F489552
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1075 | 286 | 2150 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_101356366|Ga0070670_1013563661 |
| Length | 118 |
| Sequence | LGLSIVHWVIGHCSRMSGMGKLKSEIEVQCPCCDAILIIDSNLGRIVSHREPDRRDKPELSDAQRILAQQAARRDALFEQSVEAEKTRDDALTRRFEEALRQANDEPITRPTRDFDLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 113 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 211 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 212 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 213 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 214 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 215 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 216 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 217 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 218 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 219 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 222 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 271 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 2.42 |
| Rhizosphere | 97.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_101356366 | 3300005331 | Bacteria | 652 |
| 2 | SwRhRL3b_contig_4260674 | 2162886006 | Unclassified | 862 |
| 3 | SwRhRL2b_contig_2303194 | 2162886007 | Bacteria | 1545 |
| 4 | JGI24745J21846_1006703 | 3300002073 | Bacteria | 1283 |
| 5 | JGI24749J21850_1045341 | 3300002076 | Bacteria | 649 |
| 6 | JGI24035J26624_1004317 | 3300002126 | Bacteria | 1349 |
| 7 | JGI24033J26618_1069457 | 3300002155 | Unclassified | 528 |
| 8 | Ga0058859_11517576 | 3300004798 | Bacteria | 628 |
| 9 | Ga0065704_10232228 | 3300005289 | Bacteria | 1039 |
| 10 | Ga0065704_10503292 | 3300005289 | Unclassified | 665 |
| 11 | Ga0065712_10002683 | 3300005290 | Bacteria | 5145 |
| 12 | Ga0065712_10007329 | 3300005290 | Bacteria | 2604 |
| 13 | Ga0065712_10453736 | 3300005290 | Bacteria | 671 |
| 14 | Ga0065715_10091986 | 3300005293 | Bacteria | 5408 |
| 15 | Ga0065715_10294244 | 3300005293 | Unclassified | 1051 |
| 16 | Ga0065715_10524328 | 3300005293 | Bacteria | 761 |
| 17 | Ga0065715_10816696 | 3300005293 | Bacteria | 604 |
| 18 | Ga0065707_10004395 | 3300005295 | Bacteria | 6260 |
| 19 | Ga0065707_10123479 | 3300005295 | Bacteria | 2064 |
| 20 | Ga0065707_10130896 | 3300005295 | Unclassified | 1922 |
| 21 | Ga0065707_10279394 | 3300005295 | Unclassified | 1051 |
| 22 | Ga0065707_10425128 | 3300005295 | Unclassified | 826 |
| 23 | Ga0065707_10731062 | 3300005295 | Bacteria | 626 |
| 24 | Ga0070658_10645531 | 3300005327 | Unclassified | 918 |
| 25 | Ga0070676_10026486 | 3300005328 | Bacteria | 3283 |
| 26 | Ga0070676_10027667 | 3300005328 | Bacteria | 3217 |
| 27 | Ga0070676_10099791 | 3300005328 | Bacteria | 1792 |
| 28 | Ga0070676_10410948 | 3300005328 | Bacteria | 944 |
| 29 | Ga0070683_100002803 | 3300005329 | Bacteria | 13943 |
| 30 | Ga0070683_100532077 | 3300005329 | Bacteria | 1123 |
| 31 | Ga0070683_101611383 | 3300005329 | Bacteria | 624 |
| 32 | Ga0070690_100041309 | 3300005330 | Bacteria | 2920 |
| 33 | Ga0070690_100110115 | 3300005330 | Bacteria | 1836 |
| 34 | Ga0070690_100223065 | 3300005330 | Bacteria | 1321 |
| 35 | Ga0070690_101527319 | 3300005330 | Bacteria | 540 |
| 36 | Ga0070670_100002610 | 3300005331 | Bacteria | 14900 |
| 37 | Ga0070670_100067854 | 3300005331 | Bacteria | 3060 |
| 38 | Ga0070670_100145406 | 3300005331 | Bacteria | 2051 |
| 39 | Ga0070670_100235266 | 3300005331 | Bacteria | 1595 |
| 40 | Ga0070670_100432930 | 3300005331 | Bacteria | 1164 |
| 41 | Ga0070677_10070514 | 3300005333 | Bacteria | 1469 |
| 42 | Ga0070677_10072127 | 3300005333 | Bacteria | 1455 |
| 43 | Ga0070677_10134492 | 3300005333 | Bacteria | 1133 |
| 44 | Ga0070677_10185158 | 3300005333 | Bacteria | 995 |
| 45 | Ga0070677_10219892 | 3300005333 | Bacteria | 927 |
| 46 | Ga0070677_10338436 | 3300005333 | Unclassified | 776 |
| 47 | Ga0070677_10565238 | 3300005333 | Unclassified | 625 |
| 48 | Ga0068869_100006778 | 3300005334 | Bacteria | 7281 |
| 49 | Ga0068869_100016609 | 3300005334 | Bacteria | 4963 |
| 50 | Ga0068869_100453107 | 3300005334 | Unclassified | 1064 |
| 51 | Ga0068869_101105787 | 3300005334 | Unclassified | 693 |
| 52 | Ga0068869_101211367 | 3300005334 | Bacteria | 664 |
| 53 | Ga0068869_101317159 | 3300005334 | Unclassified | 637 |
| 54 | Ga0068869_101828185 | 3300005334 | Bacteria | 543 |
| 55 | Ga0070666_10006433 | 3300005335 | Bacteria | 7220 |
| 56 | Ga0070666_10071955 | 3300005335 | Unclassified | 2354 |
| 57 | Ga0070666_11231800 | 3300005335 | Unclassified | 558 |
| 58 | Ga0070666_11414991 | 3300005335 | Unclassified | 520 |
| 59 | Ga0070680_101415984 | 3300005336 | Bacteria | 602 |
| 60 | Ga0070680_101638080 | 3300005336 | Bacteria | 558 |
| 61 | Ga0068868_100031792 | 3300005338 | Bacteria | 4058 |
| 62 | Ga0068868_100035225 | 3300005338 | Bacteria | 3868 |
| 63 | Ga0068868_100614228 | 3300005338 | Bacteria | 964 |
| 64 | Ga0068868_100794060 | 3300005338 | Bacteria | 854 |
| 65 | Ga0068868_101996542 | 3300005338 | Unclassified | 550 |
| 66 | Ga0070660_100622529 | 3300005339 | Bacteria | 903 |
| 67 | Ga0070689_100016365 | 3300005340 | Bacteria | 5427 |
| 68 | Ga0070689_100021825 | 3300005340 | Unclassified | 4772 |
| 69 | Ga0070689_100130205 | 3300005340 | Bacteria | 2017 |
| 70 | Ga0070689_100143638 | 3300005340 | Unclassified | 1921 |
| 71 | Ga0070689_100278871 | 3300005340 | Bacteria | 1386 |
| 72 | Ga0070689_101348524 | 3300005340 | Bacteria | 643 |
| 73 | Ga0070687_100049891 | 3300005343 | Bacteria | 2159 |
| 74 | Ga0070687_100060473 | 3300005343 | Bacteria | 1998 |
| 75 | Ga0070687_100073614 | 3300005343 | Bacteria | 1842 |
| 76 | Ga0070687_101411548 | 3300005343 | Unclassified | 521 |
| 77 | Ga0070661_100019728 | 3300005344 | Bacteria | 4805 |
| 78 | Ga0070661_100096285 | 3300005344 | Unclassified | 2196 |
| 79 | Ga0070661_100539573 | 3300005344 | Unclassified | 937 |
| 80 | Ga0070661_100820975 | 3300005344 | Bacteria | 764 |
| 81 | Ga0070692_10124233 | 3300005345 | Bacteria | 1443 |
| 82 | Ga0070692_10321190 | 3300005345 | Bacteria | 952 |
| 83 | Ga0070692_10347027 | 3300005345 | Unclassified | 921 |
| 84 | Ga0070668_100058877 | 3300005347 | Unclassified | 2973 |
| 85 | Ga0070668_100069279 | 3300005347 | Bacteria | 2744 |
| 86 | Ga0070668_100120255 | 3300005347 | Bacteria | 2099 |
| 87 | Ga0070668_100448333 | 3300005347 | Unclassified | 1109 |
| 88 | Ga0070668_101836662 | 3300005347 | Bacteria | 558 |
| 89 | Ga0070669_100001020 | 3300005353 | Bacteria | 20403 |
| 90 | Ga0070669_100014861 | 3300005353 | Bacteria | 5547 |
| 91 | Ga0070669_100032145 | 3300005353 | Bacteria | 3790 |
| 92 | Ga0070669_100076506 | 3300005353 | Bacteria | 2484 |
| 93 | Ga0070669_100126936 | 3300005353 | Unclassified | 1953 |
| 94 | Ga0070669_100135039 | 3300005353 | Bacteria | 1897 |
| 95 | Ga0070669_100249279 | 3300005353 | Bacteria | 1413 |
| 96 | Ga0070669_101169083 | 3300005353 | Unclassified | 664 |
| 97 | Ga0070669_101548753 | 3300005353 | Unclassified | 577 |
| 98 | Ga0070669_101551225 | 3300005353 | Unclassified | 576 |
| 99 | Ga0070675_100000033 | 3300005354 | Bacteria | 94281 |
| 100 | Ga0070675_100002075 | 3300005354 | Bacteria | 14827 |
| 101 | Ga0070675_100009814 | 3300005354 | Bacteria | 7460 |
| 102 | Ga0070675_100017656 | 3300005354 | Bacteria | 5674 |
| 103 | Ga0070675_100024575 | 3300005354 | Bacteria | 4825 |
| 104 | Ga0070675_100050630 | 3300005354 | Bacteria | 3411 |
| 105 | Ga0070675_100055048 | 3300005354 | Bacteria | 3274 |
| 106 | Ga0070675_100147359 | 3300005354 | Bacteria | 2016 |
| 107 | Ga0070675_100171437 | 3300005354 | Unclassified | 1871 |
| 108 | Ga0070675_100329580 | 3300005354 | Bacteria | 1350 |
| 109 | Ga0070675_100331383 | 3300005354 | Bacteria | 1346 |
| 110 | Ga0070675_100465320 | 3300005354 | Bacteria | 1136 |
| 111 | Ga0070675_100542918 | 3300005354 | Unclassified | 1051 |
| 112 | Ga0070675_100741178 | 3300005354 | Unclassified | 896 |
| 113 | Ga0070675_101870439 | 3300005354 | Bacteria | 554 |
| 114 | Ga0070671_100014984 | 3300005355 | Bacteria | 6260 |
| 115 | Ga0070671_100027299 | 3300005355 | Bacteria | 4697 |
| 116 | Ga0070671_100045499 | 3300005355 | Unclassified | 3649 |
| 117 | Ga0070671_100940752 | 3300005355 | Bacteria | 756 |
| 118 | Ga0070674_100000184 | 3300005356 | Bacteria | 29352 |
| 119 | Ga0070674_100015356 | 3300005356 | Bacteria | 4780 |
| 120 | Ga0070674_100126255 | 3300005356 | Bacteria | 1901 |
| 121 | Ga0070674_100286588 | 3300005356 | Bacteria | 1308 |
| 122 | Ga0070674_100345011 | 3300005356 | Unclassified | 1201 |
| 123 | Ga0070674_100589651 | 3300005356 | Bacteria | 938 |
| 124 | Ga0070673_100007303 | 3300005364 | Bacteria | 7274 |
| 125 | Ga0070673_100027094 | 3300005364 | Bacteria | 4244 |
| 126 | Ga0070673_100109560 | 3300005364 | Bacteria | 2288 |
| 127 | Ga0070673_100114781 | 3300005364 | Bacteria | 2239 |
| 128 | Ga0070673_100139394 | 3300005364 | Unclassified | 2044 |
| 129 | Ga0070673_100142185 | 3300005364 | Unclassified | 2025 |
| 130 | Ga0070673_100567349 | 3300005364 | Bacteria | 1032 |
| 131 | Ga0070673_100654649 | 3300005364 | Unclassified | 962 |
| 132 | Ga0070673_100908925 | 3300005364 | Bacteria | 817 |
| 133 | Ga0070673_101226075 | 3300005364 | Bacteria | 703 |
| 134 | Ga0070673_101668593 | 3300005364 | Bacteria | 603 |
| 135 | Ga0070688_100004930 | 3300005365 | Bacteria | 6983 |
| 136 | Ga0070688_100055491 | 3300005365 | Bacteria | 2485 |
| 137 | Ga0070688_100150967 | 3300005365 | Bacteria | 1588 |
| 138 | Ga0070688_100222147 | 3300005365 | Bacteria | 1332 |
| 139 | Ga0070688_101060952 | 3300005365 | Unclassified | 646 |
| 140 | Ga0070659_100110728 | 3300005366 | Bacteria | 2216 |
| 141 | Ga0070659_100170995 | 3300005366 | Bacteria | 1780 |
| 142 | Ga0070659_101459563 | 3300005366 | Unclassified | 609 |
| 143 | Ga0070667_100034500 | 3300005367 | Bacteria | 4233 |
| 144 | Ga0070667_100592740 | 3300005367 | Bacteria | 1021 |
| 145 | Ga0070667_100796710 | 3300005367 | Bacteria | 877 |
| 146 | Ga0070667_100856947 | 3300005367 | Unclassified | 845 |
| 147 | Ga0070667_100896067 | 3300005367 | Unclassified | 826 |
| 148 | Ga0070667_101262473 | 3300005367 | Bacteria | 692 |
| 149 | Ga0070667_102029584 | 3300005367 | Bacteria | 542 |
| 150 | Ga0070703_10014649 | 3300005406 | Bacteria | 2236 |
| 151 | Ga0070703_10066528 | 3300005406 | Unclassified | 1192 |
| 152 | Ga0070703_10081745 | 3300005406 | Bacteria | 1102 |
| 153 | Ga0070701_10012396 | 3300005438 | Bacteria | 3845 |
| 154 | Ga0070701_10329742 | 3300005438 | Bacteria | 947 |
| 155 | Ga0070701_10422344 | 3300005438 | Unclassified | 850 |
| 156 | Ga0070701_10649926 | 3300005438 | Unclassified | 704 |
| 157 | Ga0070705_100001709 | 3300005440 | Bacteria | 11435 |
| 158 | Ga0070705_100192667 | 3300005440 | Unclassified | 1391 |
| 159 | Ga0070705_100239925 | 3300005440 | Bacteria | 1266 |
| 160 | Ga0070705_100391841 | 3300005440 | Bacteria | 1026 |
| 161 | Ga0070705_100471178 | 3300005440 | Bacteria | 947 |
| 162 | Ga0070705_100665454 | 3300005440 | Unclassified | 814 |
| 163 | Ga0070705_100798232 | 3300005440 | Unclassified | 751 |
| 164 | Ga0070705_100963910 | 3300005440 | Unclassified | 690 |
| 165 | Ga0070700_100014659 | 3300005441 | Bacteria | 4430 |
| 166 | Ga0070700_100068591 | 3300005441 | Unclassified | 2255 |
| 167 | Ga0070700_100110973 | 3300005441 | Unclassified | 1823 |
| 168 | Ga0070700_100301545 | 3300005441 | Bacteria | 1170 |
| 169 | Ga0070700_100669286 | 3300005441 | Unclassified | 822 |
| 170 | Ga0070700_101669801 | 3300005441 | Unclassified | 546 |
| 171 | Ga0070694_100267311 | 3300005444 | Unclassified | 1299 |
| 172 | Ga0070694_100279106 | 3300005444 | Bacteria | 1273 |
| 173 | Ga0070694_100288427 | 3300005444 | Bacteria | 1254 |
| 174 | Ga0070694_100371181 | 3300005444 | Unclassified | 1113 |
| 175 | Ga0070694_100447963 | 3300005444 | Bacteria | 1019 |
| 176 | Ga0070694_100765992 | 3300005444 | Bacteria | 789 |
| 177 | Ga0070694_101065918 | 3300005444 | Bacteria | 673 |
| 178 | Ga0070694_101289739 | 3300005444 | Bacteria | 614 |
| 179 | Ga0070694_101498939 | 3300005444 | Unclassified | 571 |
| 180 | Ga0070708_100121916 | 3300005445 | Bacteria | 2406 |
| 181 | Ga0070708_101344902 | 3300005445 | Unclassified | 667 |
| 182 | Ga0070678_100056358 | 3300005456 | Bacteria | 2874 |
| 183 | Ga0070678_100301496 | 3300005456 | Bacteria | 1362 |
| 184 | Ga0070678_100490899 | 3300005456 | Bacteria | 1082 |
| 185 | Ga0070662_100004740 | 3300005457 | Bacteria | 8618 |
| 186 | Ga0070662_100182556 | 3300005457 | Bacteria | 1655 |
| 187 | Ga0070662_100238738 | 3300005457 | Bacteria | 1457 |
| 188 | Ga0070662_100669426 | 3300005457 | Unclassified | 877 |
| 189 | Ga0070662_100874593 | 3300005457 | Bacteria | 766 |
| 190 | Ga0070662_101380581 | 3300005457 | Unclassified | 607 |
| 191 | Ga0070681_10067907 | 3300005458 | Bacteria | 3532 |
| 192 | Ga0070681_11243663 | 3300005458 | Unclassified | 667 |
| 193 | Ga0070681_11354336 | 3300005458 | Bacteria | 635 |
| 194 | Ga0068867_100008404 | 3300005459 | Bacteria | 7280 |
| 195 | Ga0068867_100012506 | 3300005459 | Bacteria | 6007 |
| 196 | Ga0068867_100028197 | 3300005459 | Bacteria | 4041 |
| 197 | Ga0068867_100096872 | 3300005459 | Unclassified | 2247 |
| 198 | Ga0068867_100535522 | 3300005459 | Bacteria | 1012 |
| 199 | Ga0068867_101441696 | 3300005459 | Unclassified | 639 |
| 200 | Ga0068867_102217931 | 3300005459 | Unclassified | 521 |
| 201 | Ga0070685_10007510 | 3300005466 | Bacteria | 5579 |
| 202 | Ga0070685_10278822 | 3300005466 | Bacteria | 1118 |
| 203 | Ga0070685_10346887 | 3300005466 | Bacteria | 1014 |
| 204 | Ga0070685_10712521 | 3300005466 | Bacteria | 733 |
| 205 | Ga0070685_10964521 | 3300005466 | Unclassified | 638 |
| 206 | Ga0070685_11206830 | 3300005466 | Bacteria | 575 |
| 207 | Ga0070685_11380998 | 3300005466 | Unclassified | 540 |
| 208 | Ga0070706_100351426 | 3300005467 | Bacteria | 1374 |
| 209 | Ga0070706_100533063 | 3300005467 | Unclassified | 1092 |
| 210 | Ga0070707_100062698 | 3300005468 | Unclassified | 3567 |
| 211 | Ga0070707_100080412 | 3300005468 | Bacteria | 3145 |
| 212 | Ga0070707_100097528 | 3300005468 | Bacteria | 2847 |
| 213 | Ga0070698_100037618 | 3300005471 | Bacteria | 4988 |
| 214 | Ga0070698_100304644 | 3300005471 | Bacteria | 1524 |
| 215 | Ga0070698_101702111 | 3300005471 | Unclassified | 583 |
| 216 | Ga0070699_100020817 | 3300005518 | Bacteria | 5656 |
| 217 | Ga0070699_100033499 | 3300005518 | Unclassified | 4439 |
| 218 | Ga0070699_100215043 | 3300005518 | Bacteria | 1712 |
| 219 | Ga0070699_100411696 | 3300005518 | Unclassified | 1223 |
| 220 | Ga0070699_101756487 | 3300005518 | Unclassified | 568 |
| 221 | Ga0070679_100415881 | 3300005530 | Unclassified | 1290 |
| 222 | Ga0070679_100493789 | 3300005530 | Bacteria | 1168 |
| 223 | Ga0070679_101239747 | 3300005530 | Unclassified | 691 |
| 224 | Ga0070684_100003808 | 3300005535 | Bacteria | 11401 |
| 225 | Ga0070684_102313211 | 3300005535 | Bacteria | 507 |
| 226 | Ga0070697_100037352 | 3300005536 | Bacteria | 3923 |
| 227 | Ga0070697_100192357 | 3300005536 | Unclassified | 1732 |
| 228 | Ga0070697_100315975 | 3300005536 | Bacteria | 1344 |
| 229 | Ga0068853_100962420 | 3300005539 | Bacteria | 821 |
| 230 | Ga0070672_100014219 | 3300005543 | Bacteria | 5634 |
| 231 | Ga0070672_100028789 | 3300005543 | Bacteria | 4159 |
| 232 | Ga0070672_100033294 | 3300005543 | Bacteria | 3901 |
| 233 | Ga0070672_100043970 | 3300005543 | Bacteria | 3448 |
| 234 | Ga0070672_100160688 | 3300005543 | Bacteria | 1864 |
| 235 | Ga0070672_100218642 | 3300005543 | Bacteria | 1597 |
| 236 | Ga0070672_100304570 | 3300005543 | Unclassified | 1351 |
| 237 | Ga0070672_100363966 | 3300005543 | Bacteria | 1235 |
| 238 | Ga0070672_101033709 | 3300005543 | Unclassified | 729 |
| 239 | Ga0070672_102109601 | 3300005543 | Bacteria | 508 |
| 240 | Ga0070686_100006803 | 3300005544 | Bacteria | 6367 |
| 241 | Ga0070686_100042188 | 3300005544 | Bacteria | 2856 |
| 242 | Ga0070686_100224486 | 3300005544 | Bacteria | 1359 |
| 243 | Ga0070686_100457393 | 3300005544 | Bacteria | 983 |
| 244 | Ga0070686_100813783 | 3300005544 | Bacteria | 754 |
| 245 | Ga0070686_100922188 | 3300005544 | Unclassified | 712 |
| 246 | Ga0070686_101039601 | 3300005544 | Unclassified | 674 |
| 247 | Ga0070686_101048637 | 3300005544 | Bacteria | 671 |
| 248 | Ga0070695_100006594 | 3300005545 | Bacteria | 6859 |
| 249 | Ga0070695_100257074 | 3300005545 | Bacteria | 1274 |
| 250 | Ga0070695_100550063 | 3300005545 | Unclassified | 900 |
| 251 | Ga0070695_100550693 | 3300005545 | Bacteria | 899 |
| 252 | Ga0070695_101097374 | 3300005545 | Unclassified | 651 |
| 253 | Ga0070695_101098946 | 3300005545 | Unclassified | 651 |
| 254 | Ga0070695_101285312 | 3300005545 | Unclassified | 604 |
| 255 | Ga0070696_100003487 | 3300005546 | Bacteria | 10456 |
| 256 | Ga0070696_100006665 | 3300005546 | Bacteria | 7714 |
| 257 | Ga0070696_100272203 | 3300005546 | Unclassified | 1288 |
| 258 | Ga0070696_100485322 | 3300005546 | Bacteria | 981 |
| 259 | Ga0070696_100489319 | 3300005546 | Bacteria | 977 |
| 260 | Ga0070696_100712432 | 3300005546 | Bacteria | 819 |
| 261 | Ga0070696_100730212 | 3300005546 | Bacteria | 810 |
| 262 | Ga0070696_100872536 | 3300005546 | Unclassified | 745 |
| 263 | Ga0070696_101692395 | 3300005546 | Unclassified | 545 |
| 264 | Ga0070693_100012874 | 3300005547 | Bacteria | 4246 |
| 265 | Ga0070665_100001707 | 3300005548 | Bacteria | 25226 |
| 266 | Ga0070665_100178177 | 3300005548 | Bacteria | 2126 |
| 267 | Ga0070665_100254981 | 3300005548 | Bacteria | 1755 |
| 268 | Ga0070704_100000343 | 3300005549 | Bacteria | 21179 |
| 269 | Ga0070704_100111611 | 3300005549 | Unclassified | 2082 |
| 270 | Ga0070704_100120098 | 3300005549 | Bacteria | 2017 |
| 271 | Ga0070704_100239621 | 3300005549 | Unclassified | 1484 |
| 272 | Ga0070704_100247088 | 3300005549 | Unclassified | 1463 |
| 273 | Ga0070704_100352974 | 3300005549 | Bacteria | 1242 |
| 274 | Ga0070704_100402920 | 3300005549 | Unclassified | 1168 |
| 275 | Ga0070704_100476006 | 3300005549 | Bacteria | 1080 |
| 276 | Ga0070704_100523110 | 3300005549 | Bacteria | 1033 |
| 277 | Ga0070704_100532649 | 3300005549 | Bacteria | 1024 |
| 278 | Ga0070704_100594585 | 3300005549 | Unclassified | 972 |
| 279 | Ga0070704_101178029 | 3300005549 | Bacteria | 698 |
| 280 | Ga0070704_101780447 | 3300005549 | Bacteria | 570 |
| 281 | Ga0068855_100560438 | 3300005563 | Unclassified | 1236 |
| 282 | Ga0070664_100001327 | 3300005564 | Bacteria | 19736 |
| 283 | Ga0070664_100079188 | 3300005564 | Bacteria | 2828 |
| 284 | Ga0070664_100299092 | 3300005564 | Bacteria | 1454 |
| 285 | Ga0070664_100841919 | 3300005564 | Bacteria | 859 |
| 286 | Ga0070664_100848654 | 3300005564 | Bacteria | 855 |
| 287 | Ga0070664_101152881 | 3300005564 | Bacteria | 731 |
| 288 | Ga0070664_101237113 | 3300005564 | Bacteria | 705 |
| 289 | Ga0070664_101528581 | 3300005564 | Unclassified | 632 |
| 290 | Ga0070664_102110802 | 3300005564 | Unclassified | 535 |
| 291 | Ga0068857_100118789 | 3300005577 | Unclassified | 2380 |
| 292 | Ga0068857_101585569 | 3300005577 | Bacteria | 639 |
| 293 | Ga0068854_100254274 | 3300005578 | Unclassified | 1404 |
| 294 | Ga0068854_100294909 | 3300005578 | Bacteria | 1310 |
| 295 | Ga0068854_100901357 | 3300005578 | Bacteria | 777 |
| 296 | Ga0068854_101346857 | 3300005578 | Bacteria | 644 |
| 297 | Ga0068856_100342148 | 3300005614 | Bacteria | 1514 |
| 298 | Ga0070702_100071552 | 3300005615 | Unclassified | 2050 |
| 299 | Ga0070702_100109339 | 3300005615 | Bacteria | 1711 |
| 300 | Ga0070702_100254710 | 3300005615 | Bacteria | 1192 |
| 301 | Ga0068852_100148816 | 3300005616 | Unclassified | 2175 |
| 302 | Ga0068852_101262355 | 3300005616 | Unclassified | 760 |
| 303 | Ga0068859_100004737 | 3300005617 | Bacteria | 13820 |
| 304 | Ga0068859_100008005 | 3300005617 | Bacteria | 10715 |
| 305 | Ga0068859_100029471 | 3300005617 | Bacteria | 5506 |
| 306 | Ga0068859_100195030 | 3300005617 | Bacteria | 2109 |
| 307 | Ga0068859_100242799 | 3300005617 | Bacteria | 1891 |
| 308 | Ga0068859_101537581 | 3300005617 | Unclassified | 735 |
| 309 | Ga0068859_101871300 | 3300005617 | Bacteria | 663 |
| 310 | Ga0068859_102575170 | 3300005617 | Bacteria | 560 |
| 311 | Ga0068859_102728551 | 3300005617 | Unclassified | 543 |
| 312 | Ga0068864_100048934 | 3300005618 | Bacteria | 3635 |
| 313 | Ga0068864_100056442 | 3300005618 | Bacteria | 3393 |
| 314 | Ga0068864_100100497 | 3300005618 | Bacteria | 2564 |
| 315 | Ga0068864_100328606 | 3300005618 | Bacteria | 1438 |
| 316 | Ga0068864_100642660 | 3300005618 | Bacteria | 1032 |
| 317 | Ga0068864_100659115 | 3300005618 | Unclassified | 1020 |
| 318 | Ga0068866_10019977 | 3300005718 | Bacteria | 3061 |
| 319 | Ga0068866_10154078 | 3300005718 | Unclassified | 1334 |
| 320 | Ga0068866_11009163 | 3300005718 | Unclassified | 592 |
| 321 | Ga0068861_100071501 | 3300005719 | Bacteria | 2689 |
| 322 | Ga0068861_100166789 | 3300005719 | Bacteria | 1821 |
| 323 | Ga0068861_100226074 | 3300005719 | Bacteria | 1584 |
| 324 | Ga0068861_100392759 | 3300005719 | Bacteria | 1229 |
| 325 | Ga0068861_100457709 | 3300005719 | Unclassified | 1145 |
| 326 | Ga0068861_100666669 | 3300005719 | Bacteria | 963 |
| 327 | Ga0068861_100673018 | 3300005719 | Unclassified | 959 |
| 328 | Ga0068861_102211342 | 3300005719 | Unclassified | 551 |
| 329 | Ga0068851_10058013 | 3300005834 | Bacteria | 1977 |
| 330 | Ga0068851_10194288 | 3300005834 | Bacteria | 1130 |
| 331 | Ga0068851_10779575 | 3300005834 | Bacteria | 593 |
| 332 | Ga0068851_10859690 | 3300005834 | Bacteria | 566 |
| 333 | Ga0068870_10009944 | 3300005840 | Bacteria | 4346 |
| 334 | Ga0068870_10011318 | 3300005840 | Bacteria | 4133 |
| 335 | Ga0068870_10020009 | 3300005840 | Bacteria | 3253 |
| 336 | Ga0068870_10061184 | 3300005840 | Unclassified | 2023 |
| 337 | Ga0068870_10165793 | 3300005840 | Unclassified | 1314 |
| 338 | Ga0068870_10321045 | 3300005840 | Bacteria | 984 |
| 339 | Ga0068870_10456880 | 3300005840 | Unclassified | 843 |
| 340 | Ga0068870_10575754 | 3300005840 | Bacteria | 762 |
| 341 | Ga0068870_11184189 | 3300005840 | Bacteria | 553 |
| 342 | Ga0068863_100023408 | 3300005841 | Bacteria | 5899 |
| 343 | Ga0068863_100027198 | 3300005841 | Bacteria | 5454 |
| 344 | Ga0068863_100736499 | 3300005841 | Bacteria | 981 |
| 345 | Ga0068863_100938243 | 3300005841 | Bacteria | 867 |
| 346 | Ga0068863_101096089 | 3300005841 | Unclassified | 801 |
| 347 | Ga0068863_101126947 | 3300005841 | Bacteria | 789 |
| 348 | Ga0068863_102645197 | 3300005841 | Bacteria | 511 |
| 349 | Ga0068858_100021214 | 3300005842 | Bacteria | 6066 |
| 350 | Ga0068858_100038893 | 3300005842 | Bacteria | 4412 |
| 351 | Ga0068858_100042104 | 3300005842 | Bacteria | 4235 |
| 352 | Ga0068858_100061755 | 3300005842 | Bacteria | 3464 |
| 353 | Ga0068858_100074228 | 3300005842 | Unclassified | 3158 |
| 354 | Ga0068858_100360781 | 3300005842 | Unclassified | 1393 |
| 355 | Ga0068858_100627920 | 3300005842 | Bacteria | 1043 |
| 356 | Ga0068858_101211263 | 3300005842 | Unclassified | 742 |
| 357 | Ga0068860_100069371 | 3300005843 | Bacteria | 3350 |
| 358 | Ga0068860_100071856 | 3300005843 | Bacteria | 3287 |
| 359 | Ga0068860_100262337 | 3300005843 | Unclassified | 1684 |
| 360 | Ga0068860_100326915 | 3300005843 | Bacteria | 1505 |
| 361 | Ga0068860_100363828 | 3300005843 | Unclassified | 1425 |
| 362 | Ga0068860_100640107 | 3300005843 | Bacteria | 1071 |
| 363 | Ga0068860_100680183 | 3300005843 | Bacteria | 1038 |
| 364 | Ga0068860_102089522 | 3300005843 | Unclassified | 588 |
| 365 | Ga0068862_100002588 | 3300005844 | Bacteria | 15970 |
| 366 | Ga0068862_100002657 | 3300005844 | Bacteria | 15725 |
| 367 | Ga0068862_100010700 | 3300005844 | Bacteria | 7575 |
| 368 | Ga0068862_100099714 | 3300005844 | Bacteria | 2539 |
| 369 | Ga0068862_100206861 | 3300005844 | Unclassified | 1772 |
| 370 | Ga0068862_100380938 | 3300005844 | Unclassified | 1316 |
| 371 | Ga0068862_100415816 | 3300005844 | Unclassified | 1261 |
| 372 | Ga0068862_101013437 | 3300005844 | Unclassified | 822 |
| 373 | Ga0068862_101099749 | 3300005844 | Unclassified | 790 |
| 374 | Ga0068862_101463828 | 3300005844 | Bacteria | 688 |
| 375 | Ga0070717_10036827 | 3300006028 | Bacteria | 3970 |
| 376 | Ga0075432_10018649 | 3300006058 | Bacteria | 2367 |
| 377 | Ga0075432_10022440 | 3300006058 | Bacteria | 2159 |
| 378 | Ga0075432_10042709 | 3300006058 | Unclassified | 1587 |
| 379 | Ga0075432_10196518 | 3300006058 | Bacteria | 796 |
| 380 | Ga0070712_100070265 | 3300006175 | Bacteria | 2501 |
| 381 | Ga0097621_100196812 | 3300006237 | Bacteria | 1748 |
| 382 | Ga0097621_100249713 | 3300006237 | Bacteria | 1553 |
| 383 | Ga0097621_100660923 | 3300006237 | Unclassified | 960 |
| 384 | Ga0075370_10492590 | 3300006353 | Unclassified | 739 |
| 385 | Ga0068871_100032412 | 3300006358 | Bacteria | 4128 |
| 386 | Ga0068871_100088291 | 3300006358 | Unclassified | 2579 |
| 387 | Ga0068871_100311933 | 3300006358 | Bacteria | 1383 |
| 388 | Ga0068871_100804422 | 3300006358 | Unclassified | 867 |
| 389 | Ga0068871_101894518 | 3300006358 | Unclassified | 567 |
| 390 | Ga0075428_100000377 | 3300006844 | Bacteria | 44160 |
| 391 | Ga0075428_100002001 | 3300006844 | Bacteria | 21952 |
| 392 | Ga0075428_100009521 | 3300006844 | Bacteria | 10787 |
| 393 | Ga0075428_100020830 | 3300006844 | Bacteria | 7261 |
| 394 | Ga0075428_100033834 | 3300006844 | Bacteria | 5639 |
| 395 | Ga0075428_100132740 | 3300006844 | Unclassified | 2708 |
| 396 | Ga0075428_100306215 | 3300006844 | Bacteria | 1708 |
| 397 | Ga0075428_100648611 | 3300006844 | Unclassified | 1126 |
| 398 | Ga0075428_101294535 | 3300006844 | Unclassified | 767 |
| 399 | Ga0075428_101297249 | 3300006844 | Unclassified | 766 |
| 400 | Ga0075428_102195098 | 3300006844 | Bacteria | 570 |
| 401 | Ga0075430_100003207 | 3300006846 | Bacteria | 13694 |
| 402 | Ga0075430_100038491 | 3300006846 | Bacteria | 4050 |
| 403 | Ga0075430_100097632 | 3300006846 | Bacteria | 2455 |
| 404 | Ga0075431_100000943 | 3300006847 | Bacteria | 25642 |
| 405 | Ga0075431_100052605 | 3300006847 | Bacteria | 4199 |
| 406 | Ga0075431_100066018 | 3300006847 | Bacteria | 3736 |
| 407 | Ga0075431_100073720 | 3300006847 | Bacteria | 3522 |
| 408 | Ga0075431_100097501 | 3300006847 | Unclassified | 3036 |
| 409 | Ga0075433_10001576 | 3300006852 | Bacteria | 16882 |
| 410 | Ga0075433_10122925 | 3300006852 | Bacteria | 2305 |
| 411 | Ga0075433_10137231 | 3300006852 | Bacteria | 2174 |
| 412 | Ga0075433_10335777 | 3300006852 | Bacteria | 1336 |
| 413 | Ga0075433_10635860 | 3300006852 | Bacteria | 936 |
| 414 | Ga0075433_10794390 | 3300006852 | Unclassified | 827 |
| 415 | Ga0075433_11500019 | 3300006852 | Bacteria | 582 |
| 416 | Ga0075434_100008841 | 3300006871 | Bacteria | 9374 |
| 417 | Ga0075434_100049640 | 3300006871 | Bacteria | 4167 |
| 418 | Ga0075434_100114950 | 3300006871 | Bacteria | 2704 |
| 419 | Ga0075434_100449529 | 3300006871 | Bacteria | 1310 |
| 420 | Ga0075434_100848057 | 3300006871 | Unclassified | 929 |
| 421 | Ga0075434_101048974 | 3300006871 | Bacteria | 829 |
| 422 | Ga0075434_102086689 | 3300006871 | Unclassified | 571 |
| 423 | Ga0075429_100004661 | 3300006880 | Bacteria | 11801 |
| 424 | Ga0075429_100014110 | 3300006880 | Bacteria | 6922 |
| 425 | Ga0075429_100082650 | 3300006880 | Bacteria | 2799 |
| 426 | Ga0075429_100127727 | 3300006880 | Bacteria | 2223 |
| 427 | Ga0068865_100000314 | 3300006881 | Bacteria | 26796 |
| 428 | Ga0068865_100012120 | 3300006881 | Bacteria | 5420 |
| 429 | Ga0068865_100180548 | 3300006881 | Bacteria | 1625 |
| 430 | Ga0068865_100399117 | 3300006881 | Bacteria | 1126 |
| 431 | Ga0068865_100730737 | 3300006881 | Bacteria | 848 |
| 432 | Ga0068865_101652302 | 3300006881 | Unclassified | 577 |
| 433 | Ga0075436_100133015 | 3300006914 | Bacteria | 1745 |
| 434 | Ga0097620_100004737 | 3300006931 | Bacteria | 13820 |
| 435 | Ga0097620_100008005 | 3300006931 | Bacteria | 10715 |
| 436 | Ga0097620_100029472 | 3300006931 | Bacteria | 5506 |
| 437 | Ga0097620_100195026 | 3300006931 | Bacteria | 2109 |
| 438 | Ga0097620_100242785 | 3300006931 | Bacteria | 1891 |
| 439 | Ga0097620_101537587 | 3300006931 | Unclassified | 735 |
| 440 | Ga0097620_101871603 | 3300006931 | Bacteria | 663 |
| 441 | Ga0097620_102574695 | 3300006931 | Bacteria | 560 |
| 442 | Ga0097620_102727647 | 3300006931 | Unclassified | 543 |
| 443 | Ga0075435_100003605 | 3300007076 | Bacteria | 10528 |
| 444 | Ga0075435_100041793 | 3300007076 | Bacteria | 3665 |
| 445 | Ga0075435_100057999 | 3300007076 | Unclassified | 3134 |
| 446 | Ga0075435_100230262 | 3300007076 | Bacteria | 1574 |
| 447 | Ga0075435_100261351 | 3300007076 | Unclassified | 1475 |
| 448 | Ga0075435_101071859 | 3300007076 | Unclassified | 704 |
| 449 | Ga0099794_10192820 | 3300007265 | Bacteria | 1042 |
| 450 | Ga0105251_10113876 | 3300009011 | Bacteria | 1231 |
| 451 | Ga0105250_10312269 | 3300009092 | Unclassified | 682 |
| 452 | Ga0105250_10381175 | 3300009092 | Unclassified | 622 |
| 453 | Ga0105240_10301966 | 3300009093 | Bacteria | 1831 |
| 454 | Ga0111539_10003861 | 3300009094 | Bacteria | 19727 |
| 455 | Ga0111539_10007889 | 3300009094 | Bacteria | 13584 |
| 456 | Ga0111539_10009953 | 3300009094 | Bacteria | 11989 |
| 457 | Ga0111539_10041369 | 3300009094 | Bacteria | 5541 |
| 458 | Ga0111539_10070401 | 3300009094 | Bacteria | 4130 |
| 459 | Ga0111539_10120027 | 3300009094 | Unclassified | 3080 |
| 460 | Ga0111539_10150487 | 3300009094 | Bacteria | 2724 |
| 461 | Ga0111539_10297580 | 3300009094 | Bacteria | 1878 |
| 462 | Ga0111539_10606797 | 3300009094 | Bacteria | 1274 |
| 463 | Ga0111539_10675451 | 3300009094 | Bacteria | 1203 |
| 464 | Ga0111539_10772541 | 3300009094 | Bacteria | 1118 |
| 465 | Ga0111539_10815489 | 3300009094 | Bacteria | 1086 |
| 466 | Ga0111539_11371304 | 3300009094 | Unclassified | 820 |
| 467 | Ga0105245_10053254 | 3300009098 | Bacteria | 3632 |
| 468 | Ga0105245_10207295 | 3300009098 | Unclassified | 1885 |
| 469 | Ga0105245_11063816 | 3300009098 | Bacteria | 855 |
| 470 | Ga0105245_11067771 | 3300009098 | Bacteria | 853 |
| 471 | Ga0105245_11383675 | 3300009098 | Bacteria | 753 |
| 472 | Ga0105247_10012480 | 3300009101 | Bacteria | 5103 |
| 473 | Ga0105247_10172239 | 3300009101 | Bacteria | 1440 |
| 474 | Ga0105247_10201992 | 3300009101 | Bacteria | 1336 |
| 475 | Ga0114129_10000090 | 3300009147 | Bacteria | 86472 |
| 476 | Ga0114129_10000961 | 3300009147 | Bacteria | 37631 |
| 477 | Ga0114129_10003363 | 3300009147 | Bacteria | 22462 |
| 478 | Ga0114129_10003850 | 3300009147 | Bacteria | 21164 |
| 479 | Ga0114129_10045668 | 3300009147 | Bacteria | 6157 |
| 480 | Ga0114129_10068730 | 3300009147 | Bacteria | 4939 |
| 481 | Ga0114129_10161503 | 3300009147 | Bacteria | 3060 |
| 482 | Ga0114129_10186504 | 3300009147 | Unclassified | 2819 |
| 483 | Ga0114129_10196129 | 3300009147 | Unclassified | 2738 |
| 484 | Ga0114129_10629430 | 3300009147 | Unclassified | 1387 |
| 485 | Ga0114129_10857819 | 3300009147 | Bacteria | 1154 |
| 486 | Ga0114129_11344972 | 3300009147 | Unclassified | 883 |
| 487 | Ga0105243_10047234 | 3300009148 | Bacteria | 3388 |
| 488 | Ga0105243_10065887 | 3300009148 | Bacteria | 2911 |
| 489 | Ga0105243_10203651 | 3300009148 | Bacteria | 1737 |
| 490 | Ga0105243_10224491 | 3300009148 | Unclassified | 1662 |
| 491 | Ga0105243_10318624 | 3300009148 | Unclassified | 1416 |
| 492 | Ga0105243_10467714 | 3300009148 | Bacteria | 1187 |
| 493 | Ga0105243_10547711 | 3300009148 | Bacteria | 1105 |
| 494 | Ga0105243_11140309 | 3300009148 | Unclassified | 790 |
| 495 | Ga0105243_11149424 | 3300009148 | Unclassified | 787 |
| 496 | Ga0105241_12105352 | 3300009174 | Unclassified | 558 |
| 497 | Ga0105242_10024625 | 3300009176 | Bacteria | 4755 |
| 498 | Ga0105242_10041293 | 3300009176 | Bacteria | 3720 |
| 499 | Ga0105242_10097517 | 3300009176 | Bacteria | 2485 |
| 500 | Ga0105248_10009073 | 3300009177 | Bacteria | 10937 |
| 501 | Ga0105248_10440767 | 3300009177 | Bacteria | 1467 |
| 502 | Ga0105248_10587765 | 3300009177 | Bacteria | 1256 |
| 503 | Ga0105248_10896976 | 3300009177 | Bacteria | 1001 |
| 504 | Ga0105248_12124062 | 3300009177 | Unclassified | 639 |
| 505 | Ga0105248_12509649 | 3300009177 | Bacteria | 587 |
| 506 | Ga0105248_12920207 | 3300009177 | Bacteria | 545 |
| 507 | Ga0105237_10199839 | 3300009545 | Unclassified | 1998 |
| 508 | Ga0105237_12308417 | 3300009545 | Unclassified | 548 |
| 509 | Ga0105238_10052352 | 3300009551 | Bacteria | 4103 |
| 510 | Ga0105238_11326259 | 3300009551 | Bacteria | 746 |
| 511 | Ga0105249_10002499 | 3300009553 | Bacteria | 15917 |
| 512 | Ga0105249_10061572 | 3300009553 | Bacteria | 3445 |
| 513 | Ga0105249_10061612 | 3300009553 | Bacteria | 3444 |
| 514 | Ga0105249_10982670 | 3300009553 | Bacteria | 913 |
| 515 | Ga0105249_11004824 | 3300009553 | Bacteria | 903 |
| 516 | Ga0105249_11142213 | 3300009553 | Unclassified | 849 |
| 517 | Ga0105249_11551495 | 3300009553 | Bacteria | 735 |
| 518 | Ga0105249_11836706 | 3300009553 | Unclassified | 679 |
| 519 | Ga0105249_11991919 | 3300009553 | Unclassified | 653 |
| 520 | Ga0105249_12991184 | 3300009553 | Bacteria | 543 |
| 521 | Ga0105239_11203617 | 3300010375 | Unclassified | 873 |
| 522 | Ga0105246_10010255 | 3300011119 | Bacteria | 5789 |
| 523 | Ga0105246_10383606 | 3300011119 | Unclassified | 1162 |
| 524 | Ga0105246_10474260 | 3300011119 | Unclassified | 1057 |
| 525 | Ga0105246_11617527 | 3300011119 | Unclassified | 613 |
| 526 | Ga0157339_1019946 | 3300012505 | Unclassified | 703 |
| 527 | Ga0157316_1006121 | 3300012510 | Bacteria | 976 |
| 528 | Ga0157371_10268218 | 3300013102 | Bacteria | 1231 |
| 529 | Ga0157374_10034263 | 3300013296 | Bacteria | 4636 |
| 530 | Ga0157374_10154302 | 3300013296 | Bacteria | 2234 |
| 531 | Ga0157374_10660104 | 3300013296 | Bacteria | 1058 |
| 532 | Ga0157374_11230454 | 3300013296 | Bacteria | 770 |
| 533 | Ga0157374_12773698 | 3300013296 | Unclassified | 518 |
| 534 | Ga0157378_10382608 | 3300013297 | Unclassified | 1382 |
| 535 | Ga0157378_10432808 | 3300013297 | Unclassified | 1302 |
| 536 | Ga0157378_11115715 | 3300013297 | Unclassified | 826 |
| 537 | Ga0163162_10023495 | 3300013306 | Bacteria | 6084 |
| 538 | Ga0163162_10305796 | 3300013306 | Unclassified | 1722 |
| 539 | Ga0163162_10337290 | 3300013306 | Unclassified | 1640 |
| 540 | Ga0163162_10902576 | 3300013306 | Unclassified | 997 |
| 541 | Ga0163162_12052709 | 3300013306 | Unclassified | 655 |
| 542 | Ga0157372_12971316 | 3300013307 | Unclassified | 542 |
| 543 | Ga0157375_10035668 | 3300013308 | Bacteria | 4749 |
| 544 | Ga0157375_10579778 | 3300013308 | Unclassified | 1282 |
| 545 | Ga0157375_10715247 | 3300013308 | Bacteria | 1155 |
| 546 | Ga0157375_11025845 | 3300013308 | Unclassified | 964 |
| 547 | Ga0157375_12119837 | 3300013308 | Unclassified | 669 |
| 548 | Ga0157375_12791686 | 3300013308 | Unclassified | 584 |
| 549 | Ga0157375_13648500 | 3300013308 | Bacteria | 512 |
| 550 | Ga0163163_10002016 | 3300014325 | Bacteria | 17149 |
| 551 | Ga0163163_10077716 | 3300014325 | Bacteria | 3314 |
| 552 | Ga0163163_10167906 | 3300014325 | Bacteria | 2241 |
| 553 | Ga0163163_10220250 | 3300014325 | Bacteria | 1946 |
| 554 | Ga0163163_10471771 | 3300014325 | Bacteria | 1316 |
| 555 | Ga0163163_10495844 | 3300014325 | Unclassified | 1283 |
| 556 | Ga0163163_10500081 | 3300014325 | Unclassified | 1277 |
| 557 | Ga0163163_10969843 | 3300014325 | Unclassified | 913 |
| 558 | Ga0163163_11176836 | 3300014325 | Bacteria | 829 |
| 559 | Ga0163163_12447103 | 3300014325 | Unclassified | 580 |
| 560 | Ga0157380_10035309 | 3300014326 | Bacteria | 3861 |
| 561 | Ga0157380_10081419 | 3300014326 | Bacteria | 2648 |
| 562 | Ga0157380_10202531 | 3300014326 | Unclassified | 1762 |
| 563 | Ga0157380_10281129 | 3300014326 | Bacteria | 1523 |
| 564 | Ga0157380_10340602 | 3300014326 | Bacteria | 1399 |
| 565 | Ga0157380_10709635 | 3300014326 | Bacteria | 1012 |
| 566 | Ga0157380_10803286 | 3300014326 | Bacteria | 958 |
| 567 | Ga0157380_10843851 | 3300014326 | Unclassified | 937 |
| 568 | Ga0157380_10924763 | 3300014326 | Bacteria | 900 |
| 569 | Ga0157380_11299914 | 3300014326 | Bacteria | 774 |
| 570 | Ga0157380_11414201 | 3300014326 | Bacteria | 746 |
| 571 | Ga0157380_12711086 | 3300014326 | Bacteria | 562 |
| 572 | Ga0157377_10007500 | 3300014745 | Bacteria | 5271 |
| 573 | Ga0157377_10019853 | 3300014745 | Bacteria | 3514 |
| 574 | Ga0157377_10060632 | 3300014745 | Unclassified | 2160 |
| 575 | Ga0157377_10080786 | 3300014745 | Bacteria | 1900 |
| 576 | Ga0157377_10686191 | 3300014745 | Unclassified | 742 |
| 577 | Ga0157377_11122191 | 3300014745 | Bacteria | 604 |
| 578 | Ga0157379_10011139 | 3300014968 | Bacteria | 7839 |
| 579 | Ga0157379_10361242 | 3300014968 | Unclassified | 1331 |
| 580 | Ga0157379_10857228 | 3300014968 | Unclassified | 860 |
| 581 | Ga0157379_11026268 | 3300014968 | Unclassified | 787 |
| 582 | Ga0157376_10079266 | 3300014969 | Bacteria | 2815 |
| 583 | Ga0157376_10090388 | 3300014969 | Unclassified | 2650 |
| 584 | Ga0157376_10560107 | 3300014969 | Unclassified | 1132 |
| 585 | Ga0157376_11704053 | 3300014969 | Bacteria | 666 |
| 586 | Ga0163161_10054290 | 3300017792 | Bacteria | 2907 |
| 587 | Ga0163161_10423845 | 3300017792 | Unclassified | 1071 |
| 588 | Ga0163161_10808943 | 3300017792 | Unclassified | 788 |
| 589 | Ga0163161_10886326 | 3300017792 | Unclassified | 755 |
| 590 | Ga0207666_1073018 | 3300025271 | Unclassified | 553 |
| 591 | Ga0207673_1002600 | 3300025290 | Bacteria | 2069 |
| 592 | Ga0207697_10005501 | 3300025315 | Bacteria | 5880 |
| 593 | Ga0207697_10097542 | 3300025315 | Unclassified | 1250 |
| 594 | Ga0207697_10104081 | 3300025315 | Bacteria | 1212 |
| 595 | Ga0207697_10368866 | 3300025315 | Unclassified | 637 |
| 596 | Ga0207656_10007252 | 3300025321 | Bacteria | 4028 |
| 597 | Ga0207656_10258355 | 3300025321 | Bacteria | 855 |
| 598 | Ga0207656_10494942 | 3300025321 | Unclassified | 620 |
| 599 | Ga0207653_10046610 | 3300025885 | Bacteria | 1434 |
| 600 | Ga0207653_10076824 | 3300025885 | Unclassified | 1150 |
| 601 | Ga0207653_10136900 | 3300025885 | Bacteria | 893 |
| 602 | Ga0207653_10281698 | 3300025885 | Bacteria | 642 |
| 603 | Ga0207682_10001224 | 3300025893 | Bacteria | 11865 |
| 604 | Ga0207682_10035154 | 3300025893 | Unclassified | 2023 |
| 605 | Ga0207682_10063942 | 3300025893 | Bacteria | 1545 |
| 606 | Ga0207682_10109851 | 3300025893 | Bacteria | 1213 |
| 607 | Ga0207682_10165642 | 3300025893 | Unclassified | 1004 |
| 608 | Ga0207682_10270733 | 3300025893 | Bacteria | 793 |
| 609 | Ga0207642_10407204 | 3300025899 | Unclassified | 815 |
| 610 | Ga0207642_11068670 | 3300025899 | Unclassified | 521 |
| 611 | Ga0207710_10021883 | 3300025900 | Bacteria | 2743 |
| 612 | Ga0207710_10768844 | 3300025900 | Unclassified | 506 |
| 613 | Ga0207688_10009371 | 3300025901 | Bacteria | 5333 |
| 614 | Ga0207688_10254198 | 3300025901 | Bacteria | 1065 |
| 615 | Ga0207688_10261755 | 3300025901 | Bacteria | 1050 |
| 616 | Ga0207688_10315656 | 3300025901 | Bacteria | 958 |
| 617 | Ga0207688_10713712 | 3300025901 | Bacteria | 634 |
| 618 | Ga0207680_10036782 | 3300025903 | Bacteria | 2821 |
| 619 | Ga0207680_10226464 | 3300025903 | Unclassified | 1284 |
| 620 | Ga0207680_10240601 | 3300025903 | Unclassified | 1247 |
| 621 | Ga0207647_10469422 | 3300025904 | Bacteria | 704 |
| 622 | Ga0207645_10002078 | 3300025907 | Bacteria | 16024 |
| 623 | Ga0207645_10009110 | 3300025907 | Bacteria | 6883 |
| 624 | Ga0207645_10143363 | 3300025907 | Bacteria | 1557 |
| 625 | Ga0207645_10215518 | 3300025907 | Bacteria | 1265 |
| 626 | Ga0207645_10277005 | 3300025907 | Bacteria | 1113 |
| 627 | Ga0207645_10313563 | 3300025907 | Bacteria | 1045 |
| 628 | Ga0207645_10597391 | 3300025907 | Bacteria | 749 |
| 629 | Ga0207643_10000832 | 3300025908 | Bacteria | 18731 |
| 630 | Ga0207643_10015722 | 3300025908 | Bacteria | 4122 |
| 631 | Ga0207643_10026631 | 3300025908 | Bacteria | 3201 |
| 632 | Ga0207643_10100971 | 3300025908 | Bacteria | 1692 |
| 633 | Ga0207643_10452927 | 3300025908 | Bacteria | 817 |
| 634 | Ga0207643_10529557 | 3300025908 | Bacteria | 755 |
| 635 | Ga0207643_10571905 | 3300025908 | Unclassified | 726 |
| 636 | Ga0207643_10577646 | 3300025908 | Unclassified | 722 |
| 637 | Ga0207684_10439570 | 3300025910 | Unclassified | 1120 |
| 638 | Ga0207654_10466269 | 3300025911 | Unclassified | 888 |
| 639 | Ga0207707_10122110 | 3300025912 | Bacteria | 2278 |
| 640 | Ga0207660_10707203 | 3300025917 | Bacteria | 822 |
| 641 | Ga0207662_10003136 | 3300025918 | Bacteria | 8450 |
| 642 | Ga0207662_10026040 | 3300025918 | Unclassified | 3372 |
| 643 | Ga0207662_10040344 | 3300025918 | Bacteria | 2743 |
| 644 | Ga0207662_10482942 | 3300025918 | Bacteria | 851 |
| 645 | Ga0207662_10867409 | 3300025918 | Unclassified | 638 |
| 646 | Ga0207657_10659863 | 3300025919 | Bacteria | 814 |
| 647 | Ga0207649_10029447 | 3300025920 | Bacteria | 3242 |
| 648 | Ga0207649_10210507 | 3300025920 | Bacteria | 1379 |
| 649 | Ga0207649_10509554 | 3300025920 | Bacteria | 916 |
| 650 | Ga0207646_10064574 | 3300025922 | Unclassified | 3268 |
| 651 | Ga0207646_10595071 | 3300025922 | Bacteria | 993 |
| 652 | Ga0207646_10799295 | 3300025922 | Unclassified | 840 |
| 653 | Ga0207681_10012433 | 3300025923 | Bacteria | 5254 |
| 654 | Ga0207681_10012857 | 3300025923 | Bacteria | 5176 |
| 655 | Ga0207681_10060309 | 3300025923 | Bacteria | 2604 |
| 656 | Ga0207681_10139883 | 3300025923 | Bacteria | 1801 |
| 657 | Ga0207681_10149521 | 3300025923 | Bacteria | 1748 |
| 658 | Ga0207681_10177750 | 3300025923 | Bacteria | 1618 |
| 659 | Ga0207681_10946909 | 3300025923 | Bacteria | 722 |
| 660 | Ga0207681_11072158 | 3300025923 | Unclassified | 676 |
| 661 | Ga0207681_11141776 | 3300025923 | Bacteria | 654 |
| 662 | Ga0207694_10003836 | 3300025924 | Bacteria | 11890 |
| 663 | Ga0207650_10006164 | 3300025925 | Bacteria | 8172 |
| 664 | Ga0207650_10061509 | 3300025925 | Bacteria | 2804 |
| 665 | Ga0207650_10077835 | 3300025925 | Bacteria | 2508 |
| 666 | Ga0207650_10676109 | 3300025925 | Unclassified | 871 |
| 667 | Ga0207650_10908238 | 3300025925 | Unclassified | 748 |
| 668 | Ga0207659_10002642 | 3300025926 | Bacteria | 10672 |
| 669 | Ga0207659_10009199 | 3300025926 | Bacteria | 6170 |
| 670 | Ga0207659_10021667 | 3300025926 | Bacteria | 4270 |
| 671 | Ga0207659_10025297 | 3300025926 | Bacteria | 3987 |
| 672 | Ga0207659_10032932 | 3300025926 | Bacteria | 3561 |
| 673 | Ga0207659_10106017 | 3300025926 | Unclassified | 2127 |
| 674 | Ga0207659_10197810 | 3300025926 | Bacteria | 1603 |
| 675 | Ga0207659_10219883 | 3300025926 | Unclassified | 1527 |
| 676 | Ga0207659_10220441 | 3300025926 | Unclassified | 1525 |
| 677 | Ga0207659_10260618 | 3300025926 | Unclassified | 1410 |
| 678 | Ga0207659_10514744 | 3300025926 | Unclassified | 1014 |
| 679 | Ga0207659_10587441 | 3300025926 | Unclassified | 949 |
| 680 | Ga0207659_10623932 | 3300025926 | Bacteria | 920 |
| 681 | Ga0207687_10039014 | 3300025927 | Bacteria | 3250 |
| 682 | Ga0207687_10517243 | 3300025927 | Bacteria | 998 |
| 683 | Ga0207687_10623804 | 3300025927 | Bacteria | 910 |
| 684 | Ga0207700_10003456 | 3300025928 | Bacteria | 9192 |
| 685 | Ga0207644_10013059 | 3300025931 | Bacteria | 5527 |
| 686 | Ga0207644_10018847 | 3300025931 | Bacteria | 4675 |
| 687 | Ga0207644_10055749 | 3300025931 | Unclassified | 2850 |
| 688 | Ga0207690_10797450 | 3300025932 | Unclassified | 780 |
| 689 | Ga0207690_11071639 | 3300025932 | Unclassified | 671 |
| 690 | Ga0207690_11119248 | 3300025932 | Bacteria | 657 |
| 691 | Ga0207690_11700703 | 3300025932 | Unclassified | 527 |
| 692 | Ga0207706_10029018 | 3300025933 | Bacteria | 4940 |
| 693 | Ga0207706_10127780 | 3300025933 | Bacteria | 2235 |
| 694 | Ga0207706_10149111 | 3300025933 | Unclassified | 2057 |
| 695 | Ga0207706_10235777 | 3300025933 | Bacteria | 1600 |
| 696 | Ga0207706_10321647 | 3300025933 | Bacteria | 1346 |
| 697 | Ga0207686_10011465 | 3300025934 | Bacteria | 4855 |
| 698 | Ga0207686_10046529 | 3300025934 | Bacteria | 2677 |
| 699 | Ga0207686_10152844 | 3300025934 | Unclassified | 1609 |
| 700 | Ga0207709_10039347 | 3300025935 | Unclassified | 2824 |
| 701 | Ga0207709_10116053 | 3300025935 | Bacteria | 1799 |
| 702 | Ga0207709_10164768 | 3300025935 | Bacteria | 1550 |
| 703 | Ga0207709_10346675 | 3300025935 | Unclassified | 1120 |
| 704 | Ga0207709_10348594 | 3300025935 | Bacteria | 1117 |
| 705 | Ga0207709_10778738 | 3300025935 | Unclassified | 771 |
| 706 | Ga0207709_11457513 | 3300025935 | Unclassified | 567 |
| 707 | Ga0207670_10023111 | 3300025936 | Bacteria | 3864 |
| 708 | Ga0207670_10039201 | 3300025936 | Bacteria | 3101 |
| 709 | Ga0207670_10326378 | 3300025936 | Bacteria | 1209 |
| 710 | Ga0207670_10673746 | 3300025936 | Bacteria | 854 |
| 711 | Ga0207670_11935473 | 3300025936 | Unclassified | 501 |
| 712 | Ga0207669_10000046 | 3300025937 | Bacteria | 62654 |
| 713 | Ga0207669_10041347 | 3300025937 | Bacteria | 2682 |
| 714 | Ga0207669_10046745 | 3300025937 | Bacteria | 2560 |
| 715 | Ga0207669_11235858 | 3300025937 | Bacteria | 633 |
| 716 | Ga0207669_11575813 | 3300025937 | Unclassified | 560 |
| 717 | Ga0207704_10001922 | 3300025938 | Bacteria | 9301 |
| 718 | Ga0207704_10223773 | 3300025938 | Bacteria | 1394 |
| 719 | Ga0207704_10244874 | 3300025938 | Bacteria | 1342 |
| 720 | Ga0207704_10480800 | 3300025938 | Bacteria | 997 |
| 721 | Ga0207691_10021362 | 3300025940 | Bacteria | 6114 |
| 722 | Ga0207691_10026097 | 3300025940 | Bacteria | 5483 |
| 723 | Ga0207691_10038423 | 3300025940 | Bacteria | 4430 |
| 724 | Ga0207691_10065552 | 3300025940 | Bacteria | 3287 |
| 725 | Ga0207691_10108300 | 3300025940 | Bacteria | 2473 |
| 726 | Ga0207691_10142131 | 3300025940 | Unclassified | 2115 |
| 727 | Ga0207691_10151703 | 3300025940 | Bacteria | 2037 |
| 728 | Ga0207691_10201413 | 3300025940 | Bacteria | 1732 |
| 729 | Ga0207691_10237015 | 3300025940 | Bacteria | 1578 |
| 730 | Ga0207691_10383129 | 3300025940 | Unclassified | 1200 |
| 731 | Ga0207711_10007787 | 3300025941 | Bacteria | 8955 |
| 732 | Ga0207711_10192278 | 3300025941 | Bacteria | 1860 |
| 733 | Ga0207711_10200902 | 3300025941 | Bacteria | 1819 |
| 734 | Ga0207711_10302693 | 3300025941 | Unclassified | 1475 |
| 735 | Ga0207711_10375609 | 3300025941 | Bacteria | 1319 |
| 736 | Ga0207689_10002481 | 3300025942 | Bacteria | 17146 |
| 737 | Ga0207689_10009132 | 3300025942 | Bacteria | 8579 |
| 738 | Ga0207689_10040878 | 3300025942 | Bacteria | 3836 |
| 739 | Ga0207689_10397250 | 3300025942 | Bacteria | 1149 |
| 740 | Ga0207689_10614555 | 3300025942 | Bacteria | 915 |
| 741 | Ga0207689_10830430 | 3300025942 | Unclassified | 780 |
| 742 | Ga0207661_10091394 | 3300025944 | Bacteria | 2536 |
| 743 | Ga0207661_10325954 | 3300025944 | Bacteria | 1382 |
| 744 | Ga0207679_10001898 | 3300025945 | Bacteria | 12983 |
| 745 | Ga0207679_10106687 | 3300025945 | Bacteria | 2202 |
| 746 | Ga0207679_10127605 | 3300025945 | Bacteria | 2035 |
| 747 | Ga0207679_10132030 | 3300025945 | Bacteria | 2005 |
| 748 | Ga0207679_10174152 | 3300025945 | Bacteria | 1774 |
| 749 | Ga0207679_10225488 | 3300025945 | Bacteria | 1579 |
| 750 | Ga0207679_10440137 | 3300025945 | Unclassified | 1154 |
| 751 | Ga0207679_10554977 | 3300025945 | Bacteria | 1031 |
| 752 | Ga0207679_10586570 | 3300025945 | Bacteria | 1003 |
| 753 | Ga0207651_10002368 | 3300025960 | Bacteria | 8995 |
| 754 | Ga0207651_10087453 | 3300025960 | Bacteria | 2268 |
| 755 | Ga0207651_10087876 | 3300025960 | Bacteria | 2264 |
| 756 | Ga0207651_10283029 | 3300025960 | Bacteria | 1371 |
| 757 | Ga0207651_10305470 | 3300025960 | Unclassified | 1324 |
| 758 | Ga0207651_10489724 | 3300025960 | Unclassified | 1061 |
| 759 | Ga0207651_10561304 | 3300025960 | Unclassified | 994 |
| 760 | Ga0207651_10606181 | 3300025960 | Bacteria | 957 |
| 761 | Ga0207651_10788057 | 3300025960 | Unclassified | 842 |
| 762 | Ga0207651_11547566 | 3300025960 | Bacteria | 597 |
| 763 | Ga0207712_10084558 | 3300025961 | Bacteria | 2319 |
| 764 | Ga0207712_10113506 | 3300025961 | Bacteria | 2036 |
| 765 | Ga0207712_10389670 | 3300025961 | Bacteria | 1168 |
| 766 | Ga0207712_10622644 | 3300025961 | Unclassified | 936 |
| 767 | Ga0207712_11305750 | 3300025961 | Bacteria | 648 |
| 768 | Ga0207712_11330329 | 3300025961 | Unclassified | 642 |
| 769 | Ga0207712_11985506 | 3300025961 | Unclassified | 521 |
| 770 | Ga0207712_12048898 | 3300025961 | Bacteria | 512 |
| 771 | Ga0207668_10041120 | 3300025972 | Bacteria | 3123 |
| 772 | Ga0207668_10140863 | 3300025972 | Bacteria | 1854 |
| 773 | Ga0207668_11015618 | 3300025972 | Unclassified | 742 |
| 774 | Ga0207640_10089575 | 3300025981 | Bacteria | 2127 |
| 775 | Ga0207640_10504343 | 3300025981 | Unclassified | 1008 |
| 776 | Ga0207640_10972266 | 3300025981 | Bacteria | 745 |
| 777 | Ga0207640_11328704 | 3300025981 | Unclassified | 642 |
| 778 | Ga0207658_10150843 | 3300025986 | Unclassified | 1893 |
| 779 | Ga0207658_10356135 | 3300025986 | Unclassified | 1276 |
| 780 | Ga0207658_10382021 | 3300025986 | Bacteria | 1234 |
| 781 | Ga0207658_11097971 | 3300025986 | Unclassified | 727 |
| 782 | Ga0207677_10131622 | 3300026023 | Bacteria | 1900 |
| 783 | Ga0207677_10223879 | 3300026023 | Unclassified | 1511 |
| 784 | Ga0207677_10636755 | 3300026023 | Unclassified | 939 |
| 785 | Ga0207677_10739419 | 3300026023 | Unclassified | 876 |
| 786 | Ga0207677_11190820 | 3300026023 | Bacteria | 697 |
| 787 | Ga0207677_11315868 | 3300026023 | Unclassified | 664 |
| 788 | Ga0207703_10004570 | 3300026035 | Bacteria | 11347 |
| 789 | Ga0207703_10024306 | 3300026035 | Bacteria | 4767 |
| 790 | Ga0207703_10072739 | 3300026035 | Bacteria | 2842 |
| 791 | Ga0207703_10076145 | 3300026035 | Bacteria | 2782 |
| 792 | Ga0207703_10113204 | 3300026035 | Bacteria | 2319 |
| 793 | Ga0207703_10203157 | 3300026035 | Unclassified | 1762 |
| 794 | Ga0207703_10428772 | 3300026035 | Bacteria | 1232 |
| 795 | Ga0207703_10931227 | 3300026035 | Bacteria | 832 |
| 796 | Ga0207703_11203226 | 3300026035 | Unclassified | 728 |
| 797 | Ga0207639_10110541 | 3300026041 | Bacteria | 2239 |
| 798 | Ga0207639_12157191 | 3300026041 | Unclassified | 518 |
| 799 | Ga0207678_10529561 | 3300026067 | Bacteria | 1029 |
| 800 | Ga0207678_11173879 | 3300026067 | Bacteria | 680 |
| 801 | Ga0207708_10018541 | 3300026075 | Bacteria | 5242 |
| 802 | Ga0207708_10056988 | 3300026075 | Unclassified | 2981 |
| 803 | Ga0207708_10060815 | 3300026075 | Unclassified | 2884 |
| 804 | Ga0207708_10083623 | 3300026075 | Bacteria | 2454 |
| 805 | Ga0207708_10100083 | 3300026075 | Bacteria | 2243 |
| 806 | Ga0207708_10277555 | 3300026075 | Bacteria | 1357 |
| 807 | Ga0207708_10639315 | 3300026075 | Bacteria | 905 |
| 808 | Ga0207708_10958416 | 3300026075 | Bacteria | 742 |
| 809 | Ga0207702_10552079 | 3300026078 | Bacteria | 1127 |
| 810 | Ga0207641_10021850 | 3300026088 | Bacteria | 5260 |
| 811 | Ga0207641_10200323 | 3300026088 | Bacteria | 1840 |
| 812 | Ga0207641_10790200 | 3300026088 | Bacteria | 938 |
| 813 | Ga0207641_10850142 | 3300026088 | Bacteria | 904 |
| 814 | Ga0207641_11019141 | 3300026088 | Bacteria | 825 |
| 815 | Ga0207641_11523910 | 3300026088 | Unclassified | 670 |
| 816 | Ga0207641_12038310 | 3300026088 | Bacteria | 575 |
| 817 | Ga0207648_10000198 | 3300026089 | Bacteria | 63567 |
| 818 | Ga0207648_10004539 | 3300026089 | Bacteria | 14234 |
| 819 | Ga0207648_10093868 | 3300026089 | Bacteria | 2624 |
| 820 | Ga0207648_10151552 | 3300026089 | Bacteria | 2046 |
| 821 | Ga0207648_11242031 | 3300026089 | Unclassified | 700 |
| 822 | Ga0207648_11307545 | 3300026089 | Bacteria | 681 |
| 823 | Ga0207648_11777136 | 3300026089 | Unclassified | 578 |
| 824 | Ga0207676_10002483 | 3300026095 | Bacteria | 13142 |
| 825 | Ga0207676_10033829 | 3300026095 | Bacteria | 3866 |
| 826 | Ga0207676_10086796 | 3300026095 | Bacteria | 2557 |
| 827 | Ga0207676_10092542 | 3300026095 | Bacteria | 2487 |
| 828 | Ga0207676_10157578 | 3300026095 | Unclassified | 1963 |
| 829 | Ga0207676_10438501 | 3300026095 | Bacteria | 1229 |
| 830 | Ga0207676_10460303 | 3300026095 | Bacteria | 1201 |
| 831 | Ga0207676_10593730 | 3300026095 | Bacteria | 1063 |
| 832 | Ga0207676_10737620 | 3300026095 | Unclassified | 957 |
| 833 | Ga0207676_11096224 | 3300026095 | Unclassified | 787 |
| 834 | Ga0207676_11761503 | 3300026095 | Unclassified | 618 |
| 835 | Ga0207674_10031401 | 3300026116 | Bacteria | 5581 |
| 836 | Ga0207674_10698884 | 3300026116 | Bacteria | 979 |
| 837 | Ga0207674_10992711 | 3300026116 | Bacteria | 809 |
| 838 | Ga0207674_11144495 | 3300026116 | Unclassified | 748 |
| 839 | Ga0207675_100001270 | 3300026118 | Bacteria | 25243 |
| 840 | Ga0207675_100003798 | 3300026118 | Bacteria | 14710 |
| 841 | Ga0207675_100009919 | 3300026118 | Bacteria | 8914 |
| 842 | Ga0207675_100375130 | 3300026118 | Unclassified | 1398 |
| 843 | Ga0207675_100476539 | 3300026118 | Unclassified | 1240 |
| 844 | Ga0207675_100580742 | 3300026118 | Unclassified | 1122 |
| 845 | Ga0207675_101692882 | 3300026118 | Unclassified | 652 |
| 846 | Ga0207675_101702041 | 3300026118 | Unclassified | 651 |
| 847 | Ga0207675_102522021 | 3300026118 | Bacteria | 525 |
| 848 | Ga0207683_10059342 | 3300026121 | Bacteria | 3361 |
| 849 | Ga0207683_10075217 | 3300026121 | Bacteria | 2989 |
| 850 | Ga0207683_10188902 | 3300026121 | Bacteria | 1870 |
| 851 | Ga0207683_10412119 | 3300026121 | Bacteria | 1244 |
| 852 | Ga0207683_10912229 | 3300026121 | Bacteria | 816 |
| 853 | Ga0207698_10118651 | 3300026142 | Bacteria | 2235 |
| 854 | Ga0210000_1002849 | 3300027462 | Bacteria | 2470 |
| 855 | Ga0209970_1013396 | 3300027614 | Bacteria | 1360 |
| 856 | Ga0209974_10443810 | 3300027876 | Unclassified | 514 |
| 857 | Ga0207428_10000510 | 3300027907 | Bacteria | 46433 |
| 858 | Ga0207428_10003032 | 3300027907 | Bacteria | 16532 |
| 859 | Ga0207428_10004234 | 3300027907 | Bacteria | 13740 |
| 860 | Ga0207428_10263731 | 3300027907 | Bacteria | 1282 |
| 861 | Ga0268266_10013971 | 3300028379 | Bacteria | 6913 |
| 862 | Ga0268266_10417416 | 3300028379 | Bacteria | 1271 |
| 863 | Ga0268266_12221360 | 3300028379 | Bacteria | 521 |
| 864 | Ga0268265_10000767 | 3300028380 | Bacteria | 31011 |
| 865 | Ga0268265_10075231 | 3300028380 | Bacteria | 2644 |
| 866 | Ga0268265_10251782 | 3300028380 | Bacteria | 1565 |
| 867 | Ga0268265_10262384 | 3300028380 | Bacteria | 1536 |
| 868 | Ga0268265_10294777 | 3300028380 | Bacteria | 1458 |
| 869 | Ga0268265_10312020 | 3300028380 | Bacteria | 1420 |
| 870 | Ga0268265_10352055 | 3300028380 | Bacteria | 1345 |
| 871 | Ga0268265_10352470 | 3300028380 | Unclassified | 1344 |
| 872 | Ga0268265_10780979 | 3300028380 | Unclassified | 929 |
| 873 | Ga0268265_10948111 | 3300028380 | Bacteria | 847 |
| 874 | Ga0268265_10984993 | 3300028380 | Unclassified | 832 |
| 875 | Ga0268265_11428253 | 3300028380 | Unclassified | 694 |
| 876 | Ga0268265_12702755 | 3300028380 | Bacteria | 502 |
| 877 | Ga0268264_10030150 | 3300028381 | Bacteria | 4447 |
| 878 | Ga0268264_10057330 | 3300028381 | Bacteria | 3258 |
| 879 | Ga0268264_10098065 | 3300028381 | Bacteria | 2541 |
| 880 | Ga0268264_10159438 | 3300028381 | Bacteria | 2031 |
| 881 | Ga0268264_10245646 | 3300028381 | Bacteria | 1660 |
| 882 | Ga0268264_10755889 | 3300028381 | Bacteria | 969 |
| 883 | Ga0268264_10947585 | 3300028381 | Unclassified | 866 |
| 884 | Ga0268264_12219417 | 3300028381 | Bacteria | 557 |
| 885 | Ga0307408_100497660 | 3300031548 | Bacteria | 1066 |
| 886 | Ga0307408_100780086 | 3300031548 | Bacteria | 866 |
| 887 | Ga0307406_11100810 | 3300031901 | Unclassified | 686 |
| 888 | Ga0307409_100539355 | 3300031995 | Unclassified | 1143 |
| 889 | Ga0307416_100543392 | 3300032002 | Bacteria | 1234 |
| 890 | Ga0307416_101044015 | 3300032002 | Unclassified | 921 |
| 891 | Ga0307416_103272197 | 3300032002 | Bacteria | 542 |
| 892 | Ga0307416_103509611 | 3300032002 | Bacteria | 525 |
| 893 | Ga0307411_10444698 | 3300032005 | Bacteria | 1083 |
| 894 | Ga0307411_10960992 | 3300032005 | Unclassified | 763 |
| 895 | Ga0373948_0013431 | 3300034817 | Unclassified | 1479 |
| 896 | Ga0373948_0063876 | 3300034817 | Unclassified | 813 |
| 897 | Ga0373928_0031217 | 3300035084 | Bacteria | 1182 |
| 898 | Ga0373940_0009982 | 3300035088 | Unclassified | 2221 |
| 899 | Ga0373951_0085893 | 3300035091 | Bacteria | 820 |
| 900 | Ga0373952_0034602 | 3300035092 | Bacteria | 1140 |
| 901 | Ga0373939_0182272 | 3300035114 | Bacteria | 784 |
| 902 | Ga0373957_0458749 | 3300035120 | Unclassified | 552 |
| 903 | Ga0373960_0023324 | 3300035121 | Bacteria | 1665 |
| 904 | Ga0373943_0450629 | 3300035170 | Bacteria | 748 |
| 905 | Ga0373961_0105539 | 3300035241 | Bacteria | 917 |
| 906 | Ga0373962_0029537 | 3300035242 | Bacteria | 1494 |
| 907 | Ga0373931_0057702 | 3300035691 | Bacteria | 2083 |
| 908 | Ga0395898_0156379 | 3300037466 | Bacteria | 2181 |
| 909 | Ga0395905_0007149 | 3300037471 | Bacteria | 11156 |
| 910 | Ga0395905_0392493 | 3300037471 | Bacteria | 1282 |
| 911 | Ga0395905_1125915 | 3300037471 | Unclassified | 688 |
| 912 | Ga0439453_0023334 | 3300041408 | Unclassified | 1128 |
| 913 | Ga0451855_0304849 | 3300041511 | Unclassified | 763 |
| 914 | Ga0451853_1394807 | 3300041512 | Unclassified | 745 |
| 915 | Ga0439450_005251 | 3300042008 | Bacteria | 2268 |
| 916 | Ga0439454_008248 | 3300042011 | Bacteria | 1327 |
| 917 | Ga0450908_065796 | 3300042184 | Bacteria | 640 |
| 918 | Ga0439435_0005021 | 3300042436 | Bacteria | 2885 |
| 919 | Ga0439464_0262658 | 3300042439 | Unclassified | 559 |
| 920 | Ga0439460_0136469 | 3300042461 | Unclassified | 811 |
| 921 | Ga0450916_000508 | 3300042530 | Bacteria | 3417 |
| 922 | Ga0451577_0395950 | 3300042876 | Bacteria | 1253 |
| 923 | Ga0439440_0040261 | 3300042993 | Unclassified | 1137 |
| 924 | Ga0453683_0559799 | 3300044673 | Bacteria | 744 |
| 925 | Ga0451576_0015279 | 3300045051 | Bacteria | 8511 |
| 926 | Ga0451576_0025358 | 3300045051 | Bacteria | 6386 |
| 927 | Ga0451576_0136760 | 3300045051 | Unclassified | 2555 |
| 928 | Ga0451576_0296849 | 3300045051 | Bacteria | 1689 |
| 929 | Ga0451576_0461962 | 3300045051 | Unclassified | 1333 |
| 930 | Ga0451576_0798617 | 3300045051 | Unclassified | 991 |
| 931 | Ga0451576_2671451 | 3300045051 | Unclassified | 508 |
| 932 | Ga0451576_2713153 | 3300045051 | Unclassified | 504 |
| 933 | Ga0495603_0187959 | 3300046455 | Unclassified | 1194 |
| 934 | Ga0495580_0127709 | 3300046472 | Unclassified | 1765 |
| 935 | Ga0495582_0105123 | 3300046473 | Bacteria | 1583 |
| 936 | Ga0495584_0269337 | 3300046491 | Unclassified | 866 |
| 937 | Ga0495594_0119481 | 3300046499 | Unclassified | 1489 |
| 938 | Ga0495643_0407409 | 3300046522 | Unclassified | 599 |
| 939 | Ga0495644_0350931 | 3300046523 | Bacteria | 581 |
| 940 | Ga0495642_0019218 | 3300046528 | Bacteria | 2678 |
| 941 | Ga0495598_0015644 | 3300046537 | Bacteria | 1920 |
| 942 | Ga0495598_0052951 | 3300046537 | Bacteria | 1228 |
| 943 | Ga0495621_0003986 | 3300046539 | Unclassified | 4108 |
| 944 | Ga0495621_0027536 | 3300046539 | Bacteria | 1925 |
| 945 | Ga0495621_0149592 | 3300046539 | Unclassified | 918 |
| 946 | Ga0495621_0164603 | 3300046539 | Bacteria | 879 |
| 947 | Ga0495668_0842339 | 3300046616 | Unclassified | 508 |
| 948 | Ga0495611_0575908 | 3300046648 | Unclassified | 509 |
| 949 | Ga0495659_0043359 | 3300046664 | Bacteria | 1614 |
| 950 | Ga0495659_0128935 | 3300046664 | Unclassified | 1002 |
| 951 | Ga0495588_0017456 | 3300046674 | Unclassified | 3486 |
| 952 | Ga0495588_0310439 | 3300046674 | Unclassified | 830 |
| 953 | Ga0495669_0023891 | 3300046684 | Unclassified | 2663 |
| 954 | Ga0495670_0365774 | 3300046691 | Bacteria | 777 |
| 955 | Ga0495685_007328 | 3300047447 | Bacteria | 3640 |
| 956 | Ga0496100_1123756 | 3300048903 | Unclassified | 619 |
| 957 | Ga0496102_0811128 | 3300048905 | Bacteria | 858 |
| 958 | Ga0496103_0249263 | 3300048906 | Bacteria | 1143 |
| 959 | Ga0496104_1139524 | 3300048907 | Unclassified | 683 |
| 960 | Ga0496106_0413510 | 3300048909 | Unclassified | 1084 |
| 961 | Ga0496106_0424775 | 3300048909 | Unclassified | 1068 |
| 962 | Ga0496106_0498865 | 3300048909 | Bacteria | 978 |
| 963 | Ga0496106_0673437 | 3300048909 | Bacteria | 826 |
| 964 | Ga0496106_0923624 | 3300048909 | Bacteria | 688 |
| 965 | Ga0496108_0012075 | 3300048911 | Bacteria | 7024 |
| 966 | Ga0496108_0613048 | 3300048911 | Bacteria | 948 |
| 967 | Ga0496109_0048968 | 3300048912 | Bacteria | 3846 |
| 968 | Ga0496109_0288894 | 3300048912 | Unclassified | 1546 |
| 969 | Ga0496110_0411574 | 3300048913 | Unclassified | 1233 |
| 970 | Ga0496110_0417667 | 3300048913 | Bacteria | 1223 |
| 971 | Ga0496110_0941518 | 3300048913 | Bacteria | 770 |
| 972 | Ga0496111_0971003 | 3300048914 | Bacteria | 610 |
| 973 | Ga0496112_0032678 | 3300048915 | Bacteria | 5052 |
| 974 | Ga0496112_0282770 | 3300048915 | Bacteria | 1606 |
| 975 | Ga0496112_1529119 | 3300048915 | Bacteria | 581 |
| 976 | Ga0496113_0062438 | 3300048916 | Unclassified | 2813 |
| 977 | Ga0496113_0238777 | 3300048916 | Bacteria | 1450 |
| 978 | Ga0496113_0558702 | 3300048916 | Bacteria | 918 |
| 979 | Ga0496113_1426056 | 3300048916 | Unclassified | 536 |
| 980 | Ga0496114_0157966 | 3300048917 | Unclassified | 1970 |
| 981 | Ga0496114_0162749 | 3300048917 | Bacteria | 1941 |
| 982 | Ga0501032_0484185 | 3300049569 | Bacteria | 791 |
| 983 | Ga0501036_0136152 | 3300049572 | Bacteria | 2073 |
| 984 | Ga0501039_0241187 | 3300049575 | Unclassified | 1421 |
| 985 | Ga0501040_0015108 | 3300049576 | Bacteria | 5101 |
| 986 | Ga0501040_0470679 | 3300049576 | Unclassified | 905 |
| 987 | Ga0501041_0025616 | 3300049577 | Unclassified | 3545 |
| 988 | Ga0501041_0468819 | 3300049577 | Bacteria | 800 |
| 989 | Ga0501041_0615566 | 3300049577 | Unclassified | 693 |
| 990 | Ga0501042_0040657 | 3300049578 | Bacteria | 3305 |
| 991 | Ga0501042_0448264 | 3300049578 | Bacteria | 936 |
| 992 | Ga0501046_0123338 | 3300049580 | Unclassified | 1970 |
| 993 | Ga0501048_0092382 | 3300049582 | Unclassified | 2134 |
| 994 | Ga0501067_0047049 | 3300049583 | Bacteria | 2394 |
| 995 | Ga0501068_0195566 | 3300049584 | Bacteria | 1282 |
| 996 | Ga0501068_0973622 | 3300049584 | Unclassified | 559 |
| 997 | Ga0501069_0661712 | 3300049585 | Unclassified | 629 |
| 998 | Ga0501071_0014605 | 3300049587 | Bacteria | 5374 |
| 999 | Ga0501072_0111349 | 3300049588 | Unclassified | 2179 |
| 1000 | Ga0501073_0196467 | 3300049589 | Unclassified | 1395 |
| 1001 | Ga0501075_0415886 | 3300049591 | Bacteria | 1025 |
| 1002 | Ga0501075_0761614 | 3300049591 | Unclassified | 737 |
| 1003 | Ga0501076_0015576 | 3300049592 | Bacteria | 5751 |
| 1004 | Ga0501077_0065109 | 3300049593 | Bacteria | 2312 |
| 1005 | Ga0501216_189627 | 3300049660 | Bacteria | 504 |
| 1006 | Ga0501079_0541301 | 3300049741 | Bacteria | 916 |
| 1007 | Ga0501080_0157308 | 3300049742 | Unclassified | 2099 |
| 1008 | Ga0501081_0087638 | 3300049743 | Unclassified | 2186 |
| 1009 | Ga0501081_1365077 | 3300049743 | Unclassified | 538 |
| 1010 | Ga0501035_0489901 | 3300049822 | Bacteria | 1013 |
| 1011 | Ga0501045_0084317 | 3300049824 | Unclassified | 2344 |
| 1012 | Ga0501045_0754509 | 3300049824 | Unclassified | 717 |
| 1013 | nmdc:mga06z11_984731_c1 | 3300050494 | Unclassified | 514 |
| 1014 | nmdc:mga05p37_154896_c1 | 3300050507 | Bacteria | 2801 |
| 1015 | nmdc:mga05p37_316351_c1 | 3300050507 | Bacteria | 1849 |
| 1016 | nmdc:mga05p37_31798_c1 | 3300050507 | Bacteria | 6449 |
| 1017 | nmdc:mga05p37_424054_c1 | 3300050507 | Bacteria | 1547 |
| 1018 | nmdc:mga05p37_45770_c1 | 3300050507 | Bacteria | 5380 |
| 1019 | nmdc:mga05p37_46638_c1 | 3300050507 | Bacteria | 5328 |
| 1020 | nmdc:mga05p37_6944_c1 | 3300050507 | Bacteria | 13340 |
| 1021 | nmdc:mga05p37_80881_c1 | 3300050507 | Bacteria | 4002 |
| 1022 | nmdc:mga05p37_82470_c1 | 3300050507 | Bacteria | 3962 |
| 1023 | nmdc:mga05p37_9343_c1 | 3300050507 | Bacteria | 11600 |
| 1024 | nmdc:mga05p37_963354_c1 | 3300050507 | Unclassified | 911 |
| 1025 | nmdc:mga09592_141643_c1 | 3300050508 | Bacteria | 2073 |
| 1026 | nmdc:mga09592_1434034_c1 | 3300050508 | Unclassified | 564 |
| 1027 | nmdc:mga09592_27707_c1 | 3300050508 | Bacteria | 4703 |
| 1028 | nmdc:mga09592_41975_c1 | 3300050508 | Bacteria | 3848 |
| 1029 | nmdc:mga09592_7964_c1 | 3300050508 | Bacteria | 8610 |
| 1030 | nmdc:mga0qj67_2661_c1 | 3300050509 | Bacteria | 12798 |
| 1031 | nmdc:mga0qj67_4487_c1 | 3300050509 | Bacteria | 10111 |
| 1032 | nmdc:mga0qj67_48108_c1 | 3300050509 | Bacteria | 3369 |
| 1033 | nmdc:mga0qj67_81590_c1 | 3300050509 | Unclassified | 2593 |
| 1034 | nmdc:mga0qj67_944362_c1 | 3300050509 | Bacteria | 678 |
| 1035 | nmdc:mga06r32_30562_c1 | 3300050510 | Bacteria | 5054 |
| 1036 | nmdc:mga06r32_321167_c1 | 3300050510 | Bacteria | 1534 |
| 1037 | nmdc:mga06r32_341466_c1 | 3300050510 | Unclassified | 1482 |
| 1038 | nmdc:mga06r32_3807_c1 | 3300050510 | Bacteria | 13505 |
| 1039 | nmdc:mga06r32_769888_c1 | 3300050510 | Bacteria | 925 |
| 1040 | nmdc:mga06r32_961683_c1 | 3300050510 | Unclassified | 808 |
| 1041 | nmdc:mga08y16_186481_c1 | 3300050511 | Bacteria | 2152 |
| 1042 | nmdc:mga08y16_211392_c1 | 3300050511 | Unclassified | 2009 |
| 1043 | nmdc:mga08y16_2170387_c1 | 3300050511 | Unclassified | 502 |
| 1044 | nmdc:mga08y16_2418_c1 | 3300050511 | Bacteria | 19189 |
| 1045 | nmdc:mga08y16_317680_c1 | 3300050511 | Bacteria | 1604 |
| 1046 | nmdc:mga08y16_438934_c1 | 3300050511 | Bacteria | 1333 |
| 1047 | nmdc:mga08y16_470786_c1 | 3300050511 | Bacteria | 1279 |
| 1048 | nmdc:mga08y16_65165_c1 | 3300050511 | Bacteria | 3804 |
| 1049 | nmdc:mga08y16_66472_c1 | 3300050511 | Bacteria | 3762 |
| 1050 | nmdc:mga0n895_1010297_c1 | 3300050512 | Unclassified | 812 |
| 1051 | nmdc:mga0n895_113337_c1 | 3300050512 | Bacteria | 2729 |
| 1052 | nmdc:mga0n895_13174_c1 | 3300050512 | Bacteria | 7448 |
| 1053 | nmdc:mga0n895_1607549_c1 | 3300050512 | Unclassified | 614 |
| 1054 | nmdc:mga0n895_176532_c1 | 3300050512 | Bacteria | 2167 |
| 1055 | nmdc:mga0n895_23506_c1 | 3300050512 | Bacteria | 5794 |
| 1056 | nmdc:mga0n895_334878_c1 | 3300050512 | Unclassified | 1533 |
| 1057 | nmdc:mga0n895_37953_c1 | 3300050512 | Bacteria | 3986 |
| 1058 | nmdc:mga0n895_55203_c1 | 3300050512 | Bacteria | 3910 |
| 1059 | nmdc:mga0n895_763631_c1 | 3300050512 | Unclassified | 959 |
| 1060 | nmdc:mga0n895_846048_c1 | 3300050512 | Unclassified | 903 |
| 1061 | nmdc:mga0rr50_1011122_c1 | 3300050513 | Unclassified | 708 |
| 1062 | nmdc:mga0rr50_111659_c1 | 3300050513 | Bacteria | 2164 |
| 1063 | nmdc:mga0rr50_1466745_c1 | 3300050513 | Unclassified | 577 |
| 1064 | nmdc:mga0rr50_345131_c1 | 3300050513 | Bacteria | 1251 |
| 1065 | nmdc:mga0rr50_615268_c1 | 3300050513 | Bacteria | 926 |
| 1066 | nmdc:mga0rr50_74018_c1 | 3300050513 | Bacteria | 2606 |
| 1067 | nmdc:mga0a205_1393380_c1 | 3300050515 | Bacteria | 549 |
| 1068 | nmdc:mga0a205_1514780_c1 | 3300050515 | Unclassified | 519 |
| 1069 | nmdc:mga0a205_170121_c1 | 3300050515 | Bacteria | 2075 |
| 1070 | nmdc:mga0a205_1825_c2 | 3300050515 | Bacteria | 14714 |
| 1071 | nmdc:mga0a205_186754_c1 | 3300050515 | Bacteria | 1965 |
| 1072 | nmdc:mga0a205_3581_c1 | 3300050515 | Bacteria | 13902 |
| 1073 | nmdc:mga0a205_968536_c1 | 3300050515 | Unclassified | 698 |
| 1074 | Ga0500555_121089 | 3300053103 | Unclassified | 654 |
| 1075 | Ga0501082_0167734 | 3300060353 | Unclassified | 1908 |
| 1076 | Ga0070670_101356366 | |||
| 1077 | SwRhRL3b_contig_4260674 | |||
| 1078 | SwRhRL2b_contig_2303194 | |||
| 1079 | JGI24745J21846_1006703 | |||
| 1080 | JGI24749J21850_1045341 | |||
| 1081 | JGI24035J26624_1004317 | |||
| 1082 | JGI24033J26618_1069457 | |||
| 1083 | Ga0058859_11517576 | |||
| 1084 | Ga0065704_10232228 | |||
| 1085 | Ga0065704_10503292 | |||
| 1086 | Ga0065712_10002683 | |||
| 1087 | Ga0065712_10007329 | |||
| 1088 | Ga0065712_10453736 | |||
| 1089 | Ga0065715_10091986 | |||
| 1090 | Ga0065715_10294244 | |||
| 1091 | Ga0065715_10524328 | |||
| 1092 | Ga0065715_10816696 | |||
| 1093 | Ga0065707_10004395 | |||
| 1094 | Ga0065707_10123479 | |||
| 1095 | Ga0065707_10130896 | |||
| 1096 | Ga0065707_10279394 | |||
| 1097 | Ga0065707_10425128 | |||
| 1098 | Ga0065707_10731062 | |||
| 1099 | Ga0070658_10645531 | |||
| 1100 | Ga0070676_10026486 | |||
| 1101 | Ga0070676_10027667 | |||
| 1102 | Ga0070676_10099791 | |||
| 1103 | Ga0070676_10410948 | |||
| 1104 | Ga0070683_100002803 | |||
| 1105 | Ga0070683_100532077 | |||
| 1106 | Ga0070683_101611383 | |||
| 1107 | Ga0070690_100041309 | |||
| 1108 | Ga0070690_100110115 | |||
| 1109 | Ga0070690_100223065 | |||
| 1110 | Ga0070690_101527319 | |||
| 1111 | Ga0070670_100002610 | |||
| 1112 | Ga0070670_100067854 | |||
| 1113 | Ga0070670_100145406 | |||
| 1114 | Ga0070670_100235266 | |||
| 1115 | Ga0070670_100432930 | |||
| 1116 | Ga0070677_10070514 | |||
| 1117 | Ga0070677_10072127 | |||
| 1118 | Ga0070677_10134492 | |||
| 1119 | Ga0070677_10185158 | |||
| 1120 | Ga0070677_10219892 | |||
| 1121 | Ga0070677_10338436 | |||
| 1122 | Ga0070677_10565238 | |||
| 1123 | Ga0068869_100006778 | |||
| 1124 | Ga0068869_100016609 | |||
| 1125 | Ga0068869_100453107 | |||
| 1126 | Ga0068869_101105787 | |||
| 1127 | Ga0068869_101211367 | |||
| 1128 | Ga0068869_101317159 | |||
| 1129 | Ga0068869_101828185 | |||
| 1130 | Ga0070666_10006433 | |||
| 1131 | Ga0070666_10071955 | |||
| 1132 | Ga0070666_11231800 | |||
| 1133 | Ga0070666_11414991 | |||
| 1134 | Ga0070680_101415984 | |||
| 1135 | Ga0070680_101638080 | |||
| 1136 | Ga0068868_100031792 | |||
| 1137 | Ga0068868_100035225 | |||
| 1138 | Ga0068868_100614228 | |||
| 1139 | Ga0068868_100794060 | |||
| 1140 | Ga0068868_101996542 | |||
| 1141 | Ga0070660_100622529 | |||
| 1142 | Ga0070689_100016365 | |||
| 1143 | Ga0070689_100021825 | |||
| 1144 | Ga0070689_100130205 | |||
| 1145 | Ga0070689_100143638 | |||
| 1146 | Ga0070689_100278871 | |||
| 1147 | Ga0070689_101348524 | |||
| 1148 | Ga0070687_100049891 | |||
| 1149 | Ga0070687_100060473 | |||
| 1150 | Ga0070687_100073614 | |||
| 1151 | Ga0070687_101411548 | |||
| 1152 | Ga0070661_100019728 | |||
| 1153 | Ga0070661_100096285 | |||
| 1154 | Ga0070661_100539573 | |||
| 1155 | Ga0070661_100820975 | |||
| 1156 | Ga0070692_10124233 | |||
| 1157 | Ga0070692_10321190 | |||
| 1158 | Ga0070692_10347027 | |||
| 1159 | Ga0070668_100058877 | |||
| 1160 | Ga0070668_100069279 | |||
| 1161 | Ga0070668_100120255 | |||
| 1162 | Ga0070668_100448333 | |||
| 1163 | Ga0070668_101836662 | |||
| 1164 | Ga0070669_100001020 | |||
| 1165 | Ga0070669_100014861 | |||
| 1166 | Ga0070669_100032145 | |||
| 1167 | Ga0070669_100076506 | |||
| 1168 | Ga0070669_100126936 | |||
| 1169 | Ga0070669_100135039 | |||
| 1170 | Ga0070669_100249279 | |||
| 1171 | Ga0070669_101169083 | |||
| 1172 | Ga0070669_101548753 | |||
| 1173 | Ga0070669_101551225 | |||
| 1174 | Ga0070675_100000033 | |||
| 1175 | Ga0070675_100002075 | |||
| 1176 | Ga0070675_100009814 | |||
| 1177 | Ga0070675_100017656 | |||
| 1178 | Ga0070675_100024575 | |||
| 1179 | Ga0070675_100050630 | |||
| 1180 | Ga0070675_100055048 | |||
| 1181 | Ga0070675_100147359 | |||
| 1182 | Ga0070675_100171437 | |||
| 1183 | Ga0070675_100329580 | |||
| 1184 | Ga0070675_100331383 | |||
| 1185 | Ga0070675_100465320 | |||
| 1186 | Ga0070675_100542918 | |||
| 1187 | Ga0070675_100741178 | |||
| 1188 | Ga0070675_101870439 | |||
| 1189 | Ga0070671_100014984 | |||
| 1190 | Ga0070671_100027299 | |||
| 1191 | Ga0070671_100045499 | |||
| 1192 | Ga0070671_100940752 | |||
| 1193 | Ga0070674_100000184 | |||
| 1194 | Ga0070674_100015356 | |||
| 1195 | Ga0070674_100126255 | |||
| 1196 | Ga0070674_100286588 | |||
| 1197 | Ga0070674_100345011 | |||
| 1198 | Ga0070674_100589651 | |||
| 1199 | Ga0070673_100007303 | |||
| 1200 | Ga0070673_100027094 | |||
| 1201 | Ga0070673_100109560 | |||
| 1202 | Ga0070673_100114781 | |||
| 1203 | Ga0070673_100139394 | |||
| 1204 | Ga0070673_100142185 | |||
| 1205 | Ga0070673_100567349 | |||
| 1206 | Ga0070673_100654649 | |||
| 1207 | Ga0070673_100908925 | |||
| 1208 | Ga0070673_101226075 | |||
| 1209 | Ga0070673_101668593 | |||
| 1210 | Ga0070688_100004930 | |||
| 1211 | Ga0070688_100055491 | |||
| 1212 | Ga0070688_100150967 | |||
| 1213 | Ga0070688_100222147 | |||
| 1214 | Ga0070688_101060952 | |||
| 1215 | Ga0070659_100110728 | |||
| 1216 | Ga0070659_100170995 | |||
| 1217 | Ga0070659_101459563 | |||
| 1218 | Ga0070667_100034500 | |||
| 1219 | Ga0070667_100592740 | |||
| 1220 | Ga0070667_100796710 | |||
| 1221 | Ga0070667_100856947 | |||
| 1222 | Ga0070667_100896067 | |||
| 1223 | Ga0070667_101262473 | |||
| 1224 | Ga0070667_102029584 | |||
| 1225 | Ga0070703_10014649 | |||
| 1226 | Ga0070703_10066528 | |||
| 1227 | Ga0070703_10081745 | |||
| 1228 | Ga0070701_10012396 | |||
| 1229 | Ga0070701_10329742 | |||
| 1230 | Ga0070701_10422344 | |||
| 1231 | Ga0070701_10649926 | |||
| 1232 | Ga0070705_100001709 | |||
| 1233 | Ga0070705_100192667 | |||
| 1234 | Ga0070705_100239925 | |||
| 1235 | Ga0070705_100391841 | |||
| 1236 | Ga0070705_100471178 | |||
| 1237 | Ga0070705_100665454 | |||
| 1238 | Ga0070705_100798232 | |||
| 1239 | Ga0070705_100963910 | |||
| 1240 | Ga0070700_100014659 | |||
| 1241 | Ga0070700_100068591 | |||
| 1242 | Ga0070700_100110973 | |||
| 1243 | Ga0070700_100301545 | |||
| 1244 | Ga0070700_100669286 | |||
| 1245 | Ga0070700_101669801 | |||
| 1246 | Ga0070694_100267311 | |||
| 1247 | Ga0070694_100279106 | |||
| 1248 | Ga0070694_100288427 | |||
| 1249 | Ga0070694_100371181 | |||
| 1250 | Ga0070694_100447963 | |||
| 1251 | Ga0070694_100765992 | |||
| 1252 | Ga0070694_101065918 | |||
| 1253 | Ga0070694_101289739 | |||
| 1254 | Ga0070694_101498939 | |||
| 1255 | Ga0070708_100121916 | |||
| 1256 | Ga0070708_101344902 | |||
| 1257 | Ga0070678_100056358 | |||
| 1258 | Ga0070678_100301496 | |||
| 1259 | Ga0070678_100490899 | |||
| 1260 | Ga0070662_100004740 | |||
| 1261 | Ga0070662_100182556 | |||
| 1262 | Ga0070662_100238738 | |||
| 1263 | Ga0070662_100669426 | |||
| 1264 | Ga0070662_100874593 | |||
| 1265 | Ga0070662_101380581 | |||
| 1266 | Ga0070681_10067907 | |||
| 1267 | Ga0070681_11243663 | |||
| 1268 | Ga0070681_11354336 | |||
| 1269 | Ga0068867_100008404 | |||
| 1270 | Ga0068867_100012506 | |||
| 1271 | Ga0068867_100028197 | |||
| 1272 | Ga0068867_100096872 | |||
| 1273 | Ga0068867_100535522 | |||
| 1274 | Ga0068867_101441696 | |||
| 1275 | Ga0068867_102217931 | |||
| 1276 | Ga0070685_10007510 | |||
| 1277 | Ga0070685_10278822 | |||
| 1278 | Ga0070685_10346887 | |||
| 1279 | Ga0070685_10712521 | |||
| 1280 | Ga0070685_10964521 | |||
| 1281 | Ga0070685_11206830 | |||
| 1282 | Ga0070685_11380998 | |||
| 1283 | Ga0070706_100351426 | |||
| 1284 | Ga0070706_100533063 | |||
| 1285 | Ga0070707_100062698 | |||
| 1286 | Ga0070707_100080412 | |||
| 1287 | Ga0070707_100097528 | |||
| 1288 | Ga0070698_100037618 | |||
| 1289 | Ga0070698_100304644 | |||
| 1290 | Ga0070698_101702111 | |||
| 1291 | Ga0070699_100020817 | |||
| 1292 | Ga0070699_100033499 | |||
| 1293 | Ga0070699_100215043 | |||
| 1294 | Ga0070699_100411696 | |||
| 1295 | Ga0070699_101756487 | |||
| 1296 | Ga0070679_100415881 | |||
| 1297 | Ga0070679_100493789 | |||
| 1298 | Ga0070679_101239747 | |||
| 1299 | Ga0070684_100003808 | |||
| 1300 | Ga0070684_102313211 | |||
| 1301 | Ga0070697_100037352 | |||
| 1302 | Ga0070697_100192357 | |||
| 1303 | Ga0070697_100315975 | |||
| 1304 | Ga0068853_100962420 | |||
| 1305 | Ga0070672_100014219 | |||
| 1306 | Ga0070672_100028789 | |||
| 1307 | Ga0070672_100033294 | |||
| 1308 | Ga0070672_100043970 | |||
| 1309 | Ga0070672_100160688 | |||
| 1310 | Ga0070672_100218642 | |||
| 1311 | Ga0070672_100304570 | |||
| 1312 | Ga0070672_100363966 | |||
| 1313 | Ga0070672_101033709 | |||
| 1314 | Ga0070672_102109601 | |||
| 1315 | Ga0070686_100006803 | |||
| 1316 | Ga0070686_100042188 | |||
| 1317 | Ga0070686_100224486 | |||
| 1318 | Ga0070686_100457393 | |||
| 1319 | Ga0070686_100813783 | |||
| 1320 | Ga0070686_100922188 | |||
| 1321 | Ga0070686_101039601 | |||
| 1322 | Ga0070686_101048637 | |||
| 1323 | Ga0070695_100006594 | |||
| 1324 | Ga0070695_100257074 | |||
| 1325 | Ga0070695_100550063 | |||
| 1326 | Ga0070695_100550693 | |||
| 1327 | Ga0070695_101097374 | |||
| 1328 | Ga0070695_101098946 | |||
| 1329 | Ga0070695_101285312 | |||
| 1330 | Ga0070696_100003487 | |||
| 1331 | Ga0070696_100006665 | |||
| 1332 | Ga0070696_100272203 | |||
| 1333 | Ga0070696_100485322 | |||
| 1334 | Ga0070696_100489319 | |||
| 1335 | Ga0070696_100712432 | |||
| 1336 | Ga0070696_100730212 | |||
| 1337 | Ga0070696_100872536 | |||
| 1338 | Ga0070696_101692395 | |||
| 1339 | Ga0070693_100012874 | |||
| 1340 | Ga0070665_100001707 | |||
| 1341 | Ga0070665_100178177 | |||
| 1342 | Ga0070665_100254981 | |||
| 1343 | Ga0070704_100000343 | |||
| 1344 | Ga0070704_100111611 | |||
| 1345 | Ga0070704_100120098 | |||
| 1346 | Ga0070704_100239621 | |||
| 1347 | Ga0070704_100247088 | |||
| 1348 | Ga0070704_100352974 | |||
| 1349 | Ga0070704_100402920 | |||
| 1350 | Ga0070704_100476006 | |||
| 1351 | Ga0070704_100523110 | |||
| 1352 | Ga0070704_100532649 | |||
| 1353 | Ga0070704_100594585 | |||
| 1354 | Ga0070704_101178029 | |||
| 1355 | Ga0070704_101780447 | |||
| 1356 | Ga0068855_100560438 | |||
| 1357 | Ga0070664_100001327 | |||
| 1358 | Ga0070664_100079188 | |||
| 1359 | Ga0070664_100299092 | |||
| 1360 | Ga0070664_100841919 | |||
| 1361 | Ga0070664_100848654 | |||
| 1362 | Ga0070664_101152881 | |||
| 1363 | Ga0070664_101237113 | |||
| 1364 | Ga0070664_101528581 | |||
| 1365 | Ga0070664_102110802 | |||
| 1366 | Ga0068857_100118789 | |||
| 1367 | Ga0068857_101585569 | |||
| 1368 | Ga0068854_100254274 | |||
| 1369 | Ga0068854_100294909 | |||
| 1370 | Ga0068854_100901357 | |||
| 1371 | Ga0068854_101346857 | |||
| 1372 | Ga0068856_100342148 | |||
| 1373 | Ga0070702_100071552 | |||
| 1374 | Ga0070702_100109339 | |||
| 1375 | Ga0070702_100254710 | |||
| 1376 | Ga0068852_100148816 | |||
| 1377 | Ga0068852_101262355 | |||
| 1378 | Ga0068859_100004737 | |||
| 1379 | Ga0068859_100008005 | |||
| 1380 | Ga0068859_100029471 | |||
| 1381 | Ga0068859_100195030 | |||
| 1382 | Ga0068859_100242799 | |||
| 1383 | Ga0068859_101537581 | |||
| 1384 | Ga0068859_101871300 | |||
| 1385 | Ga0068859_102575170 | |||
| 1386 | Ga0068859_102728551 | |||
| 1387 | Ga0068864_100048934 | |||
| 1388 | Ga0068864_100056442 | |||
| 1389 | Ga0068864_100100497 | |||
| 1390 | Ga0068864_100328606 | |||
| 1391 | Ga0068864_100642660 | |||
| 1392 | Ga0068864_100659115 | |||
| 1393 | Ga0068866_10019977 | |||
| 1394 | Ga0068866_10154078 | |||
| 1395 | Ga0068866_11009163 | |||
| 1396 | Ga0068861_100071501 | |||
| 1397 | Ga0068861_100166789 | |||
| 1398 | Ga0068861_100226074 | |||
| 1399 | Ga0068861_100392759 | |||
| 1400 | Ga0068861_100457709 | |||
| 1401 | Ga0068861_100666669 | |||
| 1402 | Ga0068861_100673018 | |||
| 1403 | Ga0068861_102211342 | |||
| 1404 | Ga0068851_10058013 | |||
| 1405 | Ga0068851_10194288 | |||
| 1406 | Ga0068851_10779575 | |||
| 1407 | Ga0068851_10859690 | |||
| 1408 | Ga0068870_10009944 | |||
| 1409 | Ga0068870_10011318 | |||
| 1410 | Ga0068870_10020009 | |||
| 1411 | Ga0068870_10061184 | |||
| 1412 | Ga0068870_10165793 | |||
| 1413 | Ga0068870_10321045 | |||
| 1414 | Ga0068870_10456880 | |||
| 1415 | Ga0068870_10575754 | |||
| 1416 | Ga0068870_11184189 | |||
| 1417 | Ga0068863_100023408 | |||
| 1418 | Ga0068863_100027198 | |||
| 1419 | Ga0068863_100736499 | |||
| 1420 | Ga0068863_100938243 | |||
| 1421 | Ga0068863_101096089 | |||
| 1422 | Ga0068863_101126947 | |||
| 1423 | Ga0068863_102645197 | |||
| 1424 | Ga0068858_100021214 | |||
| 1425 | Ga0068858_100038893 | |||
| 1426 | Ga0068858_100042104 | |||
| 1427 | Ga0068858_100061755 | |||
| 1428 | Ga0068858_100074228 | |||
| 1429 | Ga0068858_100360781 | |||
| 1430 | Ga0068858_100627920 | |||
| 1431 | Ga0068858_101211263 | |||
| 1432 | Ga0068860_100069371 | |||
| 1433 | Ga0068860_100071856 | |||
| 1434 | Ga0068860_100262337 | |||
| 1435 | Ga0068860_100326915 | |||
| 1436 | Ga0068860_100363828 | |||
| 1437 | Ga0068860_100640107 | |||
| 1438 | Ga0068860_100680183 | |||
| 1439 | Ga0068860_102089522 | |||
| 1440 | Ga0068862_100002588 | |||
| 1441 | Ga0068862_100002657 | |||
| 1442 | Ga0068862_100010700 | |||
| 1443 | Ga0068862_100099714 | |||
| 1444 | Ga0068862_100206861 | |||
| 1445 | Ga0068862_100380938 | |||
| 1446 | Ga0068862_100415816 | |||
| 1447 | Ga0068862_101013437 | |||
| 1448 | Ga0068862_101099749 | |||
| 1449 | Ga0068862_101463828 | |||
| 1450 | Ga0070717_10036827 | |||
| 1451 | Ga0075432_10018649 | |||
| 1452 | Ga0075432_10022440 | |||
| 1453 | Ga0075432_10042709 | |||
| 1454 | Ga0075432_10196518 | |||
| 1455 | Ga0070712_100070265 | |||
| 1456 | Ga0097621_100196812 | |||
| 1457 | Ga0097621_100249713 | |||
| 1458 | Ga0097621_100660923 | |||
| 1459 | Ga0075370_10492590 | |||
| 1460 | Ga0068871_100032412 | |||
| 1461 | Ga0068871_100088291 | |||
| 1462 | Ga0068871_100311933 | |||
| 1463 | Ga0068871_100804422 | |||
| 1464 | Ga0068871_101894518 | |||
| 1465 | Ga0075428_100000377 | |||
| 1466 | Ga0075428_100002001 | |||
| 1467 | Ga0075428_100009521 | |||
| 1468 | Ga0075428_100020830 | |||
| 1469 | Ga0075428_100033834 | |||
| 1470 | Ga0075428_100132740 | |||
| 1471 | Ga0075428_100306215 | |||
| 1472 | Ga0075428_100648611 | |||
| 1473 | Ga0075428_101294535 | |||
| 1474 | Ga0075428_101297249 | |||
| 1475 | Ga0075428_102195098 | |||
| 1476 | Ga0075430_100003207 | |||
| 1477 | Ga0075430_100038491 | |||
| 1478 | Ga0075430_100097632 | |||
| 1479 | Ga0075431_100000943 | |||
| 1480 | Ga0075431_100052605 | |||
| 1481 | Ga0075431_100066018 | |||
| 1482 | Ga0075431_100073720 | |||
| 1483 | Ga0075431_100097501 | |||
| 1484 | Ga0075433_10001576 | |||
| 1485 | Ga0075433_10122925 | |||
| 1486 | Ga0075433_10137231 | |||
| 1487 | Ga0075433_10335777 | |||
| 1488 | Ga0075433_10635860 | |||
| 1489 | Ga0075433_10794390 | |||
| 1490 | Ga0075433_11500019 | |||
| 1491 | Ga0075434_100008841 | |||
| 1492 | Ga0075434_100049640 | |||
| 1493 | Ga0075434_100114950 | |||
| 1494 | Ga0075434_100449529 | |||
| 1495 | Ga0075434_100848057 | |||
| 1496 | Ga0075434_101048974 | |||
| 1497 | Ga0075434_102086689 | |||
| 1498 | Ga0075429_100004661 | |||
| 1499 | Ga0075429_100014110 | |||
| 1500 | Ga0075429_100082650 | |||
| 1501 | Ga0075429_100127727 | |||
| 1502 | Ga0068865_100000314 | |||
| 1503 | Ga0068865_100012120 | |||
| 1504 | Ga0068865_100180548 | |||
| 1505 | Ga0068865_100399117 | |||
| 1506 | Ga0068865_100730737 | |||
| 1507 | Ga0068865_101652302 | |||
| 1508 | Ga0075436_100133015 | |||
| 1509 | Ga0097620_100004737 | |||
| 1510 | Ga0097620_100008005 | |||
| 1511 | Ga0097620_100029472 | |||
| 1512 | Ga0097620_100195026 | |||
| 1513 | Ga0097620_100242785 | |||
| 1514 | Ga0097620_101537587 | |||
| 1515 | Ga0097620_101871603 | |||
| 1516 | Ga0097620_102574695 | |||
| 1517 | Ga0097620_102727647 | |||
| 1518 | Ga0075435_100003605 | |||
| 1519 | Ga0075435_100041793 | |||
| 1520 | Ga0075435_100057999 | |||
| 1521 | Ga0075435_100230262 | |||
| 1522 | Ga0075435_100261351 | |||
| 1523 | Ga0075435_101071859 | |||
| 1524 | Ga0099794_10192820 | |||
| 1525 | Ga0105251_10113876 | |||
| 1526 | Ga0105250_10312269 | |||
| 1527 | Ga0105250_10381175 | |||
| 1528 | Ga0105240_10301966 | |||
| 1529 | Ga0111539_10003861 | |||
| 1530 | Ga0111539_10007889 | |||
| 1531 | Ga0111539_10009953 | |||
| 1532 | Ga0111539_10041369 | |||
| 1533 | Ga0111539_10070401 | |||
| 1534 | Ga0111539_10120027 | |||
| 1535 | Ga0111539_10150487 | |||
| 1536 | Ga0111539_10297580 | |||
| 1537 | Ga0111539_10606797 | |||
| 1538 | Ga0111539_10675451 | |||
| 1539 | Ga0111539_10772541 | |||
| 1540 | Ga0111539_10815489 | |||
| 1541 | Ga0111539_11371304 | |||
| 1542 | Ga0105245_10053254 | |||
| 1543 | Ga0105245_10207295 | |||
| 1544 | Ga0105245_11063816 | |||
| 1545 | Ga0105245_11067771 | |||
| 1546 | Ga0105245_11383675 | |||
| 1547 | Ga0105247_10012480 | |||
| 1548 | Ga0105247_10172239 | |||
| 1549 | Ga0105247_10201992 | |||
| 1550 | Ga0114129_10000090 | |||
| 1551 | Ga0114129_10000961 | |||
| 1552 | Ga0114129_10003363 | |||
| 1553 | Ga0114129_10003850 | |||
| 1554 | Ga0114129_10045668 | |||
| 1555 | Ga0114129_10068730 | |||
| 1556 | Ga0114129_10161503 | |||
| 1557 | Ga0114129_10186504 | |||
| 1558 | Ga0114129_10196129 | |||
| 1559 | Ga0114129_10629430 | |||
| 1560 | Ga0114129_10857819 | |||
| 1561 | Ga0114129_11344972 | |||
| 1562 | Ga0105243_10047234 | |||
| 1563 | Ga0105243_10065887 | |||
| 1564 | Ga0105243_10203651 | |||
| 1565 | Ga0105243_10224491 | |||
| 1566 | Ga0105243_10318624 | |||
| 1567 | Ga0105243_10467714 | |||
| 1568 | Ga0105243_10547711 | |||
| 1569 | Ga0105243_11140309 | |||
| 1570 | Ga0105243_11149424 | |||
| 1571 | Ga0105241_12105352 | |||
| 1572 | Ga0105242_10024625 | |||
| 1573 | Ga0105242_10041293 | |||
| 1574 | Ga0105242_10097517 | |||
| 1575 | Ga0105248_10009073 | |||
| 1576 | Ga0105248_10440767 | |||
| 1577 | Ga0105248_10587765 | |||
| 1578 | Ga0105248_10896976 | |||
| 1579 | Ga0105248_12124062 | |||
| 1580 | Ga0105248_12509649 | |||
| 1581 | Ga0105248_12920207 | |||
| 1582 | Ga0105237_10199839 | |||
| 1583 | Ga0105237_12308417 | |||
| 1584 | Ga0105238_10052352 | |||
| 1585 | Ga0105238_11326259 | |||
| 1586 | Ga0105249_10002499 | |||
| 1587 | Ga0105249_10061572 | |||
| 1588 | Ga0105249_10061612 | |||
| 1589 | Ga0105249_10982670 | |||
| 1590 | Ga0105249_11004824 | |||
| 1591 | Ga0105249_11142213 | |||
| 1592 | Ga0105249_11551495 | |||
| 1593 | Ga0105249_11836706 | |||
| 1594 | Ga0105249_11991919 | |||
| 1595 | Ga0105249_12991184 | |||
| 1596 | Ga0105239_11203617 | |||
| 1597 | Ga0105246_10010255 | |||
| 1598 | Ga0105246_10383606 | |||
| 1599 | Ga0105246_10474260 | |||
| 1600 | Ga0105246_11617527 | |||
| 1601 | Ga0157339_1019946 | |||
| 1602 | Ga0157316_1006121 | |||
| 1603 | Ga0157371_10268218 | |||
| 1604 | Ga0157374_10034263 | |||
| 1605 | Ga0157374_10154302 | |||
| 1606 | Ga0157374_10660104 | |||
| 1607 | Ga0157374_11230454 | |||
| 1608 | Ga0157374_12773698 | |||
| 1609 | Ga0157378_10382608 | |||
| 1610 | Ga0157378_10432808 | |||
| 1611 | Ga0157378_11115715 | |||
| 1612 | Ga0163162_10023495 | |||
| 1613 | Ga0163162_10305796 | |||
| 1614 | Ga0163162_10337290 | |||
| 1615 | Ga0163162_10902576 | |||
| 1616 | Ga0163162_12052709 | |||
| 1617 | Ga0157372_12971316 | |||
| 1618 | Ga0157375_10035668 | |||
| 1619 | Ga0157375_10579778 | |||
| 1620 | Ga0157375_10715247 | |||
| 1621 | Ga0157375_11025845 | |||
| 1622 | Ga0157375_12119837 | |||
| 1623 | Ga0157375_12791686 | |||
| 1624 | Ga0157375_13648500 | |||
| 1625 | Ga0163163_10002016 | |||
| 1626 | Ga0163163_10077716 | |||
| 1627 | Ga0163163_10167906 | |||
| 1628 | Ga0163163_10220250 | |||
| 1629 | Ga0163163_10471771 | |||
| 1630 | Ga0163163_10495844 | |||
| 1631 | Ga0163163_10500081 | |||
| 1632 | Ga0163163_10969843 | |||
| 1633 | Ga0163163_11176836 | |||
| 1634 | Ga0163163_12447103 | |||
| 1635 | Ga0157380_10035309 | |||
| 1636 | Ga0157380_10081419 | |||
| 1637 | Ga0157380_10202531 | |||
| 1638 | Ga0157380_10281129 | |||
| 1639 | Ga0157380_10340602 | |||
| 1640 | Ga0157380_10709635 | |||
| 1641 | Ga0157380_10803286 | |||
| 1642 | Ga0157380_10843851 | |||
| 1643 | Ga0157380_10924763 | |||
| 1644 | Ga0157380_11299914 | |||
| 1645 | Ga0157380_11414201 | |||
| 1646 | Ga0157380_12711086 | |||
| 1647 | Ga0157377_10007500 | |||
| 1648 | Ga0157377_10019853 | |||
| 1649 | Ga0157377_10060632 | |||
| 1650 | Ga0157377_10080786 | |||
| 1651 | Ga0157377_10686191 | |||
| 1652 | Ga0157377_11122191 | |||
| 1653 | Ga0157379_10011139 | |||
| 1654 | Ga0157379_10361242 | |||
| 1655 | Ga0157379_10857228 | |||
| 1656 | Ga0157379_11026268 | |||
| 1657 | Ga0157376_10079266 | |||
| 1658 | Ga0157376_10090388 | |||
| 1659 | Ga0157376_10560107 | |||
| 1660 | Ga0157376_11704053 | |||
| 1661 | Ga0163161_10054290 | |||
| 1662 | Ga0163161_10423845 | |||
| 1663 | Ga0163161_10808943 | |||
| 1664 | Ga0163161_10886326 | |||
| 1665 | Ga0207666_1073018 | |||
| 1666 | Ga0207673_1002600 | |||
| 1667 | Ga0207697_10005501 | |||
| 1668 | Ga0207697_10097542 | |||
| 1669 | Ga0207697_10104081 | |||
| 1670 | Ga0207697_10368866 | |||
| 1671 | Ga0207656_10007252 | |||
| 1672 | Ga0207656_10258355 | |||
| 1673 | Ga0207656_10494942 | |||
| 1674 | Ga0207653_10046610 | |||
| 1675 | Ga0207653_10076824 | |||
| 1676 | Ga0207653_10136900 | |||
| 1677 | Ga0207653_10281698 | |||
| 1678 | Ga0207682_10001224 | |||
| 1679 | Ga0207682_10035154 | |||
| 1680 | Ga0207682_10063942 | |||
| 1681 | Ga0207682_10109851 | |||
| 1682 | Ga0207682_10165642 | |||
| 1683 | Ga0207682_10270733 | |||
| 1684 | Ga0207642_10407204 | |||
| 1685 | Ga0207642_11068670 | |||
| 1686 | Ga0207710_10021883 | |||
| 1687 | Ga0207710_10768844 | |||
| 1688 | Ga0207688_10009371 | |||
| 1689 | Ga0207688_10254198 | |||
| 1690 | Ga0207688_10261755 | |||
| 1691 | Ga0207688_10315656 | |||
| 1692 | Ga0207688_10713712 | |||
| 1693 | Ga0207680_10036782 | |||
| 1694 | Ga0207680_10226464 | |||
| 1695 | Ga0207680_10240601 | |||
| 1696 | Ga0207647_10469422 | |||
| 1697 | Ga0207645_10002078 | |||
| 1698 | Ga0207645_10009110 | |||
| 1699 | Ga0207645_10143363 | |||
| 1700 | Ga0207645_10215518 | |||
| 1701 | Ga0207645_10277005 | |||
| 1702 | Ga0207645_10313563 | |||
| 1703 | Ga0207645_10597391 | |||
| 1704 | Ga0207643_10000832 | |||
| 1705 | Ga0207643_10015722 | |||
| 1706 | Ga0207643_10026631 | |||
| 1707 | Ga0207643_10100971 | |||
| 1708 | Ga0207643_10452927 | |||
| 1709 | Ga0207643_10529557 | |||
| 1710 | Ga0207643_10571905 | |||
| 1711 | Ga0207643_10577646 | |||
| 1712 | Ga0207684_10439570 | |||
| 1713 | Ga0207654_10466269 | |||
| 1714 | Ga0207707_10122110 | |||
| 1715 | Ga0207660_10707203 | |||
| 1716 | Ga0207662_10003136 | |||
| 1717 | Ga0207662_10026040 | |||
| 1718 | Ga0207662_10040344 | |||
| 1719 | Ga0207662_10482942 | |||
| 1720 | Ga0207662_10867409 | |||
| 1721 | Ga0207657_10659863 | |||
| 1722 | Ga0207649_10029447 | |||
| 1723 | Ga0207649_10210507 | |||
| 1724 | Ga0207649_10509554 | |||
| 1725 | Ga0207646_10064574 | |||
| 1726 | Ga0207646_10595071 | |||
| 1727 | Ga0207646_10799295 | |||
| 1728 | Ga0207681_10012433 | |||
| 1729 | Ga0207681_10012857 | |||
| 1730 | Ga0207681_10060309 | |||
| 1731 | Ga0207681_10139883 | |||
| 1732 | Ga0207681_10149521 | |||
| 1733 | Ga0207681_10177750 | |||
| 1734 | Ga0207681_10946909 | |||
| 1735 | Ga0207681_11072158 | |||
| 1736 | Ga0207681_11141776 | |||
| 1737 | Ga0207694_10003836 | |||
| 1738 | Ga0207650_10006164 | |||
| 1739 | Ga0207650_10061509 | |||
| 1740 | Ga0207650_10077835 | |||
| 1741 | Ga0207650_10676109 | |||
| 1742 | Ga0207650_10908238 | |||
| 1743 | Ga0207659_10002642 | |||
| 1744 | Ga0207659_10009199 | |||
| 1745 | Ga0207659_10021667 | |||
| 1746 | Ga0207659_10025297 | |||
| 1747 | Ga0207659_10032932 | |||
| 1748 | Ga0207659_10106017 | |||
| 1749 | Ga0207659_10197810 | |||
| 1750 | Ga0207659_10219883 | |||
| 1751 | Ga0207659_10220441 | |||
| 1752 | Ga0207659_10260618 | |||
| 1753 | Ga0207659_10514744 | |||
| 1754 | Ga0207659_10587441 | |||
| 1755 | Ga0207659_10623932 | |||
| 1756 | Ga0207687_10039014 | |||
| 1757 | Ga0207687_10517243 | |||
| 1758 | Ga0207687_10623804 | |||
| 1759 | Ga0207700_10003456 | |||
| 1760 | Ga0207644_10013059 | |||
| 1761 | Ga0207644_10018847 | |||
| 1762 | Ga0207644_10055749 | |||
| 1763 | Ga0207690_10797450 | |||
| 1764 | Ga0207690_11071639 | |||
| 1765 | Ga0207690_11119248 | |||
| 1766 | Ga0207690_11700703 | |||
| 1767 | Ga0207706_10029018 | |||
| 1768 | Ga0207706_10127780 | |||
| 1769 | Ga0207706_10149111 | |||
| 1770 | Ga0207706_10235777 | |||
| 1771 | Ga0207706_10321647 | |||
| 1772 | Ga0207686_10011465 | |||
| 1773 | Ga0207686_10046529 | |||
| 1774 | Ga0207686_10152844 | |||
| 1775 | Ga0207709_10039347 | |||
| 1776 | Ga0207709_10116053 | |||
| 1777 | Ga0207709_10164768 | |||
| 1778 | Ga0207709_10346675 | |||
| 1779 | Ga0207709_10348594 | |||
| 1780 | Ga0207709_10778738 | |||
| 1781 | Ga0207709_11457513 | |||
| 1782 | Ga0207670_10023111 | |||
| 1783 | Ga0207670_10039201 | |||
| 1784 | Ga0207670_10326378 | |||
| 1785 | Ga0207670_10673746 | |||
| 1786 | Ga0207670_11935473 | |||
| 1787 | Ga0207669_10000046 | |||
| 1788 | Ga0207669_10041347 | |||
| 1789 | Ga0207669_10046745 | |||
| 1790 | Ga0207669_11235858 | |||
| 1791 | Ga0207669_11575813 | |||
| 1792 | Ga0207704_10001922 | |||
| 1793 | Ga0207704_10223773 | |||
| 1794 | Ga0207704_10244874 | |||
| 1795 | Ga0207704_10480800 | |||
| 1796 | Ga0207691_10021362 | |||
| 1797 | Ga0207691_10026097 | |||
| 1798 | Ga0207691_10038423 | |||
| 1799 | Ga0207691_10065552 | |||
| 1800 | Ga0207691_10108300 | |||
| 1801 | Ga0207691_10142131 | |||
| 1802 | Ga0207691_10151703 | |||
| 1803 | Ga0207691_10201413 | |||
| 1804 | Ga0207691_10237015 | |||
| 1805 | Ga0207691_10383129 | |||
| 1806 | Ga0207711_10007787 | |||
| 1807 | Ga0207711_10192278 | |||
| 1808 | Ga0207711_10200902 | |||
| 1809 | Ga0207711_10302693 | |||
| 1810 | Ga0207711_10375609 | |||
| 1811 | Ga0207689_10002481 | |||
| 1812 | Ga0207689_10009132 | |||
| 1813 | Ga0207689_10040878 | |||
| 1814 | Ga0207689_10397250 | |||
| 1815 | Ga0207689_10614555 | |||
| 1816 | Ga0207689_10830430 | |||
| 1817 | Ga0207661_10091394 | |||
| 1818 | Ga0207661_10325954 | |||
| 1819 | Ga0207679_10001898 | |||
| 1820 | Ga0207679_10106687 | |||
| 1821 | Ga0207679_10127605 | |||
| 1822 | Ga0207679_10132030 | |||
| 1823 | Ga0207679_10174152 | |||
| 1824 | Ga0207679_10225488 | |||
| 1825 | Ga0207679_10440137 | |||
| 1826 | Ga0207679_10554977 | |||
| 1827 | Ga0207679_10586570 | |||
| 1828 | Ga0207651_10002368 | |||
| 1829 | Ga0207651_10087453 | |||
| 1830 | Ga0207651_10087876 | |||
| 1831 | Ga0207651_10283029 | |||
| 1832 | Ga0207651_10305470 | |||
| 1833 | Ga0207651_10489724 | |||
| 1834 | Ga0207651_10561304 | |||
| 1835 | Ga0207651_10606181 | |||
| 1836 | Ga0207651_10788057 | |||
| 1837 | Ga0207651_11547566 | |||
| 1838 | Ga0207712_10084558 | |||
| 1839 | Ga0207712_10113506 | |||
| 1840 | Ga0207712_10389670 | |||
| 1841 | Ga0207712_10622644 | |||
| 1842 | Ga0207712_11305750 | |||
| 1843 | Ga0207712_11330329 | |||
| 1844 | Ga0207712_11985506 | |||
| 1845 | Ga0207712_12048898 | |||
| 1846 | Ga0207668_10041120 | |||
| 1847 | Ga0207668_10140863 | |||
| 1848 | Ga0207668_11015618 | |||
| 1849 | Ga0207640_10089575 | |||
| 1850 | Ga0207640_10504343 | |||
| 1851 | Ga0207640_10972266 | |||
| 1852 | Ga0207640_11328704 | |||
| 1853 | Ga0207658_10150843 | |||
| 1854 | Ga0207658_10356135 | |||
| 1855 | Ga0207658_10382021 | |||
| 1856 | Ga0207658_11097971 | |||
| 1857 | Ga0207677_10131622 | |||
| 1858 | Ga0207677_10223879 | |||
| 1859 | Ga0207677_10636755 | |||
| 1860 | Ga0207677_10739419 | |||
| 1861 | Ga0207677_11190820 | |||
| 1862 | Ga0207677_11315868 | |||
| 1863 | Ga0207703_10004570 | |||
| 1864 | Ga0207703_10024306 | |||
| 1865 | Ga0207703_10072739 | |||
| 1866 | Ga0207703_10076145 | |||
| 1867 | Ga0207703_10113204 | |||
| 1868 | Ga0207703_10203157 | |||
| 1869 | Ga0207703_10428772 | |||
| 1870 | Ga0207703_10931227 | |||
| 1871 | Ga0207703_11203226 | |||
| 1872 | Ga0207639_10110541 | |||
| 1873 | Ga0207639_12157191 | |||
| 1874 | Ga0207678_10529561 | |||
| 1875 | Ga0207678_11173879 | |||
| 1876 | Ga0207708_10018541 | |||
| 1877 | Ga0207708_10056988 | |||
| 1878 | Ga0207708_10060815 | |||
| 1879 | Ga0207708_10083623 | |||
| 1880 | Ga0207708_10100083 | |||
| 1881 | Ga0207708_10277555 | |||
| 1882 | Ga0207708_10639315 | |||
| 1883 | Ga0207708_10958416 | |||
| 1884 | Ga0207702_10552079 | |||
| 1885 | Ga0207641_10021850 | |||
| 1886 | Ga0207641_10200323 | |||
| 1887 | Ga0207641_10790200 | |||
| 1888 | Ga0207641_10850142 | |||
| 1889 | Ga0207641_11019141 | |||
| 1890 | Ga0207641_11523910 | |||
| 1891 | Ga0207641_12038310 | |||
| 1892 | Ga0207648_10000198 | |||
| 1893 | Ga0207648_10004539 | |||
| 1894 | Ga0207648_10093868 | |||
| 1895 | Ga0207648_10151552 | |||
| 1896 | Ga0207648_11242031 | |||
| 1897 | Ga0207648_11307545 | |||
| 1898 | Ga0207648_11777136 | |||
| 1899 | Ga0207676_10002483 | |||
| 1900 | Ga0207676_10033829 | |||
| 1901 | Ga0207676_10086796 | |||
| 1902 | Ga0207676_10092542 | |||
| 1903 | Ga0207676_10157578 | |||
| 1904 | Ga0207676_10438501 | |||
| 1905 | Ga0207676_10460303 | |||
| 1906 | Ga0207676_10593730 | |||
| 1907 | Ga0207676_10737620 | |||
| 1908 | Ga0207676_11096224 | |||
| 1909 | Ga0207676_11761503 | |||
| 1910 | Ga0207674_10031401 | |||
| 1911 | Ga0207674_10698884 | |||
| 1912 | Ga0207674_10992711 | |||
| 1913 | Ga0207674_11144495 | |||
| 1914 | Ga0207675_100001270 | |||
| 1915 | Ga0207675_100003798 | |||
| 1916 | Ga0207675_100009919 | |||
| 1917 | Ga0207675_100375130 | |||
| 1918 | Ga0207675_100476539 | |||
| 1919 | Ga0207675_100580742 | |||
| 1920 | Ga0207675_101692882 | |||
| 1921 | Ga0207675_101702041 | |||
| 1922 | Ga0207675_102522021 | |||
| 1923 | Ga0207683_10059342 | |||
| 1924 | Ga0207683_10075217 | |||
| 1925 | Ga0207683_10188902 | |||
| 1926 | Ga0207683_10412119 | |||
| 1927 | Ga0207683_10912229 | |||
| 1928 | Ga0207698_10118651 | |||
| 1929 | Ga0210000_1002849 | |||
| 1930 | Ga0209970_1013396 | |||
| 1931 | Ga0209974_10443810 | |||
| 1932 | Ga0207428_10000510 | |||
| 1933 | Ga0207428_10003032 | |||
| 1934 | Ga0207428_10004234 | |||
| 1935 | Ga0207428_10263731 | |||
| 1936 | Ga0268266_10013971 | |||
| 1937 | Ga0268266_10417416 | |||
| 1938 | Ga0268266_12221360 | |||
| 1939 | Ga0268265_10000767 | |||
| 1940 | Ga0268265_10075231 | |||
| 1941 | Ga0268265_10251782 | |||
| 1942 | Ga0268265_10262384 | |||
| 1943 | Ga0268265_10294777 | |||
| 1944 | Ga0268265_10312020 | |||
| 1945 | Ga0268265_10352055 | |||
| 1946 | Ga0268265_10352470 | |||
| 1947 | Ga0268265_10780979 | |||
| 1948 | Ga0268265_10948111 | |||
| 1949 | Ga0268265_10984993 | |||
| 1950 | Ga0268265_11428253 | |||
| 1951 | Ga0268265_12702755 | |||
| 1952 | Ga0268264_10030150 | |||
| 1953 | Ga0268264_10057330 | |||
| 1954 | Ga0268264_10098065 | |||
| 1955 | Ga0268264_10159438 | |||
| 1956 | Ga0268264_10245646 | |||
| 1957 | Ga0268264_10755889 | |||
| 1958 | Ga0268264_10947585 | |||
| 1959 | Ga0268264_12219417 | |||
| 1960 | Ga0307408_100497660 | |||
| 1961 | Ga0307408_100780086 | |||
| 1962 | Ga0307406_11100810 | |||
| 1963 | Ga0307409_100539355 | |||
| 1964 | Ga0307416_100543392 | |||
| 1965 | Ga0307416_101044015 | |||
| 1966 | Ga0307416_103272197 | |||
| 1967 | Ga0307416_103509611 | |||
| 1968 | Ga0307411_10444698 | |||
| 1969 | Ga0307411_10960992 | |||
| 1970 | Ga0373948_0013431 | |||
| 1971 | Ga0373948_0063876 | |||
| 1972 | Ga0373928_0031217 | |||
| 1973 | Ga0373940_0009982 | |||
| 1974 | Ga0373951_0085893 | |||
| 1975 | Ga0373952_0034602 | |||
| 1976 | Ga0373939_0182272 | |||
| 1977 | Ga0373957_0458749 | |||
| 1978 | Ga0373960_0023324 | |||
| 1979 | Ga0373943_0450629 | |||
| 1980 | Ga0373961_0105539 | |||
| 1981 | Ga0373962_0029537 | |||
| 1982 | Ga0373931_0057702 | |||
| 1983 | Ga0395898_0156379 | |||
| 1984 | Ga0395905_0007149 | |||
| 1985 | Ga0395905_0392493 | |||
| 1986 | Ga0395905_1125915 | |||
| 1987 | Ga0439453_0023334 | |||
| 1988 | Ga0451855_0304849 | |||
| 1989 | Ga0451853_1394807 | |||
| 1990 | Ga0439450_005251 | |||
| 1991 | Ga0439454_008248 | |||
| 1992 | Ga0450908_065796 | |||
| 1993 | Ga0439435_0005021 | |||
| 1994 | Ga0439464_0262658 | |||
| 1995 | Ga0439460_0136469 | |||
| 1996 | Ga0450916_000508 | |||
| 1997 | Ga0451577_0395950 | |||
| 1998 | Ga0439440_0040261 | |||
| 1999 | Ga0453683_0559799 | |||
| 2000 | Ga0451576_0015279 | |||
| 2001 | Ga0451576_0025358 | |||
| 2002 | Ga0451576_0136760 | |||
| 2003 | Ga0451576_0296849 | |||
| 2004 | Ga0451576_0461962 | |||
| 2005 | Ga0451576_0798617 | |||
| 2006 | Ga0451576_2671451 | |||
| 2007 | Ga0451576_2713153 | |||
| 2008 | Ga0495603_0187959 | |||
| 2009 | Ga0495580_0127709 | |||
| 2010 | Ga0495582_0105123 | |||
| 2011 | Ga0495584_0269337 | |||
| 2012 | Ga0495594_0119481 | |||
| 2013 | Ga0495643_0407409 | |||
| 2014 | Ga0495644_0350931 | |||
| 2015 | Ga0495642_0019218 | |||
| 2016 | Ga0495598_0015644 | |||
| 2017 | Ga0495598_0052951 | |||
| 2018 | Ga0495621_0003986 | |||
| 2019 | Ga0495621_0027536 | |||
| 2020 | Ga0495621_0149592 | |||
| 2021 | Ga0495621_0164603 | |||
| 2022 | Ga0495668_0842339 | |||
| 2023 | Ga0495611_0575908 | |||
| 2024 | Ga0495659_0043359 | |||
| 2025 | Ga0495659_0128935 | |||
| 2026 | Ga0495588_0017456 | |||
| 2027 | Ga0495588_0310439 | |||
| 2028 | Ga0495669_0023891 | |||
| 2029 | Ga0495670_0365774 | |||
| 2030 | Ga0495685_007328 | |||
| 2031 | Ga0496100_1123756 | |||
| 2032 | Ga0496102_0811128 | |||
| 2033 | Ga0496103_0249263 | |||
| 2034 | Ga0496104_1139524 | |||
| 2035 | Ga0496106_0413510 | |||
| 2036 | Ga0496106_0424775 | |||
| 2037 | Ga0496106_0498865 | |||
| 2038 | Ga0496106_0673437 | |||
| 2039 | Ga0496106_0923624 | |||
| 2040 | Ga0496108_0012075 | |||
| 2041 | Ga0496108_0613048 | |||
| 2042 | Ga0496109_0048968 | |||
| 2043 | Ga0496109_0288894 | |||
| 2044 | Ga0496110_0411574 | |||
| 2045 | Ga0496110_0417667 | |||
| 2046 | Ga0496110_0941518 | |||
| 2047 | Ga0496111_0971003 | |||
| 2048 | Ga0496112_0032678 | |||
| 2049 | Ga0496112_0282770 | |||
| 2050 | Ga0496112_1529119 | |||
| 2051 | Ga0496113_0062438 | |||
| 2052 | Ga0496113_0238777 | |||
| 2053 | Ga0496113_0558702 | |||
| 2054 | Ga0496113_1426056 | |||
| 2055 | Ga0496114_0157966 | |||
| 2056 | Ga0496114_0162749 | |||
| 2057 | Ga0501032_0484185 | |||
| 2058 | Ga0501036_0136152 | |||
| 2059 | Ga0501039_0241187 | |||
| 2060 | Ga0501040_0015108 | |||
| 2061 | Ga0501040_0470679 | |||
| 2062 | Ga0501041_0025616 | |||
| 2063 | Ga0501041_0468819 | |||
| 2064 | Ga0501041_0615566 | |||
| 2065 | Ga0501042_0040657 | |||
| 2066 | Ga0501042_0448264 | |||
| 2067 | Ga0501046_0123338 | |||
| 2068 | Ga0501048_0092382 | |||
| 2069 | Ga0501067_0047049 | |||
| 2070 | Ga0501068_0195566 | |||
| 2071 | Ga0501068_0973622 | |||
| 2072 | Ga0501069_0661712 | |||
| 2073 | Ga0501071_0014605 | |||
| 2074 | Ga0501072_0111349 | |||
| 2075 | Ga0501073_0196467 | |||
| 2076 | Ga0501075_0415886 | |||
| 2077 | Ga0501075_0761614 | |||
| 2078 | Ga0501076_0015576 | |||
| 2079 | Ga0501077_0065109 | |||
| 2080 | Ga0501216_189627 | |||
| 2081 | Ga0501079_0541301 | |||
| 2082 | Ga0501080_0157308 | |||
| 2083 | Ga0501081_0087638 | |||
| 2084 | Ga0501081_1365077 | |||
| 2085 | Ga0501035_0489901 | |||
| 2086 | Ga0501045_0084317 | |||
| 2087 | Ga0501045_0754509 | |||
| 2088 | nmdc:mga06z11_984731_c1 | |||
| 2089 | nmdc:mga05p37_154896_c1 | |||
| 2090 | nmdc:mga05p37_316351_c1 | |||
| 2091 | nmdc:mga05p37_31798_c1 | |||
| 2092 | nmdc:mga05p37_424054_c1 | |||
| 2093 | nmdc:mga05p37_45770_c1 | |||
| 2094 | nmdc:mga05p37_46638_c1 | |||
| 2095 | nmdc:mga05p37_6944_c1 | |||
| 2096 | nmdc:mga05p37_80881_c1 | |||
| 2097 | nmdc:mga05p37_82470_c1 | |||
| 2098 | nmdc:mga05p37_9343_c1 | |||
| 2099 | nmdc:mga05p37_963354_c1 | |||
| 2100 | nmdc:mga09592_141643_c1 | |||
| 2101 | nmdc:mga09592_1434034_c1 | |||
| 2102 | nmdc:mga09592_27707_c1 | |||
| 2103 | nmdc:mga09592_41975_c1 | |||
| 2104 | nmdc:mga09592_7964_c1 | |||
| 2105 | nmdc:mga0qj67_2661_c1 | |||
| 2106 | nmdc:mga0qj67_4487_c1 | |||
| 2107 | nmdc:mga0qj67_48108_c1 | |||
| 2108 | nmdc:mga0qj67_81590_c1 | |||
| 2109 | nmdc:mga0qj67_944362_c1 | |||
| 2110 | nmdc:mga06r32_30562_c1 | |||
| 2111 | nmdc:mga06r32_321167_c1 | |||
| 2112 | nmdc:mga06r32_341466_c1 | |||
| 2113 | nmdc:mga06r32_3807_c1 | |||
| 2114 | nmdc:mga06r32_769888_c1 | |||
| 2115 | nmdc:mga06r32_961683_c1 | |||
| 2116 | nmdc:mga08y16_186481_c1 | |||
| 2117 | nmdc:mga08y16_211392_c1 | |||
| 2118 | nmdc:mga08y16_2170387_c1 | |||
| 2119 | nmdc:mga08y16_2418_c1 | |||
| 2120 | nmdc:mga08y16_317680_c1 | |||
| 2121 | nmdc:mga08y16_438934_c1 | |||
| 2122 | nmdc:mga08y16_470786_c1 | |||
| 2123 | nmdc:mga08y16_65165_c1 | |||
| 2124 | nmdc:mga08y16_66472_c1 | |||
| 2125 | nmdc:mga0n895_1010297_c1 | |||
| 2126 | nmdc:mga0n895_113337_c1 | |||
| 2127 | nmdc:mga0n895_13174_c1 | |||
| 2128 | nmdc:mga0n895_1607549_c1 | |||
| 2129 | nmdc:mga0n895_176532_c1 | |||
| 2130 | nmdc:mga0n895_23506_c1 | |||
| 2131 | nmdc:mga0n895_334878_c1 | |||
| 2132 | nmdc:mga0n895_37953_c1 | |||
| 2133 | nmdc:mga0n895_55203_c1 | |||
| 2134 | nmdc:mga0n895_763631_c1 | |||
| 2135 | nmdc:mga0n895_846048_c1 | |||
| 2136 | nmdc:mga0rr50_1011122_c1 | |||
| 2137 | nmdc:mga0rr50_111659_c1 | |||
| 2138 | nmdc:mga0rr50_1466745_c1 | |||
| 2139 | nmdc:mga0rr50_345131_c1 | |||
| 2140 | nmdc:mga0rr50_615268_c1 | |||
| 2141 | nmdc:mga0rr50_74018_c1 | |||
| 2142 | nmdc:mga0a205_1393380_c1 | |||
| 2143 | nmdc:mga0a205_1514780_c1 | |||
| 2144 | nmdc:mga0a205_170121_c1 | |||
| 2145 | nmdc:mga0a205_1825_c2 | |||
| 2146 | nmdc:mga0a205_186754_c1 | |||
| 2147 | nmdc:mga0a205_3581_c1 | |||
| 2148 | nmdc:mga0a205_968536_c1 | |||
| 2149 | Ga0500555_121089 | |||
| 2150 | Ga0501082_0167734 |