F489555

General Info

Members Datasets Scaffolds Average Seq Length
1075 490 2151 250

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100009516|Ga0068852_1000095166
Length 276
Sequence MPDTPRSSHCLEIRRNKIRNKIKDMLSIKNLQARIEEKQILKGINLDIKAGEVHAIMGPNGSGKSTLASVLAGRSEYEVTGGSVEFLGKDLLELSPEERAGEGIFLAFQYPVEIPGLTTTNFIKTAVNEVRKYRGQEPYDAVQFLKLMREKMAMVEINQSLLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDIDAIRIVANGVNKLRSKDNAVLVVTHYQRLLDYIVPDFVHVLYNGRIVKSGTKELALELEERGYDFIKNEVGQEA

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
115 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
116 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
117 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
220 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
226 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
231 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
232 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
233 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
298 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
299 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
315 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
316 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
317 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
318 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
330 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
331 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
332 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
333 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
334 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
335 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
336 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
337 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
338 2506520008 Serratia plymuthica AS12 Isolate Unclassified
339 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
340 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
341 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
342 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
343 2547132181 Kosakonia sacchari SP1 Isolate Stem
344 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
345 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
346 2561511199 Enterobacter sp. R4-368 Isolate Nodule
347 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
348 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
349 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
350 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
351 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
352 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
353 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
354 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
355 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
356 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
357 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
358 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
359 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
360 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
361 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
362 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
363 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
364 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
365 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
366 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
367 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
368 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
369 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
370 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
371 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
372 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
373 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
374 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
375 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
376 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
377 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
378 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
379 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
380 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
381 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
382 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
383 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
384 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
385 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
386 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
387 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
388 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
389 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
390 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
391 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
392 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
393 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
394 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
395 2636415599 Klebsiella variicola DX120E Isolate Unclassified
396 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
397 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
398 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
399 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
400 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
401 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
402 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
403 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
404 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
405 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
406 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
407 2738541278 Niastella sp. CF465 Isolate Unclassified
408 2751185917 Enterobacter sp. HK169 Isolate Unclassified
409 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
410 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
411 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
412 2775507074 Klebsiella sp. D5A Isolate Unclassified
413 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
414 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
415 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
416 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
417 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
418 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
419 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
420 2818991444 Filimonas endophytica 3197 Isolate Unclassified
421 2821118458 Enterobacter asburiae 609 Isolate Unclassified
422 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
423 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
424 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
425 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
426 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
427 2847085930 Erwinia persicina B64 Isolate Bulb
428 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
429 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
430 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
431 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
432 2865014394 Pantoea sp. R-71966 Isolate Unclassified
433 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
434 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
435 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
436 2876601092 Pantoea endophytica 596 Isolate Unclassified
437 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
438 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
439 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
440 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
441 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
442 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
443 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
444 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
445 2904504865 Serratia marcescens 1822 Isolate Unclassified
446 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
447 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
448 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
449 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
450 2919150387 Rahnella aceris 1817 Isolate Unclassified
451 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
452 2927143783 Rahnella sp. 2050 Isolate Unclassified
453 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
454 2932406140 Serratia sp. 2723 Isolate Rhizosphere
455 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
456 2937539931 Pantoea sp. LS15 Isolate Unclassified
457 2937967321 Serratia sp. YC16 Isolate Unclassified
458 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
459 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
460 2939577877 Serratia sp. 509 Isolate Rhizosphere
461 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
462 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
463 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
464 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
465 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
466 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
467 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
468 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
469 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
470 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
471 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
472 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
473 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
474 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
475 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
476 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
477 640753048 Serratia proteamaculans 568 Isolate Endosphere
478 8004592986 Serratia sp. S119 Isolate Unclassified
479 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
480 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
481 8018221730 Enterobacter sp. CM29 Isolate Unclassified
482 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
483 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
484 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
485 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
486 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
487 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
488 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
489 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
490 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.12
Metatranscriptomes 0.56
Isolates 14.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0.09
Endosphere 3.91
Nodule 1.95
Rhizoplane 7.07
Rhizosphere 69.77
Stem 0.09
Stem Tuber 0.47
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100009516 3300005616 Bacteria 7221
2 RicEn_C2598 2010549000 Bacteria 1601
3 SwRhRL2b_contig_182090 2162886007 Bacteria 9021
4 SwRhRL2b_contig_535415 2162886007 Bacteria 1126
5 JGI24739J22299_10003080 3300001989 Bacteria 6366
6 JGI25162J39368_1000112 3300002737 Bacteria 89231
7 JGI25162J39368_1001236 3300002737 Bacteria 14718
8 JGI25163J39215_1000031 3300002771 Bacteria 65095
9 JGI25163J39215_1000055 3300002771 Bacteria 51174
10 JGI25164J39214_1000094 3300002772 Bacteria 89231
11 JGI25152J39213_1000343 3300002773 Bacteria 29576
12 rootH1_10003827 3300003316 Bacteria 6423
13 rootH1_10032207 3300003316 Bacteria 2231
14 rootL2_10037931 3300003322 Bacteria 8826
15 rootH1_10005693 3300003323 Bacteria 32459
16 rootH1_10018400 3300003323 Bacteria 7594
17 rootH1_10091743 3300003316 Bacteria 7093
18 rootH1_10091743 3300003323 Bacteria 2062
19 rootH1_10120495 3300003323 Bacteria 5324
20 Ga0055538_1000076 3300003751 Bacteria 89231
21 Ga0055539_1000115 3300003752 Bacteria 89231
22 Ga0055533_1000121 3300003756 Bacteria 89231
23 Ga0055525_1000159 3300003759 Bacteria 89231
24 Ga0055531_10000087 3300003794 Bacteria 101553
25 Ga0055541_1000077 3300003841 Bacteria 89231
26 Ga0058692_1000232 3300003856 Bacteria 32057
27 Ga0058692_1001974 3300003856 Bacteria 7144
28 Ga0058692_1002212 3300003856 Bacteria 6631
29 Ga0058692_1002227 3300003856 Bacteria 6592
30 Ga0058692_1002355 3300003856 Bacteria 6362
31 Ga0058692_1006223 3300003856 Bacteria 3302
32 Ga0058692_1011593 3300003856 Bacteria 2122
33 Ga0058692_1011852 3300003856 Bacteria 2090
34 Ga0065714_10086305 3300005288 Bacteria 2107
35 Ga0065704_10000270 3300005289 Bacteria 61602
36 Ga0065704_10001131 3300005289 Bacteria 9351
37 Ga0065704_10001222 3300005289 Bacteria 11254
38 Ga0065704_10108828 3300005289 Bacteria 2017
39 Ga0065704_10124612 3300005289 Bacteria 1715
40 Ga0065704_10170720 3300005289 Bacteria 1292
41 Ga0065712_10079171 3300005290 Bacteria 3242
42 Ga0070658_10188664 3300005327 Bacteria 1737
43 Ga0070676_10016642 3300005328 Bacteria 4066
44 Ga0070676_10210624 3300005328 Bacteria 1279
45 Ga0070683_100001617 3300005329 Bacteria 17421
46 Ga0070683_100002162 3300005329 Bacteria 15546
47 Ga0070683_100057546 3300005329 Bacteria 3612
48 Ga0070683_100234185 3300005329 Bacteria 1746
49 Ga0070690_100103651 3300005330 Bacteria 1889
50 Ga0070690_100585778 3300005330 Bacteria 845
51 Ga0070670_100084846 3300005331 Bacteria 2721
52 Ga0070670_100130580 3300005331 Bacteria 2169
53 Ga0070670_100334396 3300005331 Bacteria 1329
54 Ga0068869_100002709 3300005334 Bacteria 10721
55 Ga0068869_100010369 3300005334 Bacteria 6077
56 Ga0068869_100017858 3300005334 Bacteria 4820
57 Ga0068869_100043183 3300005334 Bacteria 3237
58 Ga0068869_100144321 3300005334 Bacteria 1841
59 Ga0070666_10000031 3300005335 Bacteria 132089
60 Ga0070666_10009553 3300005335 Bacteria 6050
61 Ga0070666_10417803 3300005335 Bacteria 966
62 Ga0070680_100001731 3300005336 Bacteria 16032
63 Ga0070682_100001468 3300005337 Bacteria 13211
64 Ga0068868_100007514 3300005338 Bacteria 7764
65 Ga0068868_100033134 3300005338 Bacteria 3980
66 Ga0068868_100043882 3300005338 Bacteria 3493
67 Ga0068868_100054588 3300005338 Bacteria 3149
68 Ga0068868_100079649 3300005338 Bacteria 2624
69 Ga0070660_100144238 3300005339 Bacteria 1912
70 Ga0070660_100193236 3300005339 Bacteria 1649
71 Ga0070660_100327507 3300005339 Bacteria 1259
72 Ga0070691_10034684 3300005341 Bacteria 2376
73 Ga0070661_100001586 3300005344 Bacteria 15775
74 Ga0070668_100025488 3300005347 Bacteria 4483
75 Ga0070668_100115638 3300005347 Bacteria 2138
76 Ga0070669_100224023 3300005353 Bacteria 1488
77 Ga0070669_100497565 3300005353 Bacteria 1011
78 Ga0070675_100057888 3300005354 Bacteria 3195
79 Ga0070671_100193397 3300005355 Bacteria 1724
80 Ga0070671_100233095 3300005355 Bacteria 1562
81 Ga0070671_100427751 3300005355 Bacteria 1134
82 Ga0070674_100079535 3300005356 Bacteria 2339
83 Ga0070674_100313810 3300005356 Bacteria 1254
84 Ga0070673_100201735 3300005364 Bacteria 1713
85 Ga0070673_100362119 3300005364 Bacteria 1289
86 Ga0070673_100445067 3300005364 Bacteria 1165
87 Ga0070673_100770317 3300005364 Bacteria 887
88 Ga0070688_100009950 3300005365 Bacteria 5225
89 Ga0070688_100069908 3300005365 Bacteria 2243
90 Ga0070659_100012249 3300005366 Bacteria 6357
91 Ga0070659_100016158 3300005366 Bacteria 5600
92 Ga0070659_100037129 3300005366 Bacteria 3798
93 Ga0070659_100037542 3300005366 Bacteria 3777
94 Ga0070659_100186550 3300005366 Bacteria 1704
95 Ga0070659_100207224 3300005366 Bacteria 1615
96 Ga0070667_100046365 3300005367 Bacteria 3656
97 Ga0070667_100708258 3300005367 Bacteria 932
98 Ga0070713_100163466 3300005436 Bacteria 1989
99 Ga0070678_100051008 3300005456 Bacteria 2996
100 Ga0070678_100057426 3300005456 Bacteria 2851
101 Ga0070662_100024310 3300005457 Bacteria 4172
102 Ga0070662_100028844 3300005457 Bacteria 3867
103 Ga0070662_100032828 3300005457 Bacteria 3651
104 Ga0070662_100094369 3300005457 Bacteria 2253
105 Ga0070662_100593419 3300005457 Bacteria 931
106 Ga0068867_100194794 3300005459 Bacteria 1619
107 Ga0068867_100468326 3300005459 Bacteria 1077
108 Ga0070685_10005488 3300005466 Bacteria 6426
109 Ga0070679_100014552 3300005530 Bacteria 7558
110 Ga0070684_100022943 3300005535 Bacteria 5212
111 Ga0070684_100833454 3300005535 Bacteria 863
112 Ga0068853_100004621 3300005539 Bacteria 10681
113 Ga0068853_100052273 3300005539 Bacteria 3520
114 Ga0068853_100065389 3300005539 Bacteria 3156
115 Ga0068853_100211933 3300005539 Bacteria 1766
116 Ga0068853_100409270 3300005539 Bacteria 1271
117 Ga0068853_100724119 3300005539 Bacteria 950
118 Ga0070672_100101886 3300005543 Bacteria 2330
119 Ga0070672_100457001 3300005543 Bacteria 1100
120 Ga0070693_100028255 3300005547 Bacteria 3048
121 Ga0070693_100064846 3300005547 Bacteria 2133
122 Ga0070665_100000595 3300005548 Bacteria 50263
123 Ga0070665_100121491 3300005548 Bacteria 2613
124 Ga0070665_100123066 3300005548 Bacteria 2596
125 Ga0070665_100224624 3300005548 Bacteria 1878
126 Ga0070704_100417679 3300005549 Bacteria 1148
127 Ga0068855_100020960 3300005563 Bacteria 7838
128 Ga0068855_100290088 3300005563 Bacteria 1814
129 Ga0070664_100003065 3300005564 Bacteria 13514
130 Ga0070664_100003911 3300005564 Bacteria 12021
131 Ga0070664_100036401 3300005564 Bacteria 4135
132 Ga0070664_100045037 3300005564 Bacteria 3726
133 Ga0070664_100046767 3300005564 Bacteria 3656
134 Ga0070664_100124501 3300005564 Bacteria 2260
135 Ga0070664_100330431 3300005564 Bacteria 1383
136 Ga0068857_100052473 3300005577 Bacteria 3618
137 Ga0068857_100228405 3300005577 Bacteria 1701
138 Ga0068857_100900642 3300005577 Bacteria 848
139 Ga0068854_100057524 3300005578 Bacteria 2805
140 Ga0068854_100178465 3300005578 Bacteria 1657
141 Ga0068854_100346939 3300005578 Bacteria 1214
142 Ga0070702_100227063 3300005615 Bacteria 1252
143 Ga0068852_100038782 3300005616 Bacteria 4006
144 Ga0068852_100045464 3300005616 Bacteria 3734
145 Ga0068852_100082650 3300005616 Bacteria 2854
146 Ga0068859_100000045 3300005617 Bacteria 143607
147 Ga0068859_100086353 3300005617 Bacteria 3184
148 Ga0068859_100107186 3300005617 Bacteria 2854
149 Ga0068859_100198675 3300005617 Bacteria 2090
150 Ga0068859_100491051 3300005617 Bacteria 1323
151 Ga0068864_100046141 3300005618 Bacteria 3738
152 Ga0068864_100056094 3300005618 Bacteria 3404
153 Ga0068864_100064644 3300005618 Bacteria 3173
154 Ga0068864_100233016 3300005618 Bacteria 1704
155 Ga0068864_100531215 3300005618 Bacteria 1135
156 Ga0068866_10024317 3300005718 Bacteria 2830
157 Ga0068866_10298216 3300005718 Bacteria 1005
158 Ga0068861_100033570 3300005719 Bacteria 3787
159 Ga0068851_10023513 3300005834 Bacteria 3013
160 Ga0068863_100002071 3300005841 Bacteria 19895
161 Ga0068863_100013056 3300005841 Bacteria 8012
162 Ga0068863_100162903 3300005841 Bacteria 2138
163 Ga0068858_100002469 3300005842 Bacteria 18659
164 Ga0068858_100054897 3300005842 Bacteria 3684
165 Ga0068860_100004776 3300005843 Bacteria 13806
166 Ga0068860_100058267 3300005843 Bacteria 3672
167 Ga0068860_100268699 3300005843 Bacteria 1664
168 Ga0068860_100422375 3300005843 Bacteria 1322
169 Ga0068862_100216931 3300005844 Bacteria 1731
170 Ga0075364_10067598 3300006051 Bacteria 2349
171 Ga0075364_10079981 3300006051 Bacteria 2160
172 Ga0075364_10163379 3300006051 Bacteria 1503
173 Ga0075432_10014587 3300006058 Bacteria 2676
174 Ga0070715_10024227 3300006163 Bacteria 2388
175 Ga0075366_10132706 3300006195 Bacteria 1503
176 Ga0097621_100003567 3300006237 Bacteria 10753
177 Ga0097621_100022063 3300006237 Bacteria 4938
178 Ga0097621_100126339 3300006237 Bacteria 2173
179 Ga0097621_100212845 3300006237 Bacteria 1682
180 Ga0097621_100464888 3300006237 Bacteria 1141
181 Ga0097621_100698364 3300006237 Bacteria 934
182 Ga0068871_100047223 3300006358 Bacteria 3471
183 Ga0068871_100157398 3300006358 Bacteria 1941
184 Ga0068871_100553513 3300006358 Bacteria 1042
185 Ga0075428_100097302 3300006844 Bacteria 3209
186 Ga0075431_100005705 3300006847 Bacteria 12302
187 Ga0075429_100015656 3300006880 Bacteria 6571
188 Ga0068865_100131123 3300006881 Bacteria 1878
189 Ga0068865_100610952 3300006881 Bacteria 923
190 Ga0097620_100000045 3300006931 Bacteria 143607
191 Ga0097620_100086354 3300006931 Bacteria 3184
192 Ga0097620_100107183 3300006931 Bacteria 2854
193 Ga0097620_100198669 3300006931 Bacteria 2090
194 Ga0097620_100483806 3300006931 Bacteria 1333
195 Ga0097620_100491040 3300006931 Bacteria 1323
196 Ga0079104_1000535 3300006946 Bacteria 40052
197 Ga0079104_1000611 3300006946 Bacteria 35208
198 Ga0079104_1000775 3300006946 Bacteria 27286
199 Ga0079104_1001375 3300006946 Bacteria 16606
200 Ga0079104_1001480 3300006946 Bacteria 15648
201 Ga0079104_1002577 3300006946 Bacteria 9535
202 Ga0079104_1002634 3300006946 Bacteria 9364
203 Ga0079104_1006112 3300006946 Bacteria 4647
204 Ga0079104_1013219 3300006946 Bacteria 2555
205 Ga0105251_10000752 3300009011 Bacteria 29611
206 Ga0105251_10001038 3300009011 Bacteria 24371
207 Ga0105251_10002124 3300009011 Bacteria 15933
208 Ga0105251_10002144 3300009011 Bacteria 15866
209 Ga0105251_10010747 3300009011 Bacteria 5281
210 Ga0105251_10013713 3300009011 Bacteria 4519
211 Ga0105251_10024581 3300009011 Bacteria 3092
212 Ga0105251_10024734 3300009011 Bacteria 3081
213 Ga0105251_10053907 3300009011 Bacteria 1911
214 Ga0105251_10064353 3300009011 Bacteria 1719
215 Ga0105251_10088665 3300009011 Bacteria 1423
216 Ga0105251_10098236 3300009011 Bacteria 1340
217 Ga0105244_10000104 3300009036 Bacteria 86815
218 Ga0105244_10000222 3300009036 Bacteria 58959
219 Ga0105244_10000330 3300009036 Bacteria 44986
220 Ga0105244_10000354 3300009036 Bacteria 42971
221 Ga0105244_10000586 3300009036 Bacteria 32689
222 Ga0105244_10000865 3300009036 Bacteria 25591
223 Ga0105244_10001499 3300009036 Bacteria 18722
224 Ga0105244_10003307 3300009036 Bacteria 11606
225 Ga0105244_10010356 3300009036 Bacteria 5657
226 Ga0105244_10020096 3300009036 Bacteria 3713
227 Ga0105244_10024280 3300009036 Bacteria 3310
228 Ga0105244_10052901 3300009036 Bacteria 2066
229 Ga0105244_10101605 3300009036 Bacteria 1406
230 Ga0105244_10110086 3300009036 Bacteria 1341
231 Ga0105244_10221170 3300009036 Bacteria 888
232 Ga0105250_10000001 3300009092 Bacteria 617357
233 Ga0105250_10000195 3300009092 Bacteria 51515
234 Ga0105250_10000253 3300009092 Bacteria 44276
235 Ga0105250_10000448 3300009092 Bacteria 29733
236 Ga0105250_10003065 3300009092 Bacteria 8061
237 Ga0105250_10010162 3300009092 Bacteria 3928
238 Ga0105250_10020296 3300009092 Bacteria 2687
239 Ga0105240_10000859 3300009093 Bacteria 54758
240 Ga0105240_10016428 3300009093 Bacteria 10021
241 Ga0111539_10171523 3300009094 Bacteria 2534
242 Ga0105247_10000138 3300009101 Bacteria 70791
243 Ga0114129_10025420 3300009147 Bacteria 8390
244 Ga0105243_10066237 3300009148 Bacteria 2904
245 Ga0105243_10173822 3300009148 Bacteria 1868
246 Ga0105241_10000002 3300009174 Bacteria 869480
247 Ga0105241_10000591 3300009174 Bacteria 27316
248 Ga0105241_10027307 3300009174 Bacteria 4251
249 Ga0105241_10155556 3300009174 Bacteria 1874
250 Ga0105241_10237075 3300009174 Bacteria 1540
251 Ga0105241_10243849 3300009174 Bacteria 1520
252 Ga0105242_10064347 3300009176 Bacteria 3023
253 Ga0105242_10152313 3300009176 Bacteria 2017
254 Ga0105248_10316285 3300009177 Bacteria 1758
255 Ga0105248_10686998 3300009177 Bacteria 1155
256 Ga0105237_10002015 3300009545 Bacteria 25851
257 Ga0105237_10137985 3300009545 Bacteria 2433
258 Ga0105237_10355448 3300009545 Bacteria 1469
259 Ga0105238_10507117 3300009551 Bacteria 1208
260 Ga0105249_10000870 3300009553 Bacteria 26875
261 Ga0105249_10257618 3300009553 Bacteria 1732
262 Ga0105249_10684109 3300009553 Bacteria 1085
263 Ga0105239_10347780 3300010375 Bacteria 1674
264 Ga0105239_10607058 3300010375 Bacteria 1248
265 Ga0105246_10037568 3300011119 Bacteria 3250
266 Ga0105246_10076809 3300011119 Bacteria 2367
267 Ga0105246_10212563 3300011119 Bacteria 1510
268 Ga0105246_10254171 3300011119 Bacteria 1396
269 Ga0105246_10810141 3300011119 Bacteria 832
270 Ga0157373_10000500 3300013100 Bacteria 30895
271 Ga0157373_10000783 3300013100 Bacteria 24475
272 Ga0157373_10005917 3300013100 Bacteria 9152
273 Ga0157373_10188835 3300013100 Bacteria 1452
274 Ga0157371_10000099 3300013102 Bacteria 133829
275 Ga0157371_10001578 3300013102 Bacteria 23400
276 Ga0157371_10002572 3300013102 Bacteria 17215
277 Ga0157371_10016739 3300013102 Bacteria 5462
278 Ga0157371_10020580 3300013102 Bacteria 4855
279 Ga0157371_10025659 3300013102 Bacteria 4291
280 Ga0157371_10026882 3300013102 Bacteria 4178
281 Ga0157371_10074128 3300013102 Bacteria 2410
282 Ga0157371_10075013 3300013102 Bacteria 2395
283 Ga0157371_10085380 3300013102 Bacteria 2236
284 Ga0157370_10000234 3300013104 Bacteria 70723
285 Ga0157370_10004098 3300013104 Bacteria 16897
286 Ga0157370_10006551 3300013104 Bacteria 12824
287 Ga0157370_10015259 3300013104 Bacteria 7818
288 Ga0157370_10059676 3300013104 Bacteria 3624
289 Ga0157370_10202539 3300013104 Bacteria 1841
290 Ga0157370_10214236 3300013104 Bacteria 1785
291 Ga0157370_10267333 3300013104 Bacteria 1580
292 Ga0157370_10391271 3300013104 Bacteria 1280
293 Ga0157369_10030301 3300013105 Bacteria 5967
294 Ga0157369_10032764 3300013105 Bacteria 5711
295 Ga0157369_10062171 3300013105 Bacteria 4024
296 Ga0157369_10171903 3300013105 Bacteria 2283
297 Ga0157369_10298718 3300013105 Bacteria 1675
298 Ga0157374_10000607 3300013296 Bacteria 31733
299 Ga0157374_10003134 3300013296 Bacteria 13893
300 Ga0157374_10021708 3300013296 Bacteria 5717
301 Ga0157374_10079115 3300013296 Bacteria 3115
302 Ga0157374_10317926 3300013296 Bacteria 1542
303 Ga0157374_10437749 3300013296 Bacteria 1308
304 Ga0157378_10006056 3300013297 Bacteria 10594
305 Ga0157378_10006383 3300013297 Bacteria 10310
306 Ga0157378_10037001 3300013297 Bacteria 4321
307 Ga0157378_10044926 3300013297 Bacteria 3924
308 Ga0157378_10350813 3300013297 Bacteria 1441
309 Ga0163162_10002494 3300013306 Bacteria 17393
310 Ga0163162_10021357 3300013306 Bacteria 6374
311 Ga0163162_10035335 3300013306 Bacteria 4977
312 Ga0163162_10061435 3300013306 Bacteria 3795
313 Ga0163162_10132924 3300013306 Bacteria 2598
314 Ga0163162_10195546 3300013306 Bacteria 2151
315 Ga0157372_10007775 3300013307 Bacteria 11386
316 Ga0157372_10014588 3300013307 Bacteria 8406
317 Ga0157372_10023900 3300013307 Bacteria 6631
318 Ga0157372_10083160 3300013307 Bacteria 3626
319 Ga0157372_10108661 3300013307 Bacteria 3175
320 Ga0157372_10144319 3300013307 Bacteria 2745
321 Ga0157372_10150426 3300013307 Bacteria 2686
322 Ga0157372_10282713 3300013307 Bacteria 1929
323 Ga0157372_10284671 3300013307 Bacteria 1922
324 Ga0157372_10372592 3300013307 Bacteria 1664
325 Ga0157372_10572863 3300013307 Bacteria 1316
326 Ga0157372_10803964 3300013307 Bacteria 1092
327 Ga0157372_10975451 3300013307 Bacteria 982
328 Ga0157372_11373910 3300013307 Bacteria 814
329 Ga0157372_11374089 3300013307 Bacteria 814
330 Ga0157375_10010451 3300013308 Bacteria 8167
331 Ga0157375_10016076 3300013308 Bacteria 6713
332 Ga0157375_10022934 3300013308 Bacteria 5752
333 Ga0157375_10036441 3300013308 Bacteria 4706
334 Ga0157375_10188032 3300013308 Bacteria 2219
335 Ga0157375_10194138 3300013308 Bacteria 2185
336 Ga0163163_10000078 3300014325 Bacteria 107017
337 Ga0163163_10000266 3300014325 Bacteria 52427
338 Ga0163163_10016683 3300014325 Bacteria 6831
339 Ga0163163_10057979 3300014325 Bacteria 3829
340 Ga0163163_10155883 3300014325 Bacteria 2328
341 Ga0163163_10233170 3300014325 Bacteria 1890
342 Ga0157380_10000704 3300014326 Bacteria 20846
343 Ga0157380_10013755 3300014326 Bacteria 5908
344 Ga0157380_10165053 3300014326 Bacteria 1929
345 Ga0157380_10470941 3300014326 Bacteria 1212
346 Ga0157377_10023420 3300014745 Bacteria 3272
347 Ga0157377_10073178 3300014745 Bacteria 1985
348 Ga0157379_10397977 3300014968 Bacteria 1266
349 Ga0157376_10057433 3300014969 Bacteria 3255
350 Ga0157376_10090091 3300014969 Bacteria 2654
351 Ga0157376_10117263 3300014969 Bacteria 2354
352 Ga0157376_10328331 3300014969 Bacteria 1457
353 Ga0157376_10421650 3300014969 Bacteria 1295
354 Ga0182006_1000047 3300015261 Bacteria 187006
355 Ga0182006_1008119 3300015261 Bacteria 4764
356 Ga0182007_10004870 3300015262 Bacteria 5999
357 Ga0183366_1001 3300015679 Bacteria 2743932
358 Ga0183370_1001 3300015680 Bacteria 2743932
359 Ga0183369_1001 3300015685 Bacteria 2743932
360 Ga0183368_1001 3300015687 Bacteria 2743932
361 Ga0163161_10114482 3300017792 Bacteria 2020
362 Ga0163161_10137372 3300017792 Bacteria 1849
363 Ga0163161_10211080 3300017792 Bacteria 1500
364 Ga0206351_10347196 3300020077 Bacteria 4528
365 Ga0213876_10000055 3300021384 Bacteria 136037
366 Ga0224712_10176051 3300022467 Bacteria 962
367 Ga0209760_100104 3300025207 Bacteria 65129
368 Ga0209784_100001 3300025224 Bacteria 3600592
369 Ga0209566_100001 3300025225 Bacteria 3600765
370 Ga0209674_100002 3300025226 Bacteria 3600592
371 Ga0209563_100008 3300025230 Bacteria 1554545
372 Ga0207427_100135 3300025231 Bacteria 89851
373 Ga0209437_100007 3300025233 Bacteria 938377
374 Ga0209437_100109 3300025233 Bacteria 217031
375 Ga0209437_100111 3300025233 Bacteria 214944
376 Ga0209677_100004 3300025253 Bacteria 1554545
377 Ga0209129_1000004 3300025258 Bacteria 884499
378 Ga0209257_1000006 3300025304 Bacteria 1570111
379 Ga0207656_10001167 3300025321 Bacteria 8636
380 Ga0207656_10145007 3300025321 Bacteria 1121
381 Ga0207696_1000001 3300025711 Bacteria 2579611
382 Ga0207696_1000028 3300025711 Bacteria 400424
383 Ga0207696_1000086 3300025711 Bacteria 194626
384 Ga0207696_1000116 3300025711 Bacteria 148125
385 Ga0207696_1000174 3300025711 Bacteria 102229
386 Ga0207696_1000235 3300025711 Bacteria 77526
387 Ga0207696_1000439 3300025711 Bacteria 37274
388 Ga0207696_1001155 3300025711 Bacteria 15182
389 Ga0207696_1004856 3300025711 Bacteria 5696
390 Ga0207696_1039799 3300025711 Bacteria 1380
391 Ga0207655_1000001 3300025728 Bacteria 1866413
392 Ga0207655_1000004 3300025728 Bacteria 1021221
393 Ga0207655_1000009 3300025728 Bacteria 664676
394 Ga0207655_1000037 3300025728 Bacteria 354473
395 Ga0207655_1000089 3300025728 Bacteria 204720
396 Ga0207655_1000426 3300025728 Bacteria 56714
397 Ga0207655_1000647 3300025728 Bacteria 41615
398 Ga0207655_1000741 3300025728 Bacteria 36714
399 Ga0207655_1002099 3300025728 Bacteria 16702
400 Ga0207655_1003187 3300025728 Bacteria 12363
401 Ga0207655_1005530 3300025728 Bacteria 8571
402 Ga0207655_1041906 3300025728 Bacteria 1956
403 Ga0207655_1061571 3300025728 Bacteria 1447
404 Ga0207713_1000001 3300025735 Bacteria 2295391
405 Ga0207713_1000002 3300025735 Bacteria 1061749
406 Ga0207713_1000003 3300025735 Bacteria 860698
407 Ga0207713_1000012 3300025735 Bacteria 501860
408 Ga0207713_1001881 3300025735 Bacteria 15941
409 Ga0207713_1001893 3300025735 Bacteria 15874
410 Ga0207713_1010034 3300025735 Bacteria 5280
411 Ga0207713_1012581 3300025735 Bacteria 4509
412 Ga0207713_1020048 3300025735 Bacteria 3253
413 Ga0207713_1021384 3300025735 Bacteria 3102
414 Ga0207713_1022401 3300025735 Bacteria 3000
415 Ga0207713_1025865 3300025735 Bacteria 2701
416 Ga0207713_1043857 3300025735 Bacteria 1844
417 Ga0207713_1051983 3300025735 Bacteria 1626
418 Ga0207713_1062442 3300025735 Bacteria 1412
419 Ga0207713_1062803 3300025735 Bacteria 1406
420 Ga0207713_1073257 3300025735 Bacteria 1257
421 Ga0207713_1114844 3300025735 Bacteria 910
422 Ga0207682_10013296 3300025893 Bacteria 3207
423 Ga0207642_10110967 3300025899 Bacteria 1396
424 Ga0207710_10000052 3300025900 Bacteria 181113
425 Ga0207710_10039366 3300025900 Bacteria 2092
426 Ga0207688_10019542 3300025901 Bacteria 3693
427 Ga0207688_10087378 3300025901 Bacteria 1787
428 Ga0207680_10000627 3300025903 Bacteria 16642
429 Ga0207680_10413530 3300025903 Bacteria 954
430 Ga0207647_10000951 3300025904 Bacteria 22412
431 Ga0207685_10248628 3300025905 Bacteria 859
432 Ga0207645_10000263 3300025907 Bacteria 43560
433 Ga0207645_10211058 3300025907 Bacteria 1279
434 Ga0207643_10009659 3300025908 Bacteria 5180
435 Ga0207643_10115001 3300025908 Bacteria 1588
436 Ga0207705_10215007 3300025909 Bacteria 1459
437 Ga0207705_10559955 3300025909 Bacteria 889
438 Ga0207654_10000005 3300025911 Bacteria 869492
439 Ga0207654_10002808 3300025911 Bacteria 8835
440 Ga0207654_10165487 3300025911 Bacteria 1432
441 Ga0207654_10263986 3300025911 Bacteria 1159
442 Ga0207654_10373532 3300025911 Bacteria 986
443 Ga0207707_10001133 3300025912 Bacteria 25238
444 Ga0207695_10000697 3300025913 Bacteria 65760
445 Ga0207695_10149398 3300025913 Bacteria 2277
446 Ga0207671_10001627 3300025914 Bacteria 25569
447 Ga0207657_10057255 3300025919 Bacteria 3360
448 Ga0207657_10186973 3300025919 Bacteria 1672
449 Ga0207681_10298752 3300025923 Bacteria 1273
450 Ga0207694_10360978 3300025924 Bacteria 1204
451 Ga0207650_10010602 3300025925 Bacteria 6329
452 Ga0207650_10012259 3300025925 Bacteria 5916
453 Ga0207650_10095777 3300025925 Bacteria 2276
454 Ga0207659_10081239 3300025926 Bacteria 2396
455 Ga0207644_10146786 3300025931 Bacteria 1822
456 Ga0207644_10510666 3300025931 Bacteria 992
457 Ga0207690_10007814 3300025932 Bacteria 6350
458 Ga0207690_10041973 3300025932 Bacteria 3001
459 Ga0207690_10110114 3300025932 Bacteria 1982
460 Ga0207706_10028711 3300025933 Bacteria 4966
461 Ga0207706_10036759 3300025933 Bacteria 4350
462 Ga0207706_10061454 3300025933 Bacteria 3308
463 Ga0207706_10175285 3300025933 Bacteria 1884
464 Ga0207686_10183326 3300025934 Bacteria 1486
465 Ga0207709_10117671 3300025935 Bacteria 1789
466 Ga0207709_10172431 3300025935 Bacteria 1519
467 Ga0207670_10242954 3300025936 Bacteria 1388
468 Ga0207670_10266294 3300025936 Bacteria 1330
469 Ga0207669_10208796 3300025937 Bacteria 1423
470 Ga0207704_10412162 3300025938 Bacteria 1069
471 Ga0207691_10124593 3300025940 Bacteria 2281
472 Ga0207691_10146860 3300025940 Bacteria 2075
473 Ga0207691_10490483 3300025940 Bacteria 1044
474 Ga0207711_10433756 3300025941 Bacteria 1223
475 Ga0207689_10000740 3300025942 Bacteria 31390
476 Ga0207689_10001881 3300025942 Bacteria 19847
477 Ga0207689_10004215 3300025942 Bacteria 13071
478 Ga0207689_10004731 3300025942 Bacteria 12272
479 Ga0207689_10008743 3300025942 Bacteria 8808
480 Ga0207689_10156765 3300025942 Bacteria 1877
481 Ga0207661_10002099 3300025944 Bacteria 13715
482 Ga0207661_10076603 3300025944 Bacteria 2747
483 Ga0207661_10116912 3300025944 Bacteria 2264
484 Ga0207661_10197014 3300025944 Bacteria 1769
485 Ga0207661_10707570 3300025944 Bacteria 927
486 Ga0207679_10004222 3300025945 Bacteria 8925
487 Ga0207679_10006055 3300025945 Bacteria 7625
488 Ga0207679_10056047 3300025945 Bacteria 2908
489 Ga0207679_10121017 3300025945 Bacteria 2084
490 Ga0207679_10346529 3300025945 Bacteria 1293
491 Ga0207667_10074165 3300025949 Bacteria 3535
492 Ga0207667_10130253 3300025949 Bacteria 2591
493 Ga0207667_10140052 3300025949 Bacteria 2491
494 Ga0207667_10189282 3300025949 Bacteria 2112
495 Ga0207651_10148948 3300025960 Bacteria 1819
496 Ga0207651_10231980 3300025960 Bacteria 1499
497 Ga0207712_10004692 3300025961 Bacteria 8639
498 Ga0207712_10305212 3300025961 Bacteria 1308
499 Ga0207668_10005192 3300025972 Bacteria 7662
500 Ga0207668_10116960 3300025972 Bacteria 2011
501 Ga0207640_10129225 3300025981 Bacteria 1823
502 Ga0207658_10069120 3300025986 Bacteria 2667
503 Ga0207658_10466273 3300025986 Bacteria 1120
504 Ga0207677_10042463 3300026023 Bacteria 3015
505 Ga0207677_10084549 3300026023 Bacteria 2288
506 Ga0207677_10376986 3300026023 Bacteria 1196
507 Ga0207703_10003137 3300026035 Bacteria 13955
508 Ga0207703_10242993 3300026035 Bacteria 1619
509 Ga0207703_10379941 3300026035 Bacteria 1306
510 Ga0207639_10013711 3300026041 Bacteria 5682
511 Ga0207641_10000146 3300026088 Bacteria 100666
512 Ga0207641_10004565 3300026088 Bacteria 11968
513 Ga0207641_10023870 3300026088 Bacteria 5041
514 Ga0207641_10132465 3300026088 Bacteria 2240
515 Ga0207641_10538102 3300026088 Bacteria 1138
516 Ga0207648_10007679 3300026089 Bacteria 10553
517 Ga0207648_10026554 3300026089 Bacteria 5144
518 Ga0207648_10349172 3300026089 Bacteria 1333
519 Ga0207676_10053281 3300026095 Bacteria 3166
520 Ga0207676_10081556 3300026095 Bacteria 2628
521 Ga0207676_10105893 3300026095 Bacteria 2342
522 Ga0207676_10287519 3300026095 Bacteria 1495
523 Ga0207676_10520557 3300026095 Bacteria 1132
524 Ga0207676_10750257 3300026095 Bacteria 949
525 Ga0207674_10003943 3300026116 Bacteria 18057
526 Ga0207674_10076295 3300026116 Bacteria 3360
527 Ga0207674_10348043 3300026116 Bacteria 1433
528 Ga0207675_100033135 3300026118 Bacteria 4813
529 Ga0207675_100209283 3300026118 Bacteria 1875
530 Ga0207675_100212710 3300026118 Bacteria 1860
531 Ga0207683_10001367 3300026121 Bacteria 22059
532 Ga0207683_10039890 3300026121 Bacteria 4096
533 Ga0207683_10271032 3300026121 Bacteria 1550
534 Ga0207698_10016396 3300026142 Bacteria 4992
535 Ga0207698_10098006 3300026142 Bacteria 2421
536 Ga0207698_10290463 3300026142 Bacteria 1517
537 Ga0207698_10346190 3300026142 Bacteria 1402
538 Ga0207698_10444367 3300026142 Bacteria 1250
539 Ga0209281_1000001 3300027111 Bacteria 1933496
540 Ga0209281_1000003 3300027111 Bacteria 1260089
541 Ga0209281_1000130 3300027111 Bacteria 191756
542 Ga0209281_1000394 3300027111 Bacteria 68048
543 Ga0209281_1000428 3300027111 Bacteria 62540
544 Ga0209281_1000598 3300027111 Bacteria 41043
545 Ga0209281_1000713 3300027111 Bacteria 33360
546 Ga0209281_1001045 3300027111 Bacteria 20990
547 Ga0209281_1001234 3300027111 Bacteria 16952
548 Ga0209281_1002684 3300027111 Bacteria 6726
549 Ga0209281_1002778 3300027111 Bacteria 6484
550 Ga0209371_1000001 3300027312 Bacteria 2771503
551 Ga0209371_1000002 3300027312 Bacteria 1551985
552 Ga0209371_1000041 3300027312 Bacteria 340377
553 Ga0209371_1000122 3300027312 Bacteria 132545
554 Ga0209371_1000188 3300027312 Bacteria 90102
555 Ga0209371_1000492 3300027312 Bacteria 38527
556 Ga0209371_1000862 3300027312 Bacteria 24564
557 Ga0209371_1001378 3300027312 Bacteria 16753
558 Ga0209371_1001914 3300027312 Bacteria 12710
559 Ga0209371_1002701 3300027312 Bacteria 9581
560 Ga0209371_1003845 3300027312 Bacteria 6961
561 Ga0209371_1004166 3300027312 Bacteria 6457
562 Ga0209371_1017918 3300027312 Bacteria 1817
563 Ga0209371_1022638 3300027312 Bacteria 1497
564 Ga0209995_1011204 3300027471 Bacteria 1457
565 Ga0268266_10001643 3300028379 Bacteria 25908
566 Ga0268266_10091894 3300028379 Bacteria 2662
567 Ga0268266_10490007 3300028379 Bacteria 1173
568 Ga0268265_10318611 3300028380 Bacteria 1407
569 Ga0268264_10004639 3300028381 Bacteria 11675
570 Ga0268264_10244334 3300028381 Bacteria 1664
571 Ga0268264_10362372 3300028381 Bacteria 1383
572 Ga0265323_10000155 3300028653 Bacteria 40398
573 Ga0307515_10000024 3300028794 Bacteria 393119
574 Ga0265338_10000829 3300028800 Bacteria 52134
575 Ga0265338_10022306 3300028800 Bacteria 6560
576 Ga0268256_1000001 3300030500 Bacteria 2771065
577 Ga0268256_1000002 3300030500 Bacteria 1535763
578 Ga0268256_1000003 3300030500 Bacteria 1289401
579 Ga0268256_1000048 3300030500 Bacteria 312298
580 Ga0268256_1000051 3300030500 Bacteria 283626
581 Ga0268256_1000718 3300030500 Bacteria 24564
582 Ga0268256_1000844 3300030500 Bacteria 21767
583 Ga0268256_1001182 3300030500 Bacteria 16753
584 Ga0268256_1001381 3300030500 Bacteria 14764
585 Ga0268256_1003561 3300030500 Bacteria 6961
586 Ga0268256_1003845 3300030500 Bacteria 6547
587 Ga0268256_1004889 3300030500 Bacteria 5409
588 Ga0268256_1020005 3300030500 Bacteria 1817
589 Ga0268256_1025573 3300030500 Bacteria 1497
590 Ga0265340_10006768 3300031247 Bacteria 6272
591 Ga0265327_10002353 3300031251 Bacteria 20149
592 Ga0307509_10069970 3300031507 Bacteria 3666
593 Ga0307408_100021623 3300031548 Bacteria 4357
594 Ga0307408_100199309 3300031548 Bacteria 1619
595 Ga0265342_10043736 3300031712 Bacteria 2702
596 Ga0316576_10301370 3300031727 Bacteria 1198
597 Ga0316578_10073968 3300031728 Bacteria 2020
598 Ga0316578_10166887 3300031728 Bacteria 1327
599 Ga0307516_10183073 3300031730 Bacteria 1827
600 Ga0316577_10093444 3300031733 Bacteria 1684
601 Ga0307413_10162424 3300031824 Bacteria 1571
602 Ga0307413_10403361 3300031824 Bacteria 1072
603 Ga0307410_10133007 3300031852 Bacteria 1830
604 Ga0307412_10082115 3300031911 Bacteria 2231
605 Ga0307412_10673094 3300031911 Bacteria 885
606 Ga0307416_100046890 3300032002 Bacteria 3415
607 Ga0307414_10000349 3300032004 Bacteria 25834
608 Ga0307414_10354929 3300032004 Bacteria 1260
609 Ga0307411_10076805 3300032005 Bacteria 2284
610 Ga0307411_10211510 3300032005 Bacteria 1498
611 Ga0307415_100058197 3300032126 Bacteria 2660
612 Ga0373953_0046563 3300035117 Bacteria 1742
613 Ga0373957_0078731 3300035120 Bacteria 1299
614 Ga0373955_0133452 3300035172 Bacteria 1451
615 Ga0373937_0211631 3300036401 Bacteria 1824
616 Ga0316584_0373164 3300036712 Bacteria 1021
617 Ga0395900_0032101 3300037418 Bacteria 5399
618 Ga0395900_0204509 3300037418 Bacteria 1996
619 Ga0395900_0231681 3300037418 Bacteria 1857
620 Ga0395905_0000001 3300037471 Bacteria 2037079
621 Ga0395905_0001509 3300037471 Bacteria 27821
622 Ga0395905_0321487 3300037471 Bacteria 1437
623 Ga0395905_0326249 3300037471 Bacteria 1425
624 Ga0395901_0073626 3300038443 Bacteria 3563
625 Ga0395901_0354010 3300038443 Bacteria 1515
626 Ga0436365_0971002 3300039437 Bacteria 167792
627 Ga0439436_0001403 3300041404 Bacteria 6962
628 Ga0439438_000001 3300041405 Bacteria 1263568
629 Ga0439438_000780 3300041405 Bacteria 14167
630 Ga0439438_025837 3300041405 Bacteria 1596
631 Ga0439439_0036952 3300041406 Bacteria 1258
632 Ga0439447_001075 3300041407 Bacteria 9908
633 Ga0439466_0000047 3300041411 Bacteria 48861
634 Ga0451793_0325768 3300041452 Bacteria 836
635 Ga0451795_0027072 3300041456 Bacteria 2684
636 Ga0451798_0517438 3300041458 Bacteria 832
637 Ga0451798_0974364 3300041458 Bacteria 1182
638 Ga0451807_2513161 3300041486 Bacteria 1602
639 Ga0439432_010616 3300042006 Bacteria 3185
640 Ga0439432_011524 3300042006 Bacteria 3046
641 Ga0439432_013991 3300042006 Bacteria 2718
642 Ga0439449_0001549 3300042007 Bacteria 9004
643 Ga0439449_0061628 3300042007 Bacteria 1384
644 Ga0439452_000001 3300042010 Bacteria 1725439
645 Ga0439452_000002 3300042010 Bacteria 1377577
646 Ga0439452_000008 3300042010 Bacteria 569877
647 Ga0439452_000142 3300042010 Bacteria 54077
648 Ga0439452_000298 3300042010 Bacteria 31875
649 Ga0439457_004175 3300042014 Bacteria 3810
650 Ga0439457_013437 3300042014 Bacteria 1841
651 Ga0439463_006887 3300042016 Bacteria 2806
652 Ga0450907_000190 3300042146 Bacteria 22431
653 Ga0439464_0011759 3300042439 Bacteria 2322
654 Ga0451577_0083417 3300042876 Bacteria 2851
655 Ga0466972_0000028 3300044658 Bacteria 171140
656 Ga0466972_0125101 3300044658 Bacteria 1212
657 Ga0466981_0000002 3300044669 Bacteria 313036
658 Ga0453683_0079495 3300044673 Bacteria 2054
659 Ga0453683_0152767 3300044673 Bacteria 1459
660 Ga0466966_0341366 3300044684 Bacteria 900
661 Ga0453684_0023018 3300044712 Bacteria 9207
662 Ga0453684_0086272 3300044712 Bacteria 3896
663 Ga0453684_0092605 3300044712 Bacteria 3725
664 Ga0453684_0104488 3300044712 Bacteria 3457
665 Ga0453684_0865566 3300044712 Bacteria 970
666 Ga0451576_1038951 3300045051 Bacteria 858
667 Ga0495617_040590 3300046452 Bacteria 1556
668 Ga0495627_000116 3300046453 Bacteria 99916
669 Ga0495592_0276160 3300046454 Bacteria 1100
670 Ga0495591_000013 3300046458 Bacteria 268106
671 Ga0495591_000100 3300046458 Bacteria 99473
672 Ga0495591_035053 3300046458 Bacteria 1471
673 Ga0495638_0013681 3300046460 Bacteria 5513
674 Ga0495650_0000005 3300046471 Bacteria 766553
675 Ga0495650_0000090 3300046471 Bacteria 232897
676 Ga0495650_0000187 3300046471 Bacteria 136554
677 Ga0495584_0011311 3300046491 Bacteria 4571
678 Ga0495585_0011587 3300046492 Bacteria 5213
679 Ga0495606_0003762 3300046507 Bacteria 15779
680 Ga0495618_0103054 3300046514 Bacteria 1827
681 Ga0495630_0008093 3300046517 Bacteria 7557
682 Ga0495630_0216452 3300046517 Bacteria 1462
683 Ga0495632_0176716 3300046519 Bacteria 979
684 Ga0495637_0123931 3300046520 Bacteria 992
685 Ga0495643_0034513 3300046522 Bacteria 2791
686 Ga0495644_0000573 3300046523 Bacteria 15420
687 Ga0495648_0002343 3300046524 Bacteria 17587
688 Ga0495648_0009258 3300046524 Bacteria 7655
689 Ga0495654_0000041 3300046530 Bacteria 174733
690 Ga0495654_0000173 3300046530 Bacteria 63665
691 Ga0495654_0001003 3300046530 Bacteria 20737
692 Ga0495654_0052850 3300046530 Bacteria 1976
693 Ga0495597_0001631 3300046542 Bacteria 15710
694 Ga0495633_0131575 3300046558 Bacteria 1158
695 Ga0495667_0005807 3300046559 Bacteria 8363
696 Ga0495625_0016408 3300046660 Bacteria 5831
697 Ga0495588_0003244 3300046674 Bacteria 7055
698 Ga0495613_0014269 3300046689 Bacteria 5896
699 Ga0495671_0009709 3300046692 Bacteria 5365
700 Ga0495649_0001886 3300046694 Bacteria 15339
701 Ga0495649_0009622 3300046694 Bacteria 5729
702 Ga0495589_0000004 3300046794 Bacteria 439891
703 Ga0495589_0005519 3300046794 Bacteria 6671
704 Ga0495660_0000028 3300046810 Bacteria 244534
705 Ga0495660_0000171 3300046810 Bacteria 70062
706 Ga0495660_0053644 3300046810 Bacteria 2187
707 Ga0495604_0368024 3300047317 Bacteria 952
708 Ga0495672_0000002 3300047320 Bacteria 740116
709 Ga0495672_0000020 3300047320 Bacteria 432845
710 Ga0495672_0000043 3300047320 Bacteria 266893
711 Ga0495672_0015649 3300047320 Bacteria 5141
712 Ga0495679_000282 3300047446 Bacteria 42194
713 Ga0495679_029528 3300047446 Bacteria 1787
714 Ga0495679_049639 3300047446 Bacteria 1265
715 Ga0495673_0000070 3300047469 Bacteria 217453
716 Ga0495673_0000167 3300047469 Bacteria 111793
717 Ga0495681_0021707 3300047470 Bacteria 3452
718 Ga0495681_0092896 3300047470 Bacteria 1329
719 Ga0496100_0004919 3300048903 Bacteria 7138
720 Ga0496101_0000163 3300048904 Bacteria 56805
721 Ga0496101_0254290 3300048904 Bacteria 1369
722 Ga0496102_0049801 3300048905 Bacteria 3812
723 Ga0496103_0068478 3300048906 Bacteria 2218
724 Ga0496104_0000555 3300048907 Bacteria 31796
725 Ga0496104_0048174 3300048907 Bacteria 4018
726 Ga0496104_0579797 3300048907 Bacteria 1032
727 Ga0496105_0031796 3300048908 Bacteria 4328
728 Ga0496108_0705674 3300048911 Bacteria 875
729 Ga0496110_0152210 3300048913 Bacteria 2095
730 Ga0496110_0165676 3300048913 Bacteria 2004
731 Ga0496110_0256833 3300048913 Bacteria 1591
732 Ga0496111_0114285 3300048914 Bacteria 1990
733 Ga0496115_0010820 3300048918 Bacteria 6823
734 Ga0496115_0257228 3300048918 Bacteria 1436
735 Ga0496116_0000001 3300048919 Bacteria 1501681
736 Ga0496116_0000122 3300048919 Bacteria 162802
737 Ga0496116_0000277 3300048919 Bacteria 89271
738 Ga0496116_0001125 3300048919 Bacteria 31904
739 Ga0496116_0008548 3300048919 Bacteria 8868
740 Ga0496116_0012630 3300048919 Bacteria 6879
741 Ga0496116_0015585 3300048919 Bacteria 6002
742 Ga0496116_0100569 3300048919 Bacteria 1728
743 Ga0496116_0106631 3300048919 Bacteria 1658
744 Ga0496117_0000004 3300048920 Bacteria 877131
745 Ga0496117_0000165 3300048920 Bacteria 139029
746 Ga0496117_0000399 3300048920 Bacteria 74064
747 Ga0496117_0002525 3300048920 Bacteria 22922
748 Ga0496117_0003424 3300048920 Bacteria 18450
749 Ga0496117_0004066 3300048920 Bacteria 16424
750 Ga0496117_0008180 3300048920 Bacteria 9980
751 Ga0496117_0020640 3300048920 Bacteria 5364
752 Ga0496117_0034148 3300048920 Bacteria 3837
753 Ga0496117_0034335 3300048920 Bacteria 3822
754 Ga0496117_0060036 3300048920 Bacteria 2623
755 Ga0496117_0068843 3300048920 Bacteria 2387
756 Ga0496117_0070832 3300048920 Bacteria 2339
757 Ga0496117_0073597 3300048920 Bacteria 2278
758 Ga0496118_0000007 3300048921 Bacteria 650986
759 Ga0496118_0000015 3300048921 Bacteria 551359
760 Ga0496118_0001126 3300048921 Bacteria 41304
761 Ga0496118_0002525 3300048921 Bacteria 24537
762 Ga0496118_0002850 3300048921 Bacteria 22564
763 Ga0496118_0005269 3300048921 Bacteria 14761
764 Ga0496118_0012799 3300048921 Bacteria 8007
765 Ga0496118_0021142 3300048921 Bacteria 5738
766 Ga0496118_0026635 3300048921 Bacteria 4917
767 Ga0496118_0027827 3300048921 Bacteria 4775
768 Ga0496118_0036738 3300048921 Bacteria 3954
769 Ga0496118_0176208 3300048921 Bacteria 1298
770 Ga0496119_0000066 3300048922 Bacteria 162680
771 Ga0496119_0000095 3300048922 Bacteria 129683
772 Ga0496119_0000911 3300048922 Bacteria 38310
773 Ga0496119_0001499 3300048922 Bacteria 27950
774 Ga0496119_0001967 3300048922 Bacteria 23367
775 Ga0496119_0002594 3300048922 Bacteria 19628
776 Ga0496119_0004815 3300048922 Bacteria 13237
777 Ga0496119_0012013 3300048922 Bacteria 7086
778 Ga0496119_0019406 3300048922 Bacteria 5009
779 Ga0496119_0024425 3300048922 Bacteria 4252
780 Ga0496119_0027666 3300048922 Bacteria 3890
781 Ga0496119_0031972 3300048922 Bacteria 3515
782 Ga0496119_0037015 3300048922 Bacteria 3176
783 Ga0496119_0039110 3300048922 Bacteria 3051
784 Ga0496120_0000076 3300048923 Bacteria 163121
785 Ga0496120_0000380 3300048923 Bacteria 71773
786 Ga0496120_0000928 3300048923 Bacteria 40566
787 Ga0496120_0001267 3300048923 Bacteria 31661
788 Ga0496120_0002342 3300048923 Bacteria 19477
789 Ga0496120_0003408 3300048923 Bacteria 14539
790 Ga0496120_0003965 3300048923 Bacteria 12868
791 Ga0496120_0011139 3300048923 Bacteria 6204
792 Ga0496120_0015425 3300048923 Bacteria 5041
793 Ga0496120_0025816 3300048923 Bacteria 3641
794 Ga0496120_0044450 3300048923 Bacteria 2580
795 Ga0496120_0050891 3300048923 Bacteria 2369
796 Ga0496121_0002250 3300048924 Bacteria 30081
797 Ga0496121_0003016 3300048924 Bacteria 24450
798 Ga0496121_0025828 3300048924 Bacteria 5557
799 Ga0496121_0025872 3300048924 Bacteria 5552
800 Ga0496121_0042151 3300048924 Bacteria 3976
801 Ga0496121_0187043 3300048924 Bacteria 1488
802 Ga0496121_0247971 3300048924 Bacteria 1236
803 Ga0496122_0000005 3300048925 Bacteria 630659
804 Ga0496122_0000058 3300048925 Bacteria 248805
805 Ga0496122_0000738 3300048925 Bacteria 63772
806 Ga0496122_0004902 3300048925 Bacteria 16231
807 Ga0496122_0014702 3300048925 Bacteria 7546
808 Ga0496122_0021615 3300048925 Bacteria 5751
809 Ga0496122_0022320 3300048925 Bacteria 5630
810 Ga0496122_0025084 3300048925 Bacteria 5194
811 Ga0496122_0050089 3300048925 Bacteria 3188
812 Ga0496122_0059356 3300048925 Bacteria 2824
813 Ga0496122_0061607 3300048925 Bacteria 2752
814 Ga0496122_0082194 3300048925 Bacteria 2238
815 Ga0496122_0104116 3300048925 Bacteria 1886
816 Ga0496123_0000008 3300048926 Bacteria 630628
817 Ga0496123_0000044 3300048926 Bacteria 253396
818 Ga0496123_0001322 3300048926 Bacteria 35015
819 Ga0496123_0002433 3300048926 Bacteria 23152
820 Ga0496123_0006525 3300048926 Bacteria 11270
821 Ga0496123_0011748 3300048926 Bacteria 7546
822 Ga0496123_0020012 3300048926 Bacteria 5253
823 Ga0496123_0022150 3300048926 Bacteria 4907
824 Ga0496123_0022151 3300048926 Bacteria 4907
825 Ga0496123_0044729 3300048926 Bacteria 3024
826 Ga0496123_0081598 3300048926 Bacteria 1964
827 Ga0496124_0000105 3300048927 Bacteria 176783
828 Ga0496124_0000107 3300048927 Bacteria 168020
829 Ga0496124_0000196 3300048927 Bacteria 119375
830 Ga0496124_0000564 3300048927 Bacteria 62677
831 Ga0496124_0001459 3300048927 Bacteria 34893
832 Ga0496124_0012635 3300048927 Bacteria 8309
833 Ga0496124_0023875 3300048927 Bacteria 5570
834 Ga0496124_0037841 3300048927 Bacteria 4193
835 Ga0496124_0075693 3300048927 Bacteria 2780
836 Ga0496124_0133342 3300048927 Bacteria 1970
837 Ga0496124_0139172 3300048927 Bacteria 1917
838 Ga0496124_0141534 3300048927 Bacteria 1897
839 Ga0496124_0248184 3300048927 Bacteria 1318
840 Ga0496124_0309144 3300048927 Bacteria 1137
841 Ga0496125_0000009 3300048928 Bacteria 677678
842 Ga0496125_0000103 3300048928 Bacteria 201675
843 Ga0496125_0001712 3300048928 Bacteria 30528
844 Ga0496125_0005660 3300048928 Bacteria 13790
845 Ga0496125_0007075 3300048928 Bacteria 11984
846 Ga0496125_0017105 3300048928 Bacteria 6928
847 Ga0496125_0024785 3300048928 Bacteria 5507
848 Ga0496125_0040085 3300048928 Bacteria 4022
849 Ga0496125_0081332 3300048928 Bacteria 2475
850 Ga0496126_0000399 3300048929 Bacteria 89026
851 Ga0496126_0000779 3300048929 Bacteria 57561
852 Ga0496126_0002347 3300048929 Bacteria 25872
853 Ga0496126_0020256 3300048929 Bacteria 6528
854 Ga0496126_0064326 3300048929 Bacteria 3286
855 Ga0496126_0092871 3300048929 Bacteria 2650
856 Ga0496126_0093341 3300048929 Bacteria 2642
857 Ga0496126_0117465 3300048929 Bacteria 2310
858 Ga0496126_0118871 3300048929 Bacteria 2294
859 Ga0496126_0177426 3300048929 Bacteria 1811
860 Ga0496126_0263834 3300048929 Bacteria 1431
861 Ga0496126_0270448 3300048929 Bacteria 1410
862 Ga0501308_010410 3300049128 Bacteria 1033
863 Ga0501305_001184 3300049161 Bacteria 2481
864 Ga0495678_000591 3300049459 Bacteria 34139
865 Ga0495678_014148 3300049459 Bacteria 3717
866 Ga0495682_0000001 3300049460 Bacteria 1559116
867 Ga0501315_012408 3300049531 Bacteria 1054
868 Ga0501323_000094 3300049539 Bacteria 4699
869 Ga0501031_0003536 3300049568 Bacteria 10030
870 Ga0501031_0019137 3300049568 Bacteria 4457
871 Ga0501032_0007698 3300049569 Bacteria 7853
872 Ga0501032_0192352 3300049569 Bacteria 1333
873 Ga0501033_0000199 3300049570 Bacteria 57341
874 Ga0501034_0000506 3300049571 Bacteria 62858
875 Ga0501034_0066200 3300049571 Bacteria 3626
876 Ga0501034_0376554 3300049571 Bacteria 1345
877 Ga0501036_0017191 3300049572 Bacteria 6046
878 Ga0501036_0087559 3300049572 Bacteria 2632
879 Ga0501037_0012707 3300049573 Bacteria 6201
880 Ga0501037_0023483 3300049573 Bacteria 4560
881 Ga0501038_0004083 3300049574 Bacteria 13581
882 Ga0501038_0072829 3300049574 Bacteria 2910
883 Ga0501039_0002895 3300049575 Bacteria 12839
884 Ga0501039_0108703 3300049575 Bacteria 2167
885 Ga0501043_0008259 3300049579 Bacteria 8202
886 Ga0501043_0023673 3300049579 Bacteria 4816
887 Ga0501043_0249241 3300049579 Bacteria 1368
888 Ga0501046_0020279 3300049580 Bacteria 5501
889 Ga0501047_0072084 3300049581 Bacteria 3325
890 Ga0501047_0171986 3300049581 Bacteria 2035
891 Ga0501069_0063534 3300049585 Bacteria 2062
892 Ga0501072_0308475 3300049588 Bacteria 1258
893 Ga0501199_002418 3300049650 Bacteria 1745
894 Ga0501207_020946 3300049654 Bacteria 1047
895 Ga0501238_004979 3300049671 Bacteria 1674
896 Ga0501257_011545 3300049686 Bacteria 2017
897 Ga0501264_000987 3300049761 Bacteria 3465
898 Ga0501035_0001435 3300049822 Bacteria 24437
899 Ga0501035_0079391 3300049822 Bacteria 2899
900 Ga0501044_0005001 3300049823 Bacteria 14799
901 Ga0501044_0032991 3300049823 Bacteria 5442
902 Ga0501044_0040028 3300049823 Bacteria 4887
903 Ga0501044_0235991 3300049823 Bacteria 1774
904 Ga0501045_0000745 3300049824 Bacteria 20812
905 Ga0501226_008295 3300049853 Bacteria 1160
906 nmdc:mga00v17_159762_c1 3300050491 Bacteria 1450
907 nmdc:mga00v17_177317_c1 3300050491 Bacteria 1375
908 nmdc:mga0k408_1666_c3 3300050493 Bacteria 3919
909 nmdc:mga05p37_106817_c1 3300050507 Bacteria 3444
910 nmdc:mga05p37_202163_c1 3300050507 Bacteria 2405
911 nmdc:mga09592_61110_c1 3300050508 Bacteria 3186
912 nmdc:mga06r32_13230_c1 3300050510 Bacteria 7472
913 Ga0495601_0094389 3300053077 Bacteria 1928
914 Ga0500578_0000919 3300053086 Bacteria 33045
915 Ga0500621_000003 3300053126 Bacteria 596975
916 Ga0500642_0081867 3300053130 Bacteria 1484
917 Ga0500568_0031940 3300053139 Bacteria 2168
918 Ga0500588_0005614 3300053146 Bacteria 2796
919 Ga0500616_0037732 3300053153 Bacteria 2614
920 Ga0500616_0046016 3300053153 Bacteria 2321
921 Ga0500622_0002124 3300053156 Bacteria 14761
922 Ga0500636_0110383 3300053177 Bacteria 1555
923 2506578190 2506520007 Bacteria 5442880
924 2506583328 2506520008 Bacteria 5443009
925 2508852207 2508501071 Bacteria 5454741
926 2511378921 2511231025 Bacteria 5324661
927 2511437154 2511231035 Bacteria 5341610
928 2538425773 2537561728 Bacteria 5149301
929 2547695172 2547132181 Bacteria 4945084
930 2548648354 2547132416 Bacteria 4633861
931 2555257426 2554235234 Bacteria 5762085
932 2562462966 2561511199 Bacteria 5155034
933 2585825447 2585427591 Bacteria 5482980
934 2585832071 2585427592 Bacteria 5370892
935 2599408927 2599185169 Bacteria 5441380
936 2599925465 2599185299 Bacteria 4854625
937 2601522556 2600255254 Bacteria 5281859
938 2601527583 2600255255 Bacteria 5282785
939 2601535280 2600255256 Bacteria 5597742
940 2601540843 2600255257 Bacteria 5597196
941 2601614414 2600255280 Bacteria 5292309
942 2601619134 2600255281 Bacteria 5288753
943 2601642246 2600255287 Bacteria 5210468
944 2601647108 2600255288 Bacteria 5282738
945 2601652561 2600255289 Bacteria 5281907
946 2601657887 2600255290 Bacteria 5282218
947 2601662069 2600255291 Bacteria 5217298
948 2601695027 2600255298 Bacteria 5215185
949 2601699699 2600255299 Bacteria 5218662
950 2601706406 2600255300 Bacteria 5287774
951 2601710712 2600255301 Bacteria 5280532
952 2601715726 2600255302 Bacteria 5288235
953 2601720050 2600255303 Bacteria 5219315
954 2601726132 2600255304 Bacteria 5283973
955 2601730673 2600255305 Bacteria 5282329
956 2601735689 2600255306 Bacteria 5281613
957 2601740957 2600255307 Bacteria 5439064
958 2601750887 2600255309 Bacteria 5431045
959 2601758462 2600255310 Bacteria 5600903
960 2601764572 2600255311 Bacteria 5598766
961 2602018141 2600255392 Bacteria 5437392
962 2603638185 2602042046 Bacteria 5483348
963 2603642693 2602042047 Bacteria 4697674
964 2603659431 2602042052 Bacteria 5215873
965 2603664706 2602042053 Bacteria 5214361
966 2603698263 2602042066 Bacteria 4423871
967 2603703283 2602042067 Bacteria 4863713
968 2603838065 2602042103 Bacteria 5284714
969 2603843143 2602042104 Bacteria 5281639
970 2603848216 2602042105 Bacteria 5282303
971 2603853291 2602042106 Bacteria 5282744
972 2603867235 2602042109 Bacteria 5152801
973 2603871342 2602042110 Bacteria 5283285
974 2603876273 2602042111 Bacteria 5212080
975 2606048535 2603880178 Bacteria 5283018
976 2606069133 2603880184 Bacteria 5217896
977 2606144955 2603880202 Bacteria 5284684
978 2606175936 2603880211 Bacteria 5284226
979 2608669280 2608642108 Bacteria 4104624
980 2609913477 2609459761 Bacteria 5513740
981 2637224798 2636415599 Bacteria 5718434
982 2650898800 2648501693 Bacteria 5069560
983 2656275236 2654587920 Bacteria 5475511
984 2671103220 2667528172 Bacteria 5170840
985 2671109826 2667528173 Bacteria 5375747
986 2671588313 2671180115 Bacteria 5353919
987 2676406067 2675903046 Bacteria 5451247
988 2681997633 2681812866 Bacteria 4552357
989 2682006845 2681812869 Bacteria 5014465
990 2686353184 2684622997 Bacteria 4624240
991 2689444740 2687453601 Bacteria 5546041
992 2712469818 2711768156 Bacteria 4471618
993 2738729116 2738541278 Bacteria 9755573
994 2753855711 2751185917 Bacteria 4551186
995 2765588704 2765235842 Bacteria 4799256
996 2772438794 2772190666 Bacteria 5117644
997 2775538711 2775506706 Bacteria 4873073
998 2777022177 2775507074 Bacteria 5532402
999 2791922472 2791354903 Bacteria 4937680
1000 2792314818 2791355010 Bacteria 4864581
1001 2793405753 2791355275 Bacteria 4429597
1002 2807179446 2806310673 Bacteria 4801221
1003 2809123765 2808606414 Bacteria 4917181
1004 2813729161 2811995292 Bacteria 5303342
1005 2814696727 2814123068 Bacteria 5687681
1006 2819587191 2818991444 Bacteria 6968812
1007 2821119517 2821118458 Bacteria 4714306
1008 2823374493 2823373977 Bacteria 4779415
1009 2833641385 2833640130 Bacteria 4858325
1010 2844427263 2844425489 Bacteria 4854065
1011 2844530817 2844528606 Bacteria 4733806
1012 2846544407 2846540461 Bacteria 5471451
1013 2847087812 2847085930 Bacteria 5070450
1014 2847800037 2847797336 Bacteria 5176640
1015 2852107781 2852103415 Bacteria 5193810
1016 2855195969 2855195626 Bacteria 4927512
1017 2858468945 2858466076 Bacteria 4722413
1018 2865015106 2865014394 Bacteria 4764573
1019 2869554140 2869551831 Bacteria 5474685
1020 2871272756 2871272651 Bacteria 5042015
1021 2871286326 2871282230 Bacteria 4917173
1022 2876604395 2876601092 Bacteria 5114497
1023 2881248947 2881247448 Bacteria 3717788
1024 2881610077 2881609920 Bacteria 4405319
1025 2884089084 2884086401 Bacteria 5005459
1026 2888368815 2888366609 Bacteria 5155009
1027 2888378483 2888373701 Bacteria 5098052
1028 2891672933 2891670763 Bacteria 4967099
1029 2900052697 2900051742 Bacteria 4985156
1030 2904478177 2904474040 Bacteria 5504324
1031 2904504985 2904504865 Bacteria 5152820
1032 2904514314 2904513164 Bacteria 5476410
1033 2908670036 2908669403 Bacteria 5740494
1034 2911140585 2911138879 Bacteria 5811561
1035 2919108622 2919108558 Bacteria 5897419
1036 2919155305 2919150387 Bacteria 5500879
1037 2923634584 2923634449 Bacteria 4753480
1038 2927147983 2927143783 Bacteria 5504251
1039 2927834367 2927833300 Bacteria 4923934
1040 2932408198 2932406140 Bacteria 5134491
1041 2935626900 2935625433 Bacteria 5042964
1042 2937540290 2937539931 Bacteria 4639830
1043 2937967408 2937967321 Bacteria 5094075
1044 2939568908 2939568625 Bacteria 4542555
1045 2939573836 2939573065 Bacteria 4926053
1046 2939578655 2939577877 Bacteria 5132791
1047 2939603466 2939602548 Bacteria 4950493
1048 2939607716 2939607340 Bacteria 4719256
1049 2939619357 2939617950 Bacteria 4820956
1050 2939644045 2939642701 Bacteria 4475280
1051 2945877464 2945874760 Bacteria 5527237
1052 2945953151 2945951305 Bacteria 4918162
1053 2969081778 2969079654 Bacteria 5439582
1054 2971823190 2971820967 Bacteria 5823634
1055 2974312377 2974310843 Bacteria 4947816
1056 2974438234 2974435778 Bacteria 4876478
1057 2978975674 2978975091 Bacteria 4704313
1058 2984496469 2984494565 Bacteria 5000175
1059 2984564203 2984559226 Bacteria 5683096
1060 2984596938 2984595703 Bacteria 5682994
1061 2990261890 2990261002 Bacteria 4919493
1062 3000378722 3000376612 Bacteria 4705565
1063 640937717 640753048 Bacteria 5495657
1064 8004595702 8004592986 Bacteria 5122074
1065 8015396362 8015394850 Bacteria 5064660
1066 8016736079 8016733728 Bacteria 5274317
1067 8018222313 8018221730 Bacteria 4616064
1068 8018408406 8018405270 Bacteria 4978981
1069 8019502824 8019499862 Bacteria 5169538
1070 8019506241 8019504834 Bacteria 4819156
1071 8054845640 8054844752 Bacteria 4450330
1072 8054853018 8054849141 Bacteria 5232694
1073 8055091037 8055087960 Bacteria 4784273
1074 8055094458 8055092621 Bacteria 4873875
1075 8055099871 8055097453 Bacteria 4865496
1076 8057309464 8057304971 Bacteria 4649742
1077 Ga0068852_100009516
1078 RicEn_C2598
1079 SwRhRL2b_contig_182090
1080 SwRhRL2b_contig_535415
1081 JGI24739J22299_10003080
1082 JGI25162J39368_1000112
1083 JGI25162J39368_1001236
1084 JGI25163J39215_1000031
1085 JGI25163J39215_1000055
1086 JGI25164J39214_1000094
1087 JGI25152J39213_1000343
1088 rootH1_10003827
1089 rootH1_10032207
1090 rootL2_10037931
1091 rootH1_10005693
1092 rootH1_10018400
1093 rootH1_10091743
1094 rootH1_10120495
1095 Ga0055538_1000076
1096 Ga0055539_1000115
1097 Ga0055533_1000121
1098 Ga0055525_1000159
1099 Ga0055531_10000087
1100 Ga0055541_1000077
1101 Ga0058692_1000232
1102 Ga0058692_1001974
1103 Ga0058692_1002212
1104 Ga0058692_1002227
1105 Ga0058692_1002355
1106 Ga0058692_1006223
1107 Ga0058692_1011593
1108 Ga0058692_1011852
1109 Ga0065714_10086305
1110 Ga0065704_10000270
1111 Ga0065704_10001131
1112 Ga0065704_10001222
1113 Ga0065704_10108828
1114 Ga0065704_10124612
1115 Ga0065704_10170720
1116 Ga0065712_10079171
1117 Ga0070658_10188664
1118 Ga0070676_10016642
1119 Ga0070676_10210624
1120 Ga0070683_100001617
1121 Ga0070683_100002162
1122 Ga0070683_100057546
1123 Ga0070683_100234185
1124 Ga0070690_100103651
1125 Ga0070690_100585778
1126 Ga0070670_100084846
1127 Ga0070670_100130580
1128 Ga0070670_100334396
1129 Ga0068869_100002709
1130 Ga0068869_100010369
1131 Ga0068869_100017858
1132 Ga0068869_100043183
1133 Ga0068869_100144321
1134 Ga0070666_10000031
1135 Ga0070666_10009553
1136 Ga0070666_10417803
1137 Ga0070680_100001731
1138 Ga0070682_100001468
1139 Ga0068868_100007514
1140 Ga0068868_100033134
1141 Ga0068868_100043882
1142 Ga0068868_100054588
1143 Ga0068868_100079649
1144 Ga0070660_100144238
1145 Ga0070660_100193236
1146 Ga0070660_100327507
1147 Ga0070691_10034684
1148 Ga0070661_100001586
1149 Ga0070668_100025488
1150 Ga0070668_100115638
1151 Ga0070669_100224023
1152 Ga0070669_100497565
1153 Ga0070675_100057888
1154 Ga0070671_100193397
1155 Ga0070671_100233095
1156 Ga0070671_100427751
1157 Ga0070674_100079535
1158 Ga0070674_100313810
1159 Ga0070673_100201735
1160 Ga0070673_100362119
1161 Ga0070673_100445067
1162 Ga0070673_100770317
1163 Ga0070688_100009950
1164 Ga0070688_100069908
1165 Ga0070659_100012249
1166 Ga0070659_100016158
1167 Ga0070659_100037129
1168 Ga0070659_100037542
1169 Ga0070659_100186550
1170 Ga0070659_100207224
1171 Ga0070667_100046365
1172 Ga0070667_100708258
1173 Ga0070713_100163466
1174 Ga0070678_100051008
1175 Ga0070678_100057426
1176 Ga0070662_100024310
1177 Ga0070662_100028844
1178 Ga0070662_100032828
1179 Ga0070662_100094369
1180 Ga0070662_100593419
1181 Ga0068867_100194794
1182 Ga0068867_100468326
1183 Ga0070685_10005488
1184 Ga0070679_100014552
1185 Ga0070684_100022943
1186 Ga0070684_100833454
1187 Ga0068853_100004621
1188 Ga0068853_100052273
1189 Ga0068853_100065389
1190 Ga0068853_100211933
1191 Ga0068853_100409270
1192 Ga0068853_100724119
1193 Ga0070672_100101886
1194 Ga0070672_100457001
1195 Ga0070693_100028255
1196 Ga0070693_100064846
1197 Ga0070665_100000595
1198 Ga0070665_100121491
1199 Ga0070665_100123066
1200 Ga0070665_100224624
1201 Ga0070704_100417679
1202 Ga0068855_100020960
1203 Ga0068855_100290088
1204 Ga0070664_100003065
1205 Ga0070664_100003911
1206 Ga0070664_100036401
1207 Ga0070664_100045037
1208 Ga0070664_100046767
1209 Ga0070664_100124501
1210 Ga0070664_100330431
1211 Ga0068857_100052473
1212 Ga0068857_100228405
1213 Ga0068857_100900642
1214 Ga0068854_100057524
1215 Ga0068854_100178465
1216 Ga0068854_100346939
1217 Ga0070702_100227063
1218 Ga0068852_100038782
1219 Ga0068852_100045464
1220 Ga0068852_100082650
1221 Ga0068859_100000045
1222 Ga0068859_100086353
1223 Ga0068859_100107186
1224 Ga0068859_100198675
1225 Ga0068859_100491051
1226 Ga0068864_100046141
1227 Ga0068864_100056094
1228 Ga0068864_100064644
1229 Ga0068864_100233016
1230 Ga0068864_100531215
1231 Ga0068866_10024317
1232 Ga0068866_10298216
1233 Ga0068861_100033570
1234 Ga0068851_10023513
1235 Ga0068863_100002071
1236 Ga0068863_100013056
1237 Ga0068863_100162903
1238 Ga0068858_100002469
1239 Ga0068858_100054897
1240 Ga0068860_100004776
1241 Ga0068860_100058267
1242 Ga0068860_100268699
1243 Ga0068860_100422375
1244 Ga0068862_100216931
1245 Ga0075364_10067598
1246 Ga0075364_10079981
1247 Ga0075364_10163379
1248 Ga0075432_10014587
1249 Ga0070715_10024227
1250 Ga0075366_10132706
1251 Ga0097621_100003567
1252 Ga0097621_100022063
1253 Ga0097621_100126339
1254 Ga0097621_100212845
1255 Ga0097621_100464888
1256 Ga0097621_100698364
1257 Ga0068871_100047223
1258 Ga0068871_100157398
1259 Ga0068871_100553513
1260 Ga0075428_100097302
1261 Ga0075431_100005705
1262 Ga0075429_100015656
1263 Ga0068865_100131123
1264 Ga0068865_100610952
1265 Ga0097620_100000045
1266 Ga0097620_100086354
1267 Ga0097620_100107183
1268 Ga0097620_100198669
1269 Ga0097620_100483806
1270 Ga0097620_100491040
1271 Ga0079104_1000535
1272 Ga0079104_1000611
1273 Ga0079104_1000775
1274 Ga0079104_1001375
1275 Ga0079104_1001480
1276 Ga0079104_1002577
1277 Ga0079104_1002634
1278 Ga0079104_1006112
1279 Ga0079104_1013219
1280 Ga0105251_10000752
1281 Ga0105251_10001038
1282 Ga0105251_10002124
1283 Ga0105251_10002144
1284 Ga0105251_10010747
1285 Ga0105251_10013713
1286 Ga0105251_10024581
1287 Ga0105251_10024734
1288 Ga0105251_10053907
1289 Ga0105251_10064353
1290 Ga0105251_10088665
1291 Ga0105251_10098236
1292 Ga0105244_10000104
1293 Ga0105244_10000222
1294 Ga0105244_10000330
1295 Ga0105244_10000354
1296 Ga0105244_10000586
1297 Ga0105244_10000865
1298 Ga0105244_10001499
1299 Ga0105244_10003307
1300 Ga0105244_10010356
1301 Ga0105244_10020096
1302 Ga0105244_10024280
1303 Ga0105244_10052901
1304 Ga0105244_10101605
1305 Ga0105244_10110086
1306 Ga0105244_10221170
1307 Ga0105250_10000001
1308 Ga0105250_10000195
1309 Ga0105250_10000253
1310 Ga0105250_10000448
1311 Ga0105250_10003065
1312 Ga0105250_10010162
1313 Ga0105250_10020296
1314 Ga0105240_10000859
1315 Ga0105240_10016428
1316 Ga0111539_10171523
1317 Ga0105247_10000138
1318 Ga0114129_10025420
1319 Ga0105243_10066237
1320 Ga0105243_10173822
1321 Ga0105241_10000002
1322 Ga0105241_10000591
1323 Ga0105241_10027307
1324 Ga0105241_10155556
1325 Ga0105241_10237075
1326 Ga0105241_10243849
1327 Ga0105242_10064347
1328 Ga0105242_10152313
1329 Ga0105248_10316285
1330 Ga0105248_10686998
1331 Ga0105237_10002015
1332 Ga0105237_10137985
1333 Ga0105237_10355448
1334 Ga0105238_10507117
1335 Ga0105249_10000870
1336 Ga0105249_10257618
1337 Ga0105249_10684109
1338 Ga0105239_10347780
1339 Ga0105239_10607058
1340 Ga0105246_10037568
1341 Ga0105246_10076809
1342 Ga0105246_10212563
1343 Ga0105246_10254171
1344 Ga0105246_10810141
1345 Ga0157373_10000500
1346 Ga0157373_10000783
1347 Ga0157373_10005917
1348 Ga0157373_10188835
1349 Ga0157371_10000099
1350 Ga0157371_10001578
1351 Ga0157371_10002572
1352 Ga0157371_10016739
1353 Ga0157371_10020580
1354 Ga0157371_10025659
1355 Ga0157371_10026882
1356 Ga0157371_10074128
1357 Ga0157371_10075013
1358 Ga0157371_10085380
1359 Ga0157370_10000234
1360 Ga0157370_10004098
1361 Ga0157370_10006551
1362 Ga0157370_10015259
1363 Ga0157370_10059676
1364 Ga0157370_10202539
1365 Ga0157370_10214236
1366 Ga0157370_10267333
1367 Ga0157370_10391271
1368 Ga0157369_10030301
1369 Ga0157369_10032764
1370 Ga0157369_10062171
1371 Ga0157369_10171903
1372 Ga0157369_10298718
1373 Ga0157374_10000607
1374 Ga0157374_10003134
1375 Ga0157374_10021708
1376 Ga0157374_10079115
1377 Ga0157374_10317926
1378 Ga0157374_10437749
1379 Ga0157378_10006056
1380 Ga0157378_10006383
1381 Ga0157378_10037001
1382 Ga0157378_10044926
1383 Ga0157378_10350813
1384 Ga0163162_10002494
1385 Ga0163162_10021357
1386 Ga0163162_10035335
1387 Ga0163162_10061435
1388 Ga0163162_10132924
1389 Ga0163162_10195546
1390 Ga0157372_10007775
1391 Ga0157372_10014588
1392 Ga0157372_10023900
1393 Ga0157372_10083160
1394 Ga0157372_10108661
1395 Ga0157372_10144319
1396 Ga0157372_10150426
1397 Ga0157372_10282713
1398 Ga0157372_10284671
1399 Ga0157372_10372592
1400 Ga0157372_10572863
1401 Ga0157372_10803964
1402 Ga0157372_10975451
1403 Ga0157372_11373910
1404 Ga0157372_11374089
1405 Ga0157375_10010451
1406 Ga0157375_10016076
1407 Ga0157375_10022934
1408 Ga0157375_10036441
1409 Ga0157375_10188032
1410 Ga0157375_10194138
1411 Ga0163163_10000078
1412 Ga0163163_10000266
1413 Ga0163163_10016683
1414 Ga0163163_10057979
1415 Ga0163163_10155883
1416 Ga0163163_10233170
1417 Ga0157380_10000704
1418 Ga0157380_10013755
1419 Ga0157380_10165053
1420 Ga0157380_10470941
1421 Ga0157377_10023420
1422 Ga0157377_10073178
1423 Ga0157379_10397977
1424 Ga0157376_10057433
1425 Ga0157376_10090091
1426 Ga0157376_10117263
1427 Ga0157376_10328331
1428 Ga0157376_10421650
1429 Ga0182006_1000047
1430 Ga0182006_1008119
1431 Ga0182007_10004870
1432 Ga0183366_1001
1433 Ga0183370_1001
1434 Ga0183369_1001
1435 Ga0183368_1001
1436 Ga0163161_10114482
1437 Ga0163161_10137372
1438 Ga0163161_10211080
1439 Ga0206351_10347196
1440 Ga0213876_10000055
1441 Ga0224712_10176051
1442 Ga0209760_100104
1443 Ga0209784_100001
1444 Ga0209566_100001
1445 Ga0209674_100002
1446 Ga0209563_100008
1447 Ga0207427_100135
1448 Ga0209437_100007
1449 Ga0209437_100109
1450 Ga0209437_100111
1451 Ga0209677_100004
1452 Ga0209129_1000004
1453 Ga0209257_1000006
1454 Ga0207656_10001167
1455 Ga0207656_10145007
1456 Ga0207696_1000001
1457 Ga0207696_1000028
1458 Ga0207696_1000086
1459 Ga0207696_1000116
1460 Ga0207696_1000174
1461 Ga0207696_1000235
1462 Ga0207696_1000439
1463 Ga0207696_1001155
1464 Ga0207696_1004856
1465 Ga0207696_1039799
1466 Ga0207655_1000001
1467 Ga0207655_1000004
1468 Ga0207655_1000009
1469 Ga0207655_1000037
1470 Ga0207655_1000089
1471 Ga0207655_1000426
1472 Ga0207655_1000647
1473 Ga0207655_1000741
1474 Ga0207655_1002099
1475 Ga0207655_1003187
1476 Ga0207655_1005530
1477 Ga0207655_1041906
1478 Ga0207655_1061571
1479 Ga0207713_1000001
1480 Ga0207713_1000002
1481 Ga0207713_1000003
1482 Ga0207713_1000012
1483 Ga0207713_1001881
1484 Ga0207713_1001893
1485 Ga0207713_1010034
1486 Ga0207713_1012581
1487 Ga0207713_1020048
1488 Ga0207713_1021384
1489 Ga0207713_1022401
1490 Ga0207713_1025865
1491 Ga0207713_1043857
1492 Ga0207713_1051983
1493 Ga0207713_1062442
1494 Ga0207713_1062803
1495 Ga0207713_1073257
1496 Ga0207713_1114844
1497 Ga0207682_10013296
1498 Ga0207642_10110967
1499 Ga0207710_10000052
1500 Ga0207710_10039366
1501 Ga0207688_10019542
1502 Ga0207688_10087378
1503 Ga0207680_10000627
1504 Ga0207680_10413530
1505 Ga0207647_10000951
1506 Ga0207685_10248628
1507 Ga0207645_10000263
1508 Ga0207645_10211058
1509 Ga0207643_10009659
1510 Ga0207643_10115001
1511 Ga0207705_10215007
1512 Ga0207705_10559955
1513 Ga0207654_10000005
1514 Ga0207654_10002808
1515 Ga0207654_10165487
1516 Ga0207654_10263986
1517 Ga0207654_10373532
1518 Ga0207707_10001133
1519 Ga0207695_10000697
1520 Ga0207695_10149398
1521 Ga0207671_10001627
1522 Ga0207657_10057255
1523 Ga0207657_10186973
1524 Ga0207681_10298752
1525 Ga0207694_10360978
1526 Ga0207650_10010602
1527 Ga0207650_10012259
1528 Ga0207650_10095777
1529 Ga0207659_10081239
1530 Ga0207644_10146786
1531 Ga0207644_10510666
1532 Ga0207690_10007814
1533 Ga0207690_10041973
1534 Ga0207690_10110114
1535 Ga0207706_10028711
1536 Ga0207706_10036759
1537 Ga0207706_10061454
1538 Ga0207706_10175285
1539 Ga0207686_10183326
1540 Ga0207709_10117671
1541 Ga0207709_10172431
1542 Ga0207670_10242954
1543 Ga0207670_10266294
1544 Ga0207669_10208796
1545 Ga0207704_10412162
1546 Ga0207691_10124593
1547 Ga0207691_10146860
1548 Ga0207691_10490483
1549 Ga0207711_10433756
1550 Ga0207689_10000740
1551 Ga0207689_10001881
1552 Ga0207689_10004215
1553 Ga0207689_10004731
1554 Ga0207689_10008743
1555 Ga0207689_10156765
1556 Ga0207661_10002099
1557 Ga0207661_10076603
1558 Ga0207661_10116912
1559 Ga0207661_10197014
1560 Ga0207661_10707570
1561 Ga0207679_10004222
1562 Ga0207679_10006055
1563 Ga0207679_10056047
1564 Ga0207679_10121017
1565 Ga0207679_10346529
1566 Ga0207667_10074165
1567 Ga0207667_10130253
1568 Ga0207667_10140052
1569 Ga0207667_10189282
1570 Ga0207651_10148948
1571 Ga0207651_10231980
1572 Ga0207712_10004692
1573 Ga0207712_10305212
1574 Ga0207668_10005192
1575 Ga0207668_10116960
1576 Ga0207640_10129225
1577 Ga0207658_10069120
1578 Ga0207658_10466273
1579 Ga0207677_10042463
1580 Ga0207677_10084549
1581 Ga0207677_10376986
1582 Ga0207703_10003137
1583 Ga0207703_10242993
1584 Ga0207703_10379941
1585 Ga0207639_10013711
1586 Ga0207641_10000146
1587 Ga0207641_10004565
1588 Ga0207641_10023870
1589 Ga0207641_10132465
1590 Ga0207641_10538102
1591 Ga0207648_10007679
1592 Ga0207648_10026554
1593 Ga0207648_10349172
1594 Ga0207676_10053281
1595 Ga0207676_10081556
1596 Ga0207676_10105893
1597 Ga0207676_10287519
1598 Ga0207676_10520557
1599 Ga0207676_10750257
1600 Ga0207674_10003943
1601 Ga0207674_10076295
1602 Ga0207674_10348043
1603 Ga0207675_100033135
1604 Ga0207675_100209283
1605 Ga0207675_100212710
1606 Ga0207683_10001367
1607 Ga0207683_10039890
1608 Ga0207683_10271032
1609 Ga0207698_10016396
1610 Ga0207698_10098006
1611 Ga0207698_10290463
1612 Ga0207698_10346190
1613 Ga0207698_10444367
1614 Ga0209281_1000001
1615 Ga0209281_1000003
1616 Ga0209281_1000130
1617 Ga0209281_1000394
1618 Ga0209281_1000428
1619 Ga0209281_1000598
1620 Ga0209281_1000713
1621 Ga0209281_1001045
1622 Ga0209281_1001234
1623 Ga0209281_1002684
1624 Ga0209281_1002778
1625 Ga0209371_1000001
1626 Ga0209371_1000002
1627 Ga0209371_1000041
1628 Ga0209371_1000122
1629 Ga0209371_1000188
1630 Ga0209371_1000492
1631 Ga0209371_1000862
1632 Ga0209371_1001378
1633 Ga0209371_1001914
1634 Ga0209371_1002701
1635 Ga0209371_1003845
1636 Ga0209371_1004166
1637 Ga0209371_1017918
1638 Ga0209371_1022638
1639 Ga0209995_1011204
1640 Ga0268266_10001643
1641 Ga0268266_10091894
1642 Ga0268266_10490007
1643 Ga0268265_10318611
1644 Ga0268264_10004639
1645 Ga0268264_10244334
1646 Ga0268264_10362372
1647 Ga0265323_10000155
1648 Ga0307515_10000024
1649 Ga0265338_10000829
1650 Ga0265338_10022306
1651 Ga0268256_1000001
1652 Ga0268256_1000002
1653 Ga0268256_1000003
1654 Ga0268256_1000048
1655 Ga0268256_1000051
1656 Ga0268256_1000718
1657 Ga0268256_1000844
1658 Ga0268256_1001182
1659 Ga0268256_1001381
1660 Ga0268256_1003561
1661 Ga0268256_1003845
1662 Ga0268256_1004889
1663 Ga0268256_1020005
1664 Ga0268256_1025573
1665 Ga0265340_10006768
1666 Ga0265327_10002353
1667 Ga0307509_10069970
1668 Ga0307408_100021623
1669 Ga0307408_100199309
1670 Ga0265342_10043736
1671 Ga0316576_10301370
1672 Ga0316578_10073968
1673 Ga0316578_10166887
1674 Ga0307516_10183073
1675 Ga0316577_10093444
1676 Ga0307413_10162424
1677 Ga0307413_10403361
1678 Ga0307410_10133007
1679 Ga0307412_10082115
1680 Ga0307412_10673094
1681 Ga0307416_100046890
1682 Ga0307414_10000349
1683 Ga0307414_10354929
1684 Ga0307411_10076805
1685 Ga0307411_10211510
1686 Ga0307415_100058197
1687 Ga0373953_0046563
1688 Ga0373957_0078731
1689 Ga0373955_0133452
1690 Ga0373937_0211631
1691 Ga0316584_0373164
1692 Ga0395900_0032101
1693 Ga0395900_0204509
1694 Ga0395900_0231681
1695 Ga0395905_0000001
1696 Ga0395905_0001509
1697 Ga0395905_0321487
1698 Ga0395905_0326249
1699 Ga0395901_0073626
1700 Ga0395901_0354010
1701 Ga0436365_0971002
1702 Ga0439436_0001403
1703 Ga0439438_000001
1704 Ga0439438_000780
1705 Ga0439438_025837
1706 Ga0439439_0036952
1707 Ga0439447_001075
1708 Ga0439466_0000047
1709 Ga0451793_0325768
1710 Ga0451795_0027072
1711 Ga0451798_0517438
1712 Ga0451798_0974364
1713 Ga0451807_2513161
1714 Ga0439432_010616
1715 Ga0439432_011524
1716 Ga0439432_013991
1717 Ga0439449_0001549
1718 Ga0439449_0061628
1719 Ga0439452_000001
1720 Ga0439452_000002
1721 Ga0439452_000008
1722 Ga0439452_000142
1723 Ga0439452_000298
1724 Ga0439457_004175
1725 Ga0439457_013437
1726 Ga0439463_006887
1727 Ga0450907_000190
1728 Ga0439464_0011759
1729 Ga0451577_0083417
1730 Ga0466972_0000028
1731 Ga0466972_0125101
1732 Ga0466981_0000002
1733 Ga0453683_0079495
1734 Ga0453683_0152767
1735 Ga0466966_0341366
1736 Ga0453684_0023018
1737 Ga0453684_0086272
1738 Ga0453684_0092605
1739 Ga0453684_0104488
1740 Ga0453684_0865566
1741 Ga0451576_1038951
1742 Ga0495617_040590
1743 Ga0495627_000116
1744 Ga0495592_0276160
1745 Ga0495591_000013
1746 Ga0495591_000100
1747 Ga0495591_035053
1748 Ga0495638_0013681
1749 Ga0495650_0000005
1750 Ga0495650_0000090
1751 Ga0495650_0000187
1752 Ga0495584_0011311
1753 Ga0495585_0011587
1754 Ga0495606_0003762
1755 Ga0495618_0103054
1756 Ga0495630_0008093
1757 Ga0495630_0216452
1758 Ga0495632_0176716
1759 Ga0495637_0123931
1760 Ga0495643_0034513
1761 Ga0495644_0000573
1762 Ga0495648_0002343
1763 Ga0495648_0009258
1764 Ga0495654_0000041
1765 Ga0495654_0000173
1766 Ga0495654_0001003
1767 Ga0495654_0052850
1768 Ga0495597_0001631
1769 Ga0495633_0131575
1770 Ga0495667_0005807
1771 Ga0495625_0016408
1772 Ga0495588_0003244
1773 Ga0495613_0014269
1774 Ga0495671_0009709
1775 Ga0495649_0001886
1776 Ga0495649_0009622
1777 Ga0495589_0000004
1778 Ga0495589_0005519
1779 Ga0495660_0000028
1780 Ga0495660_0000171
1781 Ga0495660_0053644
1782 Ga0495604_0368024
1783 Ga0495672_0000002
1784 Ga0495672_0000020
1785 Ga0495672_0000043
1786 Ga0495672_0015649
1787 Ga0495679_000282
1788 Ga0495679_029528
1789 Ga0495679_049639
1790 Ga0495673_0000070
1791 Ga0495673_0000167
1792 Ga0495681_0021707
1793 Ga0495681_0092896
1794 Ga0496100_0004919
1795 Ga0496101_0000163
1796 Ga0496101_0254290
1797 Ga0496102_0049801
1798 Ga0496103_0068478
1799 Ga0496104_0000555
1800 Ga0496104_0048174
1801 Ga0496104_0579797
1802 Ga0496105_0031796
1803 Ga0496108_0705674
1804 Ga0496110_0152210
1805 Ga0496110_0165676
1806 Ga0496110_0256833
1807 Ga0496111_0114285
1808 Ga0496115_0010820
1809 Ga0496115_0257228
1810 Ga0496116_0000001
1811 Ga0496116_0000122
1812 Ga0496116_0000277
1813 Ga0496116_0001125
1814 Ga0496116_0008548
1815 Ga0496116_0012630
1816 Ga0496116_0015585
1817 Ga0496116_0100569
1818 Ga0496116_0106631
1819 Ga0496117_0000004
1820 Ga0496117_0000165
1821 Ga0496117_0000399
1822 Ga0496117_0002525
1823 Ga0496117_0003424
1824 Ga0496117_0004066
1825 Ga0496117_0008180
1826 Ga0496117_0020640
1827 Ga0496117_0034148
1828 Ga0496117_0034335
1829 Ga0496117_0060036
1830 Ga0496117_0068843
1831 Ga0496117_0070832
1832 Ga0496117_0073597
1833 Ga0496118_0000007
1834 Ga0496118_0000015
1835 Ga0496118_0001126
1836 Ga0496118_0002525
1837 Ga0496118_0002850
1838 Ga0496118_0005269
1839 Ga0496118_0012799
1840 Ga0496118_0021142
1841 Ga0496118_0026635
1842 Ga0496118_0027827
1843 Ga0496118_0036738
1844 Ga0496118_0176208
1845 Ga0496119_0000066
1846 Ga0496119_0000095
1847 Ga0496119_0000911
1848 Ga0496119_0001499
1849 Ga0496119_0001967
1850 Ga0496119_0002594
1851 Ga0496119_0004815
1852 Ga0496119_0012013
1853 Ga0496119_0019406
1854 Ga0496119_0024425
1855 Ga0496119_0027666
1856 Ga0496119_0031972
1857 Ga0496119_0037015
1858 Ga0496119_0039110
1859 Ga0496120_0000076
1860 Ga0496120_0000380
1861 Ga0496120_0000928
1862 Ga0496120_0001267
1863 Ga0496120_0002342
1864 Ga0496120_0003408
1865 Ga0496120_0003965
1866 Ga0496120_0011139
1867 Ga0496120_0015425
1868 Ga0496120_0025816
1869 Ga0496120_0044450
1870 Ga0496120_0050891
1871 Ga0496121_0002250
1872 Ga0496121_0003016
1873 Ga0496121_0025828
1874 Ga0496121_0025872
1875 Ga0496121_0042151
1876 Ga0496121_0187043
1877 Ga0496121_0247971
1878 Ga0496122_0000005
1879 Ga0496122_0000058
1880 Ga0496122_0000738
1881 Ga0496122_0004902
1882 Ga0496122_0014702
1883 Ga0496122_0021615
1884 Ga0496122_0022320
1885 Ga0496122_0025084
1886 Ga0496122_0050089
1887 Ga0496122_0059356
1888 Ga0496122_0061607
1889 Ga0496122_0082194
1890 Ga0496122_0104116
1891 Ga0496123_0000008
1892 Ga0496123_0000044
1893 Ga0496123_0001322
1894 Ga0496123_0002433
1895 Ga0496123_0006525
1896 Ga0496123_0011748
1897 Ga0496123_0020012
1898 Ga0496123_0022150
1899 Ga0496123_0022151
1900 Ga0496123_0044729
1901 Ga0496123_0081598
1902 Ga0496124_0000105
1903 Ga0496124_0000107
1904 Ga0496124_0000196
1905 Ga0496124_0000564
1906 Ga0496124_0001459
1907 Ga0496124_0012635
1908 Ga0496124_0023875
1909 Ga0496124_0037841
1910 Ga0496124_0075693
1911 Ga0496124_0133342
1912 Ga0496124_0139172
1913 Ga0496124_0141534
1914 Ga0496124_0248184
1915 Ga0496124_0309144
1916 Ga0496125_0000009
1917 Ga0496125_0000103
1918 Ga0496125_0001712
1919 Ga0496125_0005660
1920 Ga0496125_0007075
1921 Ga0496125_0017105
1922 Ga0496125_0024785
1923 Ga0496125_0040085
1924 Ga0496125_0081332
1925 Ga0496126_0000399
1926 Ga0496126_0000779
1927 Ga0496126_0002347
1928 Ga0496126_0020256
1929 Ga0496126_0064326
1930 Ga0496126_0092871
1931 Ga0496126_0093341
1932 Ga0496126_0117465
1933 Ga0496126_0118871
1934 Ga0496126_0177426
1935 Ga0496126_0263834
1936 Ga0496126_0270448
1937 Ga0501308_010410
1938 Ga0501305_001184
1939 Ga0495678_000591
1940 Ga0495678_014148
1941 Ga0495682_0000001
1942 Ga0501315_012408
1943 Ga0501323_000094
1944 Ga0501031_0003536
1945 Ga0501031_0019137
1946 Ga0501032_0007698
1947 Ga0501032_0192352
1948 Ga0501033_0000199
1949 Ga0501034_0000506
1950 Ga0501034_0066200
1951 Ga0501034_0376554
1952 Ga0501036_0017191
1953 Ga0501036_0087559
1954 Ga0501037_0012707
1955 Ga0501037_0023483
1956 Ga0501038_0004083
1957 Ga0501038_0072829
1958 Ga0501039_0002895
1959 Ga0501039_0108703
1960 Ga0501043_0008259
1961 Ga0501043_0023673
1962 Ga0501043_0249241
1963 Ga0501046_0020279
1964 Ga0501047_0072084
1965 Ga0501047_0171986
1966 Ga0501069_0063534
1967 Ga0501072_0308475
1968 Ga0501199_002418
1969 Ga0501207_020946
1970 Ga0501238_004979
1971 Ga0501257_011545
1972 Ga0501264_000987
1973 Ga0501035_0001435
1974 Ga0501035_0079391
1975 Ga0501044_0005001
1976 Ga0501044_0032991
1977 Ga0501044_0040028
1978 Ga0501044_0235991
1979 Ga0501045_0000745
1980 Ga0501226_008295
1981 nmdc:mga00v17_159762_c1
1982 nmdc:mga00v17_177317_c1
1983 nmdc:mga0k408_1666_c3
1984 nmdc:mga05p37_106817_c1
1985 nmdc:mga05p37_202163_c1
1986 nmdc:mga09592_61110_c1
1987 nmdc:mga06r32_13230_c1
1988 Ga0495601_0094389
1989 Ga0500578_0000919
1990 Ga0500621_000003
1991 Ga0500642_0081867
1992 Ga0500568_0031940
1993 Ga0500588_0005614
1994 Ga0500616_0037732
1995 Ga0500616_0046016
1996 Ga0500622_0002124
1997 Ga0500636_0110383
1998 2506578190
1999 2506583328
2000 2508852207
2001 2511378921
2002 2511437154
2003 2538425773
2004 2547695172
2005 2548648354
2006 2555257426
2007 2562462966
2008 2585825447
2009 2585832071
2010 2599408927
2011 2599925465
2012 2601522556
2013 2601527583
2014 2601535280
2015 2601540843
2016 2601614414
2017 2601619134
2018 2601642246
2019 2601647108
2020 2601652561
2021 2601657887
2022 2601662069
2023 2601695027
2024 2601699699
2025 2601706406
2026 2601710712
2027 2601715726
2028 2601720050
2029 2601726132
2030 2601730673
2031 2601735689
2032 2601740957
2033 2601750887
2034 2601758462
2035 2601764572
2036 2602018141
2037 2603638185
2038 2603642693
2039 2603659431
2040 2603664706
2041 2603698263
2042 2603703283
2043 2603838065
2044 2603843143
2045 2603848216
2046 2603853291
2047 2603867235
2048 2603871342
2049 2603876273
2050 2606048535
2051 2606069133
2052 2606144955
2053 2606175936
2054 2608669280
2055 2609913477
2056 2637224798
2057 2650898800
2058 2656275236
2059 2671103220
2060 2671109826
2061 2671588313
2062 2676406067
2063 2681997633
2064 2682006845
2065 2686353184
2066 2689444740
2067 2712469818
2068 2738729116
2069 2753855711
2070 2765588704
2071 2772438794
2072 2775538711
2073 2777022177
2074 2791922472
2075 2792314818
2076 2793405753
2077 2807179446
2078 2809123765
2079 2813729161
2080 2814696727
2081 2819587191
2082 2821119517
2083 2823374493
2084 2833641385
2085 2844427263
2086 2844530817
2087 2846544407
2088 2847087812
2089 2847800037
2090 2852107781
2091 2855195969
2092 2858468945
2093 2865015106
2094 2869554140
2095 2871272756
2096 2871286326
2097 2876604395
2098 2881248947
2099 2881610077
2100 2884089084
2101 2888368815
2102 2888378483
2103 2891672933
2104 2900052697
2105 2904478177
2106 2904504985
2107 2904514314
2108 2908670036
2109 2911140585
2110 2919108622
2111 2919155305
2112 2923634584
2113 2927147983
2114 2927834367
2115 2932408198
2116 2935626900
2117 2937540290
2118 2937967408
2119 2939568908
2120 2939573836
2121 2939578655
2122 2939603466
2123 2939607716
2124 2939619357
2125 2939644045
2126 2945877464
2127 2945953151
2128 2969081778
2129 2971823190
2130 2974312377
2131 2974438234
2132 2978975674
2133 2984496469
2134 2984564203
2135 2984596938
2136 2990261890
2137 3000378722
2138 640937717
2139 8004595702
2140 8015396362
2141 8016736079
2142 8018222313
2143 8018408406
2144 8019502824
2145 8019506241
2146 8054845640
2147 8054853018
2148 8055091037
2149 8055094458
2150 8055099871
2151 8057309464

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

198

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9525 1 230
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9459 1 243
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9291 1 230
2d3w-assembly1.cif.gz_C crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery 0.9275 1 243
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9275 1 243
ID Description Score Start End Superfamily
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9549 2 247 3.40.50.300
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9362 2 247 3.40.50.300
af_Q8ILW0_99_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9274 1 243 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8901 1 244 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8796 1 244 3.40.50.300
ID Description Score Start End GO Terms
AF-Q2IA12-F1-model_v4 Chloroplast Ycf16-like transporter 0.9622 2 147 GO:0005524
GO:0016887
AF-A0A2D9VEB8-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9589 1 155 GO:0005524
GO:0016887
AF-A0A351MIF7-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9488 2 248 GO:0005524
GO:0016887
AF-A0A2D9VEB8-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9471 1 155 GO:0005524
GO:0016887
AF-J6IIC2-F1-model_v4 FeS assembly ATPase SufC 0.9442 2 246 GO:0005524
GO:0016887

Map