga0068856_100135913 3300005614 Bacteria 2464
130 Ga0070702_100042891 3300005615 Bacteria 2546
131 Ga0070702_100075220 3300005615 Bacteria 2006
132 Ga0070702_100225410 3300005615 Bacteria 1256
133 Ga0068852_100032359 3300005616 Bacteria 4329
134 Ga0068852_100102155 3300005616 Bacteria 2590
135 Ga0068852_100112799 3300005616 Bacteria 2474
136 Ga0068852_100131914 3300005616 Bacteria 2302
137 Ga0068852_100137079 3300005616 Bacteria 2260
138 Ga0068852_100188789 3300005616 Bacteria 1943
139 Ga0068852_100194999 3300005616 Bacteria 1913
140 Ga0068852_100656478 3300005616 Bacteria 1057
141 Ga0068859_100419536 3300005617 Bacteria 1434
142 Ga0068859_100678715 3300005617 Bacteria 1121
143 Ga0068859_100840332 3300005617 Bacteria 1004
144 Ga0068864_100130491 3300005618 Bacteria 2257
145 Ga0068861_100270675 3300005719 Bacteria 1458
146 Ga0068861_100987566 3300005719 Bacteria 803
147 Ga0068851_10002363 3300005834 Bacteria 8300
148 Ga0068851_10059989 3300005834 Bacteria 1947
149 Ga0068870_10386111 3300005840 Bacteria 908
150 Ga0068870_10491058 3300005840 Bacteria 817
151 Ga0068858_100095306 3300005842 Bacteria 2773
152 Ga0068858_100146461 3300005842 Bacteria 2218
153 Ga0068860_100631031 3300005843 Bacteria 1078
154 Ga0068860_100898856 3300005843 Bacteria 901
155 Ga0068860_101257128 3300005843 Bacteria 761
156 Ga0068862_100046068 3300005844 Bacteria 3722
157 Ga0068862_100433741 3300005844 Bacteria 1235
158 Ga0081455_10004895 3300005937 Bacteria 14842
159 Ga0081455_10028806 3300005937 Bacteria 5070
160 Ga0081455_10044688 3300005937 Bacteria 3861
161 Ga0081538_10004197 3300005981 Bacteria 13365
162 Ga0081538_10010846 3300005981 Bacteria 7435
163 Ga0081540_1009947 3300005983 Bacteria 6485
164 Ga0081540_1036194 3300005983 Bacteria 2636
165 Ga0081539_10009687 3300005985 Bacteria 7979
166 Ga0081539_10055644 3300005985 Bacteria 2200
167 Ga0070717_10005959 3300006028 Bacteria 8927
168 Ga0070717_11697386 3300006028 Bacteria 572
169 Ga0075365_10053696 3300006038 Bacteria 2670
170 Ga0075365_10071356 3300006038 Bacteria 2338
171 Ga0075365_10113217 3300006038 Bacteria 1866
172 Ga0075365_10235331 3300006038 Bacteria 1286
173 Ga0075365_10317951 3300006038 Bacteria 1096
174 Ga0075365_11247432 3300006038 Bacteria 523
175 Ga0075368_10003871 3300006042 Bacteria 5037
176 Ga0075368_10113045 3300006042 Bacteria 1120
177 Ga0075368_10217343 3300006042 Bacteria 811
178 Ga0075363_100012017 3300006048 Bacteria 4163
179 Ga0075363_100106657 3300006048 Bacteria 1554
180 Ga0075364_10034716 3300006051 Bacteria 3256
181 Ga0075364_10133291 3300006051 Bacteria 1668
182 Ga0075364_10146891 3300006051 Bacteria 1588
183 Ga0075364_10286629 3300006051 Bacteria 1120
184 Ga0075432_10051629 3300006058 Bacteria 1451
185 Ga0070715_10000598 3300006163 Bacteria 9517
186 Ga0070715_10448896 3300006163 Bacteria 727
187 Ga0070716_100012954 3300006173 Bacteria 4238
188 Ga0070716_100046882 3300006173 Bacteria 2435
189 Ga0070716_100135925 3300006173 Bacteria 1561
190 Ga0070712_100020443 3300006175 Bacteria 4332
191 Ga0070712_100057804 3300006175 Bacteria 2726
192 Ga0070712_100126974 3300006175 Bacteria 1928
193 Ga0075362_10128720 3300006177 Bacteria 1202
194 Ga0075362_10149866 3300006177 Bacteria 1119
195 Ga0075367_10007569 3300006178 Bacteria 5571
196 Ga0075367_10015181 3300006178 Bacteria 4181
197 Ga0075367_10023304 3300006178 Bacteria 3482
198 Ga0075367_10065607 3300006178 Bacteria 2174
199 Ga0075367_10194994 3300006178 Bacteria 1265
200 Ga0075369_10008323 3300006186 Bacteria 3988
201 Ga0075369_10046833 3300006186 Bacteria 1863
202 Ga0075369_10053273 3300006186 Bacteria 1755
203 Ga0075369_10210636 3300006186 Bacteria 898
204 Ga0075369_10485200 3300006186 Bacteria 587
205 Ga0075366_10030117 3300006195 Bacteria 3190
206 Ga0075366_10212951 3300006195 Bacteria 1176
207 Ga0075366_10270108 3300006195 Bacteria 1038
208 Ga0075366_10451629 3300006195 Bacteria 793
209 Ga0097621_100065762 3300006237 Bacteria 2985
210 Ga0097621_100361881 3300006237 Bacteria 1292
211 Ga0075370_10012433 3300006353 Bacteria 4497
212 Ga0075370_10072760 3300006353 Bacteria 1968
213 Ga0075370_10163329 3300006353 Bacteria 1307
214 Ga0075370_10645190 3300006353 Bacteria 642
215 Ga0075428_100031165 3300006844 Bacteria 5897
216 Ga0075428_100146156 3300006844 Bacteria 2569
217 Ga0075434_100303051 3300006871 Bacteria 1618
218 Ga0075434_101101209 3300006871 Bacteria 807
219 Ga0068865_100411756 3300006881 Bacteria 1109
220 Ga0075436_100000569 3300006914 Bacteria 24112
221 Ga0097620_100419532 3300006931 Bacteria 1434
222 Ga0097620_100678711 3300006931 Bacteria 1121
223 Ga0097620_100840303 3300006931 Bacteria 1004
224 Ga0075435_100015953 3300007076 Bacteria 5657
225 Ga0075435_100252215 3300007076 Bacteria 1502
226 Ga0105240_10003411 3300009093 Bacteria 24689
227 Ga0105240_10015393 3300009093 Bacteria 10397
228 Ga0105240_10029865 3300009093 Bacteria 7094
229 Ga0105240_10857771 3300009093 Bacteria 980
230 Ga0105245_11776089 3300009098 Bacteria 669
231 Ga0105247_10708510 3300009101 Bacteria 758
232 Ga0114129_10202878 3300009147 Bacteria 2685
233 Ga0105243_10116001 3300009148 Bacteria 2249
234 Ga0105243_10460636 3300009148 Bacteria 1195
235 Ga0105243_10788911 3300009148 Bacteria 935
236 Ga0105241_10002479 3300009174 Bacteria 13874
237 Ga0105241_10369543 3300009174 Bacteria 1250
238 Ga0105241_10546218 3300009174 Bacteria 1040
239 Ga0105242_10317021 3300009176 Bacteria 1429
240 Ga0105242_11398900 3300009176 Bacteria 727
241 Ga0105248_10238832 3300009177 Bacteria 2045
242 Ga0105248_10679666 3300009177 Bacteria 1161
243 Ga0105237_10050884 3300009545 Bacteria 4163
244 Ga0105237_10109537 3300009545 Bacteria 2754
245 Ga0105237_10348303 3300009545 Bacteria 1486
246 Ga0105237_10773650 3300009545 Bacteria 967
247 Ga0105237_11121505 3300009545 Bacteria 793
248 Ga0105238_10005788 3300009551 Bacteria 12235
249 Ga0105238_10010373 3300009551 Bacteria 9351
250 Ga0105238_10190515 3300009551 Bacteria 2027
251 Ga0105238_10369234 3300009551 Bacteria 1425
252 Ga0105238_10749485 3300009551 Bacteria 990
253 Ga0105249_10604954 3300009553 Bacteria 1151
254 Ga0105249_10813825 3300009553 Bacteria 998
255 Ga0105249_10816608 3300009553 Bacteria 997
256 Ga0105249_10940915 3300009553 Bacteria 932
257 Ga0105249_11734260 3300009553 Bacteria 697
258 Ga0099796_10015145 3300010159 Bacteria 2247
259 Ga0099796_10161445 3300010159 Bacteria 888
260 Ga0099796_10217887 3300010159 Bacteria 781
261 Ga0099796_10300179 3300010159 Bacteria 680
262 Ga0105239_10006751 3300010375 Bacteria 13254
263 Ga0105239_10038316 3300010375 Bacteria 5253
264 Ga0105239_10052562 3300010375 Bacteria 4468
265 Ga0105239_10109955 3300010375 Bacteria 3055
266 Ga0105239_10111235 3300010375 Bacteria 3036
267 Ga0105239_10534925 3300010375 Bacteria 1334
268 Ga0105239_11803139 3300010375 Bacteria 709
269 Ga0157322_1007909 3300012490 Bacteria 800
270 Ga0157373_10107960 3300013100 Bacteria 1957
271 Ga0157371_10395319 3300013102 Bacteria 1011
272 Ga0157369_10170948 3300013105 Bacteria 2290
273 Ga0157369_10216758 3300013105 Bacteria 2004
274 Ga0157369_11321370 3300013105 Bacteria 735
275 Ga0157374_10116742 3300013296 Bacteria 2572
276 Ga0157374_10614723 3300013296 Bacteria 1097
277 Ga0163162_10395168 3300013306 Bacteria 1515
278 Ga0163162_11016984 3300013306 Bacteria 937
279 Ga0163162_11022040 3300013306 Bacteria 935
280 Ga0157372_10126018 3300013307 Bacteria 2944
281 Ga0157372_10524511 3300013307 Bacteria 1381
282 Ga0157372_10849016 3300013307 Bacteria 1060
283 Ga0157375_10343143 3300013308 Bacteria 1659
284 Ga0157375_10546228 3300013308 Bacteria 1321
285 Ga0157375_11723273 3300013308 Bacteria 742
286 Ga0163163_10023747 3300014325 Bacteria 5825
287 Ga0163163_10164609 3300014325 Bacteria 2263
288 Ga0157377_10135851 3300014745 Bacteria 1507
289 Ga0157379_10469693 3300014968 Bacteria 1163
290 Ga0157379_12215248 3300014968 Bacteria 546
291 Ga0157376_10784459 3300014969 Bacteria 964
292 Ga0163161_10615013 3300017792 Bacteria 897
293 Ga0206354_11275229 3300020081 Bacteria 657
294 Ga0214542_1044186 3300021321 Bacteria 1015
295 Ga0214545_1000009 3300021324 Bacteria 202915
296 Ga0214545_1000094 3300021324 Bacteria 98180
297 Ga0213876_10048881 3300021384 Bacteria 2234
298 Ga0209677_107376 3300025253 Bacteria 2351
299 Ga0209233_1013039 3300025261 Bacteria 2387
300 Ga0209455_1003873 3300025272 Bacteria 5107
301 Ga0209564_1002186 3300025295 Bacteria 16369
302 Ga0209758_1003593 3300025297 Bacteria 13872
303 Ga0209758_1009747 3300025297 Bacteria 5898
304 Ga0209758_1013888 3300025297 Bacteria 4340
305 Ga0207426_1070523 3300025302 Bacteria 976
306 Ga0207697_10027745 3300025315 Bacteria 2315
307 Ga0207656_10005300 3300025321 Bacteria 4551
308 Ga0207656_10132704 3300025321 Bacteria 1168
309 Ga0207656_10145009 3300025321 Bacteria 1121
310 Ga0207653_10114445 3300025885 Bacteria 966
311 Ga0207692_10001799 3300025898 Bacteria 8124
312 Ga0207692_10031851 3300025898 Bacteria 2528
313 Ga0207642_10104301 3300025899 Bacteria 1430
314 Ga0207710_10120046 3300025900 Bacteria 1255
315 Ga0207710_10182100 3300025900 Bacteria 1031
316 Ga0207710_10191977 3300025900 Bacteria 1006
317 Ga0207688_10449513 3300025901 Bacteria 803
318 Ga0207680_10381862 3300025903 Bacteria 993
319 Ga0207680_10425102 3300025903 Bacteria 941
320 Ga0207680_10767300 3300025903 Bacteria 691
321 Ga0207647_10102419 3300025904 Bacteria 1698
322 Ga0207699_10002114 3300025906 Bacteria 9385
323 Ga0207699_10365270 3300025906 Bacteria 1022
324 Ga0207645_10189071 3300025907 Bacteria 1353
325 Ga0207645_10197119 3300025907 Bacteria 1324
326 Ga0207645_10597451 3300025907 Bacteria 749
327 Ga0207643_10065231 3300025908 Bacteria 2085
328 Ga0207705_10299799 3300025909 Bacteria 1233
329 Ga0207684_10198374 3300025910 Bacteria 1731
330 Ga0207654_10000488 3300025911 Bacteria 22690
331 Ga0207654_10057785 3300025911 Bacteria 2256
332 Ga0207654_10288715 3300025911 Bacteria 1112
333 Ga0207707_10018804 3300025912 Bacteria 6026
334 Ga0207695_10002499 3300025913 Bacteria 27042
335 Ga0207695_10058053 3300025913 Bacteria 4018
336 Ga0207695_10409973 3300025913 Bacteria 1239
337 Ga0207695_10892444 3300025913 Bacteria 769
338 Ga0207671_10055229 3300025914 Bacteria 2942
339 Ga0207671_10121817 3300025914 Bacteria 1994
340 Ga0207671_10137048 3300025914 Bacteria 1883
341 Ga0207671_10463576 3300025914 Bacteria 1010
342 Ga0207671_11299722 3300025914 Bacteria 566
343 Ga0207693_10001912 3300025915 Bacteria 18227
344 Ga0207693_10072112 3300025915 Bacteria 2704
345 Ga0207693_10093765 3300025915 Bacteria 2353
346 Ga0207693_10455177 3300025915 Bacteria 1000
347 Ga0207663_10000468 3300025916 Bacteria 17526
348 Ga0207663_10154598 3300025916 Bacteria 1612
349 Ga0207663_10257974 3300025916 Bacteria 1286
350 Ga0207660_10238664 3300025917 Bacteria 1431
351 Ga0207660_10366625 3300025917 Bacteria 1156
352 Ga0207657_10233817 3300025919 Bacteria 1469
353 Ga0207649_10284882 3300025920 Bacteria 1203
354 Ga0207652_10018004 3300025921 Bacteria 5789
355 Ga0207652_10256139 3300025921 Bacteria 1578
356 Ga0207681_10458110 3300025923 Bacteria 1038
357 Ga0207681_10952791 3300025923 Bacteria 719
358 Ga0207694_10000258 3300025924 Bacteria 50514
359 Ga0207694_10014516 3300025924 Bacteria 5939
360 Ga0207694_10022364 3300025924 Bacteria 4796
361 Ga0207694_10094707 3300025924 Bacteria 2360
362 Ga0207694_10424206 3300025924 Bacteria 1108
363 Ga0207650_10504971 3300025925 Bacteria 1011
364 Ga0207650_10877158 3300025925 Bacteria 762
365 Ga0207659_10245962 3300025926 Bacteria 1449
366 Ga0207659_10532585 3300025926 Bacteria 997
367 Ga0207687_10020017 3300025927 Bacteria 4438
368 Ga0207687_10317180 3300025927 Bacteria 1261
369 Ga0207687_10738533 3300025927 Bacteria 837
370 Ga0207700_10019468 3300025928 Bacteria 4586
371 Ga0207700_11244980 3300025928 Bacteria 664
372 Ga0207664_10040288 3300025929 Bacteria 3632
373 Ga0207664_10140530 3300025929 Bacteria 2042
374 Ga0207664_10404642 3300025929 Bacteria 1214
375 Ga0207664_10597581 3300025929 Bacteria 991
376 Ga0207644_10308486 3300025931 Bacteria 1277
377 Ga0207690_10318298 3300025932 Bacteria 1222
378 Ga0207706_10086261 3300025933 Bacteria 2759
379 Ga0207686_10923331 3300025934 Bacteria 705
380 Ga0207709_10167030 3300025935 Bacteria 1541
381 Ga0207709_10247442 3300025935 Bacteria 1300
382 Ga0207709_10287287 3300025935 Bacteria 1217
383 Ga0207709_10660633 3300025935 Bacteria 833
384 Ga0207670_10066434 3300025936 Bacteria 2478
385 Ga0207704_10014231 3300025938 Bacteria 4012
386 Ga0207704_11148251 3300025938 Bacteria 661
387 Ga0207665_10000791 3300025939 Bacteria 21348
388 Ga0207665_10040549 3300025939 Bacteria 3107
389 Ga0207691_10451481 3300025940 Bacteria 1094
390 Ga0207691_10538870 3300025940 Bacteria 990
391 Ga0207691_11005299 3300025940 Bacteria 696
392 Ga0207711_10238277 3300025941 Bacteria 1668
393 Ga0207711_11651921 3300025941 Bacteria 584
394 Ga0207689_10237062 3300025942 Bacteria 1508
395 Ga0207689_10618340 3300025942 Bacteria 912
396 Ga0207661_10657041 3300025944 Bacteria 964
397 Ga0207667_10007013 3300025949 Bacteria 13611
398 Ga0207667_10009886 3300025949 Bacteria 11193
399 Ga0207667_10010097 3300025949 Bacteria 11066
400 Ga0207667_10144533 3300025949 Bacteria 2449
401 Ga0207667_11585982 3300025949 Bacteria 624
402 Ga0207651_10121574 3300025960 Bacteria 1981
403 Ga0207651_10510769 3300025960 Bacteria 1040
404 Ga0207712_11081005 3300025961 Bacteria 714
405 Ga0207668_10005343 3300025972 Bacteria 7557
406 Ga0207668_10045426 3300025972 Bacteria 2995
407 Ga0207668_10523470 3300025972 Bacteria 1023
408 Ga0207640_10014499 3300025981 Bacteria 4540
409 Ga0207640_10019478 3300025981 Bacteria 4009
410 Ga0207658_11593968 3300025986 Bacteria 597
411 Ga0207677_10070393 3300026023 Bacteria 2465
412 Ga0207677_10247794 3300026023 Bacteria 1445
413 Ga0207677_10777377 3300026023 Bacteria 855
414 Ga0207703_10145874 3300026035 Bacteria 2058
415 Ga0207703_10179462 3300026035 Bacteria 1868
416 Ga0207703_10689005 3300026035 Bacteria 971
417 Ga0207703_10699017 3300026035 Bacteria 964
418 Ga0207639_10004848 3300026041 Bacteria 9069
419 Ga0207639_10005744 3300026041 Bacteria 8402
420 Ga0207639_10035786 3300026041 Bacteria 3675
421 Ga0207639_10093845 3300026041 Bacteria 2407
422 Ga0207639_10686529 3300026041 Bacteria 949
423 Ga0207678_10034872 3300026067 Bacteria 4382
424 Ga0207678_10146025 3300026067 Bacteria 2019
425 Ga0207678_10221370 3300026067 Bacteria 1620
426 Ga0207678_10712932 3300026067 Bacteria 883
427 Ga0207708_10281862 3300026075 Bacteria 1347
428 Ga0207702_10000006 3300026078 Bacteria 346370
429 Ga0207702_10750891 3300026078 Bacteria 963
430 Ga0207641_10317453 3300026088 Bacteria 1476
431 Ga0207648_10508952 3300026089 Bacteria 1102
432 Ga0207676_10056842 3300026095 Bacteria 3078
433 Ga0207676_10321145 3300026095 Bacteria 1421
434 Ga0207676_10757073 3300026095 Bacteria 945
435 Ga0207674_10023277 3300026116 Bacteria 6637
436 Ga0207674_10036549 3300026116 Bacteria 5115
437 Ga0207675_100470650 3300026118 Bacteria 1247
438 Ga0207683_10013150 3300026121 Bacteria 7061
439 Ga0207683_10063276 3300026121 Bacteria 3259
440 Ga0207683_10623762 3300026121 Bacteria 998
441 Ga0207698_10016031 3300026142 Bacteria 5040
442 Ga0207698_10149202 3300026142 Bacteria 2027
443 Ga0207698_10157168 3300026142 Bacteria 1983
444 Ga0207698_10815399 3300026142 Bacteria 936
445 Ga0209179_1005879 3300027512 Bacteria 1946
446 Ga0209813_10081247 3300027866 Bacteria 1072
447 Ga0209813_10086754 3300027866 Bacteria 1044
448 Ga0209813_10141147 3300027866 Bacteria 855
449 Ga0207428_10195964 3300027907 Bacteria 1521
450 Ga0268266_10080191 3300028379 Bacteria 2843
451 Ga0268266_10086045 3300028379 Bacteria 2747
452 Ga0268266_10353347 3300028379 Bacteria 1381
453 Ga0268266_10529147 3300028379 Bacteria 1128
454 Ga0268266_11064957 3300028379 Bacteria 782
455 Ga0268265_10061284 3300028380 Bacteria 2886
456 Ga0268265_10121783 3300028380 Bacteria 2150
457 Ga0268265_10215400 3300028380 Bacteria 1676
458 Ga0268265_10662327 3300028380 Bacteria 1004
459 Ga0268264_10284455 3300028381 Bacteria 1550
460 Ga0268264_10831907 3300028381 Bacteria 924
461 Ga0268264_10949356 3300028381 Bacteria 865
462 Ga0307517_10160582 3300028786 Bacteria 1510
463 Ga0307515_10060735 3300028794 Bacteria 5382
464 Ga0307515_10125784 3300028794 Bacteria 2865
465 Ga0265330_10068015 3300031235 Bacteria 1543
466 Ga0265332_10239349 3300031238 Bacteria 751
467 Ga0265325_10040179 3300031241 Bacteria 2458
468 Ga0265325_10056360 3300031241 Bacteria 2007
469 Ga0265340_10043557 3300031247 Bacteria 2199
470 Ga0265339_10006205 3300031249 Bacteria 7870
471 Ga0265339_10221853 3300031249 Bacteria 924
472 Ga0265316_10055990 3300031344 Bacteria 3082
473 Ga0265316_10751967 3300031344 Bacteria 685
474 Ga0307513_10234990 3300031456 Bacteria 1643
475 Ga0307513_10395212 3300031456 Bacteria 1118
476 Ga0307513_10719133 3300031456 Bacteria 704
477 Ga0307513_10778702 3300031456 Bacteria 662
478 Ga0307509_10323905 3300031507 Bacteria 1276
479 Ga0307509_10850076 3300031507 Bacteria 577
480 Ga0265313_10038538 3300031595 Bacteria 2379
481 Ga0307508_10000154 3300031616 Bacteria 82824
482 Ga0307508_10006872 3300031616 Bacteria 10640
483 Ga0307508_10044377 3300031616 Bacteria 3977
484 Ga0307508_10050452 3300031616 Bacteria 3704
485 Ga0307508_10156036 3300031616 Bacteria 1886
486 Ga0265314_10022217 3300031711 Bacteria 4862
487 Ga0265314_10113472 3300031711 Bacteria 1718
488 Ga0265314_10120398 3300031711 Bacteria 1653
489 Ga0265342_10004062 3300031712 Bacteria 11674
490 Ga0265342_10019741 3300031712 Bacteria 4336
491 Ga0265342_10110628 3300031712 Bacteria 1555
492 Ga0307516_10073486 3300031730 Bacteria 3276
493 Ga0307516_10384296 3300031730 Bacteria 1065
494 Ga0307516_10412146 3300031730 Bacteria 1009
495 Ga0307405_10261428 3300031731 Bacteria 1293
496 Ga0307405_10490481 3300031731 Bacteria 983
497 Ga0307405_11504341 3300031731 Bacteria 591
498 Ga0307412_11432364 3300031911 Bacteria 626
499 Ga0307409_100756929 3300031995 Bacteria 975
500 Ga0307409_100991804 3300031995 Bacteria 858
501 Ga0307416_100569624 3300032002 Bacteria 1208
502 Ga0307414_10230161 3300032004 Bacteria 1528
503 Ga0307414_10521770 3300032004 Bacteria 1054
504 Ga0307415_100509834 3300032126 Bacteria 1053
505 Ga0307415_100671707 3300032126 Bacteria 931
506 Ga0307415_102283177 3300032126 Bacteria 530
507 Ga0307510_10035129 3300033180 Bacteria 5602
508 Ga0307510_10123405 3300033180 Bacteria 2287
509 Ga0307510_10296363 3300033180 Bacteria 1081
510 Ga0316213_1002512 3300033546 Bacteria 1234
511 Ga0373930_0039630 3300034816 Bacteria 999
512 Ga0373938_0029635 3300034957 Bacteria 1163
513 Ga0373940_0093274 3300035088 Bacteria 905
514 Ga0373952_0007320 3300035092 Bacteria 2066
515 Ga0373923_0213759 3300035111 Bacteria 895
516 Ga0373932_0046080 3300035112 Bacteria 1277
517 Ga0373932_0342432 3300035112 Bacteria 567
518 Ga0373936_0004495 3300035113 Bacteria 5276
519 Ga0373936_0008591 3300035113 Bacteria 3846
520 Ga0373936_0183992 3300035113 Bacteria 917
521 Ga0373941_0050413 3300035115 Bacteria 1321
522 Ga0373941_0395687 3300035115 Bacteria 570
523 Ga0373945_0013000 3300035116 Bacteria 2773
524 Ga0373954_0131333 3300035118 Bacteria 1219
525 Ga0373956_0031554 3300035119 Bacteria 2323
526 Ga0373957_0134480 3300035120 Bacteria 1008
527 Ga0373943_0003586 3300035170 Bacteria 7061
528 Ga0373946_0514223 3300035171 Bacteria 615
529 Ga0373946_0717648 3300035171 Bacteria 523
530 Ga0373955_0070764 3300035172 Bacteria 1950
531 Ga0373955_0458847 3300035172 Bacteria 777
532 Ga0373955_0523022 3300035172 Bacteria 725
533 Ga0373924_0008812 3300035410 Bacteria 3679
534 Ga0373931_0000507 3300035691 Bacteria 15939
535 Ga0373931_0234557 3300035691 Bacteria 1110
536 Ga0373935_0322151 3300035692 Bacteria 1097
537 Ga0373927_0003207 3300035695 Bacteria 11783
538 Ga0373927_0029468 3300035695 Bacteria 3578
539 Ga0373933_0000278 3300035724 Bacteria 33265
540 Ga0373947_0027809 3300035725 Bacteria 3312
541 Ga0373937_0040577 3300036401 Bacteria 4242
542 Ga0373937_0451735 3300036401 Bacteria 1220
543 Ga0372808_020118 3300036459 Bacteria 959
544 Ga0373925_0006083 3300037068 Bacteria 8927
545 Ga0373925_0278169 3300037068 Bacteria 1348
546 Ga0373925_0587153 3300037068 Bacteria 917
547 Ga0373925_0649613 3300037068 Bacteria 869
548 Ga0395900_0134282 3300037418 Bacteria 2535
549 Ga0395898_0005012 3300037466 Bacteria 14376
550 Ga0395898_0443014 3300037466 Bacteria 1237
551 Ga0436364_0079550 3300037853 Bacteria 1003
552 Ga0395901_0153112 3300038443 Bacteria 2422
553 Ga0395901_0174892 3300038443 Bacteria 2252
554 Ga0395901_1754424 3300038443 Bacteria 571
555 Ga0436365_1314085 3300039437 Bacteria 2401
556 Ga0436365_1574673 3300039437 Bacteria 1559
557 Ga0436360_0641463 3300039438 Bacteria 2383
558 Ga0436361_0429619 3300039447 Bacteria 718
559 Ga0436363_0241633 3300039450 Bacteria 1052
560 Ga0436363_0444982 3300039450 Bacteria 642
561 Ga0436363_1053886 3300039450 Bacteria 556
562 Ga0439465_0037505 3300041413 Bacteria 1559
563 Ga0439465_0118360 3300041413 Bacteria 927
564 Ga0439465_0332166 3300041413 Bacteria 572
565 Ga0451791_1090847 3300041451 Bacteria 1824
566 Ga0451791_1192174 3300041451 Bacteria 756
567 Ga0451800_1308288 3300041459 Bacteria 762
568 Ga0451804_0808098 3300041463 Bacteria 613
569 Ga0451833_0609030 3300041491 Bacteria 876
570 Ga0451851_0648074 3300041507 Bacteria 569
571 Ga0451853_1533967 3300041512 Bacteria 1018
572 Ga0451853_3299164 3300041512 Bacteria 1291
573 Ga0439431_0022287 3300041997 Bacteria 1526
574 Ga0439445_0045575 3300042004 Bacteria 1174
575 Ga0450905_028721 3300042142 Bacteria 850
576 Ga0439434_0047398 3300042435 Bacteria 1328
577 Ga0439459_0006825 3300042438 Bacteria 1912
578 Ga0466966_0538676 3300044684 Bacteria 702
579 Ga0466963_0056480 3300044694 Bacteria 2612
580 Ga0466964_0038463 3300044706 Bacteria 1924
581 Ga0466970_0487314 3300044765 Bacteria 709
582 Ga0466957_0249422 3300044842 Bacteria 1180
583 Ga0466957_0301379 3300044842 Bacteria 1077
584 Ga0466960_0674131 3300044901 Bacteria 619
585 Ga0466959_0234345 3300045049 Bacteria 1270
586 Ga0451576_0068989 3300045051 Bacteria 3679
587 Ga0451576_0114449 3300045051 Bacteria 2808
588 Ga0451576_1808318 3300045051 Bacteria 631
589 Ga0466967_0034197 3300045976 Bacteria 4311
590 Ga0466967_0522965 3300045976 Bacteria 1166
591 Ga0466967_0944765 3300045976 Bacteria 858
592 Ga0495617_015362 3300046452 Bacteria 2595
593 Ga0495592_0012627 3300046454 Bacteria 6420
594 Ga0495592_0905318 3300046454 Bacteria 518
595 Ga0495603_0001599 3300046455 Bacteria 13286
596 Ga0495603_0050821 3300046455 Bacteria 2464
597 Ga0495603_0205660 3300046455 Bacteria 1137
598 Ga0495603_0718349 3300046455 Bacteria 571
599 Ga0495591_036772 3300046458 Bacteria 1423
600 Ga0495629_0000314 3300046459 Bacteria 41394
601 Ga0495629_0077007 3300046459 Bacteria 2328
602 Ga0495638_0025730 3300046460 Bacteria 3820
603 Ga0495638_0065201 3300046460 Bacteria 2242
604 Ga0495638_0341623 3300046460 Bacteria 793
605 Ga0495641_0002314 3300046461 Bacteria 15168
606 Ga0495651_0092239 3300046462 Bacteria 2269
607 Ga0495651_0139413 3300046462 Bacteria 1760
608 Ga0495653_0034870 3300046463 Bacteria 3974
609 Ga0495653_0195948 3300046463 Bacteria 1375
610 Ga0495653_0224516 3300046463 Bacteria 1261
611 Ga0495580_0002541 3300046472 Bacteria 15893
612 Ga0495580_0447853 3300046472 Bacteria 866
613 Ga0495582_0006906 3300046473 Bacteria 6310
614 Ga0495582_0204540 3300046473 Bacteria 1128
615 Ga0495605_0124399 3300046474 Bacteria 1167
616 Ga0495639_0017614 3300046475 Bacteria 3104
617 Ga0495639_0443551 3300046475 Bacteria 659
618 Ga0495662_0000638 3300046476 Bacteria 16370
619 Ga0495662_0216931 3300046476 Bacteria 943
620 Ga0495664_0013161 3300046477 Bacteria 4692
621 Ga0495664_0070544 3300046477 Bacteria 2086
622 Ga0495664_0362889 3300046477 Bacteria 872
623 Ga0495584_0029858 3300046491 Bacteria 2762
624 Ga0495584_0094580 3300046491 Bacteria 1508
625 Ga0495584_0239778 3300046491 Bacteria 922
626 Ga0495585_0132551 3300046492 Bacteria 1310
627 Ga0495594_0002386 3300046499 Bacteria 9784
628 Ga0495594_0125281 3300046499 Bacteria 1453
629 Ga0495596_0215009 3300046500 Bacteria 746
630 Ga0495607_0015387 3300046501 Bacteria 4960
631 Ga0495607_0070643 3300046501 Bacteria 1950
632 Ga0495583_0086025 3300046506 Bacteria 1360
633 Ga0495608_0157236 3300046511 Bacteria 1446
634 Ga0495608_0268295 3300046511 Bacteria 1061
635 Ga0495610_0029189 3300046512 Bacteria 2908
636 Ga0495610_0134507 3300046512 Bacteria 1070
637 Ga0495616_0069232 3300046513 Bacteria 1711
638 Ga0495618_0610785 3300046514 Bacteria 648
639 Ga0495628_0014010 3300046516 Bacteria 6732
640 Ga0495628_0892245 3300046516 Bacteria 617
641 Ga0495630_0002415 3300046517 Bacteria 12968
642 Ga0495630_0129744 3300046517 Bacteria 1914
643 Ga0495630_0268357 3300046517 Bacteria 1304
644 Ga0495631_0043987 3300046518 Bacteria 1969
645 Ga0495631_0203453 3300046518 Bacteria 846
646 Ga0495631_0430056 3300046518 Bacteria 562
647 Ga0495632_0030178 3300046519 Bacteria 2817
648 Ga0495632_0311209 3300046519 Bacteria 697
649 Ga0495643_0030807 3300046522 Bacteria 2991
650 Ga0495644_0033247 3300046523 Bacteria 1948
651 Ga0495644_0124037 3300046523 Bacteria 983
652 Ga0495644_0219953 3300046523 Bacteria 734
653 Ga0495648_0002388 3300046524 Bacteria 17441
654 Ga0495648_0028489 3300046524 Bacteria 3719
655 Ga0495648_0049753 3300046524 Bacteria 2566
656 Ga0495648_0154277 3300046524 Bacteria 1194
657 Ga0495663_0024099 3300046525 Bacteria 1767
658 Ga0495666_0016798 3300046526 Bacteria 3644
659 Ga0495652_0108615 3300046529 Bacteria 2235
660 Ga0495654_0196737 3300046530 Bacteria 865
661 Ga0495665_0001211 3300046531 Bacteria 13779
662 Ga0495665_0344056 3300046531 Bacteria 760
663 Ga0495640_0000308 3300046533 Bacteria 33750
664 Ga0495640_0302454 3300046533 Bacteria 993
665 Ga0495586_0026603 3300046535 Bacteria 3095
666 Ga0495587_0111857 3300046536 Bacteria 1568
667 Ga0495598_0009519 3300046537 Bacteria 2300
668 Ga0495609_0084307 3300046538 Bacteria 1387
669 Ga0495609_0103033 3300046538 Bacteria 1235
670 Ga0495609_0200769 3300046538 Bacteria 833
671 Ga0495621_0031680 3300046539 Bacteria 1815
672 Ga0495621_0116962 3300046539 Bacteria 1027
673 Ga0495597_0046750 3300046542 Bacteria 1917
674 Ga0495645_0249377 3300046543 Bacteria 1181
675 Ga0495645_0466506 3300046543 Bacteria 794
676 Ga0495645_0499969 3300046543 Bacteria 760
677 Ga0495622_0071870 3300046557 Bacteria 1596
678 Ga0495622_0174901 3300046557 Bacteria 964
679 Ga0495622_0362936 3300046557 Bacteria 626
680 Ga0495633_0156261 3300046558 Bacteria 1052
681 Ga0495667_0004819 3300046559 Bacteria 9123
682 Ga0495667_0059343 3300046559 Bacteria 2511
683 Ga0495656_0066657 3300046615 Bacteria 1586
684 Ga0495656_0069224 3300046615 Bacteria 1562
685 Ga0495656_0081697 3300046615 Bacteria 1459
686 Ga0495656_0295093 3300046615 Bacteria 829
687 Ga0495634_0001740 3300046642 Bacteria 18853
688 Ga0495611_0143953 3300046648 Bacteria 1113
689 Ga0495611_0208445 3300046648 Bacteria 910
690 Ga0495611_0312613 3300046648 Bacteria 723
691 Ga0495625_0204925 3300046660 Bacteria 1299
692 Ga0495625_0355895 3300046660 Bacteria 924
693 Ga0495625_0479201 3300046660 Bacteria 764
694 Ga0495635_0123691 3300046663 Bacteria 1764
695 Ga0495635_0146903 3300046663 Bacteria 1605
696 Ga0495635_0485421 3300046663 Bacteria 814
697 Ga0495661_0009160 3300046665 Bacteria 6803
698 Ga0495661_0244073 3300046665 Bacteria 920
699 Ga0495588_0032601 3300046674 Bacteria 2626
700 Ga0495657_0036953 3300046675 Bacteria 3370
701 Ga0495657_0112932 3300046675 Bacteria 1719
702 Ga0495657_0307756 3300046675 Bacteria 944
703 Ga0495599_0835795 3300046678 Bacteria 524
704 Ga0495623_0145241 3300046679 Bacteria 1407
705 Ga0495646_0011359 3300046680 Bacteria 5655
706 Ga0495646_0203373 3300046680 Bacteria 1078
707 Ga0495646_0382475 3300046680 Bacteria 734
708 Ga0495646_0396963 3300046680 Bacteria 717
709 Ga0495647_0018313 3300046681 Bacteria 2491
710 Ga0495658_0003427 3300046683 Bacteria 7848
711 Ga0495658_0352552 3300046683 Bacteria 935
712 Ga0495669_0273973 3300046684 Bacteria 811
713 Ga0495669_0595724 3300046684 Bacteria 538
714 Ga0495613_0102117 3300046689 Bacteria 2070
715 Ga0495613_0272386 3300046689 Bacteria 1177
716 Ga0495624_0001854 3300046690 Bacteria 16126
717 Ga0495624_0424921 3300046690 Bacteria 797
718 Ga0495670_0012591 3300046691 Bacteria 4160
719 Ga0495670_0025017 3300046691 Bacteria 2952
720 Ga0495670_0160616 3300046691 Bacteria 1180
721 Ga0495671_0038681 3300046692 Bacteria 2410
722 Ga0495671_0159050 3300046692 Bacteria 1099
723 Ga0495671_0264401 3300046692 Bacteria 829
724 Ga0495649_0355860 3300046694 Bacteria 739
725 Ga0495649_0397405 3300046694 Bacteria 692
726 Ga0495589_0104610 3300046794 Bacteria 1368
727 Ga0495589_0118679 3300046794 Bacteria 1274
728 Ga0495600_0064379 3300046809 Bacteria 2397
729 Ga0495660_0083768 3300046810 Bacteria 1668
730 Ga0495660_0113507 3300046810 Bacteria 1380
731 Ga0495581_0323932 3300047315 Bacteria 900
732 Ga0495581_0584952 3300047315 Bacteria 647
733 Ga0495581_0850386 3300047315 Bacteria 522
734 Ga0495604_0321855 3300047317 Bacteria 1033
735 Ga0495604_0388890 3300047317 Bacteria 920
736 Ga0495674_0004710 3300047319 Bacteria 13122
737 Ga0495674_0235964 3300047319 Bacteria 1508
738 Ga0495672_0041351 3300047320 Bacteria 2789
739 Ga0495672_0126634 3300047320 Bacteria 1350
740 Ga0495672_0208956 3300047320 Bacteria 971
741 Ga0495672_0442487 3300047320 Bacteria 587
742 Ga0495676_0008153 3300047321 Bacteria 9610
743 Ga0495676_0055342 3300047321 Bacteria 3146
744 Ga0495680_0158558 3300047322 Bacteria 1645
745 Ga0495675_0735044 3300047444 Bacteria 550
746 Ga0495685_064697 3300047447 Bacteria 1229
747 Ga0495673_0013795 3300047469 Bacteria 4224
748 Ga0495681_0074459 3300047470 Bacteria 1531
749 Ga0495681_0390061 3300047470 Bacteria 522
750 Ga0495684_0011224 3300047471 Bacteria 6925
751 Ga0495686_0057579 3300047472 Bacteria 2425
752 Ga0495686_0333487 3300047472 Bacteria 828
753 Ga0495593_0000481 3300047673 Bacteria 22413
754 Ga0495593_0169061 3300047673 Bacteria 1102
755 Ga0495593_0603206 3300047673 Bacteria 551
756 Ga0495602_0054541 3300048088 Bacteria 3528
757 Ga0495602_0429898 3300048088 Bacteria 936
758 Ga0495602_0529729 3300048088 Bacteria 819
759 Ga0495602_0785887 3300048088 Bacteria 640
760 Ga0495614_0017575 3300048089 Bacteria 3106
761 Ga0495615_0028618 3300048090 Bacteria 1316
762 Ga0495626_0032344 3300048091 Bacteria 2513
763 Ga0496100_0058462 3300048903 Bacteria 2530
764 Ga0496100_0251157 3300048903 Bacteria 1308
765 Ga0496100_0611023 3300048903 Bacteria 847
766 Ga0496100_0651483 3300048903 Bacteria 820
767 Ga0496100_1592339 3300048903 Bacteria 516
768 Ga0496101_0043782 3300048904 Bacteria 3200
769 Ga0496101_0733389 3300048904 Bacteria 780
770 Ga0496102_0069429 3300048905 Bacteria 3234
771 Ga0496102_0234656 3300048905 Bacteria 1729
772 Ga0496102_0280548 3300048905 Bacteria 1570
773 Ga0496102_1068035 3300048905 Bacteria 727
774 Ga0496102_1150558 3300048905 Bacteria 695
775 Ga0496103_0028323 3300048906 Bacteria 3399
776 Ga0496103_0051103 3300048906 Bacteria 2558
777 Ga0496103_0779846 3300048906 Bacteria 603
778 Ga0496104_0075770 3300048907 Bacteria 3203
779 Ga0496104_0077792 3300048907 Bacteria 3161
780 Ga0496104_0079354 3300048907 Bacteria 3128
781 Ga0496104_0648129 3300048907 Bacteria 965
782 Ga0496105_0019080 3300048908 Bacteria 5526
783 Ga0496105_0046648 3300048908 Bacteria 3576
784 Ga0496105_0312470 3300048908 Bacteria 1261
785 Ga0496106_0024683 3300048909 Bacteria 4471
786 Ga0496106_0073135 3300048909 Bacteria 2622
787 Ga0496106_0089373 3300048909 Bacteria 2375
788 Ga0496106_0174208 3300048909 Bacteria 1706
789 Ga0496106_0486683 3300048909 Bacteria 991
790 Ga0496106_0502864 3300048909 Bacteria 973
791 Ga0496107_0026235 3300048910 Bacteria 4129
792 Ga0496107_0591544 3300048910 Bacteria 820
793 Ga0496107_1045338 3300048910 Bacteria 591
794 Ga0496108_0017334 3300048911 Bacteria 5890
795 Ga0496108_0025132 3300048911 Bacteria 4907
796 Ga0496108_0113647 3300048911 Bacteria 2317
797 Ga0496109_0082847 3300048912 Bacteria 2957
798 Ga0496109_0711930 3300048912 Bacteria 942
799 Ga0496110_0007419 3300048913 Bacteria 8756
800 Ga0496110_0025242 3300048913 Bacteria 5076
801 Ga0496110_0227914 3300048913 Bacteria 1694
802 Ga0496110_0327908 3300048913 Bacteria 1394
803 Ga0496111_0149776 3300048914 Bacteria 1730
804 Ga0496111_0179988 3300048914 Bacteria 1571
805 Ga0496111_0317300 3300048914 Bacteria 1154
806 Ga0496111_0428200 3300048914 Bacteria 977
807 Ga0496112_0012429 3300048915 Bacteria 7827
808 Ga0496112_0013478 3300048915 Bacteria 7548
809 Ga0496113_0058911 3300048916 Bacteria 2891
810 Ga0496113_0101602 3300048916 Bacteria 2229
811 Ga0496113_0277194 3300048916 Bacteria 1340
812 Ga0496113_0518721 3300048916 Bacteria 956
813 Ga0496114_0002910 3300048917 Bacteria 13118
814 Ga0496114_0336034 3300048917 Bacteria 1336
815 Ga0496114_0348104 3300048917 Bacteria 1310
816 Ga0496114_0404184 3300048917 Bacteria 1209
817 Ga0496114_1192695 3300048917 Bacteria 647
818 Ga0496114_1312969 3300048917 Bacteria 610
819 Ga0496115_0011971 3300048918 Bacteria 6518
820 Ga0496115_0055681 3300048918 Bacteria 3177
821 Ga0496115_0056553 3300048918 Bacteria 3153
822 Ga0496115_0084225 3300048918 Bacteria 2592
823 Ga0496115_0105999 3300048918 Bacteria 2307
824 Ga0496116_0010029 3300048919 Bacteria 7990
825 Ga0496116_0139548 3300048919 Bacteria 1366
826 Ga0496116_0261328 3300048919 Bacteria 853
827 Ga0496117_0041250 3300048920 Bacteria 3384
828 Ga0496117_0042436 3300048920 Bacteria 3319
829 Ga0496117_0049616 3300048920 Bacteria 2983
830 Ga0496117_0095600 3300048920 Bacteria 1898
831 Ga0496117_0169105 3300048920 Bacteria 1271
832 Ga0496118_0088324 3300048921 Bacteria 2144
833 Ga0496118_0093375 3300048921 Bacteria 2061
834 Ga0496118_0108921 3300048921 Bacteria 1845
835 Ga0496118_0202844 3300048921 Bacteria 1172
836 Ga0496118_0315208 3300048921 Bacteria 851
837 Ga0496119_0119087 3300048922 Bacteria 1454
838 Ga0496119_0161662 3300048922 Bacteria 1190
839 Ga0496119_0256276 3300048922 Bacteria 880
840 Ga0496120_0069814 3300048923 Bacteria 1934
841 Ga0496121_0021536 3300048924 Bacteria 6308
842 Ga0496121_0029380 3300048924 Bacteria 5084
843 Ga0496121_0036768 3300048924 Bacteria 4358
844 Ga0496121_0054773 3300048924 Bacteria 3329
845 Ga0496121_0078393 3300048924 Bacteria 2626
846 Ga0496121_0090891 3300048924 Bacteria 2385
847 Ga0496121_0132894 3300048924 Bacteria 1859
848 Ga0496121_0150187 3300048924 Bacteria 1715
849 Ga0496121_0230802 3300048924 Bacteria 1296
850 Ga0496121_0260930 3300048924 Bacteria 1196
851 Ga0496121_0272816 3300048924 Bacteria 1161
852 Ga0496121_0415061 3300048924 Bacteria 877
853 Ga0496122_0057566 3300048925 Bacteria 2885
854 Ga0496122_0063227 3300048925 Bacteria 2703
855 Ga0496123_0039147 3300048926 Bacteria 3320
856 Ga0496123_0091822 3300048926 Bacteria 1799
857 Ga0496123_0202866 3300048926 Bacteria 1015
858 Ga0496124_0168515 3300048927 Bacteria 1699
859 Ga0496124_0224144 3300048927 Bacteria 1411
860 Ga0496124_0239059 3300048927 Bacteria 1352
861 Ga0496124_0272567 3300048927 Bacteria 1238
862 Ga0496124_0294612 3300048927 Bacteria 1175
863 Ga0496124_0297418 3300048927 Bacteria 1168
864 Ga0496124_0472205 3300048927 Bacteria 849
865 Ga0496124_0476272 3300048927 Bacteria 844
866 Ga0496125_0001626 3300048928 Bacteria 31655
867 Ga0496125_0008236 3300048928 Bacteria 10953
868 Ga0496125_0017706 3300048928 Bacteria 6782
869 Ga0496125_0022912 3300048928 Bacteria 5785
870 Ga0496125_0092356 3300048928 Bacteria 2263
871 Ga0496125_0123949 3300048928 Bacteria 1836
872 Ga0496125_0137094 3300048928 Bacteria 1709
873 Ga0496126_0024468 3300048929 Bacteria 5830
874 Ga0496126_0080538 3300048929 Bacteria 2882
875 Ga0496126_0157128 3300048929 Bacteria 1945
876 Ga0496126_0302057 3300048929 Bacteria 1320
877 Ga0496126_0308671 3300048929 Bacteria 1303
878 Ga0496126_0311675 3300048929 Bacteria 1295
879 Ga0496126_0810501 3300048929 Bacteria 717
880 Ga0496126_1036089 3300048929 Bacteria 613
881 Ga0496126_1289889 3300048929 Bacteria 532
882 Ga0495678_085819 3300049459 Bacteria 1120
883 Ga0495682_0358696 3300049460 Bacteria 513
884 Ga0501033_0009293 3300049570 Bacteria 7573
885 Ga0501036_0664985 3300049572 Bacteria 862
886 Ga0501036_1130074 3300049572 Bacteria 639
887 Ga0501037_0167347 3300049573 Bacteria 1564
888 Ga0501037_0650780 3300049573 Bacteria 704
889 Ga0501037_0717448 3300049573 Bacteria 664
890 Ga0501037_0744407 3300049573 Bacteria 650
891 Ga0501038_0014330 3300049574 Bacteria 7224
892 Ga0501038_0089156 3300049574 Bacteria 2588
893 Ga0501042_0287651 3300049578 Bacteria 1187
894 Ga0501047_0144537 3300049581 Bacteria 2256
895 Ga0501047_0512204 3300049581 Bacteria 1026
896 Ga0501067_0343257 3300049583 Bacteria 832
897 Ga0501070_0040314 3300049586 Bacteria 3894
898 Ga0501072_0012390 3300049588 Bacteria 6515
899 Ga0501072_0917789 3300049588 Bacteria 684
900 Ga0501073_0105524 3300049589 Bacteria 1955
901 Ga0501073_0361359 3300049589 Bacteria 1003
902 Ga0501081_0756140 3300049743 Bacteria 730
903 Ga0501081_1159958 3300049743 Bacteria 585
904 Ga0501083_0126731 3300049744 Bacteria 1674
905 Ga0501044_0057309 3300049823 Bacteria 3998
906 Ga0501044_0072024 3300049823 Bacteria 3514
907 Ga0501044_0317607 3300049823 Bacteria 1483
908 nmdc:mga03683_172340_c1 3300050489 Bacteria 984
909 nmdc:mga03n38_111289_c1 3300050490 Bacteria 1334
910 nmdc:mga03n38_11321_c1 3300050490 Bacteria 3318
911 nmdc:mga03n38_314514_c1 3300050490 Bacteria 844
912 nmdc:mga00v17_121269_c1 3300050491 Bacteria 1665
913 nmdc:mga00v17_184422_c1 3300050491 Bacteria 1347
914 nmdc:mga00v17_246573_c1 3300050491 Bacteria 1158
915 nmdc:mga00v17_5831_c1 3300050491 Bacteria 6504
916 nmdc:mga0yw44_109944_c1 3300050492 Bacteria 1765
917 nmdc:mga0yw44_120592_c1 3300050492 Bacteria 1689
918 nmdc:mga0yw44_136880_c1 3300050492 Bacteria 1590
919 nmdc:mga0yw44_304513_c1 3300050492 Bacteria 1068
920 nmdc:mga0k408_217138_c1 3300050493 Bacteria 1142
921 nmdc:mga0k408_246872_c1 3300050493 Bacteria 1066
922 nmdc:mga0k408_401442_c1 3300050493 Bacteria 816
923 nmdc:mga06z11_114040_c1 3300050494 Bacteria 1500
924 nmdc:mga06z11_141014_c1 3300050494 Bacteria 1363
925 nmdc:mga06z11_306400_c1 3300050494 Bacteria 945
926 nmdc:mga06z11_43113_c1 3300050494 Bacteria 2268
927 nmdc:mga06z11_741_c1 3300050494 Bacteria 11909
928 nmdc:mga04h51_35336_c1 3300050495 Bacteria 1602
929 nmdc:mga04h51_76536_c1 3300050495 Bacteria 1179
930 nmdc:mga04h51_80413_c1 3300050495 Bacteria 1155
931 nmdc:mga04h51_86276_c1 3300050495 Bacteria 1123
932 nmdc:mga07m45_132211_c1 3300050496 Bacteria 1444
933 nmdc:mga07m45_313406_c1 3300050496 Bacteria 912
934 nmdc:mga07m45_66691_c1 3300050496 Bacteria 2045
935 nmdc:mga07m45_77493_c1 3300050496 Bacteria 1896
936 nmdc:mga05p37_276277_c1 3300050507 Bacteria 2006
937 nmdc:mga09592_699481_c1 3300050508 Bacteria 863
938 nmdc:mga08y16_139533_c1 3300050511 Bacteria 2520
939 nmdc:mga0n895_193701_c1 3300050512 Bacteria 2064
940 nmdc:mga0n895_382008_c1 3300050512 Bacteria 1425
941 nmdc:mga0rr50_16434_c1 3300050513 Bacteria 4916
942 nmdc:mga08x19_42743_c1 3300050514 Bacteria 2890
943 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
944 nmdc:mga0sz30_60596_c1 3300050516 Bacteria 1616
945 Ga0495601_0011690 3300053077 Bacteria 5261
946 Ga0495601_0107429 3300053077 Bacteria 1805
947 Ga0495612_0154990 3300053078 Bacteria 998
948 Ga0500610_0113084 3300053079 Bacteria 1394
949 Ga0500635_0002258 3300053080 Bacteria 4743
950 Ga0495655_0008263 3300053083 Bacteria 1970
951 Ga0495655_0224873 3300053083 Bacteria 622
952 Ga0495595_0015650 3300053084 Bacteria 3236
953 Ga0495619_0028557 3300053085 Bacteria 3599
954 Ga0495619_0046476 3300053085 Bacteria 2854
955 Ga0495619_0085770 3300053085 Bacteria 2127
956 Ga0500578_0243714 3300053086 Bacteria 1085
957 Ga0500578_0421519 3300053086 Bacteria 765
958 Ga0500643_011537 3300053087 Bacteria 3219
959 Ga0500643_053658 3300053087 Bacteria 1146
960 Ga0500581_059361 3300053089 Bacteria 1939
961 Ga0500583_0020359 3300053092 Bacteria 2738
962 Ga0500583_0113242 3300053092 Bacteria 1337
963 Ga0500651_0017310 3300053093 Bacteria 4443
964 Ga0500651_0227644 3300053093 Bacteria 1091
965 Ga0500566_0003522 3300053094 Bacteria 9339
966 Ga0500566_0004243 3300053094 Bacteria 8554
967 Ga0500566_0045772 3300053094 Bacteria 2517
968 Ga0500640_015757 3300053095 Bacteria 3174
969 Ga0500641_0110079 3300053096 Bacteria 1185
970 Ga0500641_0186920 3300053096 Bacteria 888
971 Ga0500641_0409145 3300053096 Bacteria 532
972 Ga0500650_0028315 3300053098 Bacteria 2528
973 Ga0500554_038573 3300053102 Bacteria 1454
974 Ga0500556_0000011 3300053104 Bacteria 253393
975 Ga0500556_0204775 3300053104 Bacteria 779
976 Ga0500557_057223 3300053105 Bacteria 1261
977 Ga0500557_174339 3300053105 Bacteria 701
978 Ga0500562_016870 3300053108 Bacteria 1878
979 Ga0500569_005295 3300053109 Bacteria 2764
980 Ga0500572_000463 3300053111 Bacteria 14085
981 Ga0500582_023586 3300053114 Bacteria 1793
982 Ga0500592_000478 3300053116 Bacteria 6661
983 Ga0500592_054724 3300053116 Bacteria 650
984 Ga0500593_010665 3300053117 Bacteria 3863
985 Ga0500593_103072 3300053117 Bacteria 1187
986 Ga0500595_012046 3300053119 Bacteria 3355
987 Ga0500607_045971 3300053121 Bacteria 2341
988 Ga0500608_001779 3300053122 Bacteria 7697
989 Ga0500608_007682 3300053122 Bacteria 4478
990 Ga0500608_257807 3300053122 Bacteria 675
991 Ga0500614_001185 3300053123 Bacteria 6390
992 Ga0500614_040385 3300053123 Bacteria 1184
993 Ga0500618_072359 3300053125 Bacteria 773
994 Ga0500642_0000030 3300053130 Bacteria 115114
995 Ga0500642_0004109 3300053130 Bacteria 4500
996 Ga0500652_000542 3300053131 Bacteria 13211
997 Ga0500658_0029816 3300053134 Bacteria 2124
998 Ga0500658_0115079 3300053134 Bacteria 1187
999 Ga0500658_0133937 3300053134 Bacteria 1107
1000 Ga0500559_0000272 3300053136 Bacteria 40384
1001 Ga0500559_0001304 3300053136 Bacteria 14396
1002 Ga0500559_0044429 3300053136 Bacteria 1943
1003 Ga0500568_0000246 3300053139 Bacteria 46161
1004 Ga0500568_0086735 3300053139 Bacteria 1183
1005 Ga0500568_0230451 3300053139 Bacteria 676
1006 Ga0500577_0000382 3300053142 Bacteria 11308
1007 Ga0500577_0069543 3300053142 Bacteria 1377
1008 Ga0500586_000521 3300053145 Bacteria 7722
1009 Ga0500588_0065705 3300053146 Bacteria 1175
1010 Ga0500588_0150164 3300053146 Bacteria 842
1011 Ga0500589_021101 3300053147 Bacteria 2983
1012 Ga0500590_024521 3300053148 Bacteria 3131
1013 Ga0500590_140130 3300053148 Bacteria 1106
1014 Ga0500603_000142 3300053150 Bacteria 17305
1015 Ga0500603_005139 3300053150 Bacteria 2806
1016 Ga0500603_009208 3300053150 Bacteria 2205
1017 Ga0500604_0016748 3300053151 Bacteria 2021
1018 Ga0500604_0019842 3300053151 Bacteria 1886
1019 Ga0500616_0000026 3300053153 Bacteria 454314
1020 Ga0500616_0312525 3300053153 Bacteria 649
1021 Ga0500620_006506 3300053155 Bacteria 2808
1022 Ga0500622_0004455 3300053156 Bacteria 8787
1023 Ga0500622_0014319 3300053156 Bacteria 4260
1024 Ga0500622_0050483 3300053156 Bacteria 2143
1025 Ga0500627_0048238 3300053158 Bacteria 1849
1026 Ga0500630_011616 3300053159 Bacteria 4335
1027 Ga0500634_0023185 3300053161 Bacteria 3373
1028 Ga0500634_0087074 3300053161 Bacteria 1595
1029 Ga0500638_010149 3300053162 Bacteria 4108
1030 Ga0500638_055515 3300053162 Bacteria 1909
1031 Ga0500639_000217 3300053163 Bacteria 28559
1032 Ga0500639_023025 3300053163 Bacteria 3290
1033 Ga0500639_224567 3300053163 Bacteria 779
1034 Ga0500636_0009756 3300053177 Bacteria 5592
1035 Ga0500636_0022787 3300053177 Bacteria 3701
1036 Ga0500636_0147855 3300053177 Bacteria 1293
1037 Ga0500637_0030787 3300053178 Bacteria 2988
1038 Ga0500567_058777 3300053723 Bacteria 1729
1039 Ga0500576_009243 3300053725 Bacteria 4319
1040 Ga0500645_041308 3300053730 Bacteria 1362
1041 Ga0500645_049796 3300053730 Bacteria 1224
1042 Ga0500596_004450 3300053735 Bacteria 2566
1043 Ga0500596_042555 3300053735 Bacteria 727
1044 Ga0500601_013495 3300053737 Bacteria 925
1045 Ga0501084_0217796 3300054114 Bacteria 1611
1046 Ga0500661_002512 3300055283 Bacteria 3463
1047 Ga0500661_079024 3300055283 Bacteria 608
1048 Ga0590075_199073 3300059424 Bacteria 530
1049 Ga0501082_0435310 3300060353 Bacteria 1145
1050 Ga0466962_0414162 3300061719 Bacteria 676
1051 Ga0530510_1033557 3300061734 Bacteria 629

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1053886 Ga0436363_1053886_58_474 138
2 3300046454 Ga0495592_0905318 Ga0495592_0905318_89_505 138
3 3300046557 Ga0495622_0071870 Ga0495622_0071870_1132_1548 138
4 3300048903 Ga0496100_1592339 Ga0496100_1592339_32_448 138
5 3300048924 Ga0496121_0021536 Ga0496121_0021536_15_431 138
6 3300050493 nmdc:mga0k408_401442_c1 nmdc:mga0k408_401442_c1_13_429 138
7 3300050496 nmdc:mga07m45_313406_c1 nmdc:mga07m45_313406_c1_474_890 138
8 3300053083 Ga0495655_0224873 Ga0495655_0224873_195_611 138
9 3300053105 Ga0500557_057223 Ga0500557_057223_835_1251 138
10 3300053735 Ga0500596_042555 Ga0500596_042555_260_679 138
11 3300031235 Ga0265330_10068015 Ga0265330_100680153 142
12 3300031238 Ga0265332_10239349 Ga0265332_102393492 142
13 3300031241 Ga0265325_10056360 Ga0265325_100563602 142
14 3300031344 Ga0265316_10751967 Ga0265316_107519671 142
15 3300031595 Ga0265313_10038538 Ga0265313_100385382 142
16 3300005458 Ga0070681_10641950 Ga0070681_106419502 145
17 3300039447 Ga0436361_0429619 Ga0436361_0429619_253_690 145
18 3300046455 Ga0495603_0718349 Ga0495603_0718349_114_554 145
19 3300046523 Ga0495644_0219953 Ga0495644_0219953_17_454 145
20 3300048909 Ga0496106_0174208 Ga0496106_0174208_1251_1688 145
21 3300049743 Ga0501081_1159958 Ga0501081_1159958_15_455 145
22 3300053163 Ga0500639_224567 Ga0500639_224567_310_750 145
23 iso_pu_bacteria 2906626472 2906633031 145
24 3300039437 Ga0436365_1314085 Ga0436365_1314085_1855_2301 146
25 3300005440 Ga0070705_100469736 Ga0070705_1004697361 150
26 3300005536 Ga0070697_100000384 Ga0070697_10000038436 150
27 3300005545 Ga0070695_100016132 Ga0070695_1000161324 150
28 3300006173 Ga0070716_100135925 Ga0070716_1001359253 150
29 3300006914 Ga0075436_100000569 Ga0075436_1000005698 150
30 3300007076 Ga0075435_100015953 Ga0075435_1000159534 150
31 3300025939 Ga0207665_10040549 Ga0207665_100405495 150
32 3300044694 Ga0466963_0056480 Ga0466963_0056480_485_946 150
33 3300044842 Ga0466957_0301379 Ga0466957_0301379_565_1026 150
34 3300045976 Ga0466967_0034197 Ga0466967_0034197_1361_1822 150
35 3300050513 nmdc:mga0rr50_16434_c1 nmdc:mga0rr50_16434_c1_2380_2832 150
36 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_150406_150858 150
37 3300005435 Ga0070714_100055427 Ga0070714_1000554272 151
38 3300005518 Ga0070699_101554062 Ga0070699_1015540621 151
39 3300006038 Ga0075365_10053696 Ga0075365_100536963 151
40 3300006042 Ga0075368_10003871 Ga0075368_100038713 151
41 3300006048 Ga0075363_100012017 Ga0075363_1000120173 151
42 3300006051 Ga0075364_10034716 Ga0075364_100347164 151
43 3300006178 Ga0075367_10015181 Ga0075367_100151813 151
44 3300006178 Ga0075367_10065607 Ga0075367_100656073 151
45 3300006186 Ga0075369_10008323 Ga0075369_100083235 151
46 3300006186 Ga0075369_10210636 Ga0075369_102106362 151
47 3300006195 Ga0075366_10030117 Ga0075366_100301173 151
48 3300006353 Ga0075370_10012433 Ga0075370_100124332 151
49 3300027866 Ga0209813_10081247 Ga0209813_100812472 151
50 3300027866 Ga0209813_10086754 Ga0209813_100867542 151
51 3300046519 Ga0495632_0311209 Ga0495632_0311209_101_568 151
52 3300048905 Ga0496102_1068035 Ga0496102_1068035_70_564 151
53 3300048909 Ga0496106_0073135 Ga0496106_0073135_1643_2137 151
54 3300048919 Ga0496116_0010029 Ga0496116_0010029_4045_4539 151
55 3300048920 Ga0496117_0042436 Ga0496117_0042436_2612_3106 151
56 3300048921 Ga0496118_0093375 Ga0496118_0093375_1211_1705 151
57 3300048926 Ga0496123_0091822 Ga0496123_0091822_177_671 151
58 3300048927 Ga0496124_0476272 Ga0496124_0476272_134_628 151
59 3300048928 Ga0496125_0017706 Ga0496125_0017706_1280_1774 151
60 3300049589 Ga0501073_0105524 Ga0501073_0105524_1232_1699 151
61 3300050490 nmdc:mga03n38_111289_c1 nmdc:mga03n38_111289_c1_326_793 151
62 3300050491 nmdc:mga00v17_184422_c1 nmdc:mga00v17_184422_c1_565_1032 151
63 3300050491 nmdc:mga00v17_5831_c1 nmdc:mga00v17_5831_c1_3883_4377 151
64 3300050492 nmdc:mga0yw44_109944_c1 nmdc:mga0yw44_109944_c1_1184_1651 151
65 3300050493 nmdc:mga0k408_246872_c1 nmdc:mga0k408_246872_c1_361_828 151
66 3300050494 nmdc:mga06z11_114040_c1 nmdc:mga06z11_114040_c1_448_942 151
67 3300050494 nmdc:mga06z11_43113_c1 nmdc:mga06z11_43113_c1_1691_2158 151
68 3300050495 nmdc:mga04h51_76536_c1 nmdc:mga04h51_76536_c1_173_667 151
69 3300050495 nmdc:mga04h51_86276_c1 nmdc:mga04h51_86276_c1_238_705 151
70 3300050496 nmdc:mga07m45_77493_c1 nmdc:mga07m45_77493_c1_1313_1780 151
71 3300050516 nmdc:mga0sz30_60596_c1 nmdc:mga0sz30_60596_c1_342_836 151
72 3300053134 Ga0500658_0133937 Ga0500658_0133937_360_827 151
73 iso_pu_bacteria 2922386360 2922392782 151
74 iso_pu_bacteria 3005483717 3005489001 151
75 iso_pu_bacteria 3005587118 3005593994 151
76 iso_pu_bacteria 8056673599 8056676927 151
77 iso_pu_bacteria 8056689827 8056694054 151
78 3300036459 Ga0372808_020118 Ga0372808_020118_456_938 152
79 3300049743 Ga0501081_0756140 Ga0501081_0756140_185_643 152
80 3300054114 Ga0501084_0217796 Ga0501084_0217796_1005_1475 152
81 iso_pu_bacteria 2617270741 2617377415 152
82 iso_pu_bacteria 2721755755 2723841881 152
83 iso_pu_bacteria 2721755755 2723848466 152
84 iso_pu_bacteria 2889033259 2889036959 152
85 iso_pu_bacteria 2922361189 2922363646 152
86 iso_pu_bacteria 2922386360 2922388807 152
87 iso_pu_bacteria 8006964411 8006969437 152
88 iso_pu_bacteria 8006964411 8006972733 152
89 iso_pu_bacteria 8019555841 8019559903 152
90 iso_pu_bacteria 8019565922 8019570007 152
91 iso_pu_bacteria 8056689827 8056691879 152
92 3300005347 Ga0070668_101044669 Ga0070668_1010446691 153
93 3300005436 Ga0070713_100324064 Ga0070713_1003240642 153
94 3300005455 Ga0070663_100447024 Ga0070663_1004470242 153
95 3300006038 Ga0075365_10235331 Ga0075365_102353312 153
96 3300006051 Ga0075364_10286629 Ga0075364_102866292 153
97 3300026067 Ga0207678_10034872 Ga0207678_100348722 153
98 3300028794 Ga0307515_10125784 Ga0307515_101257842 153
99 3300045051 Ga0451576_0068989 Ga0451576_0068989_2887_3354 153
100 3300045051 Ga0451576_0114449 Ga0451576_0114449_985_1452 153
101 3300046460 Ga0495638_0025730 Ga0495638_0025730_2630_3124 153
102 3300046501 Ga0495607_0015387 Ga0495607_0015387_1972_2466 153
103 3300046506 Ga0495583_0086025 Ga0495583_0086025_35_529 153
104 3300046512 Ga0495610_0029189 Ga0495610_0029189_1072_1566 153
105 3300046513 Ga0495616_0069232 Ga0495616_0069232_430_924 153
106 3300046518 Ga0495631_0043987 Ga0495631_0043987_160_651 153
107 3300046519 Ga0495632_0030178 Ga0495632_0030178_1499_1993 153
108 3300046522 Ga0495643_0030807 Ga0495643_0030807_895_1389 153
109 3300046524 Ga0495648_0049753 Ga0495648_0049753_160_654 153
110 3300046542 Ga0495597_0046750 Ga0495597_0046750_1342_1836 153
111 3300046665 Ga0495661_0009160 Ga0495661_0009160_5307_5801 153
112 3300046691 Ga0495670_0025017 Ga0495670_0025017_1530_2024 153
113 3300046692 Ga0495671_0038681 Ga0495671_0038681_42_536 153
114 3300046810 Ga0495660_0083768 Ga0495660_0083768_945_1439 153
115 3300047320 Ga0495672_0126634 Ga0495672_0126634_469_966 153
116 3300047472 Ga0495686_0333487 Ga0495686_0333487_175_669 153
117 3300047673 Ga0495593_0603206 Ga0495593_0603206_33_524 153
118 3300048919 Ga0496116_0261328 Ga0496116_0261328_160_654 153
119 3300048920 Ga0496117_0041250 Ga0496117_0041250_1352_1846 153
120 3300048921 Ga0496118_0088324 Ga0496118_0088324_1220_1714 153
121 3300048923 Ga0496120_0069814 Ga0496120_0069814_1195_1689 153
122 3300048925 Ga0496122_0063227 Ga0496122_0063227_1003_1497 153
123 3300048926 Ga0496123_0039147 Ga0496123_0039147_1534_2028 153
124 3300048928 Ga0496125_0022912 Ga0496125_0022912_129_626 153
125 3300048929 Ga0496126_0302057 Ga0496126_0302057_667_1161 153
126 3300049459 Ga0495678_085819 Ga0495678_085819_256_750 153
127 3300053087 Ga0500643_011537 Ga0500643_011537_94_588 153
128 3300053089 Ga0500581_059361 Ga0500581_059361_751_1242 153
129 3300053096 Ga0500641_0110079 Ga0500641_0110079_562_1056 153
130 3300053098 Ga0500650_0028315 Ga0500650_0028315_1606_2100 153
131 3300053104 Ga0500556_0000011 Ga0500556_0000011_135268_135759 153
132 3300053108 Ga0500562_016870 Ga0500562_016870_1099_1593 153
133 3300053109 Ga0500569_005295 Ga0500569_005295_1199_1693 153
134 3300053116 Ga0500592_000478 Ga0500592_000478_2174_2665 153
135 3300053117 Ga0500593_010665 Ga0500593_010665_1866_2357 153
136 3300053130 Ga0500642_0000030 Ga0500642_0000030_36081_36575 153
137 3300053131 Ga0500652_000542 Ga0500652_000542_10995_11492 153
138 3300053134 Ga0500658_0029816 Ga0500658_0029816_1502_1996 153
139 3300053139 Ga0500568_0000246 Ga0500568_0000246_10167_10661 153
140 3300053142 Ga0500577_0069543 Ga0500577_0069543_181_672 153
141 3300053146 Ga0500588_0150164 Ga0500588_0150164_93_587 153
142 3300053151 Ga0500604_0016748 Ga0500604_0016748_390_884 153
143 3300053153 Ga0500616_0000026 Ga0500616_0000026_212867_213358 153
144 3300053156 Ga0500622_0004455 Ga0500622_0004455_843_1340 153
145 3300053161 Ga0500634_0023185 Ga0500634_0023185_2488_2982 153
146 iso_pu_bacteria 2889033259 2889035208 153
147 3300003215 JGI25153J46596_10016618 JGI25153J46596_100166181 154
148 3300014325 Ga0163163_10164609 Ga0163163_101646092 154
149 3300025297 Ga0209758_1003593 Ga0209758_10035932 154
150 3300048906 Ga0496103_0028323 Ga0496103_0028323_2587_3054 154
151 3300048921 Ga0496118_0202844 Ga0496118_0202844_641_1135 154
152 3300053121 Ga0500607_045971 Ga0500607_045971_1192_1686 154
153 3300053136 Ga0500559_0000272 Ga0500559_0000272_4521_5015 154
154 3300003215 JGI25153J46596_10005700 JGI25153J46596_100057002 155
155 3300005327 Ga0070658_10349330 Ga0070658_103493302 155
156 3300005335 Ga0070666_10302793 Ga0070666_103027932 155
157 3300005344 Ga0070661_100473914 Ga0070661_1004739141 155
158 3300005366 Ga0070659_100111198 Ga0070659_1001111982 155
159 3300005435 Ga0070714_100407177 Ga0070714_1004071773 155
160 3300005548 Ga0070665_101810541 Ga0070665_1018105411 155
161 3300005563 Ga0068855_100094616 Ga0068855_1000946162 155
162 3300005564 Ga0070664_100829001 Ga0070664_1008290012 155
163 3300005578 Ga0068854_101073385 Ga0068854_1010733852 155
164 3300005614 Ga0068856_100092169 Ga0068856_1000921692 155
165 3300005616 Ga0068852_100032359 Ga0068852_1000323592 155
166 3300005840 Ga0068870_10386111 Ga0068870_103861111 155
167 3300005843 Ga0068860_101257128 Ga0068860_1012571282 155
168 3300005983 Ga0081540_1009947 Ga0081540_10099474 155
169 3300005985 Ga0081539_10055644 Ga0081539_100556441 155
170 3300006028 Ga0070717_11697386 Ga0070717_116973861 155
171 3300006177 Ga0075362_10128720 Ga0075362_101287201 155
172 3300006195 Ga0075366_10270108 Ga0075366_102701082 155
173 3300006353 Ga0075370_10163329 Ga0075370_101633292 155
174 3300009551 Ga0105238_10369234 Ga0105238_103692342 155
175 3300025297 Ga0209758_1013888 Ga0209758_10138882 155
176 3300025903 Ga0207680_10425102 Ga0207680_104251022 155
177 3300025909 Ga0207705_10299799 Ga0207705_102997992 155
178 3300025920 Ga0207649_10284882 Ga0207649_102848822 155
179 3300025929 Ga0207664_10404642 Ga0207664_104046421 155
180 3300025932 Ga0207690_10318298 Ga0207690_103182982 155
181 3300025940 Ga0207691_10451481 Ga0207691_104514812 155
182 3300025949 Ga0207667_10144533 Ga0207667_101445332 155
183 3300025986 Ga0207658_11593968 Ga0207658_115939682 155
184 3300026067 Ga0207678_10221370 Ga0207678_102213703 155
185 3300026078 Ga0207702_10750891 Ga0207702_107508911 155
186 3300028381 Ga0268264_10949356 Ga0268264_109493562 155
187 3300031241 Ga0265325_10040179 Ga0265325_100401793 155
188 3300031247 Ga0265340_10043557 Ga0265340_100435573 155
189 3300031249 Ga0265339_10221853 Ga0265339_102218532 155
190 3300031344 Ga0265316_10055990 Ga0265316_100559903 155
191 3300031711 Ga0265314_10022217 Ga0265314_100222173 155
192 3300031711 Ga0265314_10120398 Ga0265314_101203981 155
193 3300031712 Ga0265342_10110628 Ga0265342_101106282 155
194 3300031731 Ga0307405_10261428 Ga0307405_102614282 155
195 3300032002 Ga0307416_100569624 Ga0307416_1005696243 155
196 3300035111 Ga0373923_0213759 Ga0373923_0213759_145_630 155
197 3300035118 Ga0373954_0131333 Ga0373954_0131333_526_996 155
198 3300035172 Ga0373955_0070764 Ga0373955_0070764_1168_1653 155
199 3300035692 Ga0373935_0322151 Ga0373935_0322151_423_908 155
200 3300035725 Ga0373947_0027809 Ga0373947_0027809_2379_2864 155
201 3300036401 Ga0373937_0451735 Ga0373937_0451735_526_996 155
202 3300037853 Ga0436364_0079550 Ga0436364_0079550_287_757 155
203 3300039437 Ga0436365_1574673 Ga0436365_1574673_316_786 155
204 3300041413 Ga0439465_0332166 Ga0439465_0332166_31_501 155
205 3300041463 Ga0451804_0808098 Ga0451804_0808098_102_572 155
206 3300041491 Ga0451833_0609030 Ga0451833_0609030_155_625 155
207 3300045976 Ga0466967_0522965 Ga0466967_0522965_605_1072 155
208 3300046460 Ga0495638_0341623 Ga0495638_0341623_176_646 155
209 3300046475 Ga0495639_0443551 Ga0495639_0443551_164_634 155
210 3300046477 Ga0495664_0362889 Ga0495664_0362889_52_537 155
211 3300046511 Ga0495608_0157236 Ga0495608_0157236_289_759 155
212 3300046514 Ga0495618_0610785 Ga0495618_0610785_29_499 155
213 3300046516 Ga0495628_0892245 Ga0495628_0892245_102_572 155
214 3300046518 Ga0495631_0430056 Ga0495631_0430056_20_490 155
215 3300046536 Ga0495587_0111857 Ga0495587_0111857_902_1372 155
216 3300046543 Ga0495645_0499969 Ga0495645_0499969_153_623 155
217 3300046559 Ga0495667_0059343 Ga0495667_0059343_1883_2353 155
218 3300046660 Ga0495625_0355895 Ga0495625_0355895_18_488 155
219 3300046683 Ga0495658_0352552 Ga0495658_0352552_119_589 155
220 3300046689 Ga0495613_0272386 Ga0495613_0272386_22_507 155
221 3300047315 Ga0495581_0584952 Ga0495581_0584952_69_554 155
222 3300047322 Ga0495680_0158558 Ga0495680_0158558_233_703 155
223 3300048088 Ga0495602_0054541 Ga0495602_0054541_1443_1913 155
224 3300048091 Ga0495626_0032344 Ga0495626_0032344_1581_2069 155
225 3300048903 Ga0496100_0651483 Ga0496100_0651483_239_709 155
226 3300048917 Ga0496114_0348104 Ga0496114_0348104_70_540 155
227 3300048919 Ga0496116_0139548 Ga0496116_0139548_691_1194 155
228 3300048920 Ga0496117_0049616 Ga0496117_0049616_781_1284 155
229 3300048921 Ga0496118_0108921 Ga0496118_0108921_794_1297 155
230 3300048922 Ga0496119_0256276 Ga0496119_0256276_214_717 155
231 3300048924 Ga0496121_0078393 Ga0496121_0078393_1419_1922 155
232 3300048927 Ga0496124_0297418 Ga0496124_0297418_295_768 155
233 3300048928 Ga0496125_0123949 Ga0496125_0123949_88_561 155
234 3300049588 Ga0501072_0012390 Ga0501072_0012390_1637_2113 155
235 3300049588 Ga0501072_0917789 Ga0501072_0917789_200_670 155
236 3300053094 Ga0500566_0045772 Ga0500566_0045772_492_965 155
237 3300053148 Ga0500590_140130 Ga0500590_140130_261_734 155
238 3300053178 Ga0500637_0030787 Ga0500637_0030787_2152_2625 155
239 3300055283 Ga0500661_002512 Ga0500661_002512_723_1196 155
240 3300060353 Ga0501082_0435310 Ga0501082_0435310_272_748 155
241 iso_pu_bacteria 2523231067 2523469444 155
242 3300001979 JGI24740J21852_10014484 JGI24740J21852_100144842 156
243 3300001989 JGI24739J22299_10004030 JGI24739J22299_100040301 156
244 3300001990 JGI24737J22298_10002056 JGI24737J22298_100020569 156
245 3300001990 JGI24737J22298_10129081 JGI24737J22298_101290812 156
246 3300002067 JGI24735J21928_10011719 JGI24735J21928_100117194 156
247 3300002075 JGI24738J21930_10028233 JGI24738J21930_100282332 156
248 3300002244 JGI24742J22300_10014917 JGI24742J22300_100149172 156
249 3300003771 Ga0055526_1034174 Ga0055526_10341743 156
250 3300005327 Ga0070658_10558937 Ga0070658_105589371 156
251 3300005329 Ga0070683_100810669 Ga0070683_1008106691 156
252 3300005330 Ga0070690_100088327 Ga0070690_1000883273 156
253 3300005331 Ga0070670_100135329 Ga0070670_1001353293 156
254 3300005331 Ga0070670_101045608 Ga0070670_1010456081 156
255 3300005333 Ga0070677_10198491 Ga0070677_101984912 156
256 3300005334 Ga0068869_100191234 Ga0068869_1001912342 156
257 3300005334 Ga0068869_100305143 Ga0068869_1003051432 156
258 3300005335 Ga0070666_10287949 Ga0070666_102879492 156
259 3300005335 Ga0070666_10361107 Ga0070666_103611072 156
260 3300005336 Ga0070680_100235800 Ga0070680_1002358001 156
261 3300005336 Ga0070680_100642863 Ga0070680_1006428632 156
262 3300005338 Ga0068868_100019990 Ga0068868_1000199902 156
263 3300005338 Ga0068868_100377181 Ga0068868_1003771812 156
264 3300005338 Ga0068868_100552004 Ga0068868_1005520042 156
265 3300005338 Ga0068868_100790312 Ga0068868_1007903122 156
266 3300005339 Ga0070660_100125899 Ga0070660_1001258992 156
267 3300005339 Ga0070660_100139170 Ga0070660_1001391702 156
268 3300005339 Ga0070660_100231275 Ga0070660_1002312752 156
269 3300005339 Ga0070660_101177496 Ga0070660_1011774962 156
270 3300005340 Ga0070689_100084174 Ga0070689_1000841742 156
271 3300005340 Ga0070689_100181538 Ga0070689_1001815382 156
272 3300005341 Ga0070691_10471534 Ga0070691_104715341 156
273 3300005343 Ga0070687_100320155 Ga0070687_1003201552 156
274 3300005345 Ga0070692_10106970 Ga0070692_101069701 156
275 3300005347 Ga0070668_100008596 Ga0070668_1000085969 156
276 3300005347 Ga0070668_100421026 Ga0070668_1004210262 156
277 3300005354 Ga0070675_101028955 Ga0070675_1010289551 156
278 3300005356 Ga0070674_100535367 Ga0070674_1005353672 156
279 3300005364 Ga0070673_100379822 Ga0070673_1003798222 156
280 3300005365 Ga0070688_100109281 Ga0070688_1001092812 156
281 3300005365 Ga0070688_100187705 Ga0070688_1001877052 156
282 3300005365 Ga0070688_100509894 Ga0070688_1005098942 156
283 3300005366 Ga0070659_100043012 Ga0070659_1000430125 156
284 3300005366 Ga0070659_100856234 Ga0070659_1008562342 156
285 3300005367 Ga0070667_100143679 Ga0070667_1001436792 156
286 3300005406 Ga0070703_10027610 Ga0070703_100276102 156
287 3300005434 Ga0070709_10399467 Ga0070709_103994672 156
288 3300005435 Ga0070714_100002536 Ga0070714_1000025365 156
289 3300005435 Ga0070714_100680363 Ga0070714_1006803632 156
290 3300005436 Ga0070713_100003570 Ga0070713_1000035703 156
291 3300005436 Ga0070713_100783350 Ga0070713_1007833502 156
292 3300005437 Ga0070710_10002610 Ga0070710_100026102 156
293 3300005437 Ga0070710_10065506 Ga0070710_100655063 156
294 3300005438 Ga0070701_10303340 Ga0070701_103033402 156
295 3300005439 Ga0070711_100018537 Ga0070711_1000185373 156
296 3300005439 Ga0070711_100190218 Ga0070711_1001902181 156
297 3300005440 Ga0070705_100572324 Ga0070705_1005723242 156
298 3300005441 Ga0070700_100147481 Ga0070700_1001474812 156
299 3300005441 Ga0070700_100490873 Ga0070700_1004908731 156
300 3300005455 Ga0070663_100191365 Ga0070663_1001913653 156
301 3300005455 Ga0070663_100200596 Ga0070663_1002005962 156
302 3300005455 Ga0070663_101083076 Ga0070663_1010830761 156
303 3300005456 Ga0070678_100035710 Ga0070678_1000357104 156
304 3300005456 Ga0070678_100060695 Ga0070678_1000606952 156
305 3300005456 Ga0070678_100179814 Ga0070678_1001798143 156
306 3300005456 Ga0070678_100269806 Ga0070678_1002698062 156
307 3300005456 Ga0070678_100328286 Ga0070678_1003282862 156
308 3300005456 Ga0070678_100412705 Ga0070678_1004127052 156
309 3300005456 Ga0070678_100424534 Ga0070678_1004245342 156
310 3300005456 Ga0070678_100533871 Ga0070678_1005338712 156
311 3300005457 Ga0070662_100068160 Ga0070662_1000681602 156
312 3300005457 Ga0070662_100741424 Ga0070662_1007414242 156
313 3300005458 Ga0070681_10170449 Ga0070681_101704492 156
314 3300005466 Ga0070685_10068454 Ga0070685_100684543 156
315 3300005471 Ga0070698_100275574 Ga0070698_1002755743 156
316 3300005471 Ga0070698_100871735 Ga0070698_1008717352 156
317 3300005518 Ga0070699_100361620 Ga0070699_1003616202 156
318 3300005536 Ga0070697_100092326 Ga0070697_1000923262 156
319 3300005536 Ga0070697_100603834 Ga0070697_1006038342 156
320 3300005539 Ga0068853_100006456 Ga0068853_1000064567 156
321 3300005539 Ga0068853_100010388 Ga0068853_1000103885 156
322 3300005539 Ga0068853_100040041 Ga0068853_1000400412 156
323 3300005539 Ga0068853_100421512 Ga0068853_1004215122 156
324 3300005539 Ga0068853_100488873 Ga0068853_1004888732 156
325 3300005543 Ga0070672_100255182 Ga0070672_1002551822 156
326 3300005543 Ga0070672_100323731 Ga0070672_1003237313 156
327 3300005543 Ga0070672_100498318 Ga0070672_1004983182 156
328 3300005543 Ga0070672_100657671 Ga0070672_1006576712 156
329 3300005544 Ga0070686_100170627 Ga0070686_1001706272 156
330 3300005546 Ga0070696_100299323 Ga0070696_1002993232 156
331 3300005547 Ga0070693_100142838 Ga0070693_1001428383 156
332 3300005547 Ga0070693_100277759 Ga0070693_1002777591 156
333 3300005548 Ga0070665_100133394 Ga0070665_1001333942 156
334 3300005563 Ga0068855_100038648 Ga0068855_1000386483 156
335 3300005563 Ga0068855_100076604 Ga0068855_1000766042 156
336 3300005563 Ga0068855_100254602 Ga0068855_1002546022 156
337 3300005563 Ga0068855_100722267 Ga0068855_1007222671 156
338 3300005563 Ga0068855_101476773 Ga0068855_1014767731 156
339 3300005564 Ga0070664_100278900 Ga0070664_1002789002 156
340 3300005564 Ga0070664_100305066 Ga0070664_1003050662 156
341 3300005564 Ga0070664_100555127 Ga0070664_1005551272 156
342 3300005577 Ga0068857_100027957 Ga0068857_1000279573 156
343 3300005577 Ga0068857_100048760 Ga0068857_1000487602 156
344 3300005577 Ga0068857_100140897 Ga0068857_1001408972 156
345 3300005578 Ga0068854_100007431 Ga0068854_1000074317 156
346 3300005578 Ga0068854_100777806 Ga0068854_1007778062 156
347 3300005614 Ga0068856_100029161 Ga0068856_1000291612 156
348 3300005614 Ga0068856_100045204 Ga0068856_1000452042 156
349 3300005614 Ga0068856_100135913 Ga0068856_1001359132 156
350 3300005615 Ga0070702_100042891 Ga0070702_1000428912 156
351 3300005615 Ga0070702_100075220 Ga0070702_1000752202 156
352 3300005615 Ga0070702_100225410 Ga0070702_1002254102 156
353 3300005616 Ga0068852_100102155 Ga0068852_1001021552 156
354 3300005616 Ga0068852_100112799 Ga0068852_1001127992 156
355 3300005616 Ga0068852_100131914 Ga0068852_1001319144 156
356 3300005616 Ga0068852_100137079 Ga0068852_1001370792 156
357 3300005616 Ga0068852_100188789 Ga0068852_1001887892 156
358 3300005616 Ga0068852_100194999 Ga0068852_1001949991 156
359 3300005616 Ga0068852_100656478 Ga0068852_1006564782 156
360 3300005617 Ga0068859_100419536 Ga0068859_1004195362 156
361 3300005617 Ga0068859_100678715 Ga0068859_1006787153 156
362 3300005617 Ga0068859_100840332 Ga0068859_1008403322 156
363 3300005618 Ga0068864_100130491 Ga0068864_1001304913 156
364 3300005719 Ga0068861_100270675 Ga0068861_1002706752 156
365 3300005719 Ga0068861_100987566 Ga0068861_1009875662 156
366 3300005834 Ga0068851_10002363 Ga0068851_100023638 156
367 3300005834 Ga0068851_10059989 Ga0068851_100599893 156
368 3300005840 Ga0068870_10491058 Ga0068870_104910582 156
369 3300005842 Ga0068858_100095306 Ga0068858_1000953062 156
370 3300005842 Ga0068858_100146461 Ga0068858_1001464612 156
371 3300005843 Ga0068860_100631031 Ga0068860_1006310312 156
372 3300005843 Ga0068860_100898856 Ga0068860_1008988562 156
373 3300005844 Ga0068862_100046068 Ga0068862_1000460682 156
374 3300005844 Ga0068862_100433741 Ga0068862_1004337412 156
375 3300005937 Ga0081455_10004895 Ga0081455_100048952 156
376 3300005937 Ga0081455_10028806 Ga0081455_100288061 156
377 3300005937 Ga0081455_10044688 Ga0081455_100446882 156
378 3300005981 Ga0081538_10004197 Ga0081538_100041978 156
379 3300005981 Ga0081538_10010846 Ga0081538_100108462 156
380 3300005983 Ga0081540_1036194 Ga0081540_10361943 156
381 3300005985 Ga0081539_10009687 Ga0081539_100096877 156
382 3300006028 Ga0070717_10005959 Ga0070717_100059599 156
383 3300006038 Ga0075365_10071356 Ga0075365_100713564 156
384 3300006038 Ga0075365_10113217 Ga0075365_101132173 156
385 3300006038 Ga0075365_10317951 Ga0075365_103179512 156
386 3300006038 Ga0075365_11247432 Ga0075365_112474321 156
387 3300006042 Ga0075368_10113045 Ga0075368_101130452 156
388 3300006042 Ga0075368_10217343 Ga0075368_102173432 156
389 3300006048 Ga0075363_100106657 Ga0075363_1001066572 156
390 3300006051 Ga0075364_10133291 Ga0075364_101332912 156
391 3300006051 Ga0075364_10146891 Ga0075364_101468912 156
392 3300006058 Ga0075432_10051629 Ga0075432_100516292 156
393 3300006163 Ga0070715_10000598 Ga0070715_100005988 156
394 3300006163 Ga0070715_10448896 Ga0070715_104488961 156
395 3300006173 Ga0070716_100012954 Ga0070716_1000129541 156
396 3300006173 Ga0070716_100046882 Ga0070716_1000468822 156
397 3300006175 Ga0070712_100020443 Ga0070712_1000204433 156
398 3300006175 Ga0070712_100057804 Ga0070712_1000578043 156
399 3300006175 Ga0070712_100126974 Ga0070712_1001269743 156
400 3300006177 Ga0075362_10149866 Ga0075362_101498663 156
401 3300006178 Ga0075367_10007569 Ga0075367_100075692 156
402 3300006178 Ga0075367_10023304 Ga0075367_100233042 156
403 3300006178 Ga0075367_10194994 Ga0075367_101949942 156
404 3300006186 Ga0075369_10046833 Ga0075369_100468333 156
405 3300006186 Ga0075369_10053273 Ga0075369_100532733 156
406 3300006186 Ga0075369_10485200 Ga0075369_104852001 156
407 3300006195 Ga0075366_10212951 Ga0075366_102129512 156
408 3300006195 Ga0075366_10451629 Ga0075366_104516292 156
409 3300006237 Ga0097621_100065762 Ga0097621_1000657622 156
410 3300006237 Ga0097621_100361881 Ga0097621_1003618812 156
411 3300006353 Ga0075370_10072760 Ga0075370_100727602 156
412 3300006353 Ga0075370_10645190 Ga0075370_106451902 156
413 3300006844 Ga0075428_100031165 Ga0075428_1000311652 156
414 3300006844 Ga0075428_100146156 Ga0075428_1001461563 156
415 3300006871 Ga0075434_100303051 Ga0075434_1003030512 156
416 3300006871 Ga0075434_101101209 Ga0075434_1011012092 156
417 3300006881 Ga0068865_100411756 Ga0068865_1004117562 156
418 3300006931 Ga0097620_100419532 Ga0097620_1004195322 156
419 3300006931 Ga0097620_100678711 Ga0097620_1006787113 156
420 3300006931 Ga0097620_100840303 Ga0097620_1008403032 156
421 3300007076 Ga0075435_100252215 Ga0075435_1002522152 156
422 3300009093 Ga0105240_10003411 Ga0105240_100034115 156
423 3300009093 Ga0105240_10015393 Ga0105240_100153937 156
424 3300009093 Ga0105240_10029865 Ga0105240_100298652 156
425 3300009093 Ga0105240_10857771 Ga0105240_108577712 156
426 3300009098 Ga0105245_11776089 Ga0105245_117760892 156
427 3300009101 Ga0105247_10708510 Ga0105247_107085102 156
428 3300009147 Ga0114129_10202878 Ga0114129_102028783 156
429 3300009148 Ga0105243_10116001 Ga0105243_101160013 156
430 3300009148 Ga0105243_10460636 Ga0105243_104606362 156
431 3300009148 Ga0105243_10788911 Ga0105243_107889112 156
432 3300009174 Ga0105241_10002479 Ga0105241_100024794 156
433 3300009174 Ga0105241_10369543 Ga0105241_103695431 156
434 3300009174 Ga0105241_10546218 Ga0105241_105462182 156
435 3300009176 Ga0105242_10317021 Ga0105242_103170212 156
436 3300009176 Ga0105242_11398900 Ga0105242_113989002 156
437 3300009177 Ga0105248_10238832 Ga0105248_102388322 156
438 3300009177 Ga0105248_10679666 Ga0105248_106796661 156
439 3300009545 Ga0105237_10050884 Ga0105237_100508843 156
440 3300009545 Ga0105237_10109537 Ga0105237_101095373 156
441 3300009545 Ga0105237_10348303 Ga0105237_103483033 156
442 3300009545 Ga0105237_10773650 Ga0105237_107736502 156
443 3300009545 Ga0105237_11121505 Ga0105237_111215052 156
444 3300009551 Ga0105238_10005788 Ga0105238_100057884 156
445 3300009551 Ga0105238_10010373 Ga0105238_100103735 156
446 3300009551 Ga0105238_10190515 Ga0105238_101905152 156
447 3300009551 Ga0105238_10749485 Ga0105238_107494852 156
448 3300009553 Ga0105249_10604954 Ga0105249_106049541 156
449 3300009553 Ga0105249_10813825 Ga0105249_108138251 156
450 3300009553 Ga0105249_10816608 Ga0105249_108166082 156
451 3300009553 Ga0105249_10940915 Ga0105249_109409152 156
452 3300009553 Ga0105249_11734260 Ga0105249_117342602 156
453 3300010159 Ga0099796_10015145 Ga0099796_100151452 156
454 3300010159 Ga0099796_10161445 Ga0099796_101614451 156
455 3300010159 Ga0099796_10217887 Ga0099796_102178871 156
456 3300010159 Ga0099796_10300179 Ga0099796_103001791 156
457 3300010375 Ga0105239_10006751 Ga0105239_100067515 156
458 3300010375 Ga0105239_10038316 Ga0105239_100383167 156
459 3300010375 Ga0105239_10052562 Ga0105239_100525624 156
460 3300010375 Ga0105239_10109955 Ga0105239_101099552 156
461 3300010375 Ga0105239_10111235 Ga0105239_101112353 156
462 3300010375 Ga0105239_10534925 Ga0105239_105349251 156
463 3300010375 Ga0105239_11803139 Ga0105239_118031392 156
464 3300012490 Ga0157322_1007909 Ga0157322_10079091 156
465 3300013100 Ga0157373_10107960 Ga0157373_101079602 156
466 3300013102 Ga0157371_10395319 Ga0157371_103953192 156
467 3300013105 Ga0157369_10170948 Ga0157369_101709481 156
468 3300013105 Ga0157369_10216758 Ga0157369_102167582 156
469 3300013105 Ga0157369_11321370 Ga0157369_113213701 156
470 3300013296 Ga0157374_10116742 Ga0157374_101167423 156
471 3300013296 Ga0157374_10614723 Ga0157374_106147232 156
472 3300013306 Ga0163162_10395168 Ga0163162_103951682 156
473 3300013306 Ga0163162_11016984 Ga0163162_110169841 156
474 3300013306 Ga0163162_11022040 Ga0163162_110220402 156
475 3300013307 Ga0157372_10126018 Ga0157372_101260184 156
476 3300013307 Ga0157372_10524511 Ga0157372_105245111 156
477 3300013307 Ga0157372_10849016 Ga0157372_108490162 156
478 3300013308 Ga0157375_10343143 Ga0157375_103431433 156
479 3300013308 Ga0157375_10546228 Ga0157375_105462283 156
480 3300013308 Ga0157375_11723273 Ga0157375_117232732 156
481 3300014325 Ga0163163_10023747 Ga0163163_100237472 156
482 3300014745 Ga0157377_10135851 Ga0157377_101358512 156
483 3300014968 Ga0157379_10469693 Ga0157379_104696932 156
484 3300014968 Ga0157379_12215248 Ga0157379_122152481 156
485 3300014969 Ga0157376_10784459 Ga0157376_107844592 156
486 3300017792 Ga0163161_10615013 Ga0163161_106150132 156
487 3300020081 Ga0206354_11275229 Ga0206354_112752291 156
488 3300021321 Ga0214542_1044186 Ga0214542_10441862 156
489 3300021324 Ga0214545_1000009 Ga0214545_1000009182 156
490 3300021324 Ga0214545_1000094 Ga0214545_100009496 156
491 3300021384 Ga0213876_10048881 Ga0213876_100488812 156
492 3300025253 Ga0209677_107376 Ga0209677_1073762 156
493 3300025261 Ga0209233_1013039 Ga0209233_10130392 156
494 3300025272 Ga0209455_1003873 Ga0209455_10038732 156
495 3300025295 Ga0209564_1002186 Ga0209564_100218616 156
496 3300025297 Ga0209758_1009747 Ga0209758_10097478 156
497 3300025302 Ga0207426_1070523 Ga0207426_10705232 156
498 3300025315 Ga0207697_10027745 Ga0207697_100277453 156
499 3300025321 Ga0207656_10005300 Ga0207656_100053002 156
500 3300025321 Ga0207656_10132704 Ga0207656_101327042 156
501 3300025321 Ga0207656_10145009 Ga0207656_101450092 156
502 3300025885 Ga0207653_10114445 Ga0207653_101144452 156
503 3300025898 Ga0207692_10001799 Ga0207692_100017994 156
504 3300025898 Ga0207692_10031851 Ga0207692_100318512 156
505 3300025899 Ga0207642_10104301 Ga0207642_101043012 156
506 3300025900 Ga0207710_10120046 Ga0207710_101200462 156
507 3300025900 Ga0207710_10182100 Ga0207710_101821002 156
508 3300025900 Ga0207710_10191977 Ga0207710_101919772 156
509 3300025901 Ga0207688_10449513 Ga0207688_104495132 156
510 3300025903 Ga0207680_10381862 Ga0207680_103818622 156
511 3300025903 Ga0207680_10767300 Ga0207680_107673001 156
512 3300025904 Ga0207647_10102419 Ga0207647_101024192 156
513 3300025906 Ga0207699_10002114 Ga0207699_100021142 156
514 3300025906 Ga0207699_10365270 Ga0207699_103652702 156
515 3300025907 Ga0207645_10189071 Ga0207645_101890712 156
516 3300025907 Ga0207645_10197119 Ga0207645_101971192 156
517 3300025907 Ga0207645_10597451 Ga0207645_105974512 156
518 3300025908 Ga0207643_10065231 Ga0207643_100652312 156
519 3300025910 Ga0207684_10198374 Ga0207684_101983741 156
520 3300025911 Ga0207654_10000488 Ga0207654_100004883 156
521 3300025911 Ga0207654_10057785 Ga0207654_100577852 156
522 3300025911 Ga0207654_10288715 Ga0207654_102887152 156
523 3300025912 Ga0207707_10018804 Ga0207707_100188042 156
524 3300025913 Ga0207695_10002499 Ga0207695_1000249920 156
525 3300025913 Ga0207695_10058053 Ga0207695_100580533 156
526 3300025913 Ga0207695_10409973 Ga0207695_104099732 156
527 3300025913 Ga0207695_10892444 Ga0207695_108924441 156
528 3300025914 Ga0207671_10055229 Ga0207671_100552292 156
529 3300025914 Ga0207671_10121817 Ga0207671_101218172 156
530 3300025914 Ga0207671_10137048 Ga0207671_101370483 156
531 3300025914 Ga0207671_10463576 Ga0207671_104635762 156
532 3300025914 Ga0207671_11299722 Ga0207671_112997221 156
533 3300025915 Ga0207693_10001912 Ga0207693_1000191213 156
534 3300025915 Ga0207693_10072112 Ga0207693_100721123 156
535 3300025915 Ga0207693_10093765 Ga0207693_100937652 156
536 3300025915 Ga0207693_10455177 Ga0207693_104551772 156
537 3300025916 Ga0207663_10000468 Ga0207663_100004686 156
538 3300025916 Ga0207663_10154598 Ga0207663_101545983 156
539 3300025916 Ga0207663_10257974 Ga0207663_102579742 156
540 3300025917 Ga0207660_10238664 Ga0207660_102386641 156
541 3300025917 Ga0207660_10366625 Ga0207660_103666252 156
542 3300025919 Ga0207657_10233817 Ga0207657_102338172 156
543 3300025921 Ga0207652_10018004 Ga0207652_100180043 156
544 3300025921 Ga0207652_10256139 Ga0207652_102561392 156
545 3300025923 Ga0207681_10458110 Ga0207681_104581102 156
546 3300025923 Ga0207681_10952791 Ga0207681_109527911 156
547 3300025924 Ga0207694_10000258 Ga0207694_1000025846 156
548 3300025924 Ga0207694_10014516 Ga0207694_100145166 156
549 3300025924 Ga0207694_10022364 Ga0207694_100223644 156
550 3300025924 Ga0207694_10094707 Ga0207694_100947073 156
551 3300025924 Ga0207694_10424206 Ga0207694_104242062 156
552 3300025925 Ga0207650_10504971 Ga0207650_105049712 156
553 3300025925 Ga0207650_10877158 Ga0207650_108771582 156
554 3300025926 Ga0207659_10245962 Ga0207659_102459623 156
555 3300025926 Ga0207659_10532585 Ga0207659_105325852 156
556 3300025927 Ga0207687_10020017 Ga0207687_100200172 156
557 3300025927 Ga0207687_10317180 Ga0207687_103171802 156
558 3300025927 Ga0207687_10738533 Ga0207687_107385331 156
559 3300025928 Ga0207700_10019468 Ga0207700_100194683 156
560 3300025928 Ga0207700_11244980 Ga0207700_112449802 156
561 3300025929 Ga0207664_10040288 Ga0207664_100402882 156
562 3300025929 Ga0207664_10140530 Ga0207664_101405301 156
563 3300025929 Ga0207664_10597581 Ga0207664_105975812 156
564 3300025931 Ga0207644_10308486 Ga0207644_103084863 156
565 3300025933 Ga0207706_10086261 Ga0207706_100862612 156
566 3300025934 Ga0207686_10923331 Ga0207686_109233311 156
567 3300025935 Ga0207709_10167030 Ga0207709_101670302 156
568 3300025935 Ga0207709_10247442 Ga0207709_102474422 156
569 3300025935 Ga0207709_10287287 Ga0207709_102872872 156
570 3300025935 Ga0207709_10660633 Ga0207709_106606332 156
571 3300025936 Ga0207670_10066434 Ga0207670_100664343 156
572 3300025938 Ga0207704_10014231 Ga0207704_100142313 156
573 3300025938 Ga0207704_11148251 Ga0207704_111482511 156
574 3300025939 Ga0207665_10000791 Ga0207665_100007919 156
575 3300025940 Ga0207691_10538870 Ga0207691_105388702 156
576 3300025940 Ga0207691_11005299 Ga0207691_110052991 156
577 3300025941 Ga0207711_10238277 Ga0207711_102382772 156
578 3300025941 Ga0207711_11651921 Ga0207711_116519211 156
579 3300025942 Ga0207689_10237062 Ga0207689_102370623 156
580 3300025942 Ga0207689_10618340 Ga0207689_106183402 156
581 3300025944 Ga0207661_10657041 Ga0207661_106570411 156
582 3300025949 Ga0207667_10007013 Ga0207667_1000701310 156
583 3300025949 Ga0207667_10009886 Ga0207667_1000988610 156
584 3300025949 Ga0207667_10010097 Ga0207667_100100975 156
585 3300025949 Ga0207667_11585982 Ga0207667_115859822 156
586 3300025960 Ga0207651_10121574 Ga0207651_101215742 156
587 3300025960 Ga0207651_10510769 Ga0207651_105107692 156
588 3300025961 Ga0207712_11081005 Ga0207712_110810052 156
589 3300025972 Ga0207668_10005343 Ga0207668_100053439 156
590 3300025972 Ga0207668_10045426 Ga0207668_100454262 156
591 3300025972 Ga0207668_10523470 Ga0207668_105234702 156
592 3300025981 Ga0207640_10014499 Ga0207640_100144992 156
593 3300025981 Ga0207640_10019478 Ga0207640_100194782 156
594 3300026023 Ga0207677_10070393 Ga0207677_100703933 156
595 3300026023 Ga0207677_10247794 Ga0207677_102477942 156
596 3300026023 Ga0207677_10777377 Ga0207677_107773771 156
597 3300026035 Ga0207703_10145874 Ga0207703_101458743 156
598 3300026035 Ga0207703_10179462 Ga0207703_101794622 156
599 3300026035 Ga0207703_10689005 Ga0207703_106890051 156
600 3300026035 Ga0207703_10699017 Ga0207703_106990172 156
601 3300026041 Ga0207639_10004848 Ga0207639_100048487 156
602 3300026041 Ga0207639_10005744 Ga0207639_100057445 156
603 3300026041 Ga0207639_10035786 Ga0207639_100357862 156
604 3300026041 Ga0207639_10093845 Ga0207639_100938452 156
605 3300026041 Ga0207639_10686529 Ga0207639_106865291 156
606 3300026067 Ga0207678_10146025 Ga0207678_101460252 156
607 3300026067 Ga0207678_10712932 Ga0207678_107129322 156
608 3300026075 Ga0207708_10281862 Ga0207708_102818622 156
609 3300026078 Ga0207702_10000006 Ga0207702_1000000617 156
610 3300026088 Ga0207641_10317453 Ga0207641_103174532 156
611 3300026089 Ga0207648_10508952 Ga0207648_105089522 156
612 3300026095 Ga0207676_10056842 Ga0207676_100568422 156
613 3300026095 Ga0207676_10321145 Ga0207676_103211452 156
614 3300026095 Ga0207676_10757073 Ga0207676_107570731 156
615 3300026116 Ga0207674_10023277 Ga0207674_100232774 156
616 3300026116 Ga0207674_10036549 Ga0207674_100365493 156
617 3300026118 Ga0207675_100470650 Ga0207675_1004706501 156
618 3300026121 Ga0207683_10013150 Ga0207683_100131502 156
619 3300026121 Ga0207683_10063276 Ga0207683_100632761 156
620 3300026121 Ga0207683_10623762 Ga0207683_106237622 156
621 3300026142 Ga0207698_10016031 Ga0207698_100160311 156
622 3300026142 Ga0207698_10149202 Ga0207698_101492023 156
623 3300026142 Ga0207698_10157168 Ga0207698_101571681 156
624 3300026142 Ga0207698_10815399 Ga0207698_108153992 156
625 3300027512 Ga0209179_1005879 Ga0209179_10058792 156
626 3300027866 Ga0209813_10141147 Ga0209813_101411472 156
627 3300027907 Ga0207428_10195964 Ga0207428_101959641 156
628 3300028379 Ga0268266_10080191 Ga0268266_100801912 156
629 3300028379 Ga0268266_10086045 Ga0268266_100860452 156
630 3300028379 Ga0268266_10353347 Ga0268266_103533471 156
631 3300028379 Ga0268266_10529147 Ga0268266_105291472 156
632 3300028379 Ga0268266_11064957 Ga0268266_110649571 156
633 3300028380 Ga0268265_10061284 Ga0268265_100612842 156
634 3300028380 Ga0268265_10121783 Ga0268265_101217832 156
635 3300028380 Ga0268265_10215400 Ga0268265_102154003 156
636 3300028380 Ga0268265_10662327 Ga0268265_106623271 156
637 3300028381 Ga0268264_10284455 Ga0268264_102844551 156
638 3300028381 Ga0268264_10831907 Ga0268264_108319072 156
639 3300028786 Ga0307517_10160582 Ga0307517_101605822 156
640 3300028794 Ga0307515_10060735 Ga0307515_100607355 156
641 3300031249 Ga0265339_10006205 Ga0265339_100062057 156
642 3300031456 Ga0307513_10234990 Ga0307513_102349902 156
643 3300031456 Ga0307513_10395212 Ga0307513_103952121 156
644 3300031456 Ga0307513_10719133 Ga0307513_107191331 156
645 3300031456 Ga0307513_10778702 Ga0307513_107787021 156
646 3300031507 Ga0307509_10323905 Ga0307509_103239051 156
647 3300031507 Ga0307509_10850076 Ga0307509_108500761 156
648 3300031616 Ga0307508_10000154 Ga0307508_1000015463 156
649 3300031616 Ga0307508_10006872 Ga0307508_1000687213 156
650 3300031616 Ga0307508_10044377 Ga0307508_100443772 156
651 3300031616 Ga0307508_10050452 Ga0307508_100504523 156
652 3300031616 Ga0307508_10156036 Ga0307508_101560362 156
653 3300031711 Ga0265314_10113472 Ga0265314_101134722 156
654 3300031712 Ga0265342_10004062 Ga0265342_100040627 156
655 3300031712 Ga0265342_10019741 Ga0265342_100197413 156
656 3300031730 Ga0307516_10073486 Ga0307516_100734865 156
657 3300031730 Ga0307516_10384296 Ga0307516_103842962 156
658 3300031730 Ga0307516_10412146 Ga0307516_104121462 156
659 3300031731 Ga0307405_10490481 Ga0307405_104904812 156
660 3300031731 Ga0307405_11504341 Ga0307405_115043411 156
661 3300031911 Ga0307412_11432364 Ga0307412_114323641 156
662 3300031995 Ga0307409_100756929 Ga0307409_1007569291 156
663 3300031995 Ga0307409_100991804 Ga0307409_1009918041 156
664 3300032004 Ga0307414_10230161 Ga0307414_102301612 156
665 3300032004 Ga0307414_10521770 Ga0307414_105217702 156
666 3300032126 Ga0307415_100509834 Ga0307415_1005098342 156
667 3300032126 Ga0307415_100671707 Ga0307415_1006717071 156
668 3300032126 Ga0307415_102283177 Ga0307415_1022831771 156
669 3300033180 Ga0307510_10035129 Ga0307510_100351298 156
670 3300033180 Ga0307510_10123405 Ga0307510_101234053 156
671 3300033180 Ga0307510_10296363 Ga0307510_102963631 156
672 3300033546 Ga0316213_1002512 Ga0316213_10025122 156
673 3300034816 Ga0373930_0039630 Ga0373930_0039630_451_924 156
674 3300034957 Ga0373938_0029635 Ga0373938_0029635_487_957 156
675 3300035088 Ga0373940_0093274 Ga0373940_0093274_94_564 156
676 3300035092 Ga0373952_0007320 Ga0373952_0007320_939_1409 156
677 3300035112 Ga0373932_0046080 Ga0373932_0046080_546_1019 156
678 3300035112 Ga0373932_0342432 Ga0373932_0342432_15_485 156
679 3300035113 Ga0373936_0004495 Ga0373936_0004495_2231_2728 156
680 3300035113 Ga0373936_0008591 Ga0373936_0008591_832_1317 156
681 3300035113 Ga0373936_0183992 Ga0373936_0183992_142_615 156
682 3300035115 Ga0373941_0050413 Ga0373941_0050413_475_948 156
683 3300035115 Ga0373941_0395687 Ga0373941_0395687_77_547 156
684 3300035116 Ga0373945_0013000 Ga0373945_0013000_468_965 156
685 3300035119 Ga0373956_0031554 Ga0373956_0031554_1165_1653 156
686 3300035120 Ga0373957_0134480 Ga0373957_0134480_110_598 156
687 3300035170 Ga0373943_0003586 Ga0373943_0003586_1191_1688 156
688 3300035171 Ga0373946_0514223 Ga0373946_0514223_63_536 156
689 3300035171 Ga0373946_0717648 Ga0373946_0717648_33_506 156
690 3300035172 Ga0373955_0458847 Ga0373955_0458847_162_632 156
691 3300035172 Ga0373955_0523022 Ga0373955_0523022_184_654 156
692 3300035410 Ga0373924_0008812 Ga0373924_0008812_1401_1901 156
693 3300035691 Ga0373931_0000507 Ga0373931_0000507_8999_9472 156
694 3300035691 Ga0373931_0234557 Ga0373931_0234557_566_1036 156
695 3300035695 Ga0373927_0003207 Ga0373927_0003207_1403_1903 156
696 3300035695 Ga0373927_0029468 Ga0373927_0029468_1818_2288 156
697 3300035724 Ga0373933_0000278 Ga0373933_0000278_6986_7456 156
698 3300036401 Ga0373937_0040577 Ga0373937_0040577_1006_1506 156
699 3300037068 Ga0373925_0006083 Ga0373925_0006083_772_1269 156
700 3300037068 Ga0373925_0278169 Ga0373925_0278169_133_603 156
701 3300037068 Ga0373925_0587153 Ga0373925_0587153_282_752 156
702 3300037068 Ga0373925_0649613 Ga0373925_0649613_58_528 156
703 3300037418 Ga0395900_0134282 Ga0395900_0134282_642_1112 156
704 3300037466 Ga0395898_0005012 Ga0395898_0005012_2887_3357 156
705 3300037466 Ga0395898_0443014 Ga0395898_0443014_271_741 156
706 3300038443 Ga0395901_0153112 Ga0395901_0153112_744_1214 156
707 3300038443 Ga0395901_0174892 Ga0395901_0174892_1155_1625 156
708 3300038443 Ga0395901_1754424 Ga0395901_1754424_85_555 156
709 3300039438 Ga0436360_0641463 Ga0436360_0641463_172_642 156
710 3300039450 Ga0436363_0241633 Ga0436363_0241633_326_796 156
711 3300039450 Ga0436363_0444982 Ga0436363_0444982_12_482 156
712 3300041413 Ga0439465_0037505 Ga0439465_0037505_1070_1546 156
713 3300041413 Ga0439465_0118360 Ga0439465_0118360_160_630 156
714 3300041451 Ga0451791_1090847 Ga0451791_1090847_526_999 156
715 3300041451 Ga0451791_1192174 Ga0451791_1192174_135_605 156
716 3300041459 Ga0451800_1308288 Ga0451800_1308288_254_727 156
717 3300041507 Ga0451851_0648074 Ga0451851_0648074_23_493 156
718 3300041512 Ga0451853_1533967 Ga0451853_1533967_396_869 156
719 3300041512 Ga0451853_3299164 Ga0451853_3299164_311_784 156
720 3300041997 Ga0439431_0022287 Ga0439431_0022287_659_1135 156
721 3300042004 Ga0439445_0045575 Ga0439445_0045575_642_1112 156
722 3300042142 Ga0450905_028721 Ga0450905_028721_43_513 156
723 3300042435 Ga0439434_0047398 Ga0439434_0047398_744_1214 156
724 3300042438 Ga0439459_0006825 Ga0439459_0006825_575_1048 156
725 3300044684 Ga0466966_0538676 Ga0466966_0538676_172_648 156
726 3300044706 Ga0466964_0038463 Ga0466964_0038463_1065_1544 156
727 3300044765 Ga0466970_0487314 Ga0466970_0487314_196_669 156
728 3300044842 Ga0466957_0249422 Ga0466957_0249422_384_863 156
729 3300044901 Ga0466960_0674131 Ga0466960_0674131_129_599 156
730 3300045049 Ga0466959_0234345 Ga0466959_0234345_237_710 156
731 3300045051 Ga0451576_1808318 Ga0451576_1808318_105_575 156
732 3300045976 Ga0466967_0944765 Ga0466967_0944765_242_712 156
733 3300046452 Ga0495617_015362 Ga0495617_015362_247_720 156
734 3300046454 Ga0495592_0012627 Ga0495592_0012627_2979_3476 156
735 3300046455 Ga0495603_0001599 Ga0495603_0001599_11387_11884 156
736 3300046455 Ga0495603_0050821 Ga0495603_0050821_532_1005 156
737 3300046455 Ga0495603_0205660 Ga0495603_0205660_241_711 156
738 3300046458 Ga0495591_036772 Ga0495591_036772_561_1031 156
739 3300046459 Ga0495629_0000314 Ga0495629_0000314_23186_23686 156
740 3300046459 Ga0495629_0077007 Ga0495629_0077007_332_802 156
741 3300046460 Ga0495638_0065201 Ga0495638_0065201_800_1273 156
742 3300046461 Ga0495641_0002314 Ga0495641_0002314_9324_9821 156
743 3300046462 Ga0495651_0092239 Ga0495651_0092239_1187_1687 156
744 3300046462 Ga0495651_0139413 Ga0495651_0139413_324_794 156
745 3300046463 Ga0495653_0034870 Ga0495653_0034870_3180_3677 156
746 3300046463 Ga0495653_0195948 Ga0495653_0195948_414_884 156
747 3300046463 Ga0495653_0224516 Ga0495653_0224516_329_802 156
748 3300046472 Ga0495580_0002541 Ga0495580_0002541_6439_6939 156
749 3300046472 Ga0495580_0447853 Ga0495580_0447853_361_831 156
750 3300046473 Ga0495582_0006906 Ga0495582_0006906_5020_5517 156
751 3300046473 Ga0495582_0204540 Ga0495582_0204540_293_766 156
752 3300046474 Ga0495605_0124399 Ga0495605_0124399_504_974 156
753 3300046475 Ga0495639_0017614 Ga0495639_0017614_2288_2758 156
754 3300046476 Ga0495662_0000638 Ga0495662_0000638_14471_14968 156
755 3300046476 Ga0495662_0216931 Ga0495662_0216931_52_525 156
756 3300046477 Ga0495664_0013161 Ga0495664_0013161_1594_2091 156
757 3300046477 Ga0495664_0070544 Ga0495664_0070544_833_1303 156
758 3300046491 Ga0495584_0029858 Ga0495584_0029858_912_1382 156
759 3300046491 Ga0495584_0094580 Ga0495584_0094580_229_702 156
760 3300046491 Ga0495584_0239778 Ga0495584_0239778_221_715 156
761 3300046492 Ga0495585_0132551 Ga0495585_0132551_456_929 156
762 3300046499 Ga0495594_0002386 Ga0495594_0002386_6055_6552 156
763 3300046499 Ga0495594_0125281 Ga0495594_0125281_47_517 156
764 3300046500 Ga0495596_0215009 Ga0495596_0215009_58_531 156
765 3300046501 Ga0495607_0070643 Ga0495607_0070643_1197_1670 156
766 3300046511 Ga0495608_0268295 Ga0495608_0268295_152_649 156
767 3300046512 Ga0495610_0134507 Ga0495610_0134507_153_626 156
768 3300046516 Ga0495628_0014010 Ga0495628_0014010_2513_3013 156
769 3300046517 Ga0495630_0002415 Ga0495630_0002415_9575_10075 156
770 3300046517 Ga0495630_0129744 Ga0495630_0129744_111_581 156
771 3300046517 Ga0495630_0268357 Ga0495630_0268357_368_841 156
772 3300046518 Ga0495631_0203453 Ga0495631_0203453_235_705 156
773 3300046523 Ga0495644_0033247 Ga0495644_0033247_422_895 156
774 3300046523 Ga0495644_0124037 Ga0495644_0124037_145_615 156
775 3300046524 Ga0495648_0002388 Ga0495648_0002388_3151_3621 156
776 3300046524 Ga0495648_0028489 Ga0495648_0028489_2819_3289 156
777 3300046524 Ga0495648_0154277 Ga0495648_0154277_199_672 156
778 3300046525 Ga0495663_0024099 Ga0495663_0024099_436_909 156
779 3300046526 Ga0495666_0016798 Ga0495666_0016798_599_1096 156
780 3300046529 Ga0495652_0108615 Ga0495652_0108615_167_664 156
781 3300046530 Ga0495654_0196737 Ga0495654_0196737_193_663 156
782 3300046531 Ga0495665_0001211 Ga0495665_0001211_1403_1900 156
783 3300046531 Ga0495665_0344056 Ga0495665_0344056_263_733 156
784 3300046533 Ga0495640_0000308 Ga0495640_0000308_23380_23880 156
785 3300046533 Ga0495640_0302454 Ga0495640_0302454_176_649 156
786 3300046535 Ga0495586_0026603 Ga0495586_0026603_1475_1963 156
787 3300046537 Ga0495598_0009519 Ga0495598_0009519_1217_1690 156
788 3300046538 Ga0495609_0084307 Ga0495609_0084307_589_1059 156
789 3300046538 Ga0495609_0103033 Ga0495609_0103033_339_809 156
790 3300046538 Ga0495609_0200769 Ga0495609_0200769_304_774 156
791 3300046539 Ga0495621_0031680 Ga0495621_0031680_673_1143 156
792 3300046539 Ga0495621_0116962 Ga0495621_0116962_58_531 156
793 3300046543 Ga0495645_0249377 Ga0495645_0249377_615_1088 156
794 3300046543 Ga0495645_0466506 Ga0495645_0466506_22_495 156
795 3300046557 Ga0495622_0174901 Ga0495622_0174901_323_793 156
796 3300046557 Ga0495622_0362936 Ga0495622_0362936_86_583 156
797 3300046558 Ga0495633_0156261 Ga0495633_0156261_469_939 156
798 3300046559 Ga0495667_0004819 Ga0495667_0004819_2739_3239 156
799 3300046615 Ga0495656_0066657 Ga0495656_0066657_510_983 156
800 3300046615 Ga0495656_0069224 Ga0495656_0069224_891_1361 156
801 3300046615 Ga0495656_0081697 Ga0495656_0081697_429_899 156
802 3300046615 Ga0495656_0295093 Ga0495656_0295093_188_658 156
803 3300046642 Ga0495634_0001740 Ga0495634_0001740_5387_5884 156
804 3300046648 Ga0495611_0143953 Ga0495611_0143953_250_729 156
805 3300046648 Ga0495611_0208445 Ga0495611_0208445_13_486 156
806 3300046648 Ga0495611_0312613 Ga0495611_0312613_52_522 156
807 3300046660 Ga0495625_0204925 Ga0495625_0204925_301_771 156
808 3300046660 Ga0495625_0479201 Ga0495625_0479201_159_629 156
809 3300046663 Ga0495635_0123691 Ga0495635_0123691_166_699 156
810 3300046663 Ga0495635_0146903 Ga0495635_0146903_981_1451 156
811 3300046663 Ga0495635_0485421 Ga0495635_0485421_32_508 156
812 3300046665 Ga0495661_0244073 Ga0495661_0244073_426_896 156
813 3300046674 Ga0495588_0032601 Ga0495588_0032601_1994_2464 156
814 3300046675 Ga0495657_0036953 Ga0495657_0036953_2311_2799 156
815 3300046675 Ga0495657_0112932 Ga0495657_0112932_487_999 156
816 3300046675 Ga0495657_0307756 Ga0495657_0307756_183_656 156
817 3300046678 Ga0495599_0835795 Ga0495599_0835795_17_514 156
818 3300046679 Ga0495623_0145241 Ga0495623_0145241_164_661 156
819 3300046680 Ga0495646_0011359 Ga0495646_0011359_4167_4667 156
820 3300046680 Ga0495646_0203373 Ga0495646_0203373_396_887 156
821 3300046680 Ga0495646_0382475 Ga0495646_0382475_81_566 156
822 3300046680 Ga0495646_0396963 Ga0495646_0396963_100_573 156
823 3300046681 Ga0495647_0018313 Ga0495647_0018313_799_1296 156
824 3300046683 Ga0495658_0003427 Ga0495658_0003427_5949_6446 156
825 3300046684 Ga0495669_0273973 Ga0495669_0273973_307_780 156
826 3300046684 Ga0495669_0595724 Ga0495669_0595724_46_519 156
827 3300046689 Ga0495613_0102117 Ga0495613_0102117_799_1296 156
828 3300046690 Ga0495624_0001854 Ga0495624_0001854_135_632 156
829 3300046690 Ga0495624_0424921 Ga0495624_0424921_89_559 156
830 3300046691 Ga0495670_0012591 Ga0495670_0012591_291_761 156
831 3300046691 Ga0495670_0160616 Ga0495670_0160616_203_676 156
832 3300046692 Ga0495671_0159050 Ga0495671_0159050_90_563 156
833 3300046692 Ga0495671_0264401 Ga0495671_0264401_146_616 156
834 3300046694 Ga0495649_0355860 Ga0495649_0355860_208_681 156
835 3300046694 Ga0495649_0397405 Ga0495649_0397405_21_518 156
836 3300046794 Ga0495589_0104610 Ga0495589_0104610_746_1216 156
837 3300046794 Ga0495589_0118679 Ga0495589_0118679_648_1118 156
838 3300046809 Ga0495600_0064379 Ga0495600_0064379_1885_2376 156
839 3300046810 Ga0495660_0113507 Ga0495660_0113507_889_1359 156
840 3300047315 Ga0495581_0323932 Ga0495581_0323932_81_551 156
841 3300047315 Ga0495581_0850386 Ga0495581_0850386_39_509 156
842 3300047317 Ga0495604_0321855 Ga0495604_0321855_421_894 156
843 3300047317 Ga0495604_0388890 Ga0495604_0388890_237_746 156
844 3300047319 Ga0495674_0004710 Ga0495674_0004710_10076_10573 156
845 3300047319 Ga0495674_0235964 Ga0495674_0235964_460_930 156
846 3300047320 Ga0495672_0041351 Ga0495672_0041351_338_850 156
847 3300047320 Ga0495672_0208956 Ga0495672_0208956_454_930 156
848 3300047320 Ga0495672_0442487 Ga0495672_0442487_34_504 156
849 3300047321 Ga0495676_0008153 Ga0495676_0008153_6011_6484 156
850 3300047321 Ga0495676_0055342 Ga0495676_0055342_1247_1744 156
851 3300047444 Ga0495675_0735044 Ga0495675_0735044_21_491 156
852 3300047447 Ga0495685_064697 Ga0495685_064697_568_1041 156
853 3300047469 Ga0495673_0013795 Ga0495673_0013795_648_1139 156
854 3300047470 Ga0495681_0074459 Ga0495681_0074459_661_1167 156
855 3300047470 Ga0495681_0390061 Ga0495681_0390061_17_487 156
856 3300047471 Ga0495684_0011224 Ga0495684_0011224_1072_1569 156
857 3300047472 Ga0495686_0057579 Ga0495686_0057579_1152_1631 156
858 3300047673 Ga0495593_0000481 Ga0495593_0000481_20642_21139 156
859 3300047673 Ga0495593_0169061 Ga0495593_0169061_449_982 156
860 3300048088 Ga0495602_0429898 Ga0495602_0429898_345_818 156
861 3300048088 Ga0495602_0529729 Ga0495602_0529729_189_746 156
862 3300048088 Ga0495602_0785887 Ga0495602_0785887_94_591 156
863 3300048089 Ga0495614_0017575 Ga0495614_0017575_2322_2822 156
864 3300048090 Ga0495615_0028618 Ga0495615_0028618_386_859 156
865 3300048903 Ga0496100_0058462 Ga0496100_0058462_1075_1548 156
866 3300048903 Ga0496100_0251157 Ga0496100_0251157_721_1194 156
867 3300048903 Ga0496100_0611023 Ga0496100_0611023_277_750 156
868 3300048904 Ga0496101_0043782 Ga0496101_0043782_2305_2778 156
869 3300048904 Ga0496101_0733389 Ga0496101_0733389_196_666 156
870 3300048905 Ga0496102_0069429 Ga0496102_0069429_1955_2425 156
871 3300048905 Ga0496102_0234656 Ga0496102_0234656_214_687 156
872 3300048905 Ga0496102_0280548 Ga0496102_0280548_321_794 156
873 3300048905 Ga0496102_1150558 Ga0496102_1150558_204_674 156
874 3300048906 Ga0496103_0051103 Ga0496103_0051103_167_640 156
875 3300048906 Ga0496103_0779846 Ga0496103_0779846_115_585 156
876 3300048907 Ga0496104_0075770 Ga0496104_0075770_2478_2948 156
877 3300048907 Ga0496104_0077792 Ga0496104_0077792_895_1365 156
878 3300048907 Ga0496104_0079354 Ga0496104_0079354_1856_2329 156
879 3300048907 Ga0496104_0648129 Ga0496104_0648129_233_703 156
880 3300048908 Ga0496105_0019080 Ga0496105_0019080_2716_3189 156
881 3300048908 Ga0496105_0046648 Ga0496105_0046648_2133_2603 156
882 3300048908 Ga0496105_0312470 Ga0496105_0312470_765_1235 156
883 3300048909 Ga0496106_0024683 Ga0496106_0024683_3412_3882 156
884 3300048909 Ga0496106_0089373 Ga0496106_0089373_1483_1956 156
885 3300048909 Ga0496106_0486683 Ga0496106_0486683_169_639 156
886 3300048909 Ga0496106_0502864 Ga0496106_0502864_17_490 156
887 3300048910 Ga0496107_0026235 Ga0496107_0026235_1534_2007 156
888 3300048910 Ga0496107_0591544 Ga0496107_0591544_15_488 156
889 3300048910 Ga0496107_1045338 Ga0496107_1045338_43_516 156
890 3300048911 Ga0496108_0017334 Ga0496108_0017334_1660_2133 156
891 3300048911 Ga0496108_0025132 Ga0496108_0025132_2970_3443 156
892 3300048911 Ga0496108_0113647 Ga0496108_0113647_198_668 156
893 3300048912 Ga0496109_0082847 Ga0496109_0082847_1039_1509 156
894 3300048912 Ga0496109_0711930 Ga0496109_0711930_285_755 156
895 3300048913 Ga0496110_0007419 Ga0496110_0007419_596_1069 156
896 3300048913 Ga0496110_0025242 Ga0496110_0025242_2537_3007 156
897 3300048913 Ga0496110_0227914 Ga0496110_0227914_923_1393 156
898 3300048913 Ga0496110_0327908 Ga0496110_0327908_315_785 156
899 3300048914 Ga0496111_0149776 Ga0496111_0149776_141_614 156
900 3300048914 Ga0496111_0179988 Ga0496111_0179988_899_1372 156
901 3300048914 Ga0496111_0317300 Ga0496111_0317300_563_1033 156
902 3300048914 Ga0496111_0428200 Ga0496111_0428200_294_767 156
903 3300048915 Ga0496112_0012429 Ga0496112_0012429_2994_3464 156
904 3300048915 Ga0496112_0013478 Ga0496112_0013478_3042_3512 156
905 3300048916 Ga0496113_0058911 Ga0496113_0058911_429_899 156
906 3300048916 Ga0496113_0101602 Ga0496113_0101602_149_619 156
907 3300048916 Ga0496113_0277194 Ga0496113_0277194_740_1213 156
908 3300048916 Ga0496113_0518721 Ga0496113_0518721_12_482 156
909 3300048917 Ga0496114_0002910 Ga0496114_0002910_7506_7979 156
910 3300048917 Ga0496114_0336034 Ga0496114_0336034_840_1313 156
911 3300048917 Ga0496114_0404184 Ga0496114_0404184_467_937 156
912 3300048917 Ga0496114_1192695 Ga0496114_1192695_99_572 156
913 3300048917 Ga0496114_1312969 Ga0496114_1312969_130_600 156
914 3300048918 Ga0496115_0011971 Ga0496115_0011971_1473_1946 156
915 3300048918 Ga0496115_0055681 Ga0496115_0055681_1034_1504 156
916 3300048918 Ga0496115_0056553 Ga0496115_0056553_410_880 156
917 3300048918 Ga0496115_0084225 Ga0496115_0084225_1839_2309 156
918 3300048918 Ga0496115_0105999 Ga0496115_0105999_234_707 156
919 3300048920 Ga0496117_0095600 Ga0496117_0095600_410_886 156
920 3300048920 Ga0496117_0169105 Ga0496117_0169105_173_652 156
921 3300048921 Ga0496118_0315208 Ga0496118_0315208_49_522 156
922 3300048922 Ga0496119_0119087 Ga0496119_0119087_364_834 156
923 3300048922 Ga0496119_0161662 Ga0496119_0161662_405_887 156
924 3300048924 Ga0496121_0029380 Ga0496121_0029380_449_919 156
925 3300048924 Ga0496121_0036768 Ga0496121_0036768_675_1154 156
926 3300048924 Ga0496121_0054773 Ga0496121_0054773_806_1282 156
927 3300048924 Ga0496121_0090891 Ga0496121_0090891_854_1327 156
928 3300048924 Ga0496121_0132894 Ga0496121_0132894_1259_1738 156
929 3300048924 Ga0496121_0150187 Ga0496121_0150187_618_1091 156
930 3300048924 Ga0496121_0230802 Ga0496121_0230802_154_624 156
931 3300048924 Ga0496121_0260930 Ga0496121_0260930_592_1071 156
932 3300048924 Ga0496121_0272816 Ga0496121_0272816_642_1112 156
933 3300048924 Ga0496121_0415061 Ga0496121_0415061_220_693 156
934 3300048925 Ga0496122_0057566 Ga0496122_0057566_415_891 156
935 3300048926 Ga0496123_0202866 Ga0496123_0202866_510_983 156
936 3300048927 Ga0496124_0168515 Ga0496124_0168515_1185_1673 156
937 3300048927 Ga0496124_0224144 Ga0496124_0224144_261_740 156
938 3300048927 Ga0496124_0239059 Ga0496124_0239059_770_1240 156
939 3300048927 Ga0496124_0272567 Ga0496124_0272567_123_593 156
940 3300048927 Ga0496124_0294612 Ga0496124_0294612_553_1023 156
941 3300048927 Ga0496124_0472205 Ga0496124_0472205_218_697 156
942 3300048928 Ga0496125_0001626 Ga0496125_0001626_6472_6948 156
943 3300048928 Ga0496125_0008236 Ga0496125_0008236_7356_7832 156
944 3300048928 Ga0496125_0092356 Ga0496125_0092356_312_791 156
945 3300048928 Ga0496125_0137094 Ga0496125_0137094_611_1081 156
946 3300048929 Ga0496126_0024468 Ga0496126_0024468_5242_5718 156
947 3300048929 Ga0496126_0080538 Ga0496126_0080538_280_750 156
948 3300048929 Ga0496126_0157128 Ga0496126_0157128_1088_1567 156
949 3300048929 Ga0496126_0308671 Ga0496126_0308671_341_811 156
950 3300048929 Ga0496126_0311675 Ga0496126_0311675_723_1193 156
951 3300048929 Ga0496126_0810501 Ga0496126_0810501_141_614 156
952 3300048929 Ga0496126_1036089 Ga0496126_1036089_92_568 156
953 3300048929 Ga0496126_1289889 Ga0496126_1289889_11_484 156
954 3300049460 Ga0495682_0358696 Ga0495682_0358696_18_491 156
955 3300049570 Ga0501033_0009293 Ga0501033_0009293_5003_5473 156
956 3300049572 Ga0501036_0664985 Ga0501036_0664985_37_522 156
957 3300049572 Ga0501036_1130074 Ga0501036_1130074_95_565 156
958 3300049573 Ga0501037_0167347 Ga0501037_0167347_525_995 156
959 3300049573 Ga0501037_0650780 Ga0501037_0650780_134_604 156
960 3300049573 Ga0501037_0717448 Ga0501037_0717448_91_564 156
961 3300049573 Ga0501037_0744407 Ga0501037_0744407_31_516 156
962 3300049574 Ga0501038_0014330 Ga0501038_0014330_6374_6859 156
963 3300049574 Ga0501038_0089156 Ga0501038_0089156_485_955 156
964 3300049578 Ga0501042_0287651 Ga0501042_0287651_21_491 156
965 3300049581 Ga0501047_0144537 Ga0501047_0144537_159_644 156
966 3300049581 Ga0501047_0512204 Ga0501047_0512204_233_718 156
967 3300049583 Ga0501067_0343257 Ga0501067_0343257_264_737 156
968 3300049586 Ga0501070_0040314 Ga0501070_0040314_2576_3061 156
969 3300049589 Ga0501073_0361359 Ga0501073_0361359_29_502 156
970 3300049744 Ga0501083_0126731 Ga0501083_0126731_148_618 156
971 3300049823 Ga0501044_0057309 Ga0501044_0057309_418_891 156
972 3300049823 Ga0501044_0072024 Ga0501044_0072024_2321_2806 156
973 3300049823 Ga0501044_0317607 Ga0501044_0317607_385_870 156
974 3300050489 nmdc:mga03683_172340_c1 nmdc:mga03683_172340_c1_504_974 156
975 3300050490 nmdc:mga03n38_11321_c1 nmdc:mga03n38_11321_c1_1008_1478 156
976 3300050490 nmdc:mga03n38_314514_c1 nmdc:mga03n38_314514_c1_354_824 156
977 3300050491 nmdc:mga00v17_121269_c1 nmdc:mga00v17_121269_c1_812_1285 156
978 3300050491 nmdc:mga00v17_246573_c1 nmdc:mga00v17_246573_c1_652_1122 156
979 3300050492 nmdc:mga0yw44_120592_c1 nmdc:mga0yw44_120592_c1_323_796 156
980 3300050492 nmdc:mga0yw44_136880_c1 nmdc:mga0yw44_136880_c1_439_909 156
981 3300050492 nmdc:mga0yw44_304513_c1 nmdc:mga0yw44_304513_c1_583_1053 156
982 3300050493 nmdc:mga0k408_217138_c1 nmdc:mga0k408_217138_c1_661_1131 156
983 3300050494 nmdc:mga06z11_141014_c1 nmdc:mga06z11_141014_c1_165_638 156
984 3300050494 nmdc:mga06z11_306400_c1 nmdc:mga06z11_306400_c1_335_805 156
985 3300050494 nmdc:mga06z11_741_c1 nmdc:mga06z11_741_c1_5480_5950 156
986 3300050495 nmdc:mga04h51_35336_c1 nmdc:mga04h51_35336_c1_186_659 156
987 3300050495 nmdc:mga04h51_80413_c1 nmdc:mga04h51_80413_c1_212_682 156
988 3300050496 nmdc:mga07m45_132211_c1 nmdc:mga07m45_132211_c1_58_531 156
989 3300050496 nmdc:mga07m45_66691_c1 nmdc:mga07m45_66691_c1_1386_1856 156
990 3300050507 nmdc:mga05p37_276277_c1 nmdc:mga05p37_276277_c1_1069_1539 156
991 3300050508 nmdc:mga09592_699481_c1 nmdc:mga09592_699481_c1_378_848 156
992 3300050511 nmdc:mga08y16_139533_c1 nmdc:mga08y16_139533_c1_155_625 156
993 3300050512 nmdc:mga0n895_193701_c1 nmdc:mga0n895_193701_c1_886_1356 156
994 3300050512 nmdc:mga0n895_382008_c1 nmdc:mga0n895_382008_c1_722_1192 156
995 3300050514 nmdc:mga08x19_42743_c1 nmdc:mga08x19_42743_c1_773_1243 156
996 3300053077 Ga0495601_0011690 Ga0495601_0011690_1061_1531 156
997 3300053077 Ga0495601_0107429 Ga0495601_0107429_477_947 156
998 3300053078 Ga0495612_0154990 Ga0495612_0154990_302_790 156
999 3300053079 Ga0500610_0113084 Ga0500610_0113084_529_999 156
1000 3300053080 Ga0500635_0002258 Ga0500635_0002258_2533_3003 156
1001 3300053083 Ga0495655_0008263 Ga0495655_0008263_813_1286 156
1002 3300053084 Ga0495595_0015650 Ga0495595_0015650_170_643 156
1003 3300053085 Ga0495619_0028557 Ga0495619_0028557_360_857 156
1004 3300053085 Ga0495619_0046476 Ga0495619_0046476_1661_2131 156
1005 3300053085 Ga0495619_0085770 Ga0495619_0085770_1478_1951 156
1006 3300053086 Ga0500578_0243714 Ga0500578_0243714_424_933 156
1007 3300053086 Ga0500578_0421519 Ga0500578_0421519_247_717 156
1008 3300053087 Ga0500643_053658 Ga0500643_053658_91_564 156
1009 3300053092 Ga0500583_0020359 Ga0500583_0020359_804_1307 156
1010 3300053092 Ga0500583_0113242 Ga0500583_0113242_718_1188 156
1011 3300053093 Ga0500651_0017310 Ga0500651_0017310_236_745 156
1012 3300053093 Ga0500651_0227644 Ga0500651_0227644_375_866 156
1013 3300053094 Ga0500566_0003522 Ga0500566_0003522_3392_3883 156
1014 3300053094 Ga0500566_0004243 Ga0500566_0004243_7934_8419 156
1015 3300053095 Ga0500640_015757 Ga0500640_015757_1725_2195 156
1016 3300053096 Ga0500641_0186920 Ga0500641_0186920_55_564 156
1017 3300053096 Ga0500641_0409145 Ga0500641_0409145_47_520 156
1018 3300053102 Ga0500554_038573 Ga0500554_038573_536_1012 156
1019 3300053104 Ga0500556_0204775 Ga0500556_0204775_68_583 156
1020 3300053105 Ga0500557_174339 Ga0500557_174339_73_543 156
1021 3300053111 Ga0500572_000463 Ga0500572_000463_713_1183 156
1022 3300053114 Ga0500582_023586 Ga0500582_023586_663_1133 156
1023 3300053116 Ga0500592_054724 Ga0500592_054724_136_606 156
1024 3300053117 Ga0500593_103072 Ga0500593_103072_371_841 156
1025 3300053119 Ga0500595_012046 Ga0500595_012046_101_577 156
1026 3300053122 Ga0500608_001779 Ga0500608_001779_5614_6105 156
1027 3300053122 Ga0500608_007682 Ga0500608_007682_3146_3616 156
1028 3300053122 Ga0500608_257807 Ga0500608_257807_33_509 156
1029 3300053123 Ga0500614_001185 Ga0500614_001185_158_628 156
1030 3300053123 Ga0500614_040385 Ga0500614_040385_403_873 156
1031 3300053125 Ga0500618_072359 Ga0500618_072359_32_523 156
1032 3300053130 Ga0500642_0004109 Ga0500642_0004109_1028_1537 156
1033 3300053134 Ga0500658_0115079 Ga0500658_0115079_536_1009 156
1034 3300053136 Ga0500559_0001304 Ga0500559_0001304_12679_13149 156
1035 3300053136 Ga0500559_0044429 Ga0500559_0044429_1428_1898 156
1036 3300053139 Ga0500568_0086735 Ga0500568_0086735_14_529 156
1037 3300053139 Ga0500568_0230451 Ga0500568_0230451_120_593 156
1038 3300053142 Ga0500577_0000382 Ga0500577_0000382_5766_6236 156
1039 3300053145 Ga0500586_000521 Ga0500586_000521_5512_6006 156
1040 3300053146 Ga0500588_0065705 Ga0500588_0065705_640_1149 156
1041 3300053147 Ga0500589_021101 Ga0500589_021101_1063_1533 156
1042 3300053148 Ga0500590_024521 Ga0500590_024521_2356_2847 156
1043 3300053150 Ga0500603_000142 Ga0500603_000142_15061_15531 156
1044 3300053150 Ga0500603_005139 Ga0500603_005139_146_631 156
1045 3300053150 Ga0500603_009208 Ga0500603_009208_85_561 156
1046 3300053151 Ga0500604_0019842 Ga0500604_0019842_1099_1572 156
1047 3300053153 Ga0500616_0312525 Ga0500616_0312525_23_538 156
1048 3300053155 Ga0500620_006506 Ga0500620_006506_1202_1675 156
1049 3300053156 Ga0500622_0014319 Ga0500622_0014319_87_557 156
1050 3300053156 Ga0500622_0050483 Ga0500622_0050483_1060_1569 156
1051 3300053158 Ga0500627_0048238 Ga0500627_0048238_791_1279 156
1052 3300053159 Ga0500630_011616 Ga0500630_011616_1933_2418 156
1053 3300053161 Ga0500634_0087074 Ga0500634_0087074_254_760 156
1054 3300053162 Ga0500638_010149 Ga0500638_010149_1481_1957 156
1055 3300053162 Ga0500638_055515 Ga0500638_055515_247_726 156
1056 3300053163 Ga0500639_000217 Ga0500639_000217_27556_28026 156
1057 3300053163 Ga0500639_023025 Ga0500639_023025_1571_2041 156
1058 3300053177 Ga0500636_0009756 Ga0500636_0009756_4573_5064 156
1059 3300053177 Ga0500636_0022787 Ga0500636_0022787_324_797 156
1060 3300053177 Ga0500636_0147855 Ga0500636_0147855_324_800 156
1061 3300053723 Ga0500567_058777 Ga0500567_058777_442_936 156
1062 3300053725 Ga0500576_009243 Ga0500576_009243_1600_2070 156
1063 3300053730 Ga0500645_041308 Ga0500645_041308_380_850 156
1064 3300053730 Ga0500645_049796 Ga0500645_049796_706_1176 156
1065 3300053735 Ga0500596_004450 Ga0500596_004450_527_997 156
1066 3300053737 Ga0500601_013495 Ga0500601_013495_169_639 156
1067 3300055283 Ga0500661_079024 Ga0500661_079024_120_593 156
1068 3300059424 Ga0590075_199073 Ga0590075_199073_36_509 156
1069 3300061719 Ga0466962_0414162 Ga0466962_0414162_64_543 156
1070 3300061734 Ga0530510_1033557 Ga0530510_1033557_11_481 156
1071 iso_pu_bacteria 2602042107 2603861925 156
1072 iso_pu_bacteria 2857524615 2857530468 156
1073 iso_pu_bacteria 2893066018 2893069577 156
1074 iso_pu_bacteria 2919073203 2919077369 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

15

150

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jpb-assembly1.cif.gz_W the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. 0.9091 11 148
3ja6-assembly1.cif.gz_F cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling 0.9 11 148
2qdl-assembly2.cif.gz_B crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8918 11 148
8c5v-assembly1.cif.gz_H chemotaxis core signalling unit from e protein lysed e. coli cells 0.8758 13 147
4jpb-assembly1.cif.gz_W the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. 0.8729 11 148
ID Description Score Start End Superfamily
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8904 32 95 2.40.50.180
2qdlB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8843 33 99 2.40.50.180
2ch4W02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8796 32 99 2.40.50.180
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8657 32 95 2.40.50.180
1b3qA04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8171 33 98 2.40.50.180
ID Description Score Start End GO Terms
AF-A0A522A6C7-F1-model_v4 Chemotaxis protein CheW 0.9701 16 148 GO:0005829
GO:0006935
GO:0007165
AF-F7QRN6-F1-model_v4 Regulator of CheA protein activity CheW 0.9684 19 156 GO:0005829
GO:0006935
GO:0007165
AF-A0A2D9RKA8-F1-model_v4 Chemotaxis protein CheW 0.9672 11 155 GO:0005829
GO:0006935
GO:0007165
AF-A0A285PID1-F1-model_v4 CheW protein 0.9664 2 147 GO:0005829
GO:0006935
GO:0007165
AF-G2KPX0-F1-model_v4 CheW-like domain protein 0.9652 8 147 GO:0005829
GO:0006935
GO:0007165

Feature Viewer

pLDDT pTM Quality
88.94 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map