F489558

General Info

Members Datasets Scaffolds Average Seq Length
1075 831 2148 375

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10030240|Ga0105241_100302405
Length 393
Sequence MMRAEDERRFRQDGADSHDIGGRLMAARQRMGVGIIGAGNISSQYLKAMRDFPVLDIRGIADMRPEVAAKKATEFGVKSATVEALLADPSVDIIVNLTIPRAHVEVGLKAIAAGKHIYGEKPLGVSFADGKKLIAAASKKGVRVGSAPDTFLGGGHQTARAVIDSGKLGRIIGGSVWFGVPGHEYWHPDPAFYYDIGGGPVLDMGPYYITDLVNLLGPVKAVQAMSVTPHKSRPVRSEPKKGQMMPVRVFTHVTGTLQFVSGALVQLSLSFDVPKHTHGPIEIYGTDAAMQVPDPNWFGGEVKIARPRADHWDDVPVKIPYADANYRSLGVADMAYAIINNRPHRASGELALHVLEVMEAFEVASKSGEIVKIKTKAERPAPMTESLKRGKIS

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
58 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
69 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
70 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
71 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
72 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
73 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
74 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
145 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
156 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
157 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
221 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
225 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
229 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
236 2509276019 Ensifer aridi TW10 Isolate Nodule
237 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
238 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
239 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
240 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
241 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
242 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
243 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
244 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
245 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
246 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
247 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
248 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
249 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
250 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
251 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
252 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
253 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
254 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
255 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
256 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
257 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
258 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
259 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
260 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
261 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
262 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
263 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
264 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
265 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
266 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
267 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
268 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
269 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
270 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
271 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
272 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
273 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
274 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
275 2516143018 Ensifer sp. BR816 Isolate Nodule
276 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
277 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
278 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
279 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
280 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
281 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
282 2519899620 Rhizobium sp. Pop5 Isolate Nodule
283 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
284 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
285 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
286 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
287 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
288 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
289 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
290 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
291 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
292 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
293 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
294 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
295 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
296 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
297 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
298 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
299 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
300 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
301 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
302 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
303 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
304 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
305 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
306 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
307 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
308 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
309 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
310 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
311 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
312 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
313 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
314 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
315 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
316 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
317 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
318 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
319 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
320 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
321 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
322 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
323 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
324 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
325 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
326 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
327 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
328 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
329 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
330 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
331 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
332 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
333 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
334 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
335 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
336 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
337 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
338 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
339 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
340 2643221557 Ensifer sp. Root558 Isolate Unclassified
341 2643221558 Rhizobium sp. Root149 Isolate Unclassified
342 2643221568 Rhizobium sp. Root564 Isolate Unclassified
343 2643221580 Devosia sp. Root635 Isolate Unclassified
344 2643221582 Rhizobium sp. Root651 Isolate Unclassified
345 2643221591 Devosia sp. Root685 Isolate Unclassified
346 2643221599 Rhizobium sp. Root708 Isolate Unclassified
347 2643221607 Rhizobium sp. Root73 Isolate Unclassified
348 2643221610 Ensifer sp. Root74 Isolate Unclassified
349 2643221618 Ensifer sp. Root231 Isolate Unclassified
350 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
351 2643221626 Ensifer sp. Root31 Isolate Unclassified
352 2643221629 Devosia sp. Root105 Isolate Unclassified
353 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
354 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
355 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
356 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
357 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
358 2643221655 Ensifer sp. Root1252 Isolate Unclassified
359 2643221659 Ensifer sp. Root127 Isolate Unclassified
360 2643221662 Devosia sp. Root413D1 Isolate Unclassified
361 2643221668 Ensifer sp. Root423 Isolate Unclassified
362 2643221674 Devosia sp. Root436 Isolate Unclassified
363 2643221675 Ensifer sp. Root1298 Isolate Unclassified
364 2643221680 Ensifer sp. Root1312 Isolate Unclassified
365 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
366 2643221688 Rhizobium sp. Root482 Isolate Unclassified
367 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
368 2643221693 Rhizobium sp. Root491 Isolate Unclassified
369 2643221698 Ensifer sp. Root142 Isolate Unclassified
370 2643221712 Ensifer sp. Root258 Isolate Unclassified
371 2643221718 Rhizobium sp. Root268 Isolate Unclassified
372 2643221719 Rhizobium sp. Root274 Isolate Unclassified
373 2643221723 Ensifer sp. Root278 Isolate Unclassified
374 2643221726 Ensifer sp. Root954 Isolate Unclassified
375 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
376 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
377 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
378 2718217882 Rhizobium sp. N741 Isolate Nodule
379 2718217927 Rhizobium sp. N324 Isolate Nodule
380 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
381 2718218009 Rhizobium sp. N561 Isolate Nodule
382 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
383 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
384 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
385 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
386 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
387 2718218363 Rhizobium sp. N113 Isolate Nodule
388 2718218365 Rhizobium sp. N731 Isolate Nodule
389 2718218366 Rhizobium sp. N621 Isolate Nodule
390 2718218423 Rhizobium sp. N941 Isolate Nodule
391 2721755514 Rhizobium sp. N6212 Isolate Nodule
392 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
393 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
394 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
395 2721755809 Rhizobium sp. N541 Isolate Nodule
396 2721755810 Rhizobium sp. N871 Isolate Nodule
397 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
398 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
399 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
400 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
401 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
402 2728369365 Rhizobium sp. N1341 Isolate Nodule
403 2728369397 Rhizobium sp. N1314 Isolate Nodule
404 2738541293 Rhizobium sp. GV031 Isolate Unclassified
405 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
406 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
407 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
408 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
409 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
410 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
411 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
412 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
413 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
414 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
415 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
416 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
417 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
418 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
419 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
420 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
421 2791355256 Rhizobium sp. M10 Isolate Nodule
422 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
423 2791355260 Rhizobium sp. L9 Isolate Nodule
424 2791355261 Rhizobium sp. J15 Isolate Nodule
425 2791355262 Rhizobium sp. M1 Isolate Nodule
426 2791355263 Rhizobium chutanense C5 Isolate Nodule
427 2791355264 Rhizobium sp. S9 Isolate Nodule
428 2791355265 Rhizobium sp. H4 Isolate Nodule
429 2791355266 Rhizobium sp. L43 Isolate Nodule
430 2791355267 Rhizobium sp. L18 Isolate Nodule
431 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
432 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
433 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
434 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
435 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
436 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
437 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
438 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
439 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
440 2802429633 Rhizobium anhuiense J3 Isolate Nodule
441 2802429634 Rhizobium anhuiense S10 Isolate Nodule
442 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
443 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
444 2802429637 Rhizobium anhuiense C15 Isolate Nodule
445 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
446 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
447 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
448 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
449 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
450 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
451 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
452 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
453 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
454 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
455 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
456 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
457 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
458 2838048938 Rhizobium pisi 27/80 Isolate Nodule
459 2838061910 Rhizobium phaseoli L15 Isolate Nodule
460 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
461 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
462 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
463 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
464 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
465 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
466 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
467 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
468 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
469 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
470 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
471 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
472 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
473 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
474 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
475 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
476 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
477 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
478 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
479 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
480 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
481 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
482 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
483 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
484 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
485 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
486 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
487 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
488 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
489 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
490 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
491 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
492 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
493 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
494 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
495 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
496 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
497 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
498 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
499 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
500 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
501 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
502 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
503 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
504 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
505 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
506 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
507 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
508 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
509 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
510 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
511 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
512 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
513 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
514 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
515 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
516 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
517 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
518 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
519 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
520 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
521 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
522 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
523 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
524 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
525 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
526 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
527 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
528 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
529 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
530 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
531 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
532 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
533 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
534 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
535 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
536 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
537 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
538 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
539 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
540 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
541 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
542 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
543 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
544 2844163670 Ensifer sp. 1H6 Isolate Unclassified
545 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
546 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
547 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
548 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
549 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
550 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
551 2854911287 Brucella lupini LUP21 Isolate Unclassified
552 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
553 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
554 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
555 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
556 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
557 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
558 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
559 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
560 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
561 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
562 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
563 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
564 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
565 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
566 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
567 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
568 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
569 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
570 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
571 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
572 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
573 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
574 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
575 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
576 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
577 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
578 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
579 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
580 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
581 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
582 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
583 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
584 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
585 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
586 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
587 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
588 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
589 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
590 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
591 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
592 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
593 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
594 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
595 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
596 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
597 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
598 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
599 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
600 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
601 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
602 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
603 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
604 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
605 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
606 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
607 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
608 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
609 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
610 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
611 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
612 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
613 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
614 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
615 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
616 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
617 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
618 2932401849 Devosia sp. 2618 Isolate Rhizosphere
619 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
620 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
621 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
622 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
623 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
624 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
625 2933599457 Rhizobium phaseoli M3 Isolate Nodule
626 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
627 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
628 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
629 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
630 2936381700 Rhizobium chutanense C16 Isolate Unclassified
631 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
632 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
633 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
634 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
635 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
636 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
637 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
638 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
639 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
640 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
641 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
642 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
643 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
644 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
645 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
646 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
647 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
648 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
649 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
650 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
651 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
652 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
653 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
654 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
655 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
656 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
657 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
658 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
659 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
660 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
661 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
662 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
663 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
664 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
665 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
666 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
667 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
668 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
669 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
670 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
671 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
672 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
673 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
674 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
675 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
676 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
677 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
678 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
679 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
680 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
681 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
682 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
683 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
684 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
685 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
686 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
687 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
688 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
689 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
690 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
691 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
692 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
693 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
694 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
695 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
696 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
697 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
698 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
699 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
700 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
701 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
702 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
703 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
704 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
705 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
706 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
707 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
708 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
709 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
710 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
711 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
712 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
713 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
714 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
715 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
716 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
717 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
718 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
719 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
720 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
721 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
722 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
723 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
724 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
725 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
726 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
727 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
728 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
729 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
730 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
731 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
732 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
733 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
734 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
735 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
736 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
737 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
738 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
739 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
740 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
741 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
742 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
743 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
744 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
745 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
746 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
747 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
748 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
749 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
750 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
751 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
752 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
753 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
754 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
755 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
756 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
757 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
758 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
759 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
760 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
761 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
762 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
763 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
764 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
765 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
766 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
767 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
768 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
769 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
770 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
771 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
772 2996887358 Rhizobium sp. R711 Isolate Nodule
773 2996893221 Rhizobium sp. R635 Isolate Nodule
774 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
775 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
776 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
777 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
778 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
779 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
780 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
781 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
782 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
783 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
784 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
785 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
786 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
787 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
788 8005258706 Rhizobium sp. R693 Isolate Nodule
789 8005275841 Rhizobium sp. N4311 Isolate Nodule
790 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
791 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
792 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
793 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
794 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
795 8005321885 Rhizobium sp. R72 Isolate Nodule
796 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
797 8005382845 Rhizobium sp. R634 Isolate Nodule
798 8005395548 Rhizobium sp. R339 Isolate Nodule
799 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
800 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
801 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
802 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
803 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
804 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
805 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
806 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
807 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
808 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
809 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
810 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
811 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
812 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
813 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
814 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
815 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
816 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
817 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
818 8018176218 Rhizobium sp. N122 Isolate Nodule
819 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
820 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
821 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
822 8024501048 Rhizobium sp. H4 Isolate Nodule
823 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
824 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
825 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
826 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
827 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
828 8056382006 Rhizobium croatiense 13T Isolate Nodule
829 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
830 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
831 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.63
Metatranscriptomes 0.37
Isolates 56

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 15.07
Nodule 41.21
Rhizoplane 1.86
Rhizosphere 25.21
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10030240 3300009174 Bacteria 4046
2 JGI24740J21852_10000136 3300001979 Bacteria 28016
3 JGI25155J39150_1000001 3300002704 Bacteria 354543
4 JGI25156J39149_1000001 3300002705 Bacteria 354557
5 JGI25154J39366_1000011 3300002738 Bacteria 296007
6 JGI25158J39367_1000114 3300002739 Bacteria 18397
7 JGI25157J39369_1000030 3300002741 Bacteria 146112
8 JGI25152J39213_1000570 3300002773 Bacteria 20104
9 JGI25152J39213_1001028 3300002773 Bacteria 13358
10 JGI25152J39213_1005380 3300002773 Bacteria 3749
11 JGI25150J39212_1000326 3300002774 Bacteria 23479
12 JGI25159J45721_1000078 3300002987 Bacteria 46708
13 JGI25159J45721_1000199 3300002987 Bacteria 27917
14 JGI25159J45721_1008988 3300002987 Bacteria 2680
15 JGI25151J46595_10000083 3300003187 Bacteria 130658
16 JGI25151J46595_10000603 3300003187 Bacteria 31677
17 JGI25151J46595_10014053 3300003187 Bacteria 3583
18 JGI25165J46597_1004159 3300003214 Bacteria 3212
19 JGI25153J46596_10002343 3300003215 Bacteria 10986
20 JGI25153J46596_10005742 3300003215 Bacteria 6467
21 JGI25153J46596_10008791 3300003215 Bacteria 4779
22 JGI25160J50197_1000010 3300003354 Bacteria 279365
23 JGI25160J50197_1000216 3300003354 Bacteria 46708
24 JGI25160J50197_1008518 3300003354 Bacteria 3901
25 JGI25160J50197_1012212 3300003354 Bacteria 2997
26 JGI25160J50197_1012905 3300003354 Bacteria 2873
27 JGI25161J50226_1000006 3300003374 Bacteria 279563
28 JGI25161J50226_1000138 3300003374 Bacteria 50562
29 JGI25161J50226_1000412 3300003374 Bacteria 20844
30 JGI25161J50226_1000583 3300003374 Bacteria 15416
31 JGI25161J50226_1001023 3300003374 Bacteria 9734
32 Ga0055526_1000594 3300003771 Bacteria 28489
33 Ga0055526_1000998 3300003771 Bacteria 20772
34 Ga0055526_1006006 3300003771 Bacteria 6741
35 Ga0055526_1014891 3300003771 Bacteria 3163
36 Ga0055524_1000866 3300003775 Bacteria 19803
37 Ga0055524_1001805 3300003775 Bacteria 11731
38 Ga0055524_1001872 3300003775 Bacteria 11470
39 Ga0055524_1004012 3300003775 Bacteria 6943
40 Ga0055528_1000358 3300003790 Bacteria 37118
41 Ga0055528_1000676 3300003790 Bacteria 24723
42 Ga0055528_1001985 3300003790 Bacteria 11518
43 Ga0055528_1005700 3300003790 Bacteria 5743
44 Ga0055528_1007582 3300003790 Bacteria 4779
45 Ga0055540_1000354 3300003792 Bacteria 38972
46 Ga0055540_1013619 3300003792 Bacteria 2473
47 Ga0055531_10018855 3300003794 Bacteria 2825
48 Ga0055531_10019507 3300003794 Bacteria 2739
49 Ga0058692_1002834 3300003856 Bacteria 5678
50 Ga0055543_1000053 3300004625 Bacteria 104589
51 Ga0055543_1000301 3300004625 Bacteria 35189
52 Ga0055543_1001332 3300004625 Bacteria 10080
53 Ga0065165_1000717 3300005262 Bacteria 46746
54 Ga0065165_1009792 3300005262 Bacteria 4238
55 Ga0065165_1012321 3300005262 Bacteria 3490
56 Ga0070658_10005999 3300005327 Bacteria 9852
57 Ga0070670_100001771 3300005331 Bacteria 17578
58 Ga0070660_100021341 3300005339 Bacteria 4774
59 Ga0070661_100003058 3300005344 Bacteria 11508
60 Ga0070661_100012268 3300005344 Bacteria 5991
61 Ga0070661_100038645 3300005344 Bacteria 3475
62 Ga0070661_100048108 3300005344 Bacteria 3121
63 Ga0070661_100228306 3300005344 Bacteria 1430
64 Ga0070668_100005878 3300005347 Bacteria 9097
65 Ga0070668_100122993 3300005347 Bacteria 2076
66 Ga0070668_100259398 3300005347 Bacteria 1445
67 Ga0070671_100220808 3300005355 Bacteria 1608
68 Ga0070659_100004052 3300005366 Bacteria 10445
69 Ga0070659_100008711 3300005366 Bacteria 7422
70 Ga0070659_100019420 3300005366 Bacteria 5151
71 Ga0070659_100333682 3300005366 Bacteria 1270
72 Ga0070684_100148732 3300005535 Bacteria 2121
73 Ga0068853_100000271 3300005539 Bacteria 36616
74 Ga0068853_100024802 3300005539 Bacteria 5030
75 Ga0068853_100037735 3300005539 Bacteria 4112
76 Ga0070665_100097786 3300005548 Bacteria 2940
77 Ga0068855_100040700 3300005563 Bacteria 5514
78 Ga0068855_100044031 3300005563 Bacteria 5284
79 Ga0068855_100175558 3300005563 Bacteria 2425
80 Ga0068855_100289863 3300005563 Bacteria 1815
81 Ga0070664_100046347 3300005564 Bacteria 3672
82 Ga0068857_100009724 3300005577 Bacteria 8354
83 Ga0068854_100001115 3300005578 Bacteria 16144
84 Ga0068854_100022418 3300005578 Bacteria 4302
85 Ga0068856_100024578 3300005614 Bacteria 5865
86 Ga0068856_100055765 3300005614 Bacteria 3900
87 Ga0068856_100100092 3300005614 Bacteria 2890
88 Ga0068856_100130470 3300005614 Bacteria 2518
89 Ga0068856_100216897 3300005614 Bacteria 1929
90 Ga0068852_100002681 3300005616 Bacteria 12307
91 Ga0068852_100008011 3300005616 Bacteria 7748
92 Ga0068852_100012510 3300005616 Bacteria 6447
93 Ga0068852_100013007 3300005616 Bacteria 6351
94 Ga0068852_100017842 3300005616 Bacteria 5579
95 Ga0068852_100170827 3300005616 Bacteria 2038
96 Ga0068852_100381707 3300005616 Bacteria 1382
97 Ga0081455_10115747 3300005937 Bacteria 2122
98 Ga0075365_10000306 3300006038 Bacteria 17174
99 Ga0075365_10000404 3300006038 Bacteria 15855
100 Ga0075365_10015261 3300006038 Bacteria 4643
101 Ga0075365_10030747 3300006038 Bacteria 3442
102 Ga0075368_10019516 3300006042 Bacteria 2560
103 Ga0075363_100039411 3300006048 Bacteria 2486
104 Ga0075364_10000091 3300006051 Bacteria 36563
105 Ga0075364_10011277 3300006051 Bacteria 5427
106 Ga0075362_10004177 3300006177 Bacteria 5152
107 Ga0075362_10035850 3300006177 Bacteria 2167
108 Ga0075367_10001214 3300006178 Bacteria 10821
109 Ga0075367_10003637 3300006178 Bacteria 7391
110 Ga0075366_10001037 3300006195 Bacteria 13641
111 Ga0075366_10008524 3300006195 Bacteria 5703
112 Ga0075366_10054185 3300006195 Bacteria 2382
113 Ga0075370_10002712 3300006353 Bacteria 8287
114 Ga0079104_1000610 3300006946 Bacteria 35237
115 Ga0079104_1013220 3300006946 Bacteria 2555
116 Ga0099826_10000054 3300006948 Bacteria 71175
117 Ga0105251_10023177 3300009011 Bacteria 3209
118 Ga0105240_10000005 3300009093 Bacteria 702630
119 Ga0105240_10009447 3300009093 Bacteria 13807
120 Ga0105240_10087374 3300009093 Bacteria 3818
121 Ga0105243_10039379 3300009148 Bacteria 3684
122 Ga0105241_10006649 3300009174 Bacteria 8516
123 Ga0105241_10031587 3300009174 Bacteria 3966
124 Ga0105241_10115356 3300009174 Bacteria 2156
125 Ga0105248_10191206 3300009177 Bacteria 2306
126 Ga0105237_10000809 3300009545 Bacteria 42758
127 Ga0105237_10006832 3300009545 Bacteria 12577
128 Ga0105238_10001305 3300009551 Bacteria 25040
129 Ga0105238_10073212 3300009551 Bacteria 3421
130 Ga0123341_1000188 3300009765 Bacteria 31454
131 Ga0123342_1014890 3300009766 Bacteria 7276
132 Ga0123342_1033521 3300009766 Bacteria 2325
133 Ga0105239_10012400 3300010375 Bacteria 9491
134 Ga0105239_10197818 3300010375 Bacteria 2251
135 Ga0157373_10015740 3300013100 Bacteria 5522
136 Ga0157373_10133085 3300013100 Bacteria 1748
137 Ga0157371_10000002 3300013102 Bacteria 665040
138 Ga0157371_10015741 3300013102 Bacteria 5662
139 Ga0157370_10000286 3300013104 Bacteria 64173
140 Ga0157370_10001170 3300013104 Bacteria 32703
141 Ga0157370_10043828 3300013104 Bacteria 4303
142 Ga0157370_10108215 3300013104 Bacteria 2599
143 Ga0157369_10058539 3300013105 Bacteria 4156
144 Ga0157369_10226328 3300013105 Bacteria 1956
145 Ga0171463_1003 3300013249 Bacteria 695693
146 Ga0157378_10016798 3300013297 Bacteria 6413
147 Ga0157378_10204004 3300013297 Bacteria 1871
148 Ga0157372_10093818 3300013307 Bacteria 3416
149 Ga0157372_10236234 3300013307 Bacteria 2120
150 Ga0182007_10004491 3300015262 Bacteria 6311
151 Ga0183363_1047 3300015690 Bacteria 39413
152 Ga0214544_1001682 3300021320 Bacteria 46508
153 Ga0214542_1001614 3300021321 Bacteria 46380
154 Ga0214542_1016791 3300021321 Bacteria 6921
155 Ga0214543_1000078 3300021327 Bacteria 119775
156 Ga0214543_1001395 3300021327 Bacteria 46435
157 Ga0228711_1000016 3300022739 Bacteria 126351
158 Ga0228710_1000013 3300022740 Bacteria 145976
159 Ga0209435_100012 3300025206 Bacteria 401621
160 Ga0209436_100085 3300025208 Bacteria 46798
161 Ga0207427_101277 3300025231 Bacteria 9577
162 Ga0209437_100047 3300025233 Bacteria 405163
163 Ga0209437_100165 3300025233 Bacteria 145009
164 Ga0207425_1000024 3300025245 Bacteria 328978
165 Ga0207425_1003357 3300025245 Bacteria 5160
166 Ga0207425_1004232 3300025245 Bacteria 4355
167 Ga0207425_1016370 3300025245 Bacteria 1646
168 Ga0209646_1000026 3300025246 Bacteria 401621
169 Ga0209026_1000014 3300025250 Bacteria 401621
170 Ga0209677_103130 3300025253 Bacteria 5619
171 Ga0209759_1000012 3300025256 Bacteria 401621
172 Ga0209129_1000069 3300025258 Bacteria 212790
173 Ga0209129_1000184 3300025258 Bacteria 87102
174 Ga0209129_1000376 3300025258 Bacteria 36225
175 Ga0209129_1000703 3300025258 Bacteria 21754
176 Ga0209129_1000735 3300025258 Bacteria 21020
177 Ga0209129_1003238 3300025258 Bacteria 7245
178 Ga0209233_1000048 3300025261 Bacteria 453669
179 Ga0209233_1000069 3300025261 Bacteria 367639
180 Ga0209233_1000195 3300025261 Bacteria 125863
181 Ga0209233_1000208 3300025261 Bacteria 115633
182 Ga0209673_1000010 3300025273 Bacteria 596656
183 Ga0209673_1000013 3300025273 Bacteria 571633
184 Ga0209673_1000296 3300025273 Bacteria 92350
185 Ga0209673_1000850 3300025273 Bacteria 39843
186 Ga0209673_1002846 3300025273 Bacteria 11085
187 Ga0209673_1005667 3300025273 Bacteria 6234
188 Ga0209673_1008745 3300025273 Bacteria 4470
189 Ga0209130_1000021 3300025284 Bacteria 374278
190 Ga0209130_1000029 3300025284 Bacteria 323399
191 Ga0209130_1000081 3300025284 Bacteria 166440
192 Ga0209676_1007150 3300025292 Bacteria 5329
193 Ga0209676_1009134 3300025292 Bacteria 4316
194 Ga0209025_1000050 3300025294 Bacteria 331531
195 Ga0209025_1000166 3300025294 Bacteria 164692
196 Ga0209025_1000959 3300025294 Bacteria 43491
197 Ga0209025_1001225 3300025294 Bacteria 35824
198 Ga0209025_1001950 3300025294 Bacteria 23818
199 Ga0209025_1004412 3300025294 Bacteria 12242
200 Ga0209025_1022035 3300025294 Bacteria 3400
201 Ga0209025_1026054 3300025294 Bacteria 2950
202 Ga0209564_1000260 3300025295 Bacteria 112444
203 Ga0209564_1000278 3300025295 Bacteria 105405
204 Ga0209564_1000584 3300025295 Bacteria 57729
205 Ga0209564_1000920 3300025295 Bacteria 38309
206 Ga0209564_1004501 3300025295 Bacteria 8498
207 Ga0209564_1016076 3300025295 Bacteria 3002
208 Ga0209564_1016737 3300025295 Bacteria 2898
209 Ga0209564_1021031 3300025295 Bacteria 2366
210 Ga0209758_1000083 3300025297 Bacteria 257283
211 Ga0209758_1000418 3300025297 Bacteria 72150
212 Ga0209758_1001270 3300025297 Bacteria 31259
213 Ga0209758_1001487 3300025297 Bacteria 27386
214 Ga0209758_1001756 3300025297 Bacteria 24054
215 Ga0209758_1005225 3300025297 Bacteria 10173
216 Ga0209050_1003249 3300025298 Bacteria 12243
217 Ga0209050_1031523 3300025298 Bacteria 1650
218 Ga0209256_1000042 3300025299 Bacteria 341821
219 Ga0209256_1000383 3300025299 Bacteria 70773
220 Ga0209256_1000588 3300025299 Bacteria 50690
221 Ga0209256_1001127 3300025299 Bacteria 30457
222 Ga0209256_1002941 3300025299 Bacteria 12786
223 Ga0209256_1010688 3300025299 Bacteria 3800
224 Ga0209256_1031368 3300025299 Bacteria 1454
225 Ga0207426_1000008 3300025302 Bacteria 848730
226 Ga0207426_1000010 3300025302 Bacteria 796003
227 Ga0207426_1000039 3300025302 Bacteria 439937
228 Ga0207426_1000074 3300025302 Bacteria 323399
229 Ga0207426_1000952 3300025302 Bacteria 28571
230 Ga0209051_1000611 3300025303 Bacteria 41422
231 Ga0209051_1002092 3300025303 Bacteria 15051
232 Ga0209051_1010035 3300025303 Bacteria 4821
233 Ga0209051_1016142 3300025303 Bacteria 3401
234 Ga0209257_1002801 3300025304 Bacteria 16394
235 Ga0209257_1007900 3300025304 Bacteria 6254
236 Ga0207705_10030520 3300025909 Bacteria 3846
237 Ga0207705_10041547 3300025909 Bacteria 3299
238 Ga0207654_10040636 3300025911 Bacteria 2622
239 Ga0207654_10042574 3300025911 Bacteria 2571
240 Ga0207695_10000011 3300025913 Bacteria 910221
241 Ga0207695_10038263 3300025913 Bacteria 5167
242 Ga0207671_10000804 3300025914 Bacteria 39792
243 Ga0207671_10018551 3300025914 Bacteria 5332
244 Ga0207657_10014455 3300025919 Bacteria 7707
245 Ga0207657_10046011 3300025919 Bacteria 3824
246 Ga0207649_10001779 3300025920 Bacteria 12329
247 Ga0207649_10008450 3300025920 Bacteria 5614
248 Ga0207649_10060527 3300025920 Bacteria 2380
249 Ga0207694_10014275 3300025924 Bacteria 5989
250 Ga0207650_10002483 3300025925 Bacteria 12829
251 Ga0207644_10202029 3300025931 Bacteria 1568
252 Ga0207690_10038204 3300025932 Bacteria 3123
253 Ga0207690_10105357 3300025932 Bacteria 2022
254 Ga0207691_10082674 3300025940 Bacteria 2884
255 Ga0207667_10010615 3300025949 Bacteria 10754
256 Ga0207667_10016213 3300025949 Bacteria 8421
257 Ga0207667_10071066 3300025949 Bacteria 3620
258 Ga0207667_10082530 3300025949 Bacteria 3329
259 Ga0207668_10049389 3300025972 Bacteria 2892
260 Ga0207668_10274457 3300025972 Bacteria 1380
261 Ga0207668_10331068 3300025972 Bacteria 1267
262 Ga0207640_10002795 3300025981 Bacteria 9359
263 Ga0207640_10053445 3300025981 Bacteria 2637
264 Ga0207640_10147048 3300025981 Bacteria 1726
265 Ga0207639_10001791 3300026041 Bacteria 14472
266 Ga0207678_10054418 3300026067 Bacteria 3447
267 Ga0207678_10200116 3300026067 Bacteria 1708
268 Ga0207702_10045718 3300026078 Bacteria 3683
269 Ga0207702_10076174 3300026078 Bacteria 2899
270 Ga0207702_10099294 3300026078 Bacteria 2566
271 Ga0207702_10105393 3300026078 Bacteria 2497
272 Ga0207702_10184388 3300026078 Bacteria 1924
273 Ga0207702_10214492 3300026078 Bacteria 1791
274 Ga0207674_10071035 3300026116 Bacteria 3499
275 Ga0207698_10000890 3300026142 Bacteria 17333
276 Ga0207698_10039607 3300026142 Bacteria 3493
277 Ga0207698_10049365 3300026142 Bacteria 3202
278 Ga0207698_10131252 3300026142 Bacteria 2141
279 Ga0207698_10144437 3300026142 Bacteria 2055
280 Ga0207698_10202097 3300026142 Bacteria 1780
281 Ga0209281_1000036 3300027111 Bacteria 369415
282 Ga0209281_1000047 3300027111 Bacteria 326514
283 Ga0209281_1000221 3300027111 Bacteria 122380
284 Ga0209281_1000453 3300027111 Bacteria 58584
285 Ga0209371_1000012 3300027312 Bacteria 748304
286 Ga0209371_1002509 3300027312 Bacteria 10168
287 Ga0209371_1003859 3300027312 Bacteria 6946
288 Ga0209282_1000041 3300027666 Bacteria 122268
289 Ga0209282_1000140 3300027666 Bacteria 42807
290 Ga0209813_10005946 3300027866 Bacteria 2995
291 Ga0268266_10074885 3300028379 Bacteria 2940
292 Ga0268266_10139096 3300028379 Bacteria 2178
293 Ga0265318_10003757 3300028577 Bacteria 7552
294 Ga0307515_10000023 3300028794 Bacteria 400846
295 Ga0307515_10046287 3300028794 Bacteria 6654
296 Ga0307515_10080288 3300028794 Bacteria 4257
297 Ga0265338_10013153 3300028800 Bacteria 9371
298 Ga0268256_1000013 3300030500 Bacteria 752103
299 Ga0268256_1003570 3300030500 Bacteria 6946
300 Ga0316181_1124615 3300030744 Bacteria 4431
301 Ga0265330_10030273 3300031235 Bacteria 2431
302 Ga0265332_10026923 3300031238 Bacteria 2520
303 Ga0265325_10001358 3300031241 Bacteria 17326
304 Ga0265329_10006287 3300031242 Bacteria 4721
305 Ga0265339_10000443 3300031249 Bacteria 32418
306 Ga0265331_10014508 3300031250 Bacteria 4195
307 Ga0265316_10038069 3300031344 Bacteria 3878
308 Ga0307513_10003030 3300031456 Bacteria 22903
309 Ga0307408_100122433 3300031548 Bacteria 2017
310 Ga0265313_10000048 3300031595 Bacteria 112723
311 Ga0265314_10010928 3300031711 Bacteria 7537
312 Ga0265342_10013396 3300031712 Bacteria 5503
313 Ga0307405_10000781 3300031731 Bacteria 12489
314 Ga0307405_10061347 3300031731 Bacteria 2377
315 Ga0307405_10152944 3300031731 Bacteria 1625
316 Ga0307407_10191787 3300031903 Bacteria 1363
317 Ga0307412_10140528 3300031911 Bacteria 1768
318 Ga0315914_1000030 3300031967 Bacteria 102599
319 Ga0307416_100085503 3300032002 Bacteria 2685
320 Ga0307414_10100666 3300032004 Bacteria 2174
321 Ga0307411_10119669 3300032005 Bacteria 1903
322 Ga0315913_1000017 3300033430 Bacteria 102835
323 Ga0315915_1000017 3300033464 Bacteria 148111
324 Ga0395901_0264505 3300038443 Bacteria 1789
325 Ga0400483_029206 3300039062 Unclassified 4687
326 Ga0400483_091231 3300039062 Unclassified 1577
327 Ga0400483_094012 3300039062 Bacteria 2585
328 Ga0400483_124851 3300039062 Bacteria 1352
329 Ga0400483_290121 3300039062 Bacteria 2925
330 Ga0436360_0610068 3300039438 Bacteria 2676
331 Ga0439436_0001642 3300041404 Bacteria 6526
332 Ga0439439_0010918 3300041406 Bacteria 2178
333 Ga0451787_009192 3300041441 Bacteria 3758
334 Ga0451807_1358952 3300041486 Bacteria 1923
335 Ga0451833_0028360 3300041491 Bacteria 1642
336 Ga0451841_0180374 3300041498 Bacteria 2136
337 Ga0451845_0316168 3300041501 Bacteria 3780
338 Ga0451849_0293555 3300041505 Bacteria 2101
339 Ga0451851_0510789 3300041507 Bacteria 1500
340 Ga0451843_0517638 3300041509 Bacteria 2266
341 Ga0451853_0469856 3300041512 Bacteria 1957
342 Ga0439431_0025176 3300041997 Bacteria 1452
343 Ga0439449_0005799 3300042007 Bacteria 4721
344 Ga0466957_0089726 3300044842 Bacteria 1925
345 Ga0495629_0065953 3300046459 Bacteria 2526
346 Ga0495638_0001984 3300046460 Bacteria 17461
347 Ga0495662_0012415 3300046476 Bacteria 4157
348 Ga0495585_0046485 3300046492 Bacteria 2421
349 Ga0495606_0089977 3300046507 Bacteria 1890
350 Ga0495631_0011061 3300046518 Bacteria 4452
351 Ga0495654_0000090 3300046530 Bacteria 101947
352 Ga0495587_0126025 3300046536 Bacteria 1465
353 Ga0495622_0005922 3300046557 Bacteria 5680
354 Ga0495625_0050368 3300046660 Bacteria 2989
355 Ga0495588_0011344 3300046674 Bacteria 4178
356 Ga0495624_0069428 3300046690 Bacteria 2195
357 Ga0495649_0041615 3300046694 Bacteria 2512
358 Ga0495604_0048763 3300047317 Bacteria 3293
359 Ga0495681_0000886 3300047470 Bacteria 23149
360 Ga0495686_0008216 3300047472 Bacteria 7697
361 Ga0496100_0042674 3300048903 Bacteria 2898
362 Ga0496102_0109133 3300048905 Bacteria 2578
363 Ga0496110_0184017 3300048913 Bacteria 1897
364 Ga0496111_0012743 3300048914 Bacteria 5700
365 Ga0496111_0056372 3300048914 Bacteria 2843
366 Ga0496113_0022885 3300048916 Bacteria 4427
367 Ga0496114_0173611 3300048917 Bacteria 1880
368 Ga0496116_0000061 3300048919 Bacteria 271860
369 Ga0496116_0018700 3300048919 Bacteria 5327
370 Ga0496116_0067462 3300048919 Bacteria 2284
371 Ga0496117_0000016 3300048920 Bacteria 523642
372 Ga0496118_0000535 3300048921 Bacteria 62444
373 Ga0496118_0016390 3300048921 Bacteria 6801
374 Ga0496118_0025170 3300048921 Bacteria 5113
375 Ga0496118_0035617 3300048921 Bacteria 4038
376 Ga0496118_0036469 3300048921 Bacteria 3975
377 Ga0496119_0021558 3300048922 Bacteria 4651
378 Ga0496119_0083943 3300048922 Bacteria 1827
379 Ga0496120_0000056 3300048923 Bacteria 180367
380 Ga0496120_0055452 3300048923 Bacteria 2241
381 Ga0496121_0000001 3300048924 Bacteria 1830318
382 Ga0496121_0003418 3300048924 Bacteria 22706
383 Ga0496121_0025293 3300048924 Bacteria 5640
384 Ga0496121_0049063 3300048924 Bacteria 3585
385 Ga0496121_0051938 3300048924 Bacteria 3448
386 Ga0496122_0000002 3300048925 Bacteria 905834
387 Ga0496122_0000369 3300048925 Bacteria 96672
388 Ga0496122_0019117 3300048925 Bacteria 6281
389 Ga0496122_0049793 3300048925 Bacteria 3202
390 Ga0496122_0053662 3300048925 Bacteria 3036
391 Ga0496122_0171475 3300048925 Bacteria 1307
392 Ga0496123_0000002 3300048926 Bacteria 1811682
393 Ga0496123_0000054 3300048926 Bacteria 234046
394 Ga0496123_0045707 3300048926 Bacteria 2980
395 Ga0496123_0073509 3300048926 Bacteria 2120
396 Ga0496124_0000091 3300048927 Bacteria 189706
397 Ga0496124_0002629 3300048927 Bacteria 23098
398 Ga0496124_0010219 3300048927 Bacteria 9534
399 Ga0496124_0060519 3300048927 Bacteria 3177
400 Ga0496124_0124752 3300048927 Bacteria 2053
401 Ga0496124_0158031 3300048927 Bacteria 1770
402 Ga0496125_0000001 3300048928 Bacteria 1766138
403 Ga0496125_0000301 3300048928 Bacteria 96860
404 Ga0496126_0000059 3300048929 Bacteria 267449
405 Ga0496126_0024626 3300048929 Bacteria 5807
406 Ga0501031_0000831 3300049568 Bacteria 18554
407 Ga0501031_0042020 3300049568 Bacteria 2985
408 Ga0501032_0000019 3300049569 Bacteria 155168
409 Ga0501032_0010722 3300049569 Bacteria 6596
410 Ga0501033_0003165 3300049570 Bacteria 13674
411 Ga0501034_0000130 3300049571 Bacteria 139568
412 Ga0501034_0001091 3300049571 Bacteria 38199
413 Ga0501034_0003341 3300049571 Bacteria 18310
414 Ga0501034_0025994 3300049571 Bacteria 5963
415 Ga0501034_0086855 3300049571 Bacteria 3128
416 Ga0501034_0102421 3300049571 Bacteria 2856
417 Ga0501034_0127961 3300049571 Bacteria 2524
418 Ga0501034_0254112 3300049571 Bacteria 1701
419 Ga0501036_0000635 3300049572 Bacteria 25582
420 Ga0501036_0072071 3300049572 Bacteria 2920
421 Ga0501036_0153858 3300049572 Bacteria 1940
422 Ga0501037_0005590 3300049573 Bacteria 9165
423 Ga0501037_0008501 3300049573 Bacteria 7527
424 Ga0501037_0086156 3300049573 Bacteria 2274
425 Ga0501038_0000478 3300049574 Bacteria 35183
426 Ga0501038_0030525 3300049574 Bacteria 4768
427 Ga0501039_0000028 3300049575 Bacteria 139568
428 Ga0501039_0012409 3300049575 Bacteria 6505
429 Ga0501039_0169072 3300049575 Bacteria 1719
430 Ga0501041_0106345 3300049577 Bacteria 1739
431 Ga0501043_0003505 3300049579 Bacteria 12900
432 Ga0501043_0155011 3300049579 Bacteria 1791
433 Ga0501046_0140291 3300049580 Bacteria 1829
434 Ga0501047_0261675 3300049581 Bacteria 1577
435 Ga0501047_0272208 3300049581 Bacteria 1540
436 Ga0501048_0156218 3300049582 Bacteria 1614
437 Ga0501069_0125237 3300049585 Bacteria 1469
438 Ga0501070_0187400 3300049586 Bacteria 1701
439 Ga0501073_0157453 3300049589 Bacteria 1574
440 Ga0501074_0209435 3300049590 Bacteria 1389
441 Ga0501280_005335 3300049776 Bacteria 1840
442 Ga0501035_0000143 3300049822 Bacteria 86821
443 Ga0501035_0092282 3300049822 Bacteria 2664
444 Ga0501044_0008899 3300049823 Bacteria 10973
445 nmdc:mga00v17_156_c1 3300050491 Bacteria 40197
446 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
447 nmdc:mga00v17_8320_c1 3300050491 Bacteria 5581
448 nmdc:mga0k408_17499_c1 3300050493 Bacteria 3994
449 nmdc:mga04h51_41482_c1 3300050495 Bacteria 1504
450 nmdc:mga0sz30_2395_c1 3300050516 Bacteria 6693
451 Ga0500572_011708 3300053111 Bacteria 2130
452 Ga0500618_002658 3300053125 Bacteria 6573
453 Ga0500658_0017602 3300053134 Bacteria 2670
454 Ga0500568_0030432 3300053139 Bacteria 2235
455 Ga0500568_0035223 3300053139 Bacteria 2044
456 Ga0500573_0000259 3300053140 Bacteria 22228
457 Ga0500604_0000146 3300053151 Bacteria 21141
458 Ga0500604_0002515 3300053151 Bacteria 5003
459 Ga0500616_0000301 3300053153 Bacteria 71758
460 Ga0500616_0006977 3300053153 Bacteria 7272
461 Ga0500616_0008228 3300053153 Bacteria 6505
462 Ga0500616_0009464 3300053153 Bacteria 5927
463 Ga0500622_0002301 3300053156 Bacteria 13988
464 Ga0500624_000733 3300053157 Bacteria 8098
465 Ga0500634_0000004 3300053161 Bacteria 214946
466 Ga0500634_0001667 3300053161 Bacteria 8818
467 Ga0500636_0000034 3300053177 Bacteria 72555
468 Ga0500636_0029235 3300053177 Bacteria 3255
469 Ga0587077_008812 3300059493 Bacteria 1513
470 Ga0587098_001071 3300059604 Bacteria 1983
471 Ga0587072_004741 3300059643 Bacteria 1996
472 Ga0587076_009010 3300059645 Bacteria 1408
473 2509111396 2508501122 Bacteria 6292184
474 2509375665 2509276019 Bacteria 6802256
475 2509392532 2509276021 Bacteria 7634384
476 2509446553 2509276033 Bacteria 7180565
477 2510133445 2510065019 Bacteria 6903379
478 2510303291 2510065057 Bacteria 6649661
479 2510840035 2510461069 Bacteria 5505000
480 2510894832 2510461076 Bacteria 8618824
481 2511135126 2510917022 Bacteria 6504556
482 2511171672 2510917026 Bacteria 7046020
483 2511181658 2510917028 Bacteria 6185411
484 2511194372 2510917030 Bacteria 7460662
485 2511391053 2511231027 Bacteria 5013807
486 2511501971 2511231052 Bacteria 6974333
487 2512533339 2512047086 Bacteria 6850303
488 2512971092 2512875026 Bacteria 6861065
489 2513572368 2513237084 Bacteria 7231967
490 2513577417 2513237085 Bacteria 7695351
491 2513582632 2513237086 Bacteria 7265287
492 2513594691 2513237088 Bacteria 6927906
493 2513604551 2513237089 Bacteria 6553624
494 2513615466 2513237091 Bacteria 6900273
495 2513629948 2513237093 Bacteria 7545552
496 2513708592 2513237103 Bacteria 7647401
497 2513864761 2513237138 Bacteria 7368160
498 2513881255 2513237140 Bacteria 7076289
499 2513902386 2513237143 Bacteria 6664116
500 2513914111 2513237144 Bacteria 7530820
501 2513926064 2513237146 Bacteria 7166346
502 2513984594 2513237156 Bacteria 6402557
503 2513997064 2513237159 Bacteria 6810126
504 2514007604 2513237160 Bacteria 6650282
505 2514021957 2513237162 Bacteria 7468464
506 2514586446 2513237351 Bacteria 6968952
507 2515112410 2515075009 Bacteria 7288508
508 2515608764 2515154107 Bacteria 6795637
509 2515632759 2515154113 Bacteria 7807172
510 2515639907 2515154114 Bacteria 7848616
511 2515655888 2515154116 Bacteria 7552979
512 2515740324 2515154134 Bacteria 7220242
513 2516209691 2516143018 Bacteria 6951533
514 2516893267 2516653046 Bacteria 6989037
515 2517036142 2516653077 Bacteria 7555578
516 2517076532 2516653085 Bacteria 7346596
517 2517095299 2517093000 Bacteria 7412387
518 2517406903 2517287029 Bacteria 6905599
519 2517570024 2517487022 Bacteria 7227575
520 2520379231 2519899620 Bacteria 6499161
521 2524448833 2524023207 Bacteria 6813453
522 2524460267 2524023209 Bacteria 6679728
523 2530645651 2529292951 Bacteria 6916614
524 2535516606 2534681796 Bacteria 7146037
525 2537877764 2537561587 Bacteria 5425293
526 2551675155 2551306084 Bacteria 8942552
527 2551680519 2551306084 Bacteria 8942552
528 2551688052 2551306085 Bacteria 7347181
529 2551691140 2551306086 Bacteria 6843938
530 2551693966 2551306086 Bacteria 6843938
531 2551698099 2551306087 Bacteria 7351905
532 2551699980 2551306087 Bacteria 7351905
533 2551713206 2551306089 Bacteria 7162724
534 2551722514 2551306090 Bacteria 7953713
535 2551727853 2551306091 Bacteria 7086830
536 2551736514 2551306092 Bacteria 6992595
537 2551745075 2551306093 Bacteria 7064773
538 2554245552 2554235003 Bacteria 5877155
539 2558867981 2558860100 Bacteria 8458965
540 2559296618 2558860242 Bacteria 5568029
541 2561468294 2558860983 Bacteria 4133860
542 2585166135 2582581283 Bacteria 6030556
543 2585200287 2582581294 Bacteria 6626667
544 2585222631 2582581298 Bacteria 7315509
545 2585229894 2582581299 Bacteria 6518058
546 2585254873 2582581304 Bacteria 5831370
547 2585267661 2582581306 Bacteria 6450535
548 2585270866 2582581307 Bacteria 6597605
549 2585277214 2582581308 Bacteria 7413247
550 2585323777 2582581315 Bacteria 7318924
551 2585331756 2582581316 Bacteria 7774528
552 2585386720 2582581865 Bacteria 6644329
553 2585393050 2582581866 Bacteria 6859583
554 2585402123 2582581867 Bacteria 7184437
555 2585527771 2585427526 Bacteria 7258840
556 2585534050 2585427527 Bacteria 7273426
557 2585537666 2585427528 Bacteria 6842387
558 2585545214 2585427529 Bacteria 7395659
559 2585552099 2585427530 Bacteria 7383882
560 2585558590 2585427531 Bacteria 6992870
561 2585821908 2585427590 Bacteria 6824633
562 2585835616 2585427593 Bacteria 7141551
563 2585846832 2585427594 Bacteria 6180594
564 2585897953 2585427608 Bacteria 6544331
565 2585904441 2585427609 Bacteria 6667127
566 2585996024 2585427633 Bacteria 6413184
567 2586000628 2585427634 Bacteria 6455027
568 2587980442 2585428125 Bacteria 6662905
569 2599331585 2599185156 Bacteria 5403036
570 2599417540 2599185170 Bacteria 7295545
571 2599602889 2599185210 Bacteria 5624189
572 2599720978 2599185236 Bacteria 6875203
573 2600193090 2599185352 Bacteria 7228948
574 2600375704 2600254933 Bacteria 4750527
575 2601610498 2600255279 Bacteria 5605316
576 2601747172 2600255308 Bacteria 5611129
577 2616292344 2615840624 Bacteria 6557588
578 2616308592 2615840626 Bacteria 7921970
579 2616557103 2615840698 Bacteria 7319877
580 2617385655 2617270742 Bacteria 6808054
581 2643803590 2643221557 Bacteria 7184309
582 2643812592 2643221558 Bacteria 5460675
583 2643854247 2643221568 Bacteria 5187270
584 2643910295 2643221580 Bacteria 3816678
585 2643911158 2643221580 Bacteria 3816678
586 2643917409 2643221582 Bacteria 5804683
587 2643963846 2643221591 Bacteria 4397626
588 2644003875 2643221599 Bacteria 6292121
589 2644050732 2643221607 Bacteria 6314006
590 2644067557 2643221610 Bacteria 7480339
591 2644107703 2643221618 Bacteria 7717186
592 2644133778 2643221623 Bacteria 5239945
593 2644148626 2643221626 Bacteria 8069654
594 2644165318 2643221629 Bacteria 5850260
595 2644192600 2643221634 Bacteria 6705461
596 2644205206 2643221636 Bacteria 6583769
597 2644210225 2643221637 Bacteria 5345260
598 2644239683 2643221643 Bacteria 5749658
599 2644298399 2643221653 Bacteria 4569637
600 2644309097 2643221655 Bacteria 7722067
601 2644332925 2643221659 Bacteria 7890716
602 2644348301 2643221662 Bacteria 5851492
603 2644375237 2643221668 Bacteria 7306521
604 2644410790 2643221674 Bacteria 3919126
605 2644411995 2643221674 Bacteria 3919126
606 2644418610 2643221675 Bacteria 7473456
607 2644451977 2643221680 Bacteria 7473610
608 2644483650 2643221686 Bacteria 6310811
609 2644491799 2643221688 Bacteria 5260751
610 2644501351 2643221689 Bacteria 6042950
611 2644520747 2643221693 Bacteria 5513853
612 2644545903 2643221698 Bacteria 7756764
613 2644615039 2643221712 Bacteria 7729434
614 2644653777 2643221718 Bacteria 5345506
615 2644656628 2643221719 Bacteria 4568197
616 2644676576 2643221723 Bacteria 7095460
617 2644690739 2643221726 Bacteria 7455827
618 2657681194 2657244999 Bacteria 5946535
619 2671111704 2667528174 Bacteria 6435400
620 2692315849 2690316117 Bacteria 6800650
621 2719181301 2718217882 Bacteria 6556348
622 2719385909 2718217927 Bacteria 6972593
623 2719665725 2718217997 Bacteria 6740740
624 2719732050 2718218009 Bacteria 6478651
625 2720492145 2718218199 Bacteria 6740745
626 2720613410 2718218232 Bacteria 6720332
627 2720620288 2718218233 Bacteria 6662049
628 2720631712 2718218235 Bacteria 6630699
629 2720775440 2718218269 Bacteria 6906114
630 2721147395 2718218363 Bacteria 6524337
631 2721158929 2718218365 Bacteria 6274507
632 2721164313 2718218366 Bacteria 6425255
633 2721399688 2718218423 Bacteria 6438183
634 2722840483 2721755514 Bacteria 6424414
635 2723027058 2721755556 Bacteria 6745503
636 2723560670 2721755684 Bacteria 6859907
637 2723567259 2721755685 Bacteria 6704835
638 2724038501 2721755809 Bacteria 6438790
639 2724044806 2721755810 Bacteria 6479005
640 2724090047 2721755819 Bacteria 6906405
641 2724104524 2721755822 Bacteria 6726041
642 2724110318 2721755823 Bacteria 6752556
643 2725948586 2724679232 Bacteria 7646494
644 2730107994 2728369352 Bacteria 6745171
645 2730164538 2728369365 Bacteria 6555560
646 2730298561 2728369397 Bacteria 6274511
647 2738804206 2738541293 Bacteria 7065685
648 2738946063 2738541317 Bacteria 5340176
649 2739036629 2738541333 Bacteria 7106503
650 2753461861 2751185821 Bacteria 6189929
651 2757572114 2757320392 Bacteria 3737298
652 2765468597 2765235802 Bacteria 5618596
653 2766067422 2765235942 Bacteria 7445910
654 2770198895 2767802442 Bacteria 5747986
655 2776272878 2775506902 Bacteria 6208009
656 2776282279 2775506904 Bacteria 5954060
657 2776913544 2775507049 Bacteria 6284736
658 2778174030 2775507266 Bacteria 7392367
659 2792581763 2791355082 Bacteria 5973319
660 2792620167 2791355091 Bacteria 6135441
661 2792626413 2791355092 Bacteria 6248105
662 2792639362 2791355094 Bacteria 7011481
663 2793279937 2791355253 Bacteria 5171699
664 2793294802 2791355256 Bacteria 6798008
665 2793312380 2791355259 Bacteria 7254731
666 2793322919 2791355260 Bacteria 6598818
667 2793331014 2791355261 Bacteria 6661293
668 2793335932 2791355262 Bacteria 6774204
669 2793341644 2791355263 Bacteria 6872478
670 2793348950 2791355264 Bacteria 6429314
671 2793352948 2791355265 Bacteria 6539969
672 2793364349 2791355266 Bacteria 7116587
673 2793366860 2791355267 Bacteria 7222458
674 2802719519 2802428858 Bacteria 6636079
675 2802726888 2802428859 Bacteria 6667919
676 2802732253 2802428860 Bacteria 6525526
677 2802739856 2802428861 Bacteria 6534206
678 2802745362 2802428862 Bacteria 6633353
679 2802752754 2802428863 Bacteria 6410669
680 2804752394 2802429268 Bacteria 6094027
681 2805925824 2802429605 Bacteria 6875453
682 2805933456 2802429606 Bacteria 6346811
683 2806046179 2802429633 Bacteria 7341974
684 2806054559 2802429634 Bacteria 7083200
685 2806060563 2802429635 Bacteria 7650140
686 2806064979 2802429636 Bacteria 7597525
687 2806072238 2802429637 Bacteria 7067217
688 2808987071 2808606387 Bacteria 5697198
689 2819241740 2818991272 Bacteria 4622173
690 2819560626 2818991439 Bacteria 6907412
691 2819612784 2818991448 Bacteria 6772224
692 2819637897 2818991453 Bacteria 7181617
693 2819684749 2818991461 Bacteria 7026071
694 2821129480 2821123053 Bacteria 7836056
695 2837654140 2837651117 Bacteria 3772164
696 2838018087 2838016132 Bacteria 6577831
697 2838026294 2838022645 Bacteria 6494267
698 2838030078 2838029111 Bacteria 6603031
699 2838038247 2838035591 Bacteria 7166484
700 2838043567 2838042994 Bacteria 6046894
701 2838053484 2838048938 Bacteria 6044578
702 2838065685 2838061910 Bacteria 6794874
703 2838074400 2838068647 Bacteria 6208656
704 2838079592 2838074704 Bacteria 6785777
705 2838661876 2838661181 Bacteria 7385261
706 2838673740 2838668709 Bacteria 6671819
707 2838677881 2838675328 Bacteria 4909118
708 2838682086 2838680041 Bacteria 6545511
709 2838691916 2838686498 Bacteria 7807632
710 2838696658 2838694306 Bacteria 6853137
711 2838706242 2838701080 Bacteria 6669771
712 2838710103 2838707686 Bacteria 6619912
713 2838717214 2838714209 Bacteria 5525906
714 2838722176 2838719591 Bacteria 5523910
715 2838727963 2838724970 Bacteria 4908691
716 2838732937 2838729681 Bacteria 7400765
717 2838738488 2838736955 Bacteria 5760694
718 2838745815 2838742623 Bacteria 7396178
719 2839996553 2839993093 Bacteria 5512535
720 2840770302 2840764183 Bacteria 6358399
721 2841841143 2841840854 Bacteria 5761912
722 2841849622 2841846520 Bacteria 5345850
723 2841855726 2841851746 Bacteria 7532261
724 2841861342 2841859092 Bacteria 5436171
725 2841864410 2841864319 Bacteria 6742987
726 2842078276 2842077413 Bacteria 6508645
727 2842114274 2842110456 Bacteria 7656360
728 2842119216 2842118031 Bacteria 7033875
729 2842127630 2842124991 Bacteria 5346824
730 2842132774 2842130223 Bacteria 4909145
731 2842140921 2842140634 Bacteria 5759631
732 2842150996 2842146304 Bacteria 5957337
733 2842154767 2842152218 Bacteria 4908957
734 2842157282 2842156927 Bacteria 6894975
735 2842167940 2842163707 Bacteria 6916235
736 2842173266 2842170452 Bacteria 5525737
737 2842178388 2842175837 Bacteria 4908771
738 2842181134 2842180545 Bacteria 6888678
739 2842190322 2842187318 Bacteria 5524014
740 2842194395 2842192696 Bacteria 6147454
741 2842201773 2842198810 Bacteria 6608673
742 2842205913 2842205361 Bacteria 6340321
743 2842214636 2842211629 Bacteria 5523832
744 2842217377 2842217011 Bacteria 7497767
745 2842227355 2842224351 Bacteria 5524473
746 2842230808 2842229732 Bacteria 7475766
747 2842239515 2842237096 Bacteria 6620661
748 2842245086 2842243621 Bacteria 7421798
749 2842255858 2842250916 Bacteria 6579627
750 2842258899 2842257432 Bacteria 7401195
751 2842265920 2842264693 Bacteria 6472963
752 2842276431 2842271015 Bacteria 7807131
753 2842279370 2842278818 Bacteria 6340002
754 2842286020 2842285085 Bacteria 6011953
755 2842291938 2842291075 Bacteria 7076806
756 2842302030 2842298080 Bacteria 6123127
757 2842304429 2842304105 Bacteria 7023636
758 2842314360 2842311132 Bacteria 6616990
759 2842317791 2842317721 Bacteria 6793725
760 2842345240 2842341865 Bacteria 7003929
761 2842357503 2842357229 Bacteria 6485165
762 2842364686 2842363717 Bacteria 6844742
763 2842372653 2842370503 Bacteria 7038661
764 2842378334 2842377471 Bacteria 7140707
765 2842385725 2842384541 Bacteria 7057858
766 2842398807 2842395702 Bacteria 6780583
767 2842403380 2842402390 Bacteria 6681310
768 2842409247 2842409023 Bacteria 6687331
769 2842415901 2842415677 Bacteria 6596907
770 2842427484 2842422224 Bacteria 6239196
771 2842429443 2842428310 Bacteria 6767288
772 2842436056 2842434925 Bacteria 6502746
773 2842442403 2842441272 Bacteria 6769273
774 2842450694 2842447887 Bacteria 6754142
775 2842463864 2842462802 Bacteria 6588055
776 2842470385 2842469257 Bacteria 6752936
777 2842476637 2842475841 Bacteria 6603183
778 2842484823 2842482326 Bacteria 7212537
779 2842490142 2842489311 Bacteria 6620893
780 2842496062 2842495871 Bacteria 6820686
781 2842503606 2842502639 Bacteria 6604161
782 2842511422 2842509118 Bacteria 6850950
783 2842518391 2842515876 Bacteria 5436280
784 2842522694 2842521101 Bacteria 6569494
785 2842874223 2842871566 Bacteria 4827117
786 2842923983 2842922631 Bacteria 5824079
787 2844167584 2844163670 Bacteria 7266046
788 2844459028 2844454524 Bacteria 7952546
789 2847419087 2847417321 Bacteria 6913799
790 2848994117 2848992105 Bacteria 6810864
791 2850081159 2850079185 Bacteria 6848280
792 2852389912 2852387548 Bacteria 8025568
793 2854899355 2854896431 Bacteria 5869725
794 2854913492 2854911287 Bacteria 5582813
795 2854917967 2854916844 Bacteria 5725939
796 2855825990 2855825444 Bacteria 6785811
797 2855841335 2855839649 Bacteria 7135830
798 2855876762 2855872281 Bacteria 6964271
799 2857519840 2857516855 Bacteria 7787325
800 2857535118 2857531043 Bacteria 6754041
801 2858802322 2858800743 Bacteria 6603254
802 2891050897 2891048133 Bacteria 4447501
803 2894656810 2894652903 Bacteria 4587256
804 2896384844 2896384573 Bacteria 7700774
805 2899795598 2899792073 Bacteria 4926588
806 2899809011 2899803654 Bacteria 5577784
807 2899849924 2899845264 Bacteria 5672268
808 2904582500 2904578770 Bacteria 5302906
809 2913300839 2913295892 Bacteria 6333755
810 2913311354 2913308742 Bacteria 5350706
811 2915981888 2915980308 Bacteria 6624279
812 2915991339 2915986958 Bacteria 6739310
813 2915994363 2915993759 Bacteria 7016183
814 2916004384 2916000859 Bacteria 6865702
815 2916008148 2916007675 Bacteria 6898660
816 2916015087 2916014648 Bacteria 6946486
817 2916024234 2916021584 Bacteria 6854472
818 2916031766 2916028427 Bacteria 6748433
819 2916041272 2916035215 Bacteria 6755766
820 2916042734 2916041962 Bacteria 6820487
821 2916052278 2916048683 Bacteria 6543552
822 2916056435 2916055098 Bacteria 6758838
823 2916067574 2916061851 Bacteria 6737736
824 2916074290 2916068649 Bacteria 6943657
825 2916080865 2916076590 Bacteria 6596108
826 2919106514 2919100787 Bacteria 7710546
827 2919117472 2919114240 Bacteria 5700270
828 2919123979 2919119836 Bacteria 5208557
829 2919168634 2919166419 Bacteria 4952238
830 2919174963 2919171160 Bacteria 6499771
831 2919411676 2919408235 Bacteria 6149349
832 2920766093 2920760137 Bacteria 7427611
833 2920824723 2920822456 Bacteria 6897201
834 2921201936 2921201388 Bacteria 6926299
835 2921211206 2921208531 Bacteria 6745326
836 2921240725 2921237296 Bacteria 6876710
837 2921244636 2921244191 Bacteria 6568419
838 2921251171 2921250672 Bacteria 6677771
839 2921262466 2921257292 Bacteria 6808382
840 2921265114 2921263974 Bacteria 6864552
841 2921283769 2921282425 Bacteria 6826397
842 2921296323 2921289301 Bacteria 7316391
843 2921299373 2921296804 Bacteria 7176999
844 2923558042 2923556063 Bacteria 6793593
845 2924147100 2924144063 Bacteria 6883928
846 2924155256 2924150972 Bacteria 7169444
847 2924160765 2924158325 Bacteria 7188855
848 2924167343 2924165586 Bacteria 7260590
849 2924178984 2924172951 Bacteria 6749356
850 2924184072 2924179722 Bacteria 6843264
851 2924189067 2924186466 Bacteria 6876637
852 2924194794 2924193448 Bacteria 6955718
853 2924203358 2924200457 Bacteria 6757188
854 2924208832 2924207177 Bacteria 6917007
855 2924217922 2924214083 Bacteria 7080103
856 2924226510 2924221636 Bacteria 7113495
857 2924229948 2924228884 Bacteria 6633132
858 2926758918 2926754445 Bacteria 5964435
859 2926763570 2926760298 Bacteria 5505990
860 2929138835 2929138655 Bacteria 5810547
861 2932403597 2932401849 Bacteria 4262978
862 2933009850 2933006813 Bacteria 4912075
863 2933014018 2933011516 Bacteria 5439334
864 2933018400 2933016740 Bacteria 6355406
865 2933571703 2933570622 Bacteria 7023390
866 2933590369 2933586486 Bacteria 7667493
867 2933595805 2933594066 Bacteria 5594265
868 2933604856 2933599457 Bacteria 5858799
869 2935897487 2935894831 Bacteria 6620579
870 2935905549 2935901341 Bacteria 7341747
871 2936372565 2936367885 Bacteria 7324495
872 2936376439 2936375103 Bacteria 6652732
873 2936387229 2936381700 Bacteria 7006523
874 2936998122 2936996657 Bacteria 6298727
875 2937005066 2937002841 Bacteria 6934057
876 2937012206 2937009748 Bacteria 6746052
877 2937018635 2937016420 Bacteria 6782579
878 2937028974 2937023124 Bacteria 6815156
879 2937031278 2937029754 Bacteria 6424026
880 2937038581 2937036028 Bacteria 6846469
881 2937045883 2937042894 Bacteria 6741576
882 2937050948 2937049772 Bacteria 6757901
883 2937061542 2937056579 Bacteria 7107896
884 2937065227 2937063883 Bacteria 7199456
885 2937073050 2937071275 Bacteria 6984483
886 2937079800 2937078374 Bacteria 6610289
887 2937087053 2937084907 Bacteria 6618516
888 2937097590 2937091812 Bacteria 6979387
889 2937099537 2937098957 Bacteria 7249374
890 2937110011 2937106411 Bacteria 6947143
891 2937116267 2937113482 Bacteria 6505872
892 2937123077 2937119839 Bacteria 6597547
893 2937128710 2937126314 Bacteria 6771275
894 2941504975 2941499720 Bacteria 7599444
895 2954011343 2954011201 Bacteria 4762601
896 2957376586 2957375807 Bacteria 6425588
897 2957384804 2957382221 Bacteria 6737050
898 2957394846 2957388812 Bacteria 6778072
899 2957398268 2957395598 Bacteria 6822399
900 2957403204 2957402308 Bacteria 6741770
901 2957411597 2957408893 Bacteria 6558585
902 2957418321 2957415311 Bacteria 6991633
903 2957423294 2957422303 Bacteria 7172205
904 2957432801 2957430029 Bacteria 7022557
905 2957441266 2957437181 Bacteria 6568994
906 2957444990 2957443900 Bacteria 6869977
907 2957455971 2957450854 Bacteria 6765715
908 2957459918 2957457609 Bacteria 6967680
909 2957465994 2957464669 Bacteria 6568877
910 2957477089 2957471148 Bacteria 6797643
911 2957479217 2957478035 Bacteria 6756658
912 2957486258 2957484790 Bacteria 6703082
913 2957498037 2957491536 Bacteria 6695180
914 2957498694 2957498199 Bacteria 7126688
915 2957507655 2957505466 Bacteria 7253085
916 2960584305 2960584000 Bacteria 6864594
917 2960592715 2960591022 Bacteria 6622873
918 2960602685 2960597568 Bacteria 6550735
919 2960605936 2960603979 Bacteria 6898737
920 2960612422 2960610863 Bacteria 6691244
921 2960620012 2960617483 Bacteria 6727748
922 2960630922 2960624210 Bacteria 6875384
923 2960632832 2960631154 Bacteria 6732508
924 2960639854 2960637947 Bacteria 7296468
925 2960650506 2960645483 Bacteria 7211087
926 2960660037 2960652885 Bacteria 7083688
927 2960660848 2960660292 Bacteria 7041660
928 2960670968 2960667422 Bacteria 6763020
929 2960675911 2960674078 Bacteria 6609048
930 2960681861 2960680706 Bacteria 6624464
931 2960689952 2960687367 Bacteria 6535474
932 2960694659 2960693952 Bacteria 6749742
933 2964609193 2964607997 Bacteria 7101408
934 2964616578 2964615318 Bacteria 6809089
935 2964622580 2964621998 Bacteria 6834995
936 2964635801 2964628898 Bacteria 7083044
937 2964640949 2964636051 Bacteria 7091832
938 2964649475 2964643177 Bacteria 6820887
939 2964651785 2964649959 Bacteria 6675118
940 2964661009 2964656573 Bacteria 7100150
941 2964667045 2964663802 Bacteria 7019362
942 2964677503 2964670856 Bacteria 6851364
943 2964684093 2964678106 Bacteria 6792020
944 2964687287 2964685014 Bacteria 6839111
945 2964692861 2964691889 Bacteria 6802758
946 2964702320 2964698721 Bacteria 6765331
947 2964711846 2964705432 Bacteria 7114648
948 2964716769 2964712639 Bacteria 6695970
949 2964723892 2964719344 Bacteria 7286602
950 2967665499 2967664464 Bacteria 6948836
951 2967672562 2967671571 Bacteria 7021409
952 2967681855 2967678726 Bacteria 7264382
953 2967691702 2967686174 Bacteria 6678622
954 2967695253 2967693043 Bacteria 6804451
955 2967703247 2967699805 Bacteria 6854538
956 2967707790 2967706974 Bacteria 7186053
957 2967716663 2967714385 Bacteria 7000047
958 2967721664 2967721400 Bacteria 7073753
959 2967734985 2967728569 Bacteria 6641507
960 2967736862 2967735183 Bacteria 6827012
961 2967744126 2967742019 Bacteria 6794534
962 2967755483 2967748971 Bacteria 6733771
963 2967758751 2967755722 Bacteria 6814706
964 2967765381 2967762386 Bacteria 6923502
965 2967775659 2967769361 Bacteria 6587838
966 2967782290 2967775926 Bacteria 6738189
967 2970026517 2970019648 Bacteria 7072033
968 2970031009 2970026789 Bacteria 6785236
969 2970039723 2970033650 Bacteria 7118744
970 2970041330 2970040964 Bacteria 6731123
971 2970054423 2970047711 Bacteria 7088379
972 2970057810 2970054988 Bacteria 6611507
973 2970066699 2970061556 Bacteria 7099761
974 2970072998 2970068827 Bacteria 7123112
975 2970077460 2970076120 Bacteria 6697332
976 2970086195 2970082768 Bacteria 6183754
977 2970091171 2970088815 Bacteria 6933825
978 2970097290 2970095765 Bacteria 6936963
979 2970107501 2970102677 Bacteria 6812532
980 2970110864 2970109326 Bacteria 6863976
981 2970122164 2970116247 Bacteria 6501857
982 2970122982 2970122695 Bacteria 6625855
983 2970131685 2970129317 Bacteria 6806560
984 2970138583 2970136068 Bacteria 7207982
985 2970144098 2970143518 Bacteria 6446480
986 2970154254 2970149975 Bacteria 6779706
987 2970160215 2970156795 Bacteria 7168044
988 2970167124 2970164137 Bacteria 6861252
989 2970173282 2970170962 Bacteria 6876229
990 2970180319 2970177841 Bacteria 6768001
991 2970187581 2970184632 Bacteria 7054431
992 2970193338 2970191845 Bacteria 7032787
993 2977522401 2977516862 Bacteria 6940108
994 2977529041 2977523885 Bacteria 6960446
995 2977531671 2977530762 Bacteria 6951399
996 2977540562 2977537788 Bacteria 6929320
997 2977549086 2977544691 Bacteria 6875412
998 2977554416 2977551784 Bacteria 7125765
999 2977560184 2977558990 Bacteria 6863948
1000 2977572258 2977565890 Bacteria 6901543
1001 2977575291 2977572785 Bacteria 6763888
1002 2977580175 2977579622 Bacteria 6772100
1003 2978971324 2978969890 Bacteria 5400756
1004 2979091390 2979089926 Bacteria 5670289
1005 2979096913 2979095461 Bacteria 5669583
1006 2979101416 2979100975 Bacteria 5423623
1007 2984510632 2984509177 Bacteria 5274802
1008 2984518665 2984518228 Bacteria 5277463
1009 2984538981 2984537506 Bacteria 5277481
1010 2984588469 2984587000 Bacteria 5263363
1011 2984605678 2984601300 Bacteria 5455244
1012 2989778927 2989776772 Bacteria 4843317
1013 2995393081 2995392953 Bacteria 4539380
1014 2996316101 2996310559 Bacteria 6357320
1015 2996891821 2996887358 Bacteria 5795980
1016 2996894043 2996893221 Bacteria 5823108
1017 3002145524 3002141150 Bacteria 5254435
1018 3003933777 3003930520 Bacteria 5667563
1019 3005414979 3005409236 Bacteria 7188837
1020 3005420093 3005416602 Bacteria 7064308
1021 3005448249 3005445848 Bacteria 6906074
1022 3005454356 3005452660 Bacteria 5889319
1023 639648668 639633055 Bacteria 7751309
1024 643825977 643692032 Bacteria 6891900
1025 648739559 648276728 Bacteria 6968865
1026 650843040 650716007 Bacteria 5573770
1027 8003574251 8003570095 Bacteria 5747666
1028 8003993850 8003992118 Bacteria 7266902
1029 8004001395 8003999396 Bacteria 7063185
1030 8005248480 8005246636 Bacteria 4933972
1031 8005263152 8005258706 Bacteria 6184835
1032 8005280690 8005275841 Bacteria 6929066
1033 8005287091 8005282627 Bacteria 6675747
1034 8005293213 8005289223 Bacteria 6634003
1035 8005302676 8005301065 Bacteria 6614431
1036 8005309858 8005307578 Bacteria 7395396
1037 8005317044 8005314921 Bacteria 7072929
1038 8005326348 8005321885 Bacteria 5795980
1039 8005379355 8005376324 Bacteria 6590079
1040 8005385359 8005382845 Bacteria 6732062
1041 8005396648 8005395548 Bacteria 6806915
1042 8005435937 8005430974 Bacteria 6689030
1043 8005463081 8005460587 Bacteria 7157962
1044 8005485161 8005484373 Bacteria 6297373
1045 8005500456 8005497431 Bacteria 6477605
1046 8005545264 8005542996 Bacteria 7077758
1047 8005557578 8005556819 Bacteria 6908598
1048 8005568749 8005563573 Bacteria 7153261
1049 8005574366 8005570704 Bacteria 6957481
1050 8005621834 8005619151 Bacteria 7030230
1051 8005627076 8005626139 Bacteria 6534237
1052 8005645324 8005645114 Bacteria 6950293
1053 8005659559 8005658619 Bacteria 4500593
1054 8005671874 8005668836 Bacteria 6953162
1055 8005683175 8005682033 Bacteria 6726518
1056 8005694692 8005688590 Bacteria 6610080
1057 8005699886 8005695170 Bacteria 6912330
1058 8018130034 8018127388 Bacteria 7351159
1059 8018152648 8018150411 Bacteria 5549903
1060 8018166665 8018163183 Bacteria 7277977
1061 8018179713 8018176218 Bacteria 6896178
1062 8023685251 8023680758 Bacteria 7729763
1063 8024483409 8024479707 Bacteria 6954785
1064 8024492252 8024486573 Bacteria 6540512
1065 8024501523 8024501048 Bacteria 6427847
1066 8046773778 8046767195 Bacteria 7547379
1067 8049294961 8049293176 Bacteria 6128433
1068 8054464583 8054460903 Bacteria 4872905
1069 8055432582 8055431914 Bacteria 4551896
1070 8056376745 8056375014 Bacteria 7006639
1071 8056387956 8056382006 Bacteria 6408074
1072 8056877779 8056875544 Bacteria 4355797
1073 8057576847 8057575449 Bacteria 7367519
1074 8057874928 8057874678 Bacteria 7494653
1075 Ga0105241_10030240
1076 JGI24740J21852_10000136
1077 JGI25155J39150_1000001
1078 JGI25156J39149_1000001
1079 JGI25154J39366_1000011
1080 JGI25158J39367_1000114
1081 JGI25157J39369_1000030
1082 JGI25152J39213_1000570
1083 JGI25152J39213_1001028
1084 JGI25152J39213_1005380
1085 JGI25150J39212_1000326
1086 JGI25159J45721_1000078
1087 JGI25159J45721_1000199
1088 JGI25159J45721_1008988
1089 JGI25151J46595_10000083
1090 JGI25151J46595_10000603
1091 JGI25151J46595_10014053
1092 JGI25165J46597_1004159
1093 JGI25153J46596_10002343
1094 JGI25153J46596_10005742
1095 JGI25153J46596_10008791
1096 JGI25160J50197_1000010
1097 JGI25160J50197_1000216
1098 JGI25160J50197_1008518
1099 JGI25160J50197_1012212
1100 JGI25160J50197_1012905
1101 JGI25161J50226_1000006
1102 JGI25161J50226_1000138
1103 JGI25161J50226_1000412
1104 JGI25161J50226_1000583
1105 JGI25161J50226_1001023
1106 Ga0055526_1000594
1107 Ga0055526_1000998
1108 Ga0055526_1006006
1109 Ga0055526_1014891
1110 Ga0055524_1000866
1111 Ga0055524_1001805
1112 Ga0055524_1001872
1113 Ga0055524_1004012
1114 Ga0055528_1000358
1115 Ga0055528_1000676
1116 Ga0055528_1001985
1117 Ga0055528_1005700
1118 Ga0055528_1007582
1119 Ga0055540_1000354
1120 Ga0055540_1013619
1121 Ga0055531_10018855
1122 Ga0055531_10019507
1123 Ga0058692_1002834
1124 Ga0055543_1000053
1125 Ga0055543_1000301
1126 Ga0055543_1001332
1127 Ga0065165_1000717
1128 Ga0065165_1009792
1129 Ga0065165_1012321
1130 Ga0070658_10005999
1131 Ga0070670_100001771
1132 Ga0070660_100021341
1133 Ga0070661_100003058
1134 Ga0070661_100012268
1135 Ga0070661_100038645
1136 Ga0070661_100048108
1137 Ga0070661_100228306
1138 Ga0070668_100005878
1139 Ga0070668_100122993
1140 Ga0070668_100259398
1141 Ga0070671_100220808
1142 Ga0070659_100004052
1143 Ga0070659_100008711
1144 Ga0070659_100019420
1145 Ga0070659_100333682
1146 Ga0070684_100148732
1147 Ga0068853_100000271
1148 Ga0068853_100024802
1149 Ga0068853_100037735
1150 Ga0070665_100097786
1151 Ga0068855_100040700
1152 Ga0068855_100044031
1153 Ga0068855_100175558
1154 Ga0068855_100289863
1155 Ga0070664_100046347
1156 Ga0068857_100009724
1157 Ga0068854_100001115
1158 Ga0068854_100022418
1159 Ga0068856_100024578
1160 Ga0068856_100055765
1161 Ga0068856_100100092
1162 Ga0068856_100130470
1163 Ga0068856_100216897
1164 Ga0068852_100002681
1165 Ga0068852_100008011
1166 Ga0068852_100012510
1167 Ga0068852_100013007
1168 Ga0068852_100017842
1169 Ga0068852_100170827
1170 Ga0068852_100381707
1171 Ga0081455_10115747
1172 Ga0075365_10000306
1173 Ga0075365_10000404
1174 Ga0075365_10015261
1175 Ga0075365_10030747
1176 Ga0075368_10019516
1177 Ga0075363_100039411
1178 Ga0075364_10000091
1179 Ga0075364_10011277
1180 Ga0075362_10004177
1181 Ga0075362_10035850
1182 Ga0075367_10001214
1183 Ga0075367_10003637
1184 Ga0075366_10001037
1185 Ga0075366_10008524
1186 Ga0075366_10054185
1187 Ga0075370_10002712
1188 Ga0079104_1000610
1189 Ga0079104_1013220
1190 Ga0099826_10000054
1191 Ga0105251_10023177
1192 Ga0105240_10000005
1193 Ga0105240_10009447
1194 Ga0105240_10087374
1195 Ga0105243_10039379
1196 Ga0105241_10006649
1197 Ga0105241_10031587
1198 Ga0105241_10115356
1199 Ga0105248_10191206
1200 Ga0105237_10000809
1201 Ga0105237_10006832
1202 Ga0105238_10001305
1203 Ga0105238_10073212
1204 Ga0123341_1000188
1205 Ga0123342_1014890
1206 Ga0123342_1033521
1207 Ga0105239_10012400
1208 Ga0105239_10197818
1209 Ga0157373_10015740
1210 Ga0157373_10133085
1211 Ga0157371_10000002
1212 Ga0157371_10015741
1213 Ga0157370_10000286
1214 Ga0157370_10001170
1215 Ga0157370_10043828
1216 Ga0157370_10108215
1217 Ga0157369_10058539
1218 Ga0157369_10226328
1219 Ga0171463_1003
1220 Ga0157378_10016798
1221 Ga0157378_10204004
1222 Ga0157372_10093818
1223 Ga0157372_10236234
1224 Ga0182007_10004491
1225 Ga0183363_1047
1226 Ga0214544_1001682
1227 Ga0214542_1001614
1228 Ga0214542_1016791
1229 Ga0214543_1000078
1230 Ga0214543_1001395
1231 Ga0228711_1000016
1232 Ga0228710_1000013
1233 Ga0209435_100012
1234 Ga0209436_100085
1235 Ga0207427_101277
1236 Ga0209437_100047
1237 Ga0209437_100165
1238 Ga0207425_1000024
1239 Ga0207425_1003357
1240 Ga0207425_1004232
1241 Ga0207425_1016370
1242 Ga0209646_1000026
1243 Ga0209026_1000014
1244 Ga0209677_103130
1245 Ga0209759_1000012
1246 Ga0209129_1000069
1247 Ga0209129_1000184
1248 Ga0209129_1000376
1249 Ga0209129_1000703
1250 Ga0209129_1000735
1251 Ga0209129_1003238
1252 Ga0209233_1000048
1253 Ga0209233_1000069
1254 Ga0209233_1000195
1255 Ga0209233_1000208
1256 Ga0209673_1000010
1257 Ga0209673_1000013
1258 Ga0209673_1000296
1259 Ga0209673_1000850
1260 Ga0209673_1002846
1261 Ga0209673_1005667
1262 Ga0209673_1008745
1263 Ga0209130_1000021
1264 Ga0209130_1000029
1265 Ga0209130_1000081
1266 Ga0209676_1007150
1267 Ga0209676_1009134
1268 Ga0209025_1000050
1269 Ga0209025_1000166
1270 Ga0209025_1000959
1271 Ga0209025_1001225
1272 Ga0209025_1001950
1273 Ga0209025_1004412
1274 Ga0209025_1022035
1275 Ga0209025_1026054
1276 Ga0209564_1000260
1277 Ga0209564_1000278
1278 Ga0209564_1000584
1279 Ga0209564_1000920
1280 Ga0209564_1004501
1281 Ga0209564_1016076
1282 Ga0209564_1016737
1283 Ga0209564_1021031
1284 Ga0209758_1000083
1285 Ga0209758_1000418
1286 Ga0209758_1001270
1287 Ga0209758_1001487
1288 Ga0209758_1001756
1289 Ga0209758_1005225
1290 Ga0209050_1003249
1291 Ga0209050_1031523
1292 Ga0209256_1000042
1293 Ga0209256_1000383
1294 Ga0209256_1000588
1295 Ga0209256_1001127
1296 Ga0209256_1002941
1297 Ga0209256_1010688
1298 Ga0209256_1031368
1299 Ga0207426_1000008
1300 Ga0207426_1000010
1301 Ga0207426_1000039
1302 Ga0207426_1000074
1303 Ga0207426_1000952
1304 Ga0209051_1000611
1305 Ga0209051_1002092
1306 Ga0209051_1010035
1307 Ga0209051_1016142
1308 Ga0209257_1002801
1309 Ga0209257_1007900
1310 Ga0207705_10030520
1311 Ga0207705_10041547
1312 Ga0207654_10040636
1313 Ga0207654_10042574
1314 Ga0207695_10000011
1315 Ga0207695_10038263
1316 Ga0207671_10000804
1317 Ga0207671_10018551
1318 Ga0207657_10014455
1319 Ga0207657_10046011
1320 Ga0207649_10001779
1321 Ga0207649_10008450
1322 Ga0207649_10060527
1323 Ga0207694_10014275
1324 Ga0207650_10002483
1325 Ga0207644_10202029
1326 Ga0207690_10038204
1327 Ga0207690_10105357
1328 Ga0207691_10082674
1329 Ga0207667_10010615
1330 Ga0207667_10016213
1331 Ga0207667_10071066
1332 Ga0207667_10082530
1333 Ga0207668_10049389
1334 Ga0207668_10274457
1335 Ga0207668_10331068
1336 Ga0207640_10002795
1337 Ga0207640_10053445
1338 Ga0207640_10147048
1339 Ga0207639_10001791
1340 Ga0207678_10054418
1341 Ga0207678_10200116
1342 Ga0207702_10045718
1343 Ga0207702_10076174
1344 Ga0207702_10099294
1345 Ga0207702_10105393
1346 Ga0207702_10184388
1347 Ga0207702_10214492
1348 Ga0207674_10071035
1349 Ga0207698_10000890
1350 Ga0207698_10039607
1351 Ga0207698_10049365
1352 Ga0207698_10131252
1353 Ga0207698_10144437
1354 Ga0207698_10202097
1355 Ga0209281_1000036
1356 Ga0209281_1000047
1357 Ga0209281_1000221
1358 Ga0209281_1000453
1359 Ga0209371_1000012
1360 Ga0209371_1002509
1361 Ga0209371_1003859
1362 Ga0209282_1000041
1363 Ga0209282_1000140
1364 Ga0209813_10005946
1365 Ga0268266_10074885
1366 Ga0268266_10139096
1367 Ga0265318_10003757
1368 Ga0307515_10000023
1369 Ga0307515_10046287
1370 Ga0307515_10080288
1371 Ga0265338_10013153
1372 Ga0268256_1000013
1373 Ga0268256_1003570
1374 Ga0316181_1124615
1375 Ga0265330_10030273
1376 Ga0265332_10026923
1377 Ga0265325_10001358
1378 Ga0265329_10006287
1379 Ga0265339_10000443
1380 Ga0265331_10014508
1381 Ga0265316_10038069
1382 Ga0307513_10003030
1383 Ga0307408_100122433
1384 Ga0265313_10000048
1385 Ga0265314_10010928
1386 Ga0265342_10013396
1387 Ga0307405_10000781
1388 Ga0307405_10061347
1389 Ga0307405_10152944
1390 Ga0307407_10191787
1391 Ga0307412_10140528
1392 Ga0315914_1000030
1393 Ga0307416_100085503
1394 Ga0307414_10100666
1395 Ga0307411_10119669
1396 Ga0315913_1000017
1397 Ga0315915_1000017
1398 Ga0395901_0264505
1399 Ga0400483_029206
1400 Ga0400483_091231
1401 Ga0400483_094012
1402 Ga0400483_124851
1403 Ga0400483_290121
1404 Ga0436360_0610068
1405 Ga0439436_0001642
1406 Ga0439439_0010918
1407 Ga0451787_009192
1408 Ga0451807_1358952
1409 Ga0451833_0028360
1410 Ga0451841_0180374
1411 Ga0451845_0316168
1412 Ga0451849_0293555
1413 Ga0451851_0510789
1414 Ga0451843_0517638
1415 Ga0451853_0469856
1416 Ga0439431_0025176
1417 Ga0439449_0005799
1418 Ga0466957_0089726
1419 Ga0495629_0065953
1420 Ga0495638_0001984
1421 Ga0495662_0012415
1422 Ga0495585_0046485
1423 Ga0495606_0089977
1424 Ga0495631_0011061
1425 Ga0495654_0000090
1426 Ga0495587_0126025
1427 Ga0495622_0005922
1428 Ga0495625_0050368
1429 Ga0495588_0011344
1430 Ga0495624_0069428
1431 Ga0495649_0041615
1432 Ga0495604_0048763
1433 Ga0495681_0000886
1434 Ga0495686_0008216
1435 Ga0496100_0042674
1436 Ga0496102_0109133
1437 Ga0496110_0184017
1438 Ga0496111_0012743
1439 Ga0496111_0056372
1440 Ga0496113_0022885
1441 Ga0496114_0173611
1442 Ga0496116_0000061
1443 Ga0496116_0018700
1444 Ga0496116_0067462
1445 Ga0496117_0000016
1446 Ga0496118_0000535
1447 Ga0496118_0016390
1448 Ga0496118_0025170
1449 Ga0496118_0035617
1450 Ga0496118_0036469
1451 Ga0496119_0021558
1452 Ga0496119_0083943
1453 Ga0496120_0000056
1454 Ga0496120_0055452
1455 Ga0496121_0000001
1456 Ga0496121_0003418
1457 Ga0496121_0025293
1458 Ga0496121_0049063
1459 Ga0496121_0051938
1460 Ga0496122_0000002
1461 Ga0496122_0000369
1462 Ga0496122_0019117
1463 Ga0496122_0049793
1464 Ga0496122_0053662
1465 Ga0496122_0171475
1466 Ga0496123_0000002
1467 Ga0496123_0000054
1468 Ga0496123_0045707
1469 Ga0496123_0073509
1470 Ga0496124_0000091
1471 Ga0496124_0002629
1472 Ga0496124_0010219
1473 Ga0496124_0060519
1474 Ga0496124_0124752
1475 Ga0496124_0158031
1476 Ga0496125_0000001
1477 Ga0496125_0000301
1478 Ga0496126_0000059
1479 Ga0496126_0024626
1480 Ga0501031_0000831
1481 Ga0501031_0042020
1482 Ga0501032_0000019
1483 Ga0501032_0010722
1484 Ga0501033_0003165
1485 Ga0501034_0000130
1486 Ga0501034_0001091
1487 Ga0501034_0003341
1488 Ga0501034_0025994
1489 Ga0501034_0086855
1490 Ga0501034_0102421
1491 Ga0501034_0127961
1492 Ga0501034_0254112
1493 Ga0501036_0000635
1494 Ga0501036_0072071
1495 Ga0501036_0153858
1496 Ga0501037_0005590
1497 Ga0501037_0008501
1498 Ga0501037_0086156
1499 Ga0501038_0000478
1500 Ga0501038_0030525
1501 Ga0501039_0000028
1502 Ga0501039_0012409
1503 Ga0501039_0169072
1504 Ga0501041_0106345
1505 Ga0501043_0003505
1506 Ga0501043_0155011
1507 Ga0501046_0140291
1508 Ga0501047_0261675
1509 Ga0501047_0272208
1510 Ga0501048_0156218
1511 Ga0501069_0125237
1512 Ga0501070_0187400
1513 Ga0501073_0157453
1514 Ga0501074_0209435
1515 Ga0501280_005335
1516 Ga0501035_0000143
1517 Ga0501035_0092282
1518 Ga0501044_0008899
1519 nmdc:mga00v17_156_c1
1520 nmdc:mga00v17_3_c1
1521 nmdc:mga00v17_8320_c1
1522 nmdc:mga0k408_17499_c1
1523 nmdc:mga04h51_41482_c1
1524 nmdc:mga0sz30_2395_c1
1525 Ga0500572_011708
1526 Ga0500618_002658
1527 Ga0500658_0017602
1528 Ga0500568_0030432
1529 Ga0500568_0035223
1530 Ga0500573_0000259
1531 Ga0500604_0000146
1532 Ga0500604_0002515
1533 Ga0500616_0000301
1534 Ga0500616_0006977
1535 Ga0500616_0008228
1536 Ga0500616_0009464
1537 Ga0500622_0002301
1538 Ga0500624_000733
1539 Ga0500634_0000004
1540 Ga0500634_0001667
1541 Ga0500636_0000034
1542 Ga0500636_0029235
1543 Ga0587077_008812
1544 Ga0587098_001071
1545 Ga0587072_004741
1546 Ga0587076_009010
1547 2509111396
1548 2509375665
1549 2509392532
1550 2509446553
1551 2510133445
1552 2510303291
1553 2510840035
1554 2510894832
1555 2511135126
1556 2511171672
1557 2511181658
1558 2511194372
1559 2511391053
1560 2511501971
1561 2512533339
1562 2512971092
1563 2513572368
1564 2513577417
1565 2513582632
1566 2513594691
1567 2513604551
1568 2513615466
1569 2513629948
1570 2513708592
1571 2513864761
1572 2513881255
1573 2513902386
1574 2513914111
1575 2513926064
1576 2513984594
1577 2513997064
1578 2514007604
1579 2514021957
1580 2514586446
1581 2515112410
1582 2515608764
1583 2515632759
1584 2515639907
1585 2515655888
1586 2515740324
1587 2516209691
1588 2516893267
1589 2517036142
1590 2517076532
1591 2517095299
1592 2517406903
1593 2517570024
1594 2520379231
1595 2524448833
1596 2524460267
1597 2530645651
1598 2535516606
1599 2537877764
1600 2551675155
1601 2551680519
1602 2551688052
1603 2551691140
1604 2551693966
1605 2551698099
1606 2551699980
1607 2551713206
1608 2551722514
1609 2551727853
1610 2551736514
1611 2551745075
1612 2554245552
1613 2558867981
1614 2559296618
1615 2561468294
1616 2585166135
1617 2585200287
1618 2585222631
1619 2585229894
1620 2585254873
1621 2585267661
1622 2585270866
1623 2585277214
1624 2585323777
1625 2585331756
1626 2585386720
1627 2585393050
1628 2585402123
1629 2585527771
1630 2585534050
1631 2585537666
1632 2585545214
1633 2585552099
1634 2585558590
1635 2585821908
1636 2585835616
1637 2585846832
1638 2585897953
1639 2585904441
1640 2585996024
1641 2586000628
1642 2587980442
1643 2599331585
1644 2599417540
1645 2599602889
1646 2599720978
1647 2600193090
1648 2600375704
1649 2601610498
1650 2601747172
1651 2616292344
1652 2616308592
1653 2616557103
1654 2617385655
1655 2643803590
1656 2643812592
1657 2643854247
1658 2643910295
1659 2643911158
1660 2643917409
1661 2643963846
1662 2644003875
1663 2644050732
1664 2644067557
1665 2644107703
1666 2644133778
1667 2644148626
1668 2644165318
1669 2644192600
1670 2644205206
1671 2644210225
1672 2644239683
1673 2644298399
1674 2644309097
1675 2644332925
1676 2644348301
1677 2644375237
1678 2644410790
1679 2644411995
1680 2644418610
1681 2644451977
1682 2644483650
1683 2644491799
1684 2644501351
1685 2644520747
1686 2644545903
1687 2644615039
1688 2644653777
1689 2644656628
1690 2644676576
1691 2644690739
1692 2657681194
1693 2671111704
1694 2692315849
1695 2719181301
1696 2719385909
1697 2719665725
1698 2719732050
1699 2720492145
1700 2720613410
1701 2720620288
1702 2720631712
1703 2720775440
1704 2721147395
1705 2721158929
1706 2721164313
1707 2721399688
1708 2722840483
1709 2723027058
1710 2723560670
1711 2723567259
1712 2724038501
1713 2724044806
1714 2724090047
1715 2724104524
1716 2724110318
1717 2725948586
1718 2730107994
1719 2730164538
1720 2730298561
1721 2738804206
1722 2738946063
1723 2739036629
1724 2753461861
1725 2757572114
1726 2765468597
1727 2766067422
1728 2770198895
1729 2776272878
1730 2776282279
1731 2776913544
1732 2778174030
1733 2792581763
1734 2792620167
1735 2792626413
1736 2792639362
1737 2793279937
1738 2793294802
1739 2793312380
1740 2793322919
1741 2793331014
1742 2793335932
1743 2793341644
1744 2793348950
1745 2793352948
1746 2793364349
1747 2793366860
1748 2802719519
1749 2802726888
1750 2802732253
1751 2802739856
1752 2802745362
1753 2802752754
1754 2804752394
1755 2805925824
1756 2805933456
1757 2806046179
1758 2806054559
1759 2806060563
1760 2806064979
1761 2806072238
1762 2808987071
1763 2819241740
1764 2819560626
1765 2819612784
1766 2819637897
1767 2819684749
1768 2821129480
1769 2837654140
1770 2838018087
1771 2838026294
1772 2838030078
1773 2838038247
1774 2838043567
1775 2838053484
1776 2838065685
1777 2838074400
1778 2838079592
1779 2838661876
1780 2838673740
1781 2838677881
1782 2838682086
1783 2838691916
1784 2838696658
1785 2838706242
1786 2838710103
1787 2838717214
1788 2838722176
1789 2838727963
1790 2838732937
1791 2838738488
1792 2838745815
1793 2839996553
1794 2840770302
1795 2841841143
1796 2841849622
1797 2841855726
1798 2841861342
1799 2841864410
1800 2842078276
1801 2842114274
1802 2842119216
1803 2842127630
1804 2842132774
1805 2842140921
1806 2842150996
1807 2842154767
1808 2842157282
1809 2842167940
1810 2842173266
1811 2842178388
1812 2842181134
1813 2842190322
1814 2842194395
1815 2842201773
1816 2842205913
1817 2842214636
1818 2842217377
1819 2842227355
1820 2842230808
1821 2842239515
1822 2842245086
1823 2842255858
1824 2842258899
1825 2842265920
1826 2842276431
1827 2842279370
1828 2842286020
1829 2842291938
1830 2842302030
1831 2842304429
1832 2842314360
1833 2842317791
1834 2842345240
1835 2842357503
1836 2842364686
1837 2842372653
1838 2842378334
1839 2842385725
1840 2842398807
1841 2842403380
1842 2842409247
1843 2842415901
1844 2842427484
1845 2842429443
1846 2842436056
1847 2842442403
1848 2842450694
1849 2842463864
1850 2842470385
1851 2842476637
1852 2842484823
1853 2842490142
1854 2842496062
1855 2842503606
1856 2842511422
1857 2842518391
1858 2842522694
1859 2842874223
1860 2842923983
1861 2844167584
1862 2844459028
1863 2847419087
1864 2848994117
1865 2850081159
1866 2852389912
1867 2854899355
1868 2854913492
1869 2854917967
1870 2855825990
1871 2855841335
1872 2855876762
1873 2857519840
1874 2857535118
1875 2858802322
1876 2891050897
1877 2894656810
1878 2896384844
1879 2899795598
1880 2899809011
1881 2899849924
1882 2904582500
1883 2913300839
1884 2913311354
1885 2915981888
1886 2915991339
1887 2915994363
1888 2916004384
1889 2916008148
1890 2916015087
1891 2916024234
1892 2916031766
1893 2916041272
1894 2916042734
1895 2916052278
1896 2916056435
1897 2916067574
1898 2916074290
1899 2916080865
1900 2919106514
1901 2919117472
1902 2919123979
1903 2919168634
1904 2919174963
1905 2919411676
1906 2920766093
1907 2920824723
1908 2921201936
1909 2921211206
1910 2921240725
1911 2921244636
1912 2921251171
1913 2921262466
1914 2921265114
1915 2921283769
1916 2921296323
1917 2921299373
1918 2923558042
1919 2924147100
1920 2924155256
1921 2924160765
1922 2924167343
1923 2924178984
1924 2924184072
1925 2924189067
1926 2924194794
1927 2924203358
1928 2924208832
1929 2924217922
1930 2924226510
1931 2924229948
1932 2926758918
1933 2926763570
1934 2929138835
1935 2932403597
1936 2933009850
1937 2933014018
1938 2933018400
1939 2933571703
1940 2933590369
1941 2933595805
1942 2933604856
1943 2935897487
1944 2935905549
1945 2936372565
1946 2936376439
1947 2936387229
1948 2936998122
1949 2937005066
1950 2937012206
1951 2937018635
1952 2937028974
1953 2937031278
1954 2937038581
1955 2937045883
1956 2937050948
1957 2937061542
1958 2937065227
1959 2937073050
1960 2937079800
1961 2937087053
1962 2937097590
1963 2937099537
1964 2937110011
1965 2937116267
1966 2937123077
1967 2937128710
1968 2941504975
1969 2954011343
1970 2957376586
1971 2957384804
1972 2957394846
1973 2957398268
1974 2957403204
1975 2957411597
1976 2957418321
1977 2957423294
1978 2957432801
1979 2957441266
1980 2957444990
1981 2957455971
1982 2957459918
1983 2957465994
1984 2957477089
1985 2957479217
1986 2957486258
1987 2957498037
1988 2957498694
1989 2957507655
1990 2960584305
1991 2960592715
1992 2960602685
1993 2960605936
1994 2960612422
1995 2960620012
1996 2960630922
1997 2960632832
1998 2960639854
1999 2960650506
2000 2960660037
2001 2960660848
2002 2960670968
2003 2960675911
2004 2960681861
2005 2960689952
2006 2960694659
2007 2964609193
2008 2964616578
2009 2964622580
2010 2964635801
2011 2964640949
2012 2964649475
2013 2964651785
2014 2964661009
2015 2964667045
2016 2964677503
2017 2964684093
2018 2964687287
2019 2964692861
2020 2964702320
2021 2964711846
2022 2964716769
2023 2964723892
2024 2967665499
2025 2967672562
2026 2967681855
2027 2967691702
2028 2967695253
2029 2967703247
2030 2967707790
2031 2967716663
2032 2967721664
2033 2967734985
2034 2967736862
2035 2967744126
2036 2967755483
2037 2967758751
2038 2967765381
2039 2967775659
2040 2967782290
2041 2970026517
2042 2970031009
2043 2970039723
2044 2970041330
2045 2970054423
2046 2970057810
2047 2970066699
2048 2970072998
2049 2970077460
2050 2970086195
2051 2970091171
2052 2970097290
2053 2970107501
2054 2970110864
2055 2970122164
2056 2970122982
2057 2970131685
2058 2970138583
2059 2970144098
2060 2970154254
2061 2970160215
2062 2970167124
2063 2970173282
2064 2970180319
2065 2970187581
2066 2970193338
2067 2977522401
2068 2977529041
2069 2977531671
2070 2977540562
2071 2977549086
2072 2977554416
2073 2977560184
2074 2977572258
2075 2977575291
2076 2977580175
2077 2978971324
2078 2979091390
2079 2979096913
2080 2979101416
2081 2984510632
2082 2984518665
2083 2984538981
2084 2984588469
2085 2984605678
2086 2989778927
2087 2995393081
2088 2996316101
2089 2996891821
2090 2996894043
2091 3002145524
2092 3003933777
2093 3005414979
2094 3005420093
2095 3005448249
2096 3005454356
2097 639648668
2098 643825977
2099 648739559
2100 650843040
2101 8003574251
2102 8003993850
2103 8004001395
2104 8005248480
2105 8005263152
2106 8005280690
2107 8005287091
2108 8005293213
2109 8005302676
2110 8005309858
2111 8005317044
2112 8005326348
2113 8005379355
2114 8005385359
2115 8005396648
2116 8005435937
2117 8005463081
2118 8005485161
2119 8005500456
2120 8005545264
2121 8005557578
2122 8005568749
2123 8005574366
2124 8005621834
2125 8005627076
2126 8005645324
2127 8005659559
2128 8005671874
2129 8005683175
2130 8005694692
2131 8005699886
2132 8018130034
2133 8018152648
2134 8018166665
2135 8018179713
2136 8023685251
2137 8024483409
2138 8024492252
2139 8024501523
2140 8046773778
2141 8049294961
2142 8054464583
2143 8055432582
2144 8056376745
2145 8056387956
2146 8056877779
2147 8057576847
2148 8057874928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

31

147

0.96

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

156

291

0.94

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

37

146

0.88

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

160

373

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rye-assembly1.cif.gz_D crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis 0.8727 3 358
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8572 4 351
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8547 4 351
2glx-assembly1.cif.gz_A crystal structure analysis of bacterial 1,5-af reductase 0.8513 6 358
4gqa-assembly1.cif.gz_A-2 crystal structure of nad binding oxidoreductase from klebsiella pneumoniae 0.851 4 359
ID Description Score Start End Superfamily
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9372 3 122 3.40.50.720
3e18A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9354 3 120 3.40.50.720
af_Q9VJH7_91_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9334 5 118 3.40.50.720
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9298 3 122 3.40.50.720
af_M9PE54_6_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9271 4 118 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A504B0T3-F1-model_v4 deleted 0.9677 1 377
AF-A0A504B0T3-F1-model_v4 deleted 0.9652 1 377
AF-A0A6B1H9B9-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9648 1 119 GO:0000166
AF-A0A3B8VPJ9-F1-model_v4 Oxidoreductase 0.9608 27 251 GO:0000166
GO:0016491
AF-A0A0Q7DUK4-F1-model_v4 Oxidoreductase 0.9588 1 377 GO:0000166
GO:0016491

Map