F489560

General Info

Members Datasets Scaffolds Average Seq Length
1075 434 1037 235

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10637380|Ga0157380_106373801
Length 286
Sequence MVRRKGDIRRNPQGAARALLSSWLEAPIRLFELAANPGYGRRSATPGETAMGRTEILTREIKALAFDQYGTIVDMQKGLTEAVTPFLAKKGWKGSPDSFVTWWRRTHFENSMIDALLDRGHTPYRQIGHRAVAHVMDRCTIAYTQDEVRWLVAEIERLKPFPDVVAALEKLRSAGYKLAILSNGDLDMLRAAGPHIGFAFDHVISVAQAGYFKPHWKTYATAAELMGLDRSSILFVANHAFDCIGAKAFGMRTAFIDRRKRPFGETPHQPDLIVADFAELAAVLNP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231024 Pseudomonas sp. GM84 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
11 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
12 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
13 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
14 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
15 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
16 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
19 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
20 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
21 2904699407
22 2906610324
23 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
24 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
25 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
26 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
27 2922425934
28 2928163908 Burkholderia sp. 567 Isolate Unclassified
29 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
30 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
31 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
32 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
33 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
34 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
131 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
132 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
133 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
134 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
135 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
167 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
168 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
169 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
228 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
229 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
231 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
232 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
244 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
247 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
248 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
249 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
255 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
258 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
260 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
261 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
262 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
263 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
264 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
265 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
266 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
267 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
268 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
269 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
270 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
271 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
275 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
276 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
277 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
278 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
279 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
286 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
287 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
288 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
289 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
290 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
291 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
292 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
293 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
294 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
295 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
296 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
297 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
312 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
313 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
314 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
325 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
363 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
364 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
365 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
366 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
367 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
385 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
386 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
387 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
388 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
391 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
392 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
393 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
394 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
399 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
400 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
401 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
402 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
403 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
404 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
407 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
408 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
409 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
410 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
411 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
412 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
413 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
414 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
415 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
419 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
420 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
421 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
422 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
423 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
424 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
425 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
426 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
427 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
428 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
429 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
430 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
431 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
432 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
433 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
434 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 0.19
Isolates 3.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 3.16
Rhizoplane 3.07
Rhizosphere 86.14
Stem 0
Stem Tuber 0
Unclassified 3.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1539896 2162886007 Bacteria 2189
2 JGI25404J52841_10001396 3300003659 Bacteria 4233
3 JGI25404J52841_10027946 3300003659 Bacteria 1212
4 JGI25405J52794_10040079 3300003911 Bacteria 989
5 Ga0065704_10070608 3300005289 Bacteria 19206
6 Ga0065707_10090819 3300005295 Bacteria 4062
7 Ga0065707_10119993 3300005295 Bacteria 2145
8 Ga0070658_10006326 3300005327 Bacteria 9597
9 Ga0070676_10022931 3300005328 Bacteria 3505
10 Ga0070676_10028077 3300005328 Bacteria 3195
11 Ga0070676_10182914 3300005328 Bacteria 1364
12 Ga0070683_100074740 3300005329 Bacteria 3165
13 Ga0070690_100061242 3300005330 Bacteria 2424
14 Ga0070690_100088100 3300005330 Bacteria 2040
15 Ga0070690_100250836 3300005330 Bacteria 1252
16 Ga0070670_100013203 3300005331 Bacteria 7076
17 Ga0068869_100055272 3300005334 Bacteria 2893
18 Ga0070666_10110639 3300005335 Bacteria 1899
19 Ga0070666_10178034 3300005335 Bacteria 1491
20 Ga0070680_100001927 3300005336 Bacteria 15249
21 Ga0070680_100003662 3300005336 Bacteria 11484
22 Ga0070680_100032091 3300005336 Bacteria 4225
23 Ga0070680_100289534 3300005336 Bacteria 1388
24 Ga0070682_100246581 3300005337 Bacteria 1285
25 Ga0070660_100330502 3300005339 Bacteria 1253
26 Ga0070689_100121898 3300005340 Bacteria 2083
27 Ga0070689_100158953 3300005340 Bacteria 1826
28 Ga0070691_10000329 3300005341 Bacteria 16785
29 Ga0070691_10002207 3300005341 Bacteria 8619
30 Ga0070691_10004950 3300005341 Bacteria 6060
31 Ga0070687_100132891 3300005343 Bacteria 1439
32 Ga0070687_100145007 3300005343 Bacteria 1387
33 Ga0070687_100397911 3300005343 Bacteria 902
34 Ga0070692_10033526 3300005345 Bacteria 2588
35 Ga0070668_100122403 3300005347 Bacteria 2081
36 Ga0070669_100026327 3300005353 Bacteria 4184
37 Ga0070669_100039908 3300005353 Bacteria 3412
38 Ga0070675_100003469 3300005354 Bacteria 11951
39 Ga0070675_100019794 3300005354 Bacteria 5367
40 Ga0070675_100070905 3300005354 Bacteria 2889
41 Ga0070671_100000809 3300005355 Bacteria 22625
42 Ga0070671_100032760 3300005355 Bacteria 4295
43 Ga0070671_100227593 3300005355 Bacteria 1582
44 Ga0070674_100011210 3300005356 Bacteria 5448
45 Ga0070674_100351410 3300005356 Bacteria 1191
46 Ga0070673_100019506 3300005364 Bacteria 4868
47 Ga0070673_100051254 3300005364 Bacteria 3231
48 Ga0070673_100062956 3300005364 Bacteria 2949
49 Ga0070673_100063682 3300005364 Bacteria 2935
50 Ga0070673_100155060 3300005364 Bacteria 1943
51 Ga0070673_100846652 3300005364 Bacteria 846
52 Ga0070659_100087438 3300005366 Bacteria 2495
53 Ga0070659_100201221 3300005366 Bacteria 1639
54 Ga0070667_100749712 3300005367 Bacteria 905
55 Ga0070703_10005122 3300005406 Bacteria 3662
56 Ga0070703_10181549 3300005406 Bacteria 813
57 Ga0070709_10019017 3300005434 Bacteria 3963
58 Ga0070709_10029357 3300005434 Bacteria 3289
59 Ga0070709_10088423 3300005434 Bacteria 2038
60 Ga0070709_10519459 3300005434 Bacteria 907
61 Ga0070714_100020841 3300005435 Bacteria 5358
62 Ga0070714_100058150 3300005435 Bacteria 3312
63 Ga0070714_100059244 3300005435 Bacteria 3282
64 Ga0070714_100103757 3300005435 Bacteria 2508
65 Ga0070714_100501319 3300005435 Bacteria 1158
66 Ga0070713_100014977 3300005436 Bacteria 5774
67 Ga0070713_100021097 3300005436 Bacteria 5004
68 Ga0070713_100121851 3300005436 Bacteria 2289
69 Ga0070713_100132084 3300005436 Bacteria 2203
70 Ga0070713_100350499 3300005436 Bacteria 1369
71 Ga0070710_10098204 3300005437 Bacteria 1739
72 Ga0070711_100128931 3300005439 Bacteria 1881
73 Ga0070711_100746120 3300005439 Bacteria 827
74 Ga0070705_100000171 3300005440 Bacteria 37880
75 Ga0070705_100017929 3300005440 Bacteria 3702
76 Ga0070705_100493315 3300005440 Bacteria 928
77 Ga0070700_100000482 3300005441 Bacteria 19974
78 Ga0070700_100029678 3300005441 Bacteria 3262
79 Ga0070694_100000555 3300005444 Bacteria 20563
80 Ga0070694_100105982 3300005444 Bacteria 1996
81 Ga0070694_100167348 3300005444 Bacteria 1617
82 Ga0070708_100197215 3300005445 Bacteria 1884
83 Ga0070708_100197426 3300005445 Bacteria 1883
84 Ga0070708_100246872 3300005445 Bacteria 1676
85 Ga0070708_100337724 3300005445 Bacteria 1420
86 Ga0070663_100085917 3300005455 Bacteria 2322
87 Ga0070663_100823562 3300005455 Bacteria 797
88 Ga0070678_100026383 3300005456 Bacteria 3927
89 Ga0070678_100175988 3300005456 Bacteria 1747
90 Ga0070678_100243734 3300005456 Bacteria 1504
91 Ga0070678_100535080 3300005456 Bacteria 1038
92 Ga0070662_100806967 3300005457 Bacteria 798
93 Ga0070681_10002685 3300005458 Bacteria 16354
94 Ga0070681_10018179 3300005458 Bacteria 7029
95 Ga0070681_10033835 3300005458 Bacteria 5131
96 Ga0070681_10092447 3300005458 Bacteria 2974
97 Ga0068867_100034469 3300005459 Bacteria 3668
98 Ga0070685_10194140 3300005466 Bacteria 1315
99 Ga0070706_100032937 3300005467 Bacteria 4781
100 Ga0070706_100272557 3300005467 Bacteria 1579
101 Ga0070707_100008295 3300005468 Bacteria 9642
102 Ga0070707_100118537 3300005468 Bacteria 2569
103 Ga0070707_100361524 3300005468 Bacteria 1410
104 Ga0070698_100013437 3300005471 Bacteria 8666
105 Ga0070698_100247533 3300005471 Bacteria 1715
106 Ga0070698_100320946 3300005471 Bacteria 1479
107 Ga0070699_100000167 3300005518 Bacteria 63239
108 Ga0070699_100004951 3300005518 Bacteria 11749
109 Ga0070699_100061845 3300005518 Bacteria 3245
110 Ga0070679_100011073 3300005530 Bacteria 8581
111 Ga0070679_100037519 3300005530 Bacteria 4815
112 Ga0070679_100080696 3300005530 Bacteria 3243
113 Ga0070679_100122535 3300005530 Bacteria 2584
114 Ga0070684_100008775 3300005535 Bacteria 7926
115 Ga0070697_100146596 3300005536 Bacteria 1987
116 Ga0070697_100808672 3300005536 Bacteria 830
117 Ga0068853_100653878 3300005539 Bacteria 1001
118 Ga0070672_100434943 3300005543 Bacteria 1128
119 Ga0070672_100885923 3300005543 Bacteria 788
120 Ga0070686_100065014 3300005544 Bacteria 2368
121 Ga0070686_100298485 3300005544 Bacteria 1194
122 Ga0070695_100003493 3300005545 Bacteria 9175
123 Ga0070695_100005467 3300005545 Bacteria 7478
124 Ga0070696_100000097 3300005546 Bacteria 44009
125 Ga0070696_100003174 3300005546 Bacteria 10946
126 Ga0070696_100172418 3300005546 Bacteria 1600
127 Ga0070696_100217350 3300005546 Bacteria 1433
128 Ga0070696_100296519 3300005546 Bacteria 1237
129 Ga0070665_100024997 3300005548 Bacteria 6021
130 Ga0070665_100033840 3300005548 Bacteria 5140
131 Ga0070665_100117938 3300005548 Bacteria 2657
132 Ga0070665_100330026 3300005548 Bacteria 1530
133 Ga0070665_100587604 3300005548 Bacteria 1126
134 Ga0070704_100000416 3300005549 Bacteria 19780
135 Ga0070704_100000566 3300005549 Bacteria 17827
136 Ga0070704_100033822 3300005549 Bacteria 3460
137 Ga0070704_100057400 3300005549 Bacteria 2768
138 Ga0070704_100313406 3300005549 Bacteria 1312
139 Ga0070704_100375629 3300005549 Bacteria 1206
140 Ga0070704_100703976 3300005549 Bacteria 896
141 Ga0068855_100011573 3300005563 Bacteria 10656
142 Ga0068855_100334887 3300005563 Bacteria 1670
143 Ga0070664_100125491 3300005564 Bacteria 2251
144 Ga0068857_100030564 3300005577 Bacteria 4757
145 Ga0068857_100260672 3300005577 Bacteria 1591
146 Ga0068856_100002546 3300005614 Bacteria 18781
147 Ga0068856_100120313 3300005614 Bacteria 2627
148 Ga0068856_100160167 3300005614 Bacteria 2261
149 Ga0068856_100169686 3300005614 Bacteria 2194
150 Ga0070702_100094107 3300005615 Bacteria 1824
151 Ga0068852_100524039 3300005616 Bacteria 1183
152 Ga0068859_100001658 3300005617 Bacteria 22662
153 Ga0068859_100009816 3300005617 Bacteria 9668
154 Ga0068859_100224369 3300005617 Bacteria 1967
155 Ga0068864_100029916 3300005618 Bacteria 4616
156 Ga0068864_100042835 3300005618 Bacteria 3874
157 Ga0068864_100334698 3300005618 Bacteria 1425
158 Ga0068864_100431749 3300005618 Bacteria 1257
159 Ga0068866_10031807 3300005718 Bacteria 2545
160 Ga0068866_10033248 3300005718 Bacteria 2500
161 Ga0068866_10100296 3300005718 Bacteria 1596
162 Ga0068861_100000857 3300005719 Bacteria 18411
163 Ga0068861_100068559 3300005719 Bacteria 2741
164 Ga0068861_100095924 3300005719 Bacteria 2350
165 Ga0068861_100208750 3300005719 Bacteria 1644
166 Ga0068861_100237834 3300005719 Bacteria 1548
167 Ga0068870_10071943 3300005840 Bacteria 1888
168 Ga0068870_10168790 3300005840 Bacteria 1304
169 Ga0068863_100027027 3300005841 Bacteria 5472
170 Ga0068858_100021764 3300005842 Bacteria 5990
171 Ga0068858_100061152 3300005842 Bacteria 3481
172 Ga0068858_100970565 3300005842 Bacteria 832
173 Ga0068860_100001592 3300005843 Bacteria 24376
174 Ga0068860_100161420 3300005843 Bacteria 2161
175 Ga0068860_100340409 3300005843 Bacteria 1475
176 Ga0068862_100001428 3300005844 Bacteria 22066
177 Ga0068862_100176988 3300005844 Bacteria 1913
178 Ga0068862_100333843 3300005844 Bacteria 1402
179 Ga0068862_100481959 3300005844 Bacteria 1174
180 Ga0081455_10000657 3300005937 Bacteria 44807
181 Ga0081455_10000864 3300005937 Bacteria 39060
182 Ga0081455_10001134 3300005937 Bacteria 33332
183 Ga0081455_10001642 3300005937 Bacteria 27218
184 Ga0081455_10002534 3300005937 Bacteria 21714
185 Ga0081455_10003988 3300005937 Bacteria 16757
186 Ga0081455_10006090 3300005937 Bacteria 13046
187 Ga0081455_10032675 3300005937 Bacteria 4687
188 Ga0081455_10035407 3300005937 Bacteria 4461
189 Ga0081455_10068231 3300005937 Bacteria 2960
190 Ga0081538_10011156 3300005981 Bacteria 7299
191 Ga0081538_10017699 3300005981 Bacteria 5394
192 Ga0081538_10040992 3300005981 Bacteria 2945
193 Ga0081538_10081108 3300005981 Bacteria 1727
194 Ga0081538_10109354 3300005981 Bacteria 1362
195 Ga0081540_1000099 3300005983 Bacteria 91686
196 Ga0081540_1000360 3300005983 Bacteria 45924
197 Ga0081540_1001779 3300005983 Bacteria 18070
198 Ga0081540_1004048 3300005983 Bacteria 11353
199 Ga0081540_1011456 3300005983 Bacteria 5924
200 Ga0081540_1023457 3300005983 Bacteria 3608
201 Ga0081540_1069636 3300005983 Bacteria 1634
202 Ga0081540_1072553 3300005983 Unclassified 1585
203 Ga0081539_10009313 3300005985 Bacteria 8243
204 Ga0081539_10014029 3300005985 Bacteria 5966
205 Ga0081539_10055442 3300005985 Bacteria 2205
206 Ga0070717_10005042 3300006028 Bacteria 9619
207 Ga0070717_10022371 3300006028 Bacteria 4995
208 Ga0070717_10049468 3300006028 Bacteria 3451
209 Ga0070717_10090224 3300006028 Bacteria 2586
210 Ga0070717_10243390 3300006028 Bacteria 1587
211 Ga0070717_10396837 3300006028 Bacteria 1239
212 Ga0070717_10564819 3300006028 Bacteria 1031
213 Ga0070717_10757660 3300006028 Bacteria 883
214 Ga0075365_10019392 3300006038 Bacteria 4197
215 Ga0075365_10032160 3300006038 Bacteria 3370
216 Ga0075368_10028054 3300006042 Bacteria 2174
217 Ga0075368_10128725 3300006042 Bacteria 1051
218 Ga0075364_10001339 3300006051 Bacteria 13277
219 Ga0075364_10250362 3300006051 Bacteria 1204
220 Ga0070715_10049600 3300006163 Bacteria 1799
221 Ga0070715_10089219 3300006163 Bacteria 1415
222 Ga0070715_10144294 3300006163 Bacteria 1160
223 Ga0070712_100011352 3300006175 Bacteria 5644
224 Ga0070712_100069757 3300006175 Bacteria 2508
225 Ga0070712_100114181 3300006175 Bacteria 2021
226 Ga0070712_100354892 3300006175 Bacteria 1201
227 Ga0075367_10000626 3300006178 Bacteria 13524
228 Ga0075367_10009405 3300006178 Bacteria 5107
229 Ga0075367_10094349 3300006178 Bacteria 1824
230 Ga0075367_10110687 3300006178 Bacteria 1685
231 Ga0075367_10152045 3300006178 Bacteria 1437
232 Ga0075369_10000923 3300006186 Bacteria 9741
233 Ga0075369_10022620 3300006186 Bacteria 2594
234 Ga0075369_10099908 3300006186 Bacteria 1301
235 Ga0075369_10177593 3300006186 Bacteria 979
236 Ga0075366_10065072 3300006195 Bacteria 2169
237 Ga0097621_100010240 3300006237 Bacteria 6849
238 Ga0097621_100275959 3300006237 Bacteria 1478
239 Ga0097621_100289668 3300006237 Bacteria 1443
240 Ga0075370_10180418 3300006353 Bacteria 1242
241 Ga0068871_100092459 3300006358 Bacteria 2523
242 Ga0068871_100294682 3300006358 Bacteria 1422
243 Ga0075428_100001353 3300006844 Bacteria 26002
244 Ga0075428_100019486 3300006844 Bacteria 7508
245 Ga0075428_100073118 3300006844 Bacteria 3744
246 Ga0075428_100111168 3300006844 Bacteria 2985
247 Ga0075428_100169541 3300006844 Bacteria 2367
248 Ga0075428_100424097 3300006844 Bacteria 1425
249 Ga0075428_100531161 3300006844 Bacteria 1258
250 Ga0075430_100002744 3300006846 Bacteria 14703
251 Ga0075430_100010364 3300006846 Bacteria 7893
252 Ga0075430_100080769 3300006846 Bacteria 2723
253 Ga0075431_100000652 3300006847 Bacteria 29451
254 Ga0075431_100000965 3300006847 Bacteria 25537
255 Ga0075431_100008835 3300006847 Bacteria 10097
256 Ga0075431_100018577 3300006847 Bacteria 7082
257 Ga0075431_100018795 3300006847 Bacteria 7040
258 Ga0075431_100037919 3300006847 Bacteria 4963
259 Ga0075431_100051615 3300006847 Bacteria 4240
260 Ga0075431_100086041 3300006847 Bacteria 3244
261 Ga0075431_100311745 3300006847 Bacteria 1588
262 Ga0075431_100313276 3300006847 Bacteria 1584
263 Ga0075431_100420649 3300006847 Bacteria 1335
264 Ga0075433_10001856 3300006852 Bacteria 15871
265 Ga0075433_10009983 3300006852 Bacteria 7607
266 Ga0075433_10150743 3300006852 Bacteria 2068
267 Ga0075433_10286572 3300006852 Bacteria 1459
268 Ga0075433_10409594 3300006852 Bacteria 1196
269 Ga0075433_10410290 3300006852 Bacteria 1195
270 Ga0075434_100016479 3300006871 Bacteria 7104
271 Ga0075434_100017182 3300006871 Bacteria 6965
272 Ga0075434_100019636 3300006871 Bacteria 6540
273 Ga0075434_100061611 3300006871 Bacteria 3733
274 Ga0075434_100091824 3300006871 Bacteria 3038
275 Ga0075434_100142304 3300006871 Bacteria 2419
276 Ga0075434_100201804 3300006871 Bacteria 2009
277 Ga0075434_100222122 3300006871 Bacteria 1909
278 Ga0075429_100000008 3300006880 Bacteria 86739
279 Ga0075429_100016293 3300006880 Bacteria 6442
280 Ga0075429_100083463 3300006880 Bacteria 2785
281 Ga0075429_100171143 3300006880 Bacteria 1902
282 Ga0068865_100024142 3300006881 Bacteria 3986
283 Ga0068865_100233311 3300006881 Bacteria 1445
284 Ga0075436_100002475 3300006914 Bacteria 12713
285 Ga0075436_100048683 3300006914 Bacteria 2925
286 Ga0075436_100349312 3300006914 Bacteria 1066
287 Ga0075436_100414629 3300006914 Bacteria 977
288 Ga0075436_100563748 3300006914 Bacteria 837
289 Ga0097620_100001658 3300006931 Bacteria 22662
290 Ga0097620_100009816 3300006931 Bacteria 9668
291 Ga0097620_100027068 3300006931 Bacteria 5751
292 Ga0097620_100076460 3300006931 Bacteria 3389
293 Ga0097620_100224378 3300006931 Bacteria 1967
294 Ga0099824_1010358 3300006942 Bacteria 11033
295 Ga0099824_1017393 3300006942 Bacteria 6238
296 Ga0099822_1011679 3300006943 Bacteria 10670
297 Ga0099823_1000008 3300006944 Bacteria 105646
298 Ga0075435_100003479 3300007076 Bacteria 10682
299 Ga0075435_100010249 3300007076 Bacteria 6847
300 Ga0075435_100026643 3300007076 Bacteria 4513
301 Ga0075435_100156033 3300007076 Bacteria 1920
302 Ga0075435_100612103 3300007076 Bacteria 945
303 Ga0099794_10021736 3300007265 Bacteria 2918
304 Ga0099794_10046570 3300007265 Bacteria 2077
305 Ga0099795_10096442 3300007788 Bacteria 1154
306 Ga0099795_10098942 3300007788 Bacteria 1141
307 Ga0105240_10020965 3300009093 Bacteria 8699
308 Ga0105240_10073123 3300009093 Bacteria 4234
309 Ga0105240_10142513 3300009093 Bacteria 2864
310 Ga0111539_10002318 3300009094 Bacteria 25335
311 Ga0111539_10006931 3300009094 Bacteria 14546
312 Ga0111539_10014205 3300009094 Bacteria 9946
313 Ga0111539_10021387 3300009094 Bacteria 7963
314 Ga0111539_10041808 3300009094 Bacteria 5508
315 Ga0111539_10043015 3300009094 Bacteria 5419
316 Ga0111539_10166565 3300009094 Bacteria 2576
317 Ga0111539_10217931 3300009094 Bacteria 2223
318 Ga0111539_10268814 3300009094 Bacteria 1985
319 Ga0111539_10288311 3300009094 Bacteria 1910
320 Ga0111539_10372893 3300009094 Bacteria 1661
321 Ga0111539_10449443 3300009094 Bacteria 1501
322 Ga0105245_10042501 3300009098 Bacteria 4056
323 Ga0105245_10113869 3300009098 Bacteria 2519
324 Ga0105245_10313864 3300009098 Bacteria 1542
325 Ga0105247_10055307 3300009101 Bacteria 2449
326 Ga0114129_10000124 3300009147 Bacteria 77871
327 Ga0114129_10001247 3300009147 Bacteria 33913
328 Ga0114129_10011216 3300009147 Bacteria 12774
329 Ga0114129_10034081 3300009147 Bacteria 7192
330 Ga0114129_10036668 3300009147 Bacteria 6922
331 Ga0114129_10067868 3300009147 Bacteria 4972
332 Ga0114129_10164798 3300009147 Bacteria 3026
333 Ga0114129_10196755 3300009147 Bacteria 2733
334 Ga0114129_10204492 3300009147 Bacteria 2672
335 Ga0114129_10352186 3300009147 Bacteria 1950
336 Ga0114129_10464370 3300009147 Bacteria 1659
337 Ga0114129_10473705 3300009147 Bacteria 1639
338 Ga0114129_10530682 3300009147 Bacteria 1533
339 Ga0114129_10659418 3300009147 Bacteria 1350
340 Ga0114129_10827687 3300009147 Bacteria 1179
341 Ga0114129_10830926 3300009147 Unclassified 1176
342 Ga0114129_10947226 3300009147 Bacteria 1088
343 Ga0105243_10041053 3300009148 Bacteria 3617
344 Ga0105243_10059591 3300009148 Bacteria 3047
345 Ga0105243_10128192 3300009148 Bacteria 2149
346 Ga0105243_10548847 3300009148 Bacteria 1104
347 Ga0105242_10222766 3300009176 Bacteria 1687
348 Ga0105248_10045144 3300009177 Bacteria 4941
349 Ga0105237_10079588 3300009545 Bacteria 3267
350 Ga0105238_10018836 3300009551 Bacteria 7027
351 Ga0105238_10547729 3300009551 Bacteria 1161
352 Ga0105238_10753349 3300009551 Bacteria 988
353 Ga0105238_10977371 3300009551 Bacteria 867
354 Ga0105249_10340101 3300009553 Bacteria 1517
355 Ga0105249_10553884 3300009553 Bacteria 1201
356 Ga0105249_11103158 3300009553 Unclassified 864
357 Ga0099796_10048408 3300010159 Bacteria 1466
358 Ga0105239_10044406 3300010375 Bacteria 4872
359 Ga0105239_10137147 3300010375 Bacteria 2724
360 Ga0105239_10326917 3300010375 Bacteria 1729
361 Ga0105239_10839514 3300010375 Bacteria 1053
362 Ga0105246_10004309 3300011119 Bacteria 8653
363 Ga0105246_10266578 3300011119 Bacteria 1367
364 Ga0105246_10412621 3300011119 Bacteria 1124
365 Ga0157370_10046562 3300013104 Bacteria 4159
366 Ga0157370_10078130 3300013104 Bacteria 3117
367 Ga0157370_10140031 3300013104 Bacteria 2254
368 Ga0157370_10234338 3300013104 Bacteria 1699
369 Ga0157369_10004728 3300013105 Bacteria 16002
370 Ga0157369_10080978 3300013105 Bacteria 3475
371 Ga0157369_10120862 3300013105 Bacteria 2779
372 Ga0157369_10379362 3300013105 Bacteria 1467
373 Ga0157374_10065852 3300013296 Bacteria 3404
374 Ga0157374_10346365 3300013296 Bacteria 1476
375 Ga0157374_10786039 3300013296 Bacteria 967
376 Ga0157378_10084372 3300013297 Bacteria 2876
377 Ga0157378_10104740 3300013297 Bacteria 2586
378 Ga0163162_10088047 3300013306 Bacteria 3185
379 Ga0163162_10203702 3300013306 Bacteria 2108
380 Ga0163162_10324032 3300013306 Bacteria 1673
381 Ga0163162_10422832 3300013306 Bacteria 1465
382 Ga0163162_10922907 3300013306 Bacteria 985
383 Ga0163162_11251087 3300013306 Bacteria 843
384 Ga0157372_10051839 3300013307 Bacteria 4567
385 Ga0157372_10216690 3300013307 Bacteria 2219
386 Ga0157372_10466617 3300013307 Bacteria 1472
387 Ga0157375_10047284 3300013308 Bacteria 4201
388 Ga0157375_10067217 3300013308 Bacteria 3581
389 Ga0157375_10086244 3300013308 Bacteria 3190
390 Ga0157375_10114897 3300013308 Bacteria 2794
391 Ga0163163_10004951 3300014325 Bacteria 11463
392 Ga0163163_10187646 3300014325 Bacteria 2115
393 Ga0163163_10432039 3300014325 Bacteria 1376
394 Ga0157380_10042097 3300014326 Bacteria 3568
395 Ga0157380_10047458 3300014326 Bacteria 3378
396 Ga0157380_10585550 3300014326 Bacteria 1101
397 Ga0157380_10637380 3300014326 Bacteria 1061
398 Ga0182008_10030391 3300014497 Bacteria 2724
399 Ga0157377_10310937 3300014745 Bacteria 1043
400 Ga0157379_10084851 3300014968 Bacteria 2838
401 Ga0157379_10090347 3300014968 Bacteria 2748
402 Ga0157379_10405397 3300014968 Bacteria 1254
403 Ga0157376_10015043 3300014969 Bacteria 5833
404 Ga0157376_10177271 3300014969 Bacteria 1945
405 Ga0157376_10197518 3300014969 Bacteria 1849
406 Ga0163161_10097821 3300017792 Bacteria 2180
407 Ga0163161_10201383 3300017792 Bacteria 1534
408 Ga0163161_10453852 3300017792 Bacteria 1037
409 Ga0206356_11376152 3300020070 Bacteria 984
410 Ga0213872_10074428 3300021361 Bacteria 1529
411 Ga0213872_10149366 3300021361 Bacteria 1022
412 Ga0213876_10283219 3300021384 Bacteria 881
413 Ga0228598_1003914 3300024227 Bacteria 3176
414 Ga0209233_1033592 3300025261 Bacteria 1176
415 Ga0207653_10000520 3300025885 Bacteria 14672
416 Ga0207692_10184043 3300025898 Bacteria 1219
417 Ga0207642_10019878 3300025899 Bacteria 2610
418 Ga0207642_10098722 3300025899 Bacteria 1461
419 Ga0207688_10440605 3300025901 Bacteria 811
420 Ga0207680_10191384 3300025903 Bacteria 1389
421 Ga0207647_10004760 3300025904 Bacteria 10047
422 Ga0207647_10056006 3300025904 Bacteria 2420
423 Ga0207685_10107146 3300025905 Bacteria 1205
424 Ga0207685_10185814 3300025905 Bacteria 966
425 Ga0207699_10027940 3300025906 Bacteria 3130
426 Ga0207699_10106069 3300025906 Bacteria 1793
427 Ga0207699_10229154 3300025906 Bacteria 1272
428 Ga0207699_10329356 3300025906 Bacteria 1073
429 Ga0207645_10004028 3300025907 Bacteria 10953
430 Ga0207645_10050054 3300025907 Bacteria 2668
431 Ga0207643_10017955 3300025908 Bacteria 3874
432 Ga0207643_10170107 3300025908 Bacteria 1315
433 Ga0207643_10453525 3300025908 Bacteria 816
434 Ga0207705_10068507 3300025909 Bacteria 2569
435 Ga0207684_10132915 3300025910 Bacteria 2136
436 Ga0207684_10292596 3300025910 Bacteria 1404
437 Ga0207684_10858669 3300025910 Bacteria 765
438 Ga0207707_10000642 3300025912 Bacteria 34523
439 Ga0207707_10004649 3300025912 Bacteria 12059
440 Ga0207707_10023202 3300025912 Bacteria 5429
441 Ga0207707_10081957 3300025912 Bacteria 2816
442 Ga0207695_10044531 3300025913 Bacteria 4719
443 Ga0207695_10084962 3300025913 Bacteria 3194
444 Ga0207695_10137687 3300025913 Bacteria 2393
445 Ga0207671_10197672 3300025914 Bacteria 1569
446 Ga0207693_10005660 3300025915 Bacteria 10388
447 Ga0207693_10126573 3300025915 Bacteria 2008
448 Ga0207663_10048765 3300025916 Bacteria 2623
449 Ga0207663_10135262 3300025916 Bacteria 1709
450 Ga0207660_10009091 3300025917 Bacteria 6436
451 Ga0207660_10017922 3300025917 Bacteria 4714
452 Ga0207660_10123833 3300025917 Bacteria 1961
453 Ga0207660_10452900 3300025917 Bacteria 1038
454 Ga0207660_10528114 3300025917 Bacteria 959
455 Ga0207662_10041516 3300025918 Bacteria 2709
456 Ga0207652_10039233 3300025921 Bacteria 4019
457 Ga0207652_10041125 3300025921 Bacteria 3928
458 Ga0207652_10053420 3300025921 Bacteria 3470
459 Ga0207652_10071231 3300025921 Bacteria 3020
460 Ga0207652_10120193 3300025921 Bacteria 2337
461 Ga0207646_10193767 3300025922 Bacteria 1835
462 Ga0207646_10523156 3300025922 Bacteria 1068
463 Ga0207681_10088701 3300025923 Bacteria 2203
464 Ga0207681_10097944 3300025923 Bacteria 2109
465 Ga0207694_10114780 3300025924 Bacteria 2145
466 Ga0207694_10503869 3300025924 Bacteria 1014
467 Ga0207650_10000781 3300025925 Bacteria 24513
468 Ga0207650_10016748 3300025925 Bacteria 5126
469 Ga0207659_10000872 3300025926 Bacteria 17941
470 Ga0207659_10021857 3300025926 Bacteria 4254
471 Ga0207659_10038471 3300025926 Bacteria 3328
472 Ga0207687_10050784 3300025927 Bacteria 2888
473 Ga0207687_10170491 3300025927 Bacteria 1678
474 Ga0207687_10210680 3300025927 Bacteria 1524
475 Ga0207700_10041534 3300025928 Bacteria 3366
476 Ga0207700_10136178 3300025928 Bacteria 2012
477 Ga0207700_10184972 3300025928 Bacteria 1747
478 Ga0207700_10196080 3300025928 Bacteria 1699
479 Ga0207700_10356556 3300025928 Bacteria 1274
480 Ga0207664_10018559 3300025929 Bacteria 5125
481 Ga0207664_10055279 3300025929 Bacteria 3150
482 Ga0207664_10173174 3300025929 Bacteria 1848
483 Ga0207664_10191078 3300025929 Bacteria 1762
484 Ga0207664_10192727 3300025929 Bacteria 1755
485 Ga0207664_10297950 3300025929 Bacteria 1418
486 Ga0207644_10000454 3300025931 Bacteria 26457
487 Ga0207644_10033114 3300025931 Bacteria 3609
488 Ga0207690_10066046 3300025932 Bacteria 2476
489 Ga0207686_10074502 3300025934 Bacteria 2193
490 Ga0207686_10438260 3300025934 Bacteria 1003
491 Ga0207709_10297343 3300025935 Bacteria 1199
492 Ga0207709_10461556 3300025935 Bacteria 984
493 Ga0207709_10790345 3300025935 Bacteria 765
494 Ga0207670_10054126 3300025936 Bacteria 2707
495 Ga0207670_10248731 3300025936 Bacteria 1373
496 Ga0207670_10405641 3300025936 Bacteria 1091
497 Ga0207669_10023880 3300025937 Bacteria 3275
498 Ga0207669_10191811 3300025937 Bacteria 1475
499 Ga0207669_10400518 3300025937 Bacteria 1075
500 Ga0207704_10094407 3300025938 Bacteria 1975
501 Ga0207704_10146636 3300025938 Bacteria 1659
502 Ga0207665_10048803 3300025939 Bacteria 2843
503 Ga0207665_10414078 3300025939 Bacteria 1028
504 Ga0207691_10085352 3300025940 Bacteria 2833
505 Ga0207691_10241860 3300025940 Bacteria 1560
506 Ga0207691_10279871 3300025940 Bacteria 1435
507 Ga0207691_10596947 3300025940 Bacteria 935
508 Ga0207689_10142030 3300025942 Bacteria 1978
509 Ga0207661_10001102 3300025944 Bacteria 17966
510 Ga0207661_10032238 3300025944 Bacteria 4057
511 Ga0207661_10406142 3300025944 Bacteria 1236
512 Ga0207679_10092569 3300025945 Bacteria 2342
513 Ga0207667_10019069 3300025949 Bacteria 7668
514 Ga0207651_10006912 3300025960 Bacteria 5996
515 Ga0207651_10164488 3300025960 Bacteria 1743
516 Ga0207651_10230312 3300025960 Bacteria 1504
517 Ga0207712_10121303 3300025961 Bacteria 1978
518 Ga0207712_10245975 3300025961 Bacteria 1443
519 Ga0207712_10439109 3300025961 Bacteria 1105
520 Ga0207668_10166277 3300025972 Bacteria 1725
521 Ga0207668_10948252 3300025972 Bacteria 767
522 Ga0207658_10345281 3300025986 Bacteria 1295
523 Ga0207677_10089296 3300026023 Bacteria 2237
524 Ga0207703_10031065 3300026035 Bacteria 4222
525 Ga0207703_10079632 3300026035 Bacteria 2726
526 Ga0207703_10520719 3300026035 Bacteria 1118
527 Ga0207639_10130448 3300026041 Bacteria 2080
528 Ga0207639_10140780 3300026041 Bacteria 2009
529 Ga0207639_11097192 3300026041 Bacteria 746
530 Ga0207678_10166491 3300026067 Bacteria 1882
531 Ga0207678_10177096 3300026067 Bacteria 1821
532 Ga0207678_10236393 3300026067 Bacteria 1565
533 Ga0207678_10726638 3300026067 Bacteria 875
534 Ga0207708_10000296 3300026075 Bacteria 39206
535 Ga0207708_10004708 3300026075 Bacteria 10034
536 Ga0207708_10051929 3300026075 Bacteria 3122
537 Ga0207708_10472478 3300026075 Bacteria 1047
538 Ga0207702_10002900 3300026078 Bacteria 16046
539 Ga0207702_10111960 3300026078 Bacteria 2429
540 Ga0207702_10278850 3300026078 Bacteria 1579
541 Ga0207641_10820920 3300026088 Bacteria 920
542 Ga0207648_10006984 3300026089 Bacteria 11167
543 Ga0207648_10024842 3300026089 Bacteria 5344
544 Ga0207648_10090889 3300026089 Bacteria 2668
545 Ga0207676_10010115 3300026095 Bacteria 6712
546 Ga0207676_10074308 3300026095 Bacteria 2738
547 Ga0207674_10012981 3300026116 Bacteria 9286
548 Ga0207674_10059853 3300026116 Bacteria 3854
549 Ga0207674_10088227 3300026116 Bacteria 3095
550 Ga0207675_100001111 3300026118 Bacteria 26632
551 Ga0207675_100036432 3300026118 Bacteria 4589
552 Ga0207675_100125857 3300026118 Bacteria 2427
553 Ga0207675_100168994 3300026118 Bacteria 2089
554 Ga0207675_100269764 3300026118 Bacteria 1651
555 Ga0207683_10024977 3300026121 Bacteria 5151
556 Ga0207683_10145399 3300026121 Bacteria 2138
557 Ga0207683_10165211 3300026121 Bacteria 2003
558 Ga0207683_10285093 3300026121 Bacteria 1510
559 Ga0207683_10355926 3300026121 Bacteria 1344
560 Ga0207698_10024188 3300026142 Bacteria 4259
561 Ga0209389_1000032 3300027296 Bacteria 134064
562 Ga0209589_1000001 3300027357 Bacteria 794224
563 Ga0209969_1013838 3300027360 Bacteria 1171
564 Ga0209489_100001 3300027361 Bacteria 794224
565 Ga0209489_100035 3300027361 Bacteria 168255
566 Ga0209700_100001 3300027363 Bacteria 794224
567 Ga0209700_100005 3300027363 Bacteria 573969
568 Ga0209981_1001056 3300027378 Bacteria 3497
569 Ga0210000_1007327 3300027462 Bacteria 1613
570 Ga0209995_1010700 3300027471 Bacteria 1489
571 Ga0209179_1035288 3300027512 Unclassified 1039
572 Ga0209968_1016241 3300027526 Bacteria 1182
573 Ga0209588_1029541 3300027671 Bacteria 1748
574 Ga0209588_1090079 3300027671 Unclassified 988
575 Ga0209813_10088148 3300027866 Bacteria 1037
576 Ga0207428_10007031 3300027907 Bacteria 10305
577 Ga0207428_10111590 3300027907 Bacteria 2104
578 Ga0207428_10195341 3300027907 Bacteria 1524
579 Ga0207428_10243728 3300027907 Bacteria 1342
580 Ga0268266_10002798 3300028379 Bacteria 18191
581 Ga0268266_10015117 3300028379 Bacteria 6628
582 Ga0268266_10344079 3300028379 Bacteria 1400
583 Ga0268266_10571950 3300028379 Bacteria 1084
584 Ga0268265_10000508 3300028380 Bacteria 40027
585 Ga0268265_10472149 3300028380 Bacteria 1176
586 Ga0268265_10602334 3300028380 Bacteria 1050
587 Ga0268264_10003796 3300028381 Bacteria 12956
588 Ga0268264_10076507 3300028381 Bacteria 2848
589 Ga0265340_10022948 3300031247 Bacteria 3185
590 Ga0265339_10004326 3300031249 Bacteria 9708
591 Ga0307408_100050721 3300031548 Bacteria 2986
592 Ga0307408_100294440 3300031548 Bacteria 1357
593 Ga0316575_10031691 3300031665 Bacteria 2069
594 Ga0265314_10004147 3300031711 Bacteria 13641
595 Ga0316576_10008667 3300031727 Bacteria 6507
596 Ga0316578_10035225 3300031728 Bacteria 2877
597 Ga0307406_10289268 3300031901 Bacteria 1254
598 Ga0307416_100528761 3300032002 Bacteria 1249
599 Ga0315911_1000019 3300033442 Bacteria 146597
600 Ga0373926_0031430 3300035083 Bacteria 1872
601 Ga0373934_0000091 3300035086 Bacteria 31467
602 Ga0373934_0121130 3300035086 Bacteria 1064
603 Ga0373940_0010148 3300035088 Bacteria 2207
604 Ga0373923_0077565 3300035111 Bacteria 1437
605 Ga0373923_0080737 3300035111 Bacteria 1410
606 Ga0373932_0083488 3300035112 Bacteria 1013
607 Ga0373936_0009291 3300035113 Bacteria 3704
608 Ga0373936_0121413 3300035113 Bacteria 1116
609 Ga0373939_0004820 3300035114 Bacteria 3198
610 Ga0373941_0032874 3300035115 Bacteria 1555
611 Ga0373945_0037865 3300035116 Bacteria 1733
612 Ga0373945_0156550 3300035116 Bacteria 926
613 Ga0373954_0033145 3300035118 Bacteria 2389
614 Ga0373954_0085383 3300035118 Bacteria 1511
615 Ga0373954_0119384 3300035118 Bacteria 1279
616 Ga0373956_0001188 3300035119 Bacteria 10757
617 Ga0373956_0032222 3300035119 Bacteria 2299
618 Ga0373956_0035371 3300035119 Bacteria 2203
619 Ga0373956_0117284 3300035119 Bacteria 1242
620 Ga0373957_0021564 3300035120 Bacteria 2288
621 Ga0373960_0004649 3300035121 Bacteria 3153
622 Ga0373943_0027831 3300035170 Bacteria 2660
623 Ga0373943_0176711 3300035170 Bacteria 1171
624 Ga0373946_0020107 3300035171 Bacteria 2578
625 Ga0373946_0047655 3300035171 Bacteria 1781
626 Ga0373955_0004048 3300035172 Bacteria 6471
627 Ga0373955_0017692 3300035172 Bacteria 3531
628 Ga0373955_0037554 3300035172 Bacteria 2576
629 Ga0373955_0043529 3300035172 Bacteria 2415
630 Ga0373961_0002460 3300035241 Bacteria 4797
631 Ga0373962_0016193 3300035242 Bacteria 1920
632 Ga0373924_0022137 3300035410 Bacteria 2483
633 Ga0373931_0003385 3300035691 Bacteria 7154
634 Ga0373931_0005812 3300035691 Bacteria 5739
635 Ga0373931_0208819 3300035691 Bacteria 1170
636 Ga0373935_0031978 3300035692 Bacteria 3268
637 Ga0373935_0046269 3300035692 Bacteria 2748
638 Ga0373935_0216199 3300035692 Bacteria 1330
639 Ga0373935_0291096 3300035692 Bacteria 1152
640 Ga0373927_0051594 3300035695 Bacteria 2659
641 Ga0373927_0106749 3300035695 Bacteria 1823
642 Ga0373927_0215168 3300035695 Bacteria 1262
643 Ga0373927_0234151 3300035695 Bacteria 1207
644 Ga0373933_0000636 3300035724 Bacteria 21874
645 Ga0373933_0001319 3300035724 Bacteria 14586
646 Ga0373933_0023287 3300035724 Bacteria 3536
647 Ga0373933_0066336 3300035724 Bacteria 2187
648 Ga0373933_0384408 3300035724 Bacteria 914
649 Ga0373947_0053109 3300035725 Bacteria 2443
650 Ga0373947_0086015 3300035725 Bacteria 1953
651 Ga0373947_0299973 3300035725 Unclassified 1071
652 Ga0373937_0000929 3300036401 Bacteria 24822
653 Ga0373937_0001593 3300036401 Bacteria 19081
654 Ga0373937_0017678 3300036401 Bacteria 6362
655 Ga0373937_0034276 3300036401 Bacteria 4618
656 Ga0373937_0064468 3300036401 Bacteria 3370
657 Ga0373937_0109026 3300036401 Bacteria 2574
658 Ga0373937_0126081 3300036401 Bacteria 2388
659 Ga0373937_0488068 3300036401 Bacteria 1170
660 Ga0373937_0709727 3300036401 Bacteria 952
661 Ga0372808_005078 3300036459 Bacteria 1717
662 Ga0316584_0010427 3300036712 Bacteria 6492
663 Ga0373925_0029640 3300037068 Bacteria 4015
664 Ga0373925_0071610 3300037068 Bacteria 2622
665 Ga0373925_0226273 3300037068 Bacteria 1494
666 Ga0373925_0341543 3300037068 Bacteria 1215
667 Ga0373925_0354464 3300037068 Bacteria 1192
668 Ga0395899_0332674 3300037312 Bacteria 1020
669 Ga0395900_0007634 3300037418 Bacteria 11167
670 Ga0395900_0323083 3300037418 Bacteria 1523
671 Ga0395898_0004948 3300037466 Bacteria 14463
672 Ga0395898_0038449 3300037466 Bacteria 4743
673 Ga0395898_0044855 3300037466 Bacteria 4349
674 Ga0395898_0064375 3300037466 Bacteria 3556
675 Ga0395898_0222500 3300037466 Bacteria 1800
676 Ga0395898_0418882 3300037466 Bacteria 1276
677 Ga0395905_0966217 3300037471 Bacteria 755
678 Ga0436364_0448530 3300037853 Bacteria 1330
679 Ga0436364_0726557 3300037853 Bacteria 1181
680 Ga0436364_1337618 3300037853 Bacteria 5053
681 Ga0395901_0055306 3300038443 Bacteria 4127
682 Ga0395901_0102296 3300038443 Bacteria 3007
683 Ga0395901_0290885 3300038443 Bacteria 1695
684 Ga0436365_0199779 3300039437 Bacteria 4132
685 Ga0436365_0675434 3300039437 Bacteria 3737
686 Ga0436365_1234709 3300039437 Bacteria 1185
687 Ga0436365_1327472 3300039437 Bacteria 1714
688 Ga0436360_0513745 3300039438 Bacteria 847
689 Ga0436360_1119639 3300039438 Bacteria 2118
690 Ga0436361_0808304 3300039447 Bacteria 1486
691 Ga0436361_0844310 3300039447 Bacteria 9297
692 Ga0436361_1158949 3300039447 Bacteria 1089
693 Ga0436361_1192224 3300039447 Bacteria 2700
694 Ga0436363_0359787 3300039450 Bacteria 2174
695 Ga0436363_1257565 3300039450 Bacteria 4182
696 Ga0436363_1646537 3300039450 Bacteria 795
697 Ga0439441_000158 3300042001 Bacteria 5928
698 Ga0439441_004858 3300042001 Bacteria 2059
699 Ga0439456_046709 3300042013 Bacteria 943
700 Ga0439435_0002921 3300042436 Bacteria 3474
701 Ga0439435_0014803 3300042436 Bacteria 1932
702 Ga0439444_0000818 3300042437 Bacteria 3750
703 Ga0439444_0009740 3300042437 Bacteria 1520
704 Ga0439460_0122877 3300042461 Bacteria 850
705 Ga0453683_0208282 3300044673 Bacteria 1242
706 Ga0466961_0051159 3300044693 Bacteria 2639
707 Ga0466963_0206608 3300044694 Bacteria 1374
708 Ga0466970_0069435 3300044765 Bacteria 1894
709 Ga0466957_0620872 3300044842 Bacteria 758
710 Ga0466959_0036080 3300045049 Bacteria 3654
711 Ga0466959_0549602 3300045049 Bacteria 779
712 Ga0451576_0013568 3300045051 Bacteria 9110
713 Ga0451576_0035215 3300045051 Bacteria 5313
714 Ga0451576_0057652 3300045051 Bacteria 4060
715 Ga0466967_0115925 3300045976 Bacteria 2468
716 Ga0466967_0631939 3300045976 Bacteria 1058
717 Ga0466967_0725797 3300045976 Bacteria 985
718 Ga0495592_0053200 3300046454 Bacteria 3004
719 Ga0495592_0103380 3300046454 Bacteria 2027
720 Ga0495592_0122000 3300046454 Bacteria 1832
721 Ga0495592_0161411 3300046454 Bacteria 1542
722 Ga0495592_0222752 3300046454 Bacteria 1260
723 Ga0495592_0307369 3300046454 Bacteria 1029
724 Ga0495603_0245817 3300046455 Bacteria 1030
725 Ga0495629_0103979 3300046459 Bacteria 1981
726 Ga0495629_0251548 3300046459 Bacteria 1216
727 Ga0495638_0000330 3300046460 Bacteria 59733
728 Ga0495651_0001982 3300046462 Bacteria 15869
729 Ga0495651_0004780 3300046462 Bacteria 10368
730 Ga0495651_0115097 3300046462 Bacteria 1983
731 Ga0495651_0239715 3300046462 Bacteria 1244
732 Ga0495653_0125567 3300046463 Bacteria 1823
733 Ga0495582_0035466 3300046473 Bacteria 2743
734 Ga0495582_0249034 3300046473 Bacteria 1019
735 Ga0495639_0106820 3300046475 Bacteria 1325
736 Ga0495664_0007023 3300046477 Bacteria 6237
737 Ga0495664_0007261 3300046477 Bacteria 6146
738 Ga0495664_0009390 3300046477 Bacteria 5471
739 Ga0495584_0149159 3300046491 Bacteria 1188
740 Ga0495584_0313830 3300046491 Bacteria 796
741 Ga0495608_0008754 3300046511 Bacteria 7079
742 Ga0495608_0049559 3300046511 Bacteria 2788
743 Ga0495628_0103309 3300046516 Bacteria 2197
744 Ga0495630_0121394 3300046517 Bacteria 1982
745 Ga0495630_0127898 3300046517 Bacteria 1928
746 Ga0495652_0249385 3300046529 Bacteria 1316
747 Ga0495652_0284608 3300046529 Bacteria 1209
748 Ga0495652_0412241 3300046529 Bacteria 954
749 Ga0495665_0216230 3300046531 Bacteria 991
750 Ga0495640_0016968 3300046533 Bacteria 5436
751 Ga0495640_0072831 3300046533 Bacteria 2301
752 Ga0495640_0099384 3300046533 Bacteria 1912
753 Ga0495586_0049421 3300046535 Bacteria 2274
754 Ga0495587_0049445 3300046536 Bacteria 2489
755 Ga0495587_0303426 3300046536 Bacteria 893
756 Ga0495621_0017170 3300046539 Bacteria 2335
757 Ga0495645_0000500 3300046543 Bacteria 27082
758 Ga0495645_0010769 3300046543 Bacteria 6424
759 Ga0495645_0199234 3300046543 Bacteria 1360
760 Ga0495667_0042398 3300046559 Bacteria 3017
761 Ga0495667_0097203 3300046559 Bacteria 1906
762 Ga0495667_0160351 3300046559 Bacteria 1447
763 Ga0495667_0167870 3300046559 Bacteria 1410
764 Ga0495656_0031341 3300046615 Bacteria 2156
765 Ga0495668_0105682 3300046616 Bacteria 1540
766 Ga0495635_0074400 3300046663 Bacteria 2327
767 Ga0495659_0069808 3300046664 Bacteria 1315
768 Ga0495657_0032389 3300046675 Bacteria 3648
769 Ga0495657_0187779 3300046675 Bacteria 1264
770 Ga0495599_0055545 3300046678 Bacteria 2479
771 Ga0495623_0143549 3300046679 Bacteria 1418
772 Ga0495646_0056973 3300046680 Bacteria 2341
773 Ga0495646_0354661 3300046680 Bacteria 768
774 Ga0495647_0019335 3300046681 Bacteria 2434
775 Ga0495658_0210128 3300046683 Bacteria 1216
776 Ga0495658_0351561 3300046683 Bacteria 937
777 Ga0495669_0100249 3300046684 Bacteria 1345
778 Ga0495613_0238680 3300046689 Bacteria 1271
779 Ga0495624_0026742 3300046690 Bacteria 3780
780 Ga0495581_0134974 3300047315 Bacteria 1438
781 Ga0495604_0068519 3300047317 Bacteria 2693
782 Ga0495674_0069015 3300047319 Bacteria 3057
783 Ga0495674_0104836 3300047319 Bacteria 2404
784 Ga0495674_0260553 3300047319 Bacteria 1425
785 Ga0495674_0367907 3300047319 Bacteria 1165
786 Ga0495672_0158823 3300047320 Bacteria 1165
787 Ga0495680_0024185 3300047322 Bacteria 5041
788 Ga0495680_0079794 3300047322 Bacteria 2474
789 Ga0495680_0089833 3300047322 Bacteria 2306
790 Ga0495680_0289297 3300047322 Bacteria 1153
791 Ga0495675_0044986 3300047444 Bacteria 2811
792 Ga0495684_0017127 3300047471 Bacteria 5581
793 Ga0495684_0033134 3300047471 Bacteria 3965
794 Ga0495593_0159142 3300047673 Bacteria 1140
795 Ga0495602_0000143 3300048088 Bacteria 66782
796 Ga0496100_0258062 3300048903 Bacteria 1292
797 Ga0496101_0091275 3300048904 Bacteria 2267
798 Ga0496101_0465438 3300048904 Bacteria 998
799 Ga0496102_0002928 3300048905 Bacteria 14484
800 Ga0496102_0507571 3300048905 Bacteria 1128
801 Ga0496103_0003743 3300048906 Bacteria 9250
802 Ga0496104_0000583 3300048907 Bacteria 31105
803 Ga0496104_0012330 3300048907 Bacteria 7684
804 Ga0496104_0245225 3300048907 Bacteria 1704
805 Ga0496105_0008697 3300048908 Bacteria 7900
806 Ga0496105_0050684 3300048908 Bacteria 3429
807 Ga0496105_0256239 3300048908 Bacteria 1416
808 Ga0496106_0022118 3300048909 Bacteria 4722
809 Ga0496106_0299811 3300048909 Bacteria 1289
810 Ga0496107_0001227 3300048910 Bacteria 15652
811 Ga0496108_0049238 3300048911 Bacteria 3524
812 Ga0496108_0173590 3300048911 Bacteria 1865
813 Ga0496108_0225623 3300048911 Bacteria 1628
814 Ga0496108_0365082 3300048911 Bacteria 1260
815 Ga0496109_0057825 3300048912 Bacteria 3541
816 Ga0496109_0118398 3300048912 Bacteria 2466
817 Ga0496109_0886103 3300048912 Bacteria 830
818 Ga0496110_0007441 3300048913 Bacteria 8747
819 Ga0496110_0204667 3300048913 Bacteria 1794
820 Ga0496111_0072319 3300048914 Bacteria 2510
821 Ga0496112_0088621 3300048915 Bacteria 3062
822 Ga0496112_0104855 3300048915 Bacteria 2797
823 Ga0496112_0177127 3300048915 Bacteria 2097
824 Ga0496112_0394726 3300048915 Bacteria 1323
825 Ga0496113_0020887 3300048916 Bacteria 4612
826 Ga0496113_0037774 3300048916 Bacteria 3547
827 Ga0496115_0022061 3300048918 Bacteria 4926
828 Ga0496116_0127278 3300048919 Bacteria 1460
829 Ga0496117_0003630 3300048920 Bacteria 17770
830 Ga0496118_0010798 3300048921 Bacteria 8997
831 Ga0496121_0001572 3300048924 Bacteria 38031
832 Ga0496121_0051858 3300048924 Bacteria 3452
833 Ga0496121_0135321 3300048924 Bacteria 1837
834 Ga0496122_0173024 3300048925 Bacteria 1298
835 Ga0496123_0031626 3300048926 Bacteria 3847
836 Ga0496126_0008605 3300048929 Bacteria 10983
837 Ga0496126_0110482 3300048929 Bacteria 2395
838 Ga0496126_0114982 3300048929 Bacteria 2340
839 Ga0496126_0222400 3300048929 Bacteria 1585
840 Ga0501031_0063494 3300049568 Bacteria 2406
841 Ga0501033_0015021 3300049570 Bacteria 5878
842 Ga0501034_0029827 3300049571 Bacteria 5544
843 Ga0501034_0044973 3300049571 Bacteria 4462
844 Ga0501034_0273259 3300049571 Bacteria 1631
845 Ga0501034_0360463 3300049571 Bacteria 1381
846 Ga0501036_0006734 3300049572 Bacteria 9341
847 Ga0501036_0093588 3300049572 Bacteria 2539
848 Ga0501036_0213089 3300049572 Bacteria 1623
849 Ga0501036_0297152 3300049572 Bacteria 1351
850 Ga0501038_0002157 3300049574 Bacteria 18290
851 Ga0501038_0049869 3300049574 Bacteria 3618
852 Ga0501038_0061036 3300049574 Bacteria 3225
853 Ga0501039_0048849 3300049575 Bacteria 3271
854 Ga0501039_0189821 3300049575 Bacteria 1616
855 Ga0501040_0000906 3300049576 Bacteria 18608
856 Ga0501040_0005522 3300049576 Bacteria 8189
857 Ga0501040_0096766 3300049576 Bacteria 2056
858 Ga0501040_0350384 3300049576 Bacteria 1058
859 Ga0501041_0009565 3300049577 Bacteria 5715
860 Ga0501041_0063399 3300049577 Bacteria 2263
861 Ga0501041_0150096 3300049577 Bacteria 1455
862 Ga0501042_0000035 3300049578 Bacteria 43703
863 Ga0501042_0028580 3300049578 Bacteria 3930
864 Ga0501042_0313151 3300049578 Bacteria 1134
865 Ga0501046_0009529 3300049580 Bacteria 8389
866 Ga0501046_0129428 3300049580 Bacteria 1915
867 Ga0501046_0272008 3300049580 Bacteria 1242
868 Ga0501046_0346596 3300049580 Bacteria 1079
869 Ga0501048_0013519 3300049582 Bacteria 6057
870 Ga0501067_0043894 3300049583 Bacteria 2484
871 Ga0501068_0023383 3300049584 Bacteria 3621
872 Ga0501069_0246373 3300049585 Bacteria 1042
873 Ga0501070_0052327 3300049586 Bacteria 3389
874 Ga0501070_0606219 3300049586 Bacteria 872
875 Ga0501071_0000007 3300049587 Bacteria 73318
876 Ga0501072_0001853 3300049588 Bacteria 15746
877 Ga0501072_0007323 3300049588 Bacteria 8371
878 Ga0501072_0102163 3300049588 Bacteria 2279
879 Ga0501072_0212854 3300049588 Bacteria 1540
880 Ga0501072_0460444 3300049588 Bacteria 1007
881 Ga0501073_0066937 3300049589 Bacteria 2504
882 Ga0501074_0000890 3300049590 Bacteria 19092
883 Ga0501074_0011936 3300049590 Bacteria 6318
884 Ga0501074_0045444 3300049590 Bacteria 3178
885 Ga0501074_0102208 3300049590 Bacteria 2052
886 Ga0501075_0004980 3300049591 Bacteria 9060
887 Ga0501075_0008897 3300049591 Bacteria 7003
888 Ga0501075_0265060 3300049591 Bacteria 1309
889 Ga0501075_0284358 3300049591 Bacteria 1260
890 Ga0501076_0002324 3300049592 Bacteria 13021
891 Ga0501076_0003466 3300049592 Bacteria 11075
892 Ga0501076_0150081 3300049592 Bacteria 1896
893 Ga0501077_0000416 3300049593 Bacteria 25791
894 Ga0501077_0012149 3300049593 Bacteria 5389
895 Ga0501077_0083034 3300049593 Bacteria 2030
896 Ga0501079_0000624 3300049741 Bacteria 23502
897 Ga0501079_0003460 3300049741 Bacteria 11600
898 Ga0501079_0012156 3300049741 Bacteria 6572
899 Ga0501079_0067224 3300049741 Bacteria 2766
900 Ga0501079_0113823 3300049741 Bacteria 2103
901 Ga0501080_0000512 3300049742 Bacteria 30523
902 Ga0501080_0002139 3300049742 Bacteria 17167
903 Ga0501080_0061963 3300049742 Bacteria 3481
904 Ga0501080_0160405 3300049742 Bacteria 2077
905 Ga0501080_0999471 3300049742 Bacteria 726
906 Ga0501081_0008832 3300049743 Bacteria 6551
907 Ga0501081_0016154 3300049743 Bacteria 4930
908 Ga0501081_0017365 3300049743 Bacteria 4762
909 Ga0501081_0145991 3300049743 Bacteria 1698
910 Ga0501081_0249084 3300049743 Bacteria 1297
911 Ga0501081_0254236 3300049743 Bacteria 1283
912 Ga0501081_0417951 3300049743 Bacteria 994
913 Ga0501083_0394444 3300049744 Bacteria 900
914 Ga0501035_0012129 3300049822 Bacteria 7970
915 Ga0501035_0124134 3300049822 Bacteria 2255
916 Ga0501044_0110959 3300049823 Bacteria 2751
917 Ga0501045_0000029 3300049824 Bacteria 60421
918 Ga0501045_0013527 3300049824 Bacteria 5764
919 Ga0501045_0052869 3300049824 Bacteria 2967
920 Ga0501045_0107985 3300049824 Bacteria 2063
921 nmdc:mga03683_41561_c1 3300050489 Bacteria 1889
922 nmdc:mga03n38_1857_c1 3300050490 Bacteria 6306
923 nmdc:mga03n38_20425_c1 3300050490 Bacteria 2649
924 nmdc:mga00v17_366329_c1 3300050491 Bacteria 937
925 nmdc:mga0yw44_286956_c1 3300050492 Bacteria 1101
926 nmdc:mga0yw44_39681_c1 3300050492 Bacteria 2793
927 nmdc:mga0yw44_600552_c1 3300050492 Bacteria 748
928 nmdc:mga0yw44_69373_c1 3300050492 Bacteria 2183
929 nmdc:mga0k408_309391_c1 3300050493 Bacteria 943
930 nmdc:mga0k408_80884_c1 3300050493 Bacteria 1902
931 nmdc:mga06z11_31047_c1 3300050494 Bacteria 2592
932 nmdc:mga06z11_54019_c1 3300050494 Bacteria 2069
933 nmdc:mga06z11_78189_c1 3300050494 Bacteria 1768
934 nmdc:mga06z11_92811_c1 3300050494 Bacteria 1642
935 nmdc:mga04h51_132065_c1 3300050495 Bacteria 940
936 nmdc:mga04h51_92715_c1 3300050495 Bacteria 1089
937 nmdc:mga07m45_14266_c2 3300050496 Bacteria 1237
938 nmdc:mga05p37_109_c1 3300050507 Bacteria 74571
939 nmdc:mga05p37_1198817_c1 3300050507 Bacteria 784
940 nmdc:mga05p37_188231_c1 3300050507 Plasmid 2508
941 nmdc:mga05p37_214957_c1 3300050507 Bacteria 2323
942 nmdc:mga05p37_237746_c1 3300050507 Bacteria 2192
943 nmdc:mga05p37_246642_c1 3300050507 Bacteria 2144
944 nmdc:mga05p37_281300_c1 3300050507 Bacteria 1984
945 nmdc:mga05p37_443652_c1 3300050507 Bacteria 1504
946 nmdc:mga05p37_7536_c1 3300050507 Bacteria 12830
947 nmdc:mga09592_16967_c1 3300050508 Bacteria 5959
948 nmdc:mga09592_26569_c1 3300050508 Bacteria 4798
949 nmdc:mga09592_291128_c1 3300050508 Bacteria 1416
950 nmdc:mga09592_357095_c1 3300050508 Bacteria 1265
951 nmdc:mga09592_654955_c1 3300050508 Bacteria 896
952 nmdc:mga09592_754_c1 3300050508 Bacteria 24849
953 nmdc:mga09592_79346_c1 3300050508 Bacteria 2794
954 nmdc:mga0qj67_10743_c1 3300050509 Bacteria 6845
955 nmdc:mga0qj67_1103_c1 3300050509 Bacteria 18726
956 nmdc:mga0qj67_129978_c1 3300050509 Bacteria 2040
957 nmdc:mga0qj67_220871_c1 3300050509 Bacteria 1538
958 nmdc:mga0qj67_41864_c1 3300050509 Unclassified 3605
959 nmdc:mga0qj67_47826_c1 3300050509 Bacteria 3379
960 nmdc:mga0qj67_7392_c1 3300050509 Bacteria 8120
961 nmdc:mga06r32_117505_c1 3300050510 Bacteria 2621
962 nmdc:mga06r32_168813_c1 3300050510 Bacteria 2171
963 nmdc:mga06r32_199877_c1 3300050510 Bacteria 1987
964 nmdc:mga06r32_29856_c1 3300050510 Bacteria 5113
965 nmdc:mga06r32_553346_c1 3300050510 Bacteria 1124
966 nmdc:mga06r32_63429_c1 3300050510 Bacteria 3561
967 nmdc:mga06r32_63637_c1 3300050510 Bacteria 3556
968 nmdc:mga06r32_6421_c1 3300050510 Bacteria 10563
969 nmdc:mga06r32_661643_c1 3300050510 Bacteria 1012
970 nmdc:mga08y16_198311_c1 3300050511 Bacteria 2080
971 nmdc:mga08y16_21654_c1 3300050511 Bacteria 6787
972 nmdc:mga08y16_310675_c1 3300050511 Bacteria 1623
973 nmdc:mga08y16_355340_c1 3300050511 Bacteria 1505
974 nmdc:mga08y16_36479_c1 3300050511 Bacteria 5163
975 nmdc:mga08y16_454175_c1 3300050511 Bacteria 1306
976 nmdc:mga08y16_56786_c1 3300050511 Bacteria 4091
977 nmdc:mga08y16_607426_c1 3300050511 Bacteria 1102
978 nmdc:mga08y16_677050_c1 3300050511 Unclassified 1033
979 nmdc:mga08y16_77177_c1 3300050511 Bacteria 3473
980 nmdc:mga08y16_80472_c1 3300050511 Bacteria 3397
981 nmdc:mga0n895_16307_c1 3300050512 Bacteria 6813
982 nmdc:mga0n895_175850_c1 3300050512 Bacteria 2171
983 nmdc:mga0n895_202821_c1 3300050512 Bacteria 2014
984 nmdc:mga0n895_42519_c1 3300050512 Bacteria 4421
985 nmdc:mga0n895_663266_c1 3300050512 Bacteria 1041
986 nmdc:mga0n895_7693_c1 3300050512 Bacteria 9271
987 nmdc:mga0n895_87815_c1 3300050512 Bacteria 3108
988 nmdc:mga0rr50_116094_c1 3300050513 Bacteria 2125
989 nmdc:mga0rr50_119942_c1 3300050513 Bacteria 2092
990 nmdc:mga0rr50_15506_c1 3300050513 Bacteria 5032
991 nmdc:mga0rr50_7491_c1 3300050513 Bacteria 6737
992 nmdc:mga08x19_1428_c1 3300050514 Bacteria 14774
993 nmdc:mga08x19_311646_c1 3300050514 Bacteria 1094
994 nmdc:mga08x19_378288_c1 3300050514 Bacteria 991
995 nmdc:mga0a205_12754_c1 3300050515 Bacteria 7792
996 nmdc:mga0a205_1353_c1 3300050515 Bacteria 20648
997 nmdc:mga0a205_308416_c1 3300050515 Bacteria 1455
998 nmdc:mga0sz30_1337_c1 3300050516 Bacteria 8797
999 nmdc:mga0sz30_165760_c1 3300050516 Bacteria 979
1000 nmdc:mga0sz30_4470_c1 3300050516 Bacteria 2618
1001 Ga0495601_0013464 3300053077 Bacteria 4921
1002 Ga0495601_0035902 3300053077 Bacteria 3095
1003 Ga0495601_0084666 3300053077 Bacteria 2037
1004 Ga0495601_0179977 3300053077 Bacteria 1382
1005 Ga0495612_0011345 3300053078 Bacteria 3592
1006 Ga0495595_0058130 3300053084 Bacteria 1805
1007 Ga0495595_0103369 3300053084 Bacteria 1376
1008 Ga0495619_0007665 3300053085 Bacteria 6836
1009 Ga0495619_0023438 3300053085 Bacteria 3958
1010 Ga0495619_0065822 3300053085 Bacteria 2418
1011 Ga0500646_0132143 3300053090 Bacteria 812
1012 Ga0500642_0229206 3300053130 Bacteria 859
1013 Ga0500604_0111355 3300053151 Bacteria 909
1014 Ga0500616_0002472 3300053153 Bacteria 15337
1015 Ga0500616_0077499 3300053153 Bacteria 1678
1016 Ga0500645_033059 3300053730 Bacteria 1549
1017 Ga0501084_0001721 3300054114 Bacteria 17359
1018 Ga0501084_0017907 3300054114 Bacteria 5898
1019 Ga0501084_0025366 3300054114 Bacteria 4945
1020 Ga0501084_0036910 3300054114 Bacteria 4083
1021 Ga0501084_0208733 3300054114 Bacteria 1648
1022 Ga0501084_0209696 3300054114 Bacteria 1644
1023 Ga0501084_0437477 3300054114 Bacteria 1106
1024 Ga0501084_0497065 3300054114 Bacteria 1031
1025 Ga0501084_0899748 3300054114 Bacteria 744
1026 Ga0501082_0014375 3300060353 Bacteria 6811
1027 Ga0501082_0020395 3300060353 Bacteria 5714
1028 Ga0501082_0133887 3300060353 Bacteria 2150
1029 Ga0501082_0259702 3300060353 Bacteria 1511
1030 Ga0501082_0326966 3300060353 Bacteria 1336
1031 Ga0466962_0019244 3300061719 Bacteria 3280
1032 Ga0530510_0003414 3300061734 Bacteria 10926
1033 Ga0530510_0004308 3300061734 Bacteria 9845
1034 Ga0530510_0006430 3300061734 Bacteria 8184
1035 Ga0530510_0024289 3300061734 Bacteria 4323
1036 Ga0530510_0103592 3300061734 Unclassified 2081
1037 Ga0530510_0116450 3300061734 Bacteria 1959

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019565922 8019572186 205
2 3300049742 Ga0501080_0999471 Ga0501080_0999471_46_696 210
3 3300050511 nmdc:mga08y16_677050_c1 nmdc:mga08y16_677050_c1_38_673 210
4 3300005355 Ga0070671_100227593 Ga0070671_1002275932 220
5 3300005434 Ga0070709_10029357 Ga0070709_100293573 220
6 3300005436 Ga0070713_100350499 Ga0070713_1003504991 220
7 3300005548 Ga0070665_100330026 Ga0070665_1003300263 220
8 3300005618 Ga0068864_100334698 Ga0068864_1003346981 220
9 3300005843 Ga0068860_100161420 Ga0068860_1001614203 220
10 3300009147 Ga0114129_10011216 Ga0114129_100112168 220
11 3300013297 Ga0157378_10084372 Ga0157378_100843721 220
12 3300013306 Ga0163162_11251087 Ga0163162_112510871 220
13 3300025921 Ga0207652_10053420 Ga0207652_100534202 220
14 3300025927 Ga0207687_10210680 Ga0207687_102106802 220
15 3300025929 Ga0207664_10192727 Ga0207664_101927272 220
16 3300025944 Ga0207661_10406142 Ga0207661_104061422 220
17 3300028379 Ga0268266_10344079 Ga0268266_103440792 220
18 3300028381 Ga0268264_10076507 Ga0268264_100765073 220
19 3300035692 Ga0373935_0216199 Ga0373935_0216199_125_787 220
20 3300036401 Ga0373937_0034276 Ga0373937_0034276_3736_4398 220
21 3300042013 Ga0439456_046709 Ga0439456_046709_145_807 220
22 3300044842 Ga0466957_0620872 Ga0466957_0620872_32_694 220
23 3300045049 Ga0466959_0549602 Ga0466959_0549602_96_758 220
24 3300045051 Ga0451576_0057652 Ga0451576_0057652_2029_2691 220
25 3300045976 Ga0466967_0725797 Ga0466967_0725797_311_973 220
26 3300046454 Ga0495592_0307369 Ga0495592_0307369_54_716 220
27 3300046529 Ga0495652_0412241 Ga0495652_0412241_130_792 220
28 3300046543 Ga0495645_0199234 Ga0495645_0199234_88_750 220
29 3300048929 Ga0496126_0114982 Ga0496126_0114982_1083_1745 220
30 3300049585 Ga0501069_0246373 Ga0501069_0246373_355_1017 220
31 3300050507 nmdc:mga05p37_7536_c1 nmdc:mga05p37_7536_c1_4920_5582 220
32 3300050515 nmdc:mga0a205_308416_c1 nmdc:mga0a205_308416_c1_323_985 220
33 3300054114 Ga0501084_0497065 Ga0501084_0497065_177_839 220
34 3300054114 Ga0501084_0899748 Ga0501084_0899748_70_732 220
35 3300039438 Ga0436360_0513745 Ga0436360_0513745_46_747 224
36 3300049742 Ga0501080_0160405 Ga0501080_0160405_575_1300 224
37 3300035111 Ga0373923_0077565 Ga0373923_0077565_13_699 228
38 3300035116 Ga0373945_0037865 Ga0373945_0037865_501_1187 228
39 3300035171 Ga0373946_0047655 Ga0373946_0047655_496_1182 228
40 3300035692 Ga0373935_0291096 Ga0373935_0291096_405_1091 228
41 3300035724 Ga0373933_0066336 Ga0373933_0066336_872_1558 228
42 3300035725 Ga0373947_0053109 Ga0373947_0053109_61_747 228
43 3300036401 Ga0373937_0126081 Ga0373937_0126081_1269_1955 228
44 3300046473 Ga0495582_0249034 Ga0495582_0249034_295_981 228
45 3300003659 JGI25404J52841_10001396 JGI25404J52841_100013962 229
46 3300005983 Ga0081540_1004048 Ga0081540_100404811 229
47 3300039450 Ga0436363_1646537 Ga0436363_1646537_10_702 229
48 3300046459 Ga0495629_0251548 Ga0495629_0251548_281_970 229
49 3300050510 nmdc:mga06r32_661643_c1 nmdc:mga06r32_661643_c1_244_945 229
50 iso_pu_bacteria 2513237096 2513658547 229
51 iso_pu_bacteria 2513237137 2513860129 229
52 iso_pu_bacteria 2513237141 2513890553 229
53 iso_pu_bacteria 2513237145 2513920663 229
54 iso_pu_bacteria 2517572143 2517888571 229
55 iso_pu_bacteria 2524023228 2524535115 229
56 iso_pu_bacteria 2667528175 2671119751 229
57 iso_pu_bacteria 2728368998 2728755245 229
58 iso_pu_bacteria 2791355197 2793067391 229
59 iso_pu_bacteria 2885374607 2885377867 229
60 iso_pu_bacteria 2885409591 2885418738 229
61 iso_pu_bacteria 2904699407 2904708180 229
62 iso_pu_bacteria 2906610324 2906614074 229
63 iso_pu_bacteria 2906635258 2906637744 229
64 iso_pu_bacteria 2906660503 2906668312 229
65 iso_pu_bacteria 2908739725 2908747107 229
66 iso_pu_bacteria 2922425934 2922434561 229
67 iso_pu_bacteria 2935630451 2935637585 229
68 iso_pu_bacteria 2941507105 2941514178 229
69 iso_pu_bacteria 2941515067 2941522139 229
70 iso_pu_bacteria 2941523033 2941529877 229
71 iso_pu_bacteria 3005474847 3005483668 229
72 iso_pu_bacteria 8006933436 8006936536 229
73 iso_pu_bacteria 8006973647 8006976502 229
74 iso_pu_bacteria 8019555841 8019562120 229
75 iso_pu_bacteria 8056681323 8056682505 229
76 3300005295 Ga0065707_10119993 Ga0065707_101199933 230
77 3300005434 Ga0070709_10088423 Ga0070709_100884231 230
78 3300005435 Ga0070714_100059244 Ga0070714_1000592443 230
79 3300005546 Ga0070696_100172418 Ga0070696_1001724182 230
80 3300006914 Ga0075436_100048683 Ga0075436_1000486832 230
81 3300025906 Ga0207699_10027940 Ga0207699_100279402 230
82 3300025929 Ga0207664_10018559 Ga0207664_100185593 230
83 iso_pu_bacteria 2511231024 2511373584 230
84 iso_pu_bacteria 2513237094 2513641309 230
85 iso_pu_bacteria 2847930680 2847935728 230
86 iso_pu_bacteria 2876808645 2876816650 230
87 iso_pu_bacteria 2879110137 2879117343 230
88 iso_pu_bacteria 2881412998 2881415058 230
89 iso_pu_bacteria 2887375801 2887376900 230
90 iso_pu_bacteria 2903748898 2903757263 230
91 iso_pu_bacteria 2906643746 2906645112 230
92 iso_pu_bacteria 2928163908 2928166181 230
93 iso_pu_bacteria 8056689827 8056692393 230
94 3300005549 Ga0070704_100057400 Ga0070704_1000574002 231
95 3300005937 Ga0081455_10001134 Ga0081455_1000113413 231
96 3300049576 Ga0501040_0350384 Ga0501040_0350384_123_818 231
97 3300005468 Ga0070707_100118537 Ga0070707_1001185373 232
98 3300006847 Ga0075431_100018577 Ga0075431_1000185778 232
99 3300009094 Ga0111539_10021387 Ga0111539_100213872 232
100 3300025907 Ga0207645_10004028 Ga0207645_100040284 232
101 3300050507 nmdc:mga05p37_214957_c1 nmdc:mga05p37_214957_c1_294_995 232
102 3300050509 nmdc:mga0qj67_10743_c1 nmdc:mga0qj67_10743_c1_5087_5788 232
103 3300050510 nmdc:mga06r32_63429_c1 nmdc:mga06r32_63429_c1_918_1628 232
104 3300050510 nmdc:mga06r32_6421_c1 nmdc:mga06r32_6421_c1_8507_9208 232
105 3300050511 nmdc:mga08y16_21654_c1 nmdc:mga08y16_21654_c1_1330_2031 232
106 3300050512 nmdc:mga0n895_202821_c1 nmdc:mga0n895_202821_c1_233_934 232
107 3300050515 nmdc:mga0a205_12754_c1 nmdc:mga0a205_12754_c1_1149_1850 232
108 3300003659 JGI25404J52841_10027946 JGI25404J52841_100279462 233
109 3300005327 Ga0070658_10006326 Ga0070658_100063263 233
110 3300005328 Ga0070676_10028077 Ga0070676_100280772 233
111 3300005328 Ga0070676_10182914 Ga0070676_101829142 233
112 3300005329 Ga0070683_100074740 Ga0070683_1000747402 233
113 3300005330 Ga0070690_100061242 Ga0070690_1000612423 233
114 3300005330 Ga0070690_100088100 Ga0070690_1000881002 233
115 3300005331 Ga0070670_100013203 Ga0070670_1000132032 233
116 3300005335 Ga0070666_10110639 Ga0070666_101106392 233
117 3300005336 Ga0070680_100001927 Ga0070680_1000019276 233
118 3300005336 Ga0070680_100032091 Ga0070680_1000320913 233
119 3300005336 Ga0070680_100289534 Ga0070680_1002895342 233
120 3300005337 Ga0070682_100246581 Ga0070682_1002465812 233
121 3300005340 Ga0070689_100158953 Ga0070689_1001589531 233
122 3300005341 Ga0070691_10000329 Ga0070691_100003294 233
123 3300005341 Ga0070691_10004950 Ga0070691_100049503 233
124 3300005343 Ga0070687_100132891 Ga0070687_1001328912 233
125 3300005343 Ga0070687_100145007 Ga0070687_1001450072 233
126 3300005353 Ga0070669_100026327 Ga0070669_1000263272 233
127 3300005353 Ga0070669_100039908 Ga0070669_1000399084 233
128 3300005354 Ga0070675_100003469 Ga0070675_1000034694 233
129 3300005354 Ga0070675_100070905 Ga0070675_1000709052 233
130 3300005355 Ga0070671_100032760 Ga0070671_1000327605 233
131 3300005356 Ga0070674_100011210 Ga0070674_1000112106 233
132 3300005356 Ga0070674_100351410 Ga0070674_1003514102 233
133 3300005364 Ga0070673_100051254 Ga0070673_1000512542 233
134 3300005364 Ga0070673_100062956 Ga0070673_1000629563 233
135 3300005364 Ga0070673_100155060 Ga0070673_1001550602 233
136 3300005364 Ga0070673_100846652 Ga0070673_1008466521 233
137 3300005366 Ga0070659_100201221 Ga0070659_1002012212 233
138 3300005367 Ga0070667_100749712 Ga0070667_1007497121 233
139 3300005434 Ga0070709_10019017 Ga0070709_100190172 233
140 3300005435 Ga0070714_100020841 Ga0070714_1000208413 233
141 3300005435 Ga0070714_100501319 Ga0070714_1005013191 233
142 3300005436 Ga0070713_100014977 Ga0070713_1000149775 233
143 3300005436 Ga0070713_100021097 Ga0070713_1000210973 233
144 3300005436 Ga0070713_100132084 Ga0070713_1001320843 233
145 3300005437 Ga0070710_10098204 Ga0070710_100982043 233
146 3300005440 Ga0070705_100493315 Ga0070705_1004933151 233
147 3300005444 Ga0070694_100105982 Ga0070694_1001059821 233
148 3300005455 Ga0070663_100823562 Ga0070663_1008235621 233
149 3300005456 Ga0070678_100243734 Ga0070678_1002437342 233
150 3300005456 Ga0070678_100535080 Ga0070678_1005350802 233
151 3300005458 Ga0070681_10002685 Ga0070681_1000268517 233
152 3300005458 Ga0070681_10033835 Ga0070681_100338359 233
153 3300005458 Ga0070681_10092447 Ga0070681_100924473 233
154 3300005459 Ga0068867_100034469 Ga0068867_1000344691 233
155 3300005466 Ga0070685_10194140 Ga0070685_101941402 233
156 3300005530 Ga0070679_100011073 Ga0070679_1000110734 233
157 3300005530 Ga0070679_100037519 Ga0070679_1000375191 233
158 3300005530 Ga0070679_100080696 Ga0070679_1000806962 233
159 3300005535 Ga0070684_100008775 Ga0070684_1000087758 233
160 3300005536 Ga0070697_100146596 Ga0070697_1001465962 233
161 3300005543 Ga0070672_100434943 Ga0070672_1004349432 233
162 3300005544 Ga0070686_100065014 Ga0070686_1000650142 233
163 3300005545 Ga0070695_100005467 Ga0070695_1000054675 233
164 3300005546 Ga0070696_100003174 Ga0070696_1000031744 233
165 3300005546 Ga0070696_100296519 Ga0070696_1002965192 233
166 3300005548 Ga0070665_100033840 Ga0070665_1000338403 233
167 3300005548 Ga0070665_100587604 Ga0070665_1005876041 233
168 3300005549 Ga0070704_100033822 Ga0070704_1000338222 233
169 3300005549 Ga0070704_100313406 Ga0070704_1003134061 233
170 3300005549 Ga0070704_100375629 Ga0070704_1003756292 233
171 3300005563 Ga0068855_100011573 Ga0068855_10001157311 233
172 3300005563 Ga0068855_100334887 Ga0068855_1003348872 233
173 3300005577 Ga0068857_100030564 Ga0068857_1000305643 233
174 3300005614 Ga0068856_100002546 Ga0068856_10000254614 233
175 3300005614 Ga0068856_100160167 Ga0068856_1001601673 233
176 3300005614 Ga0068856_100169686 Ga0068856_1001696862 233
177 3300005615 Ga0070702_100094107 Ga0070702_1000941072 233
178 3300005616 Ga0068852_100524039 Ga0068852_1005240392 233
179 3300005618 Ga0068864_100042835 Ga0068864_1000428353 233
180 3300005718 Ga0068866_10031807 Ga0068866_100318073 233
181 3300005718 Ga0068866_10033248 Ga0068866_100332483 233
182 3300005719 Ga0068861_100000857 Ga0068861_1000008575 233
183 3300005719 Ga0068861_100068559 Ga0068861_1000685591 233
184 3300005841 Ga0068863_100027027 Ga0068863_1000270277 233
185 3300005842 Ga0068858_100021764 Ga0068858_1000217649 233
186 3300005844 Ga0068862_100176988 Ga0068862_1001769883 233
187 3300005844 Ga0068862_100481959 Ga0068862_1004819592 233
188 3300005981 Ga0081538_10011156 Ga0081538_100111566 233
189 3300005981 Ga0081538_10081108 Ga0081538_100811083 233
190 3300005983 Ga0081540_1000099 Ga0081540_10000996 233
191 3300005983 Ga0081540_1069636 Ga0081540_10696361 233
192 3300006028 Ga0070717_10005042 Ga0070717_100050427 233
193 3300006028 Ga0070717_10049468 Ga0070717_100494683 233
194 3300006028 Ga0070717_10090224 Ga0070717_100902243 233
195 3300006028 Ga0070717_10243390 Ga0070717_102433902 233
196 3300006028 Ga0070717_10564819 Ga0070717_105648192 233
197 3300006028 Ga0070717_10757660 Ga0070717_107576601 233
198 3300006042 Ga0075368_10128725 Ga0075368_101287251 233
199 3300006051 Ga0075364_10250362 Ga0075364_102503622 233
200 3300006163 Ga0070715_10089219 Ga0070715_100892191 233
201 3300006175 Ga0070712_100069757 Ga0070712_1000697572 233
202 3300006178 Ga0075367_10094349 Ga0075367_100943493 233
203 3300006186 Ga0075369_10022620 Ga0075369_100226204 233
204 3300006186 Ga0075369_10177593 Ga0075369_101775932 233
205 3300006237 Ga0097621_100275959 Ga0097621_1002759592 233
206 3300006237 Ga0097621_100289668 Ga0097621_1002896681 233
207 3300006846 Ga0075430_100002744 Ga0075430_10000274415 233
208 3300006846 Ga0075430_100010364 Ga0075430_1000103642 233
209 3300006847 Ga0075431_100313276 Ga0075431_1003132763 233
210 3300006852 Ga0075433_10001856 Ga0075433_1000185611 233
211 3300006852 Ga0075433_10150743 Ga0075433_101507433 233
212 3300006871 Ga0075434_100017182 Ga0075434_1000171828 233
213 3300006871 Ga0075434_100019636 Ga0075434_1000196361 233
214 3300006871 Ga0075434_100061611 Ga0075434_1000616112 233
215 3300006871 Ga0075434_100222122 Ga0075434_1002221222 233
216 3300006881 Ga0068865_100024142 Ga0068865_1000241424 233
217 3300006881 Ga0068865_100233311 Ga0068865_1002333112 233
218 3300006914 Ga0075436_100002475 Ga0075436_1000024756 233
219 3300006914 Ga0075436_100349312 Ga0075436_1003493121 233
220 3300006914 Ga0075436_100563748 Ga0075436_1005637481 233
221 3300006942 Ga0099824_1010358 Ga0099824_101035814 233
222 3300006943 Ga0099822_1011679 Ga0099822_10116799 233
223 3300007076 Ga0075435_100010249 Ga0075435_10001024911 233
224 3300007076 Ga0075435_100026643 Ga0075435_1000266434 233
225 3300009093 Ga0105240_10020965 Ga0105240_100209655 233
226 3300009093 Ga0105240_10073123 Ga0105240_100731237 233
227 3300009093 Ga0105240_10142513 Ga0105240_101425133 233
228 3300009094 Ga0111539_10268814 Ga0111539_102688143 233
229 3300009094 Ga0111539_10449443 Ga0111539_104494432 233
230 3300009098 Ga0105245_10313864 Ga0105245_103138641 233
231 3300009147 Ga0114129_10034081 Ga0114129_100340815 233
232 3300009147 Ga0114129_10830926 Ga0114129_108309262 233
233 3300009148 Ga0105243_10041053 Ga0105243_100410532 233
234 3300009148 Ga0105243_10059591 Ga0105243_100595912 233
235 3300009176 Ga0105242_10222766 Ga0105242_102227662 233
236 3300009551 Ga0105238_10018836 Ga0105238_100188364 233
237 3300009551 Ga0105238_10753349 Ga0105238_107533491 233
238 3300009553 Ga0105249_10553884 Ga0105249_105538842 233
239 3300010375 Ga0105239_10044406 Ga0105239_100444066 233
240 3300010375 Ga0105239_10326917 Ga0105239_103269172 233
241 3300013104 Ga0157370_10046562 Ga0157370_100465622 233
242 3300013104 Ga0157370_10078130 Ga0157370_100781303 233
243 3300013104 Ga0157370_10140031 Ga0157370_101400312 233
244 3300013104 Ga0157370_10234338 Ga0157370_102343382 233
245 3300013105 Ga0157369_10004728 Ga0157369_100047289 233
246 3300013105 Ga0157369_10120862 Ga0157369_101208622 233
247 3300013105 Ga0157369_10379362 Ga0157369_103793622 233
248 3300013296 Ga0157374_10346365 Ga0157374_103463651 233
249 3300013296 Ga0157374_10786039 Ga0157374_107860392 233
250 3300013306 Ga0163162_10203702 Ga0163162_102037023 233
251 3300013306 Ga0163162_10922907 Ga0163162_109229072 233
252 3300013307 Ga0157372_10051839 Ga0157372_100518394 233
253 3300013308 Ga0157375_10086244 Ga0157375_100862443 233
254 3300013308 Ga0157375_10114897 Ga0157375_101148973 233
255 3300014326 Ga0157380_10042097 Ga0157380_100420973 233
256 3300014497 Ga0182008_10030391 Ga0182008_100303912 233
257 3300014745 Ga0157377_10310937 Ga0157377_103109371 233
258 3300014968 Ga0157379_10090347 Ga0157379_100903474 233
259 3300014969 Ga0157376_10015043 Ga0157376_100150432 233
260 3300020070 Ga0206356_11376152 Ga0206356_113761522 233
261 3300021361 Ga0213872_10149366 Ga0213872_101493661 233
262 3300021384 Ga0213876_10283219 Ga0213876_102832191 233
263 3300025261 Ga0209233_1033592 Ga0209233_10335922 233
264 3300025899 Ga0207642_10019878 Ga0207642_100198782 233
265 3300025899 Ga0207642_10098722 Ga0207642_100987222 233
266 3300025901 Ga0207688_10440605 Ga0207688_104406051 233
267 3300025904 Ga0207647_10056006 Ga0207647_100560062 233
268 3300025905 Ga0207685_10107146 Ga0207685_101071462 233
269 3300025906 Ga0207699_10106069 Ga0207699_101060692 233
270 3300025906 Ga0207699_10229154 Ga0207699_102291542 233
271 3300025906 Ga0207699_10329356 Ga0207699_103293562 233
272 3300025907 Ga0207645_10050054 Ga0207645_100500545 233
273 3300025908 Ga0207643_10017955 Ga0207643_100179554 233
274 3300025909 Ga0207705_10068507 Ga0207705_100685073 233
275 3300025910 Ga0207684_10292596 Ga0207684_102925961 233
276 3300025912 Ga0207707_10000642 Ga0207707_100006421 233
277 3300025912 Ga0207707_10004649 Ga0207707_1000464918 233
278 3300025912 Ga0207707_10081957 Ga0207707_100819571 233
279 3300025913 Ga0207695_10044531 Ga0207695_100445315 233
280 3300025913 Ga0207695_10084962 Ga0207695_100849622 233
281 3300025913 Ga0207695_10137687 Ga0207695_101376871 233
282 3300025914 Ga0207671_10197672 Ga0207671_101976722 233
283 3300025915 Ga0207693_10005660 Ga0207693_100056606 233
284 3300025917 Ga0207660_10017922 Ga0207660_100179222 233
285 3300025917 Ga0207660_10123833 Ga0207660_101238331 233
286 3300025917 Ga0207660_10528114 Ga0207660_105281141 233
287 3300025918 Ga0207662_10041516 Ga0207662_100415162 233
288 3300025921 Ga0207652_10039233 Ga0207652_100392333 233
289 3300025921 Ga0207652_10041125 Ga0207652_100411253 233
290 3300025921 Ga0207652_10071231 Ga0207652_100712312 233
291 3300025921 Ga0207652_10120193 Ga0207652_101201931 233
292 3300025922 Ga0207646_10193767 Ga0207646_101937672 233
293 3300025922 Ga0207646_10523156 Ga0207646_105231561 233
294 3300025923 Ga0207681_10088701 Ga0207681_100887014 233
295 3300025923 Ga0207681_10097944 Ga0207681_100979442 233
296 3300025924 Ga0207694_10114780 Ga0207694_101147802 233
297 3300025925 Ga0207650_10000781 Ga0207650_1000078118 233
298 3300025926 Ga0207659_10000872 Ga0207659_1000087211 233
299 3300025926 Ga0207659_10021857 Ga0207659_100218573 233
300 3300025928 Ga0207700_10184972 Ga0207700_101849722 233
301 3300025928 Ga0207700_10356556 Ga0207700_103565562 233
302 3300025929 Ga0207664_10055279 Ga0207664_100552792 233
303 3300025929 Ga0207664_10297950 Ga0207664_102979502 233
304 3300025931 Ga0207644_10033114 Ga0207644_100331144 233
305 3300025934 Ga0207686_10074502 Ga0207686_100745022 233
306 3300025934 Ga0207686_10438260 Ga0207686_104382602 233
307 3300025935 Ga0207709_10297343 Ga0207709_102973432 233
308 3300025935 Ga0207709_10461556 Ga0207709_104615561 233
309 3300025936 Ga0207670_10054126 Ga0207670_100541262 233
310 3300025937 Ga0207669_10023880 Ga0207669_100238802 233
311 3300025937 Ga0207669_10191811 Ga0207669_101918113 233
312 3300025938 Ga0207704_10094407 Ga0207704_100944072 233
313 3300025938 Ga0207704_10146636 Ga0207704_101466362 233
314 3300025939 Ga0207665_10414078 Ga0207665_104140782 233
315 3300025940 Ga0207691_10279871 Ga0207691_102798712 233
316 3300025944 Ga0207661_10001102 Ga0207661_1000110214 233
317 3300025944 Ga0207661_10032238 Ga0207661_100322382 233
318 3300025945 Ga0207679_10092569 Ga0207679_100925692 233
319 3300025949 Ga0207667_10019069 Ga0207667_100190695 233
320 3300025960 Ga0207651_10006912 Ga0207651_100069124 233
321 3300025960 Ga0207651_10230312 Ga0207651_102303121 233
322 3300025961 Ga0207712_10439109 Ga0207712_104391092 233
323 3300025972 Ga0207668_10166277 Ga0207668_101662772 233
324 3300025972 Ga0207668_10948252 Ga0207668_109482521 233
325 3300026035 Ga0207703_10079632 Ga0207703_100796323 233
326 3300026041 Ga0207639_10140780 Ga0207639_101407802 233
327 3300026041 Ga0207639_11097192 Ga0207639_110971921 233
328 3300026067 Ga0207678_10726638 Ga0207678_107266381 233
329 3300026075 Ga0207708_10004708 Ga0207708_100047088 233
330 3300026075 Ga0207708_10472478 Ga0207708_104724781 233
331 3300026078 Ga0207702_10002900 Ga0207702_100029009 233
332 3300026078 Ga0207702_10111960 Ga0207702_101119602 233
333 3300026078 Ga0207702_10278850 Ga0207702_102788502 233
334 3300026088 Ga0207641_10820920 Ga0207641_108209202 233
335 3300026089 Ga0207648_10006984 Ga0207648_1000698412 233
336 3300026089 Ga0207648_10090889 Ga0207648_100908892 233
337 3300026095 Ga0207676_10010115 Ga0207676_100101153 233
338 3300026116 Ga0207674_10088227 Ga0207674_100882273 233
339 3300026118 Ga0207675_100001111 Ga0207675_10000111112 233
340 3300026121 Ga0207683_10145399 Ga0207683_101453992 233
341 3300026121 Ga0207683_10165211 Ga0207683_101652112 233
342 3300026121 Ga0207683_10285093 Ga0207683_102850932 233
343 3300026121 Ga0207683_10355926 Ga0207683_103559262 233
344 3300027357 Ga0209589_1000001 Ga0209589_1000001456 233
345 3300027360 Ga0209969_1013838 Ga0209969_10138382 233
346 3300027361 Ga0209489_100001 Ga0209489_100001456 233
347 3300027363 Ga0209700_100001 Ga0209700_100001456 233
348 3300027378 Ga0209981_1001056 Ga0209981_10010562 233
349 3300027462 Ga0210000_1007327 Ga0210000_10073272 233
350 3300027471 Ga0209995_1010700 Ga0209995_10107002 233
351 3300027526 Ga0209968_1016241 Ga0209968_10162412 233
352 3300028379 Ga0268266_10002798 Ga0268266_1000279816 233
353 3300028379 Ga0268266_10571950 Ga0268266_105719501 233
354 3300028380 Ga0268265_10472149 Ga0268265_104721491 233
355 3300031247 Ga0265340_10022948 Ga0265340_100229482 233
356 3300031249 Ga0265339_10004326 Ga0265339_100043263 233
357 3300031548 Ga0307408_100294440 Ga0307408_1002944401 233
358 3300031711 Ga0265314_10004147 Ga0265314_100041472 233
359 3300033442 Ga0315911_1000019 Ga0315911_1000019126 233
360 3300035083 Ga0373926_0031430 Ga0373926_0031430_540_1241 233
361 3300035086 Ga0373934_0121130 Ga0373934_0121130_19_720 233
362 3300035111 Ga0373923_0080737 Ga0373923_0080737_282_983 233
363 3300035113 Ga0373936_0009291 Ga0373936_0009291_2141_2842 233
364 3300035113 Ga0373936_0121413 Ga0373936_0121413_243_944 233
365 3300035116 Ga0373945_0156550 Ga0373945_0156550_70_771 233
366 3300035118 Ga0373954_0033145 Ga0373954_0033145_1165_1866 233
367 3300035118 Ga0373954_0085383 Ga0373954_0085383_211_960 233
368 3300035119 Ga0373956_0032222 Ga0373956_0032222_747_1448 233
369 3300035119 Ga0373956_0117284 Ga0373956_0117284_146_847 233
370 3300035120 Ga0373957_0021564 Ga0373957_0021564_1483_2184 233
371 3300035170 Ga0373943_0027831 Ga0373943_0027831_1771_2472 233
372 3300035170 Ga0373943_0176711 Ga0373943_0176711_277_978 233
373 3300035171 Ga0373946_0020107 Ga0373946_0020107_632_1333 233
374 3300035172 Ga0373955_0017692 Ga0373955_0017692_173_919 233
375 3300035172 Ga0373955_0037554 Ga0373955_0037554_1191_1892 233
376 3300035172 Ga0373955_0043529 Ga0373955_0043529_579_1280 233
377 3300035410 Ga0373924_0022137 Ga0373924_0022137_1496_2197 233
378 3300035691 Ga0373931_0208819 Ga0373931_0208819_278_979 233
379 3300035692 Ga0373935_0031978 Ga0373935_0031978_1555_2256 233
380 3300035695 Ga0373927_0051594 Ga0373927_0051594_368_1114 233
381 3300035695 Ga0373927_0215168 Ga0373927_0215168_534_1235 233
382 3300035724 Ga0373933_0000636 Ga0373933_0000636_12648_13349 233
383 3300035724 Ga0373933_0023287 Ga0373933_0023287_2037_2738 233
384 3300035725 Ga0373947_0086015 Ga0373947_0086015_229_930 233
385 3300036401 Ga0373937_0109026 Ga0373937_0109026_1435_2136 233
386 3300036401 Ga0373937_0709727 Ga0373937_0709727_121_822 233
387 3300036459 Ga0372808_005078 Ga0372808_005078_443_1144 233
388 3300037068 Ga0373925_0071610 Ga0373925_0071610_1579_2280 233
389 3300037312 Ga0395899_0332674 Ga0395899_0332674_242_943 233
390 3300037418 Ga0395900_0007634 Ga0395900_0007634_980_1681 233
391 3300037466 Ga0395898_0004948 Ga0395898_0004948_8394_9095 233
392 3300037466 Ga0395898_0038449 Ga0395898_0038449_834_1535 233
393 3300037466 Ga0395898_0222500 Ga0395898_0222500_496_1197 233
394 3300037853 Ga0436364_0726557 Ga0436364_0726557_119_820 233
395 3300038443 Ga0395901_0102296 Ga0395901_0102296_451_1152 233
396 3300039437 Ga0436365_0199779 Ga0436365_0199779_896_1597 233
397 3300039437 Ga0436365_0675434 Ga0436365_0675434_2382_3083 233
398 3300039437 Ga0436365_1234709 Ga0436365_1234709_338_1039 233
399 3300039437 Ga0436365_1327472 Ga0436365_1327472_263_964 233
400 3300039438 Ga0436360_1119639 Ga0436360_1119639_93_794 233
401 3300039447 Ga0436361_0808304 Ga0436361_0808304_255_956 233
402 3300039450 Ga0436363_0359787 Ga0436363_0359787_795_1496 233
403 3300039450 Ga0436363_1257565 Ga0436363_1257565_2183_2884 233
404 3300042001 Ga0439441_000158 Ga0439441_000158_3487_4188 233
405 3300042436 Ga0439435_0014803 Ga0439435_0014803_831_1532 233
406 3300042437 Ga0439444_0000818 Ga0439444_0000818_743_1444 233
407 3300044693 Ga0466961_0051159 Ga0466961_0051159_616_1317 233
408 3300044694 Ga0466963_0206608 Ga0466963_0206608_103_804 233
409 3300044765 Ga0466970_0069435 Ga0466970_0069435_436_1137 233
410 3300045049 Ga0466959_0036080 Ga0466959_0036080_2811_3512 233
411 3300045051 Ga0451576_0013568 Ga0451576_0013568_956_1660 233
412 3300045976 Ga0466967_0115925 Ga0466967_0115925_1543_2244 233
413 3300046454 Ga0495592_0053200 Ga0495592_0053200_2286_2987 233
414 3300046454 Ga0495592_0122000 Ga0495592_0122000_62_763 233
415 3300046459 Ga0495629_0103979 Ga0495629_0103979_190_891 233
416 3300046460 Ga0495638_0000330 Ga0495638_0000330_54501_55202 233
417 3300046462 Ga0495651_0115097 Ga0495651_0115097_847_1548 233
418 3300046473 Ga0495582_0035466 Ga0495582_0035466_931_1632 233
419 3300046475 Ga0495639_0106820 Ga0495639_0106820_321_1022 233
420 3300046477 Ga0495664_0007023 Ga0495664_0007023_2189_2950 233
421 3300046477 Ga0495664_0007261 Ga0495664_0007261_2047_2748 233
422 3300046477 Ga0495664_0009390 Ga0495664_0009390_1385_2086 233
423 3300046511 Ga0495608_0008754 Ga0495608_0008754_1373_2074 233
424 3300046511 Ga0495608_0049559 Ga0495608_0049559_529_1230 233
425 3300046516 Ga0495628_0103309 Ga0495628_0103309_1102_1803 233
426 3300046517 Ga0495630_0121394 Ga0495630_0121394_747_1448 233
427 3300046517 Ga0495630_0127898 Ga0495630_0127898_1213_1914 233
428 3300046529 Ga0495652_0249385 Ga0495652_0249385_446_1147 233
429 3300046529 Ga0495652_0284608 Ga0495652_0284608_496_1197 233
430 3300046531 Ga0495665_0216230 Ga0495665_0216230_86_787 233
431 3300046533 Ga0495640_0016968 Ga0495640_0016968_968_1669 233
432 3300046533 Ga0495640_0099384 Ga0495640_0099384_1155_1856 233
433 3300046535 Ga0495586_0049421 Ga0495586_0049421_991_1692 233
434 3300046543 Ga0495645_0000500 Ga0495645_0000500_1370_2071 233
435 3300046543 Ga0495645_0010769 Ga0495645_0010769_1323_2084 233
436 3300046559 Ga0495667_0042398 Ga0495667_0042398_1979_2680 233
437 3300046559 Ga0495667_0097203 Ga0495667_0097203_1047_1748 233
438 3300046559 Ga0495667_0167870 Ga0495667_0167870_41_742 233
439 3300046663 Ga0495635_0074400 Ga0495635_0074400_648_1349 233
440 3300046675 Ga0495657_0187779 Ga0495657_0187779_453_1154 233
441 3300046678 Ga0495599_0055545 Ga0495599_0055545_499_1200 233
442 3300046679 Ga0495623_0143549 Ga0495623_0143549_565_1266 233
443 3300046680 Ga0495646_0056973 Ga0495646_0056973_770_1471 233
444 3300046681 Ga0495647_0019335 Ga0495647_0019335_178_879 233
445 3300046690 Ga0495624_0026742 Ga0495624_0026742_554_1255 233
446 3300047315 Ga0495581_0134974 Ga0495581_0134974_540_1241 233
447 3300047319 Ga0495674_0069015 Ga0495674_0069015_2217_2918 233
448 3300047319 Ga0495674_0104836 Ga0495674_0104836_115_816 233
449 3300047319 Ga0495674_0260553 Ga0495674_0260553_511_1212 233
450 3300047322 Ga0495680_0024185 Ga0495680_0024185_3392_4093 233
451 3300047322 Ga0495680_0079794 Ga0495680_0079794_1568_2269 233
452 3300047444 Ga0495675_0044986 Ga0495675_0044986_1363_2064 233
453 3300047471 Ga0495684_0017127 Ga0495684_0017127_1951_2652 233
454 3300047471 Ga0495684_0033134 Ga0495684_0033134_653_1354 233
455 3300047673 Ga0495593_0159142 Ga0495593_0159142_428_1129 233
456 3300048088 Ga0495602_0000143 Ga0495602_0000143_1366_2067 233
457 3300048904 Ga0496101_0465438 Ga0496101_0465438_146_847 233
458 3300048905 Ga0496102_0507571 Ga0496102_0507571_165_869 233
459 3300048911 Ga0496108_0225623 Ga0496108_0225623_102_806 233
460 3300048911 Ga0496108_0365082 Ga0496108_0365082_382_1089 233
461 3300048916 Ga0496113_0037774 Ga0496113_0037774_666_1370 233
462 3300048924 Ga0496121_0135321 Ga0496121_0135321_505_1230 233
463 3300048929 Ga0496126_0110482 Ga0496126_0110482_970_1671 233
464 3300048929 Ga0496126_0222400 Ga0496126_0222400_305_1006 233
465 3300049580 Ga0501046_0129428 Ga0501046_0129428_816_1517 233
466 3300049580 Ga0501046_0272008 Ga0501046_0272008_494_1195 233
467 3300049584 Ga0501068_0023383 Ga0501068_0023383_982_1719 233
468 3300049586 Ga0501070_0052327 Ga0501070_0052327_2292_2993 233
469 3300049589 Ga0501073_0066937 Ga0501073_0066937_25_726 233
470 3300049590 Ga0501074_0045444 Ga0501074_0045444_1603_2304 233
471 3300049593 Ga0501077_0083034 Ga0501077_0083034_173_883 233
472 3300049823 Ga0501044_0110959 Ga0501044_0110959_2038_2739 233
473 3300050493 nmdc:mga0k408_309391_c1 nmdc:mga0k408_309391_c1_65_766 233
474 3300050494 nmdc:mga06z11_92811_c1 nmdc:mga06z11_92811_c1_214_915 233
475 3300050507 nmdc:mga05p37_188231_c1 nmdc:mga05p37_188231_c1_121_936 233
476 3300050508 nmdc:mga09592_26569_c1 nmdc:mga09592_26569_c1_1052_1756 233
477 3300050508 nmdc:mga09592_357095_c1 nmdc:mga09592_357095_c1_476_1177 233
478 3300050509 nmdc:mga0qj67_1103_c1 nmdc:mga0qj67_1103_c1_7958_8659 233
479 3300050509 nmdc:mga0qj67_129978_c1 nmdc:mga0qj67_129978_c1_712_1422 233
480 3300050509 nmdc:mga0qj67_220871_c1 nmdc:mga0qj67_220871_c1_114_815 233
481 3300050509 nmdc:mga0qj67_41864_c1 nmdc:mga0qj67_41864_c1_1044_1748 233
482 3300050510 nmdc:mga06r32_168813_c1 nmdc:mga06r32_168813_c1_111_830 233
483 3300050510 nmdc:mga06r32_199877_c1 nmdc:mga06r32_199877_c1_239_943 233
484 3300050511 nmdc:mga08y16_454175_c1 nmdc:mga08y16_454175_c1_555_1259 233
485 3300050511 nmdc:mga08y16_56786_c1 nmdc:mga08y16_56786_c1_2567_3268 233
486 3300050512 nmdc:mga0n895_16307_c1 nmdc:mga0n895_16307_c1_5860_6561 233
487 3300050512 nmdc:mga0n895_7693_c1 nmdc:mga0n895_7693_c1_3289_3990 233
488 3300050513 nmdc:mga0rr50_116094_c1 nmdc:mga0rr50_116094_c1_1242_1943 233
489 3300050513 nmdc:mga0rr50_7491_c1 nmdc:mga0rr50_7491_c1_2853_3554 233
490 3300050514 nmdc:mga08x19_1428_c1 nmdc:mga08x19_1428_c1_9056_9757 233
491 3300050514 nmdc:mga08x19_378288_c1 nmdc:mga08x19_378288_c1_182_883 233
492 3300050515 nmdc:mga0a205_1353_c1 nmdc:mga0a205_1353_c1_940_1641 233
493 3300050516 nmdc:mga0sz30_165760_c1 nmdc:mga0sz30_165760_c1_208_915 233
494 3300050516 nmdc:mga0sz30_4470_c1 nmdc:mga0sz30_4470_c1_1435_2136 233
495 3300053077 Ga0495601_0035902 Ga0495601_0035902_1421_2122 233
496 3300053077 Ga0495601_0084666 Ga0495601_0084666_162_863 233
497 3300053078 Ga0495612_0011345 Ga0495612_0011345_298_999 233
498 3300053084 Ga0495595_0103369 Ga0495595_0103369_645_1346 233
499 3300053090 Ga0500646_0132143 Ga0500646_0132143_31_732 233
500 3300053130 Ga0500642_0229206 Ga0500642_0229206_101_802 233
501 3300053153 Ga0500616_0002472 Ga0500616_0002472_12139_12840 233
502 3300053730 Ga0500645_033059 Ga0500645_033059_625_1326 233
503 3300061719 Ga0466962_0019244 Ga0466962_0019244_1565_2266 233
504 2162886007 SwRhRL2b_contig_1539896 SwRhRL2b_0706.00001320 234
505 3300003911 JGI25405J52794_10040079 JGI25405J52794_100400792 234
506 3300005289 Ga0065704_10070608 Ga0065704_1007060817 234
507 3300005295 Ga0065707_10090819 Ga0065707_100908199 234
508 3300005328 Ga0070676_10022931 Ga0070676_100229314 234
509 3300005330 Ga0070690_100250836 Ga0070690_1002508362 234
510 3300005334 Ga0068869_100055272 Ga0068869_1000552722 234
511 3300005335 Ga0070666_10178034 Ga0070666_101780342 234
512 3300005336 Ga0070680_100003662 Ga0070680_10000366211 234
513 3300005339 Ga0070660_100330502 Ga0070660_1003305022 234
514 3300005340 Ga0070689_100121898 Ga0070689_1001218982 234
515 3300005341 Ga0070691_10002207 Ga0070691_100022077 234
516 3300005343 Ga0070687_100397911 Ga0070687_1003979111 234
517 3300005345 Ga0070692_10033526 Ga0070692_100335265 234
518 3300005347 Ga0070668_100122403 Ga0070668_1001224032 234
519 3300005354 Ga0070675_100019794 Ga0070675_1000197945 234
520 3300005355 Ga0070671_100000809 Ga0070671_1000008095 234
521 3300005364 Ga0070673_100019506 Ga0070673_1000195064 234
522 3300005364 Ga0070673_100063682 Ga0070673_1000636824 234
523 3300005366 Ga0070659_100087438 Ga0070659_1000874383 234
524 3300005406 Ga0070703_10005122 Ga0070703_100051225 234
525 3300005406 Ga0070703_10181549 Ga0070703_101815491 234
526 3300005434 Ga0070709_10519459 Ga0070709_105194591 234
527 3300005435 Ga0070714_100058150 Ga0070714_1000581502 234
528 3300005435 Ga0070714_100103757 Ga0070714_1001037572 234
529 3300005436 Ga0070713_100121851 Ga0070713_1001218512 234
530 3300005439 Ga0070711_100128931 Ga0070711_1001289312 234
531 3300005439 Ga0070711_100746120 Ga0070711_1007461201 234
532 3300005440 Ga0070705_100000171 Ga0070705_10000017113 234
533 3300005440 Ga0070705_100017929 Ga0070705_1000179293 234
534 3300005441 Ga0070700_100000482 Ga0070700_1000004829 234
535 3300005441 Ga0070700_100029678 Ga0070700_1000296783 234
536 3300005444 Ga0070694_100000555 Ga0070694_1000005556 234
537 3300005444 Ga0070694_100167348 Ga0070694_1001673482 234
538 3300005445 Ga0070708_100197215 Ga0070708_1001972152 234
539 3300005445 Ga0070708_100197426 Ga0070708_1001974262 234
540 3300005445 Ga0070708_100246872 Ga0070708_1002468723 234
541 3300005445 Ga0070708_100337724 Ga0070708_1003377242 234
542 3300005455 Ga0070663_100085917 Ga0070663_1000859173 234
543 3300005456 Ga0070678_100026383 Ga0070678_1000263833 234
544 3300005456 Ga0070678_100175988 Ga0070678_1001759882 234
545 3300005457 Ga0070662_100806967 Ga0070662_1008069671 234
546 3300005458 Ga0070681_10018179 Ga0070681_100181793 234
547 3300005467 Ga0070706_100032937 Ga0070706_1000329373 234
548 3300005467 Ga0070706_100272557 Ga0070706_1002725573 234
549 3300005468 Ga0070707_100008295 Ga0070707_1000082955 234
550 3300005468 Ga0070707_100361524 Ga0070707_1003615242 234
551 3300005471 Ga0070698_100013437 Ga0070698_1000134375 234
552 3300005471 Ga0070698_100247533 Ga0070698_1002475333 234
553 3300005471 Ga0070698_100320946 Ga0070698_1003209461 234
554 3300005518 Ga0070699_100000167 Ga0070699_10000016725 234
555 3300005518 Ga0070699_100004951 Ga0070699_1000049514 234
556 3300005518 Ga0070699_100061845 Ga0070699_1000618452 234
557 3300005530 Ga0070679_100122535 Ga0070679_1001225352 234
558 3300005536 Ga0070697_100808672 Ga0070697_1008086721 234
559 3300005539 Ga0068853_100653878 Ga0068853_1006538781 234
560 3300005543 Ga0070672_100885923 Ga0070672_1008859231 234
561 3300005544 Ga0070686_100298485 Ga0070686_1002984852 234
562 3300005545 Ga0070695_100003493 Ga0070695_1000034932 234
563 3300005546 Ga0070696_100000097 Ga0070696_1000000972 234
564 3300005546 Ga0070696_100217350 Ga0070696_1002173502 234
565 3300005548 Ga0070665_100024997 Ga0070665_1000249974 234
566 3300005548 Ga0070665_100117938 Ga0070665_1001179384 234
567 3300005549 Ga0070704_100000416 Ga0070704_10000041611 234
568 3300005549 Ga0070704_100000566 Ga0070704_10000056614 234
569 3300005549 Ga0070704_100703976 Ga0070704_1007039761 234
570 3300005564 Ga0070664_100125491 Ga0070664_1001254912 234
571 3300005577 Ga0068857_100260672 Ga0068857_1002606722 234
572 3300005614 Ga0068856_100120313 Ga0068856_1001203132 234
573 3300005617 Ga0068859_100001658 Ga0068859_10000165825 234
574 3300005617 Ga0068859_100009816 Ga0068859_1000098165 234
575 3300005617 Ga0068859_100224369 Ga0068859_1002243692 234
576 3300005618 Ga0068864_100029916 Ga0068864_1000299167 234
577 3300005618 Ga0068864_100431749 Ga0068864_1004317492 234
578 3300005718 Ga0068866_10100296 Ga0068866_101002962 234
579 3300005719 Ga0068861_100095924 Ga0068861_1000959243 234
580 3300005719 Ga0068861_100208750 Ga0068861_1002087502 234
581 3300005719 Ga0068861_100237834 Ga0068861_1002378341 234
582 3300005840 Ga0068870_10071943 Ga0068870_100719432 234
583 3300005840 Ga0068870_10168790 Ga0068870_101687902 234
584 3300005842 Ga0068858_100061152 Ga0068858_1000611526 234
585 3300005842 Ga0068858_100970565 Ga0068858_1009705651 234
586 3300005843 Ga0068860_100001592 Ga0068860_10000159222 234
587 3300005843 Ga0068860_100340409 Ga0068860_1003404092 234
588 3300005844 Ga0068862_100001428 Ga0068862_10000142823 234
589 3300005844 Ga0068862_100333843 Ga0068862_1003338431 234
590 3300005937 Ga0081455_10000657 Ga0081455_1000065712 234
591 3300005937 Ga0081455_10000864 Ga0081455_1000086417 234
592 3300005937 Ga0081455_10001642 Ga0081455_100016422 234
593 3300005937 Ga0081455_10002534 Ga0081455_1000253412 234
594 3300005937 Ga0081455_10003988 Ga0081455_100039888 234
595 3300005937 Ga0081455_10006090 Ga0081455_1000609011 234
596 3300005937 Ga0081455_10032675 Ga0081455_100326752 234
597 3300005937 Ga0081455_10035407 Ga0081455_100354071 234
598 3300005937 Ga0081455_10068231 Ga0081455_100682313 234
599 3300005981 Ga0081538_10017699 Ga0081538_100176991 234
600 3300005981 Ga0081538_10040992 Ga0081538_100409922 234
601 3300005981 Ga0081538_10109354 Ga0081538_101093541 234
602 3300005983 Ga0081540_1000360 Ga0081540_10003603 234
603 3300005983 Ga0081540_1001779 Ga0081540_100177921 234
604 3300005983 Ga0081540_1011456 Ga0081540_10114563 234
605 3300005983 Ga0081540_1023457 Ga0081540_10234574 234
606 3300005983 Ga0081540_1072553 Ga0081540_10725532 234
607 3300005985 Ga0081539_10009313 Ga0081539_100093138 234
608 3300005985 Ga0081539_10014029 Ga0081539_100140299 234
609 3300005985 Ga0081539_10055442 Ga0081539_100554422 234
610 3300006028 Ga0070717_10022371 Ga0070717_100223712 234
611 3300006028 Ga0070717_10396837 Ga0070717_103968372 234
612 3300006038 Ga0075365_10019392 Ga0075365_100193923 234
613 3300006038 Ga0075365_10032160 Ga0075365_100321603 234
614 3300006042 Ga0075368_10028054 Ga0075368_100280543 234
615 3300006051 Ga0075364_10001339 Ga0075364_100013399 234
616 3300006163 Ga0070715_10049600 Ga0070715_100496002 234
617 3300006163 Ga0070715_10144294 Ga0070715_101442942 234
618 3300006175 Ga0070712_100011352 Ga0070712_1000113525 234
619 3300006175 Ga0070712_100114181 Ga0070712_1001141812 234
620 3300006175 Ga0070712_100354892 Ga0070712_1003548922 234
621 3300006178 Ga0075367_10000626 Ga0075367_100006263 234
622 3300006178 Ga0075367_10009405 Ga0075367_100094052 234
623 3300006178 Ga0075367_10110687 Ga0075367_101106872 234
624 3300006178 Ga0075367_10152045 Ga0075367_101520452 234
625 3300006186 Ga0075369_10000923 Ga0075369_100009239 234
626 3300006186 Ga0075369_10099908 Ga0075369_100999081 234
627 3300006195 Ga0075366_10065072 Ga0075366_100650722 234
628 3300006237 Ga0097621_100010240 Ga0097621_10001024010 234
629 3300006353 Ga0075370_10180418 Ga0075370_101804182 234
630 3300006358 Ga0068871_100092459 Ga0068871_1000924594 234
631 3300006358 Ga0068871_100294682 Ga0068871_1002946821 234
632 3300006844 Ga0075428_100001353 Ga0075428_10000135317 234
633 3300006844 Ga0075428_100019486 Ga0075428_1000194866 234
634 3300006844 Ga0075428_100073118 Ga0075428_1000731182 234
635 3300006844 Ga0075428_100111168 Ga0075428_1001111684 234
636 3300006844 Ga0075428_100169541 Ga0075428_1001695412 234
637 3300006844 Ga0075428_100424097 Ga0075428_1004240972 234
638 3300006844 Ga0075428_100531161 Ga0075428_1005311612 234
639 3300006846 Ga0075430_100080769 Ga0075430_1000807693 234
640 3300006847 Ga0075431_100000652 Ga0075431_10000065225 234
641 3300006847 Ga0075431_100000965 Ga0075431_10000096520 234
642 3300006847 Ga0075431_100008835 Ga0075431_1000088353 234
643 3300006847 Ga0075431_100018795 Ga0075431_1000187954 234
644 3300006847 Ga0075431_100037919 Ga0075431_1000379198 234
645 3300006847 Ga0075431_100051615 Ga0075431_1000516156 234
646 3300006847 Ga0075431_100086041 Ga0075431_1000860415 234
647 3300006847 Ga0075431_100311745 Ga0075431_1003117453 234
648 3300006847 Ga0075431_100420649 Ga0075431_1004206492 234
649 3300006852 Ga0075433_10009983 Ga0075433_100099832 234
650 3300006852 Ga0075433_10286572 Ga0075433_102865722 234
651 3300006852 Ga0075433_10409594 Ga0075433_104095942 234
652 3300006852 Ga0075433_10410290 Ga0075433_104102902 234
653 3300006871 Ga0075434_100016479 Ga0075434_1000164796 234
654 3300006871 Ga0075434_100091824 Ga0075434_1000918243 234
655 3300006871 Ga0075434_100142304 Ga0075434_1001423042 234
656 3300006871 Ga0075434_100201804 Ga0075434_1002018042 234
657 3300006880 Ga0075429_100000008 Ga0075429_10000000882 234
658 3300006880 Ga0075429_100016293 Ga0075429_1000162937 234
659 3300006880 Ga0075429_100083463 Ga0075429_1000834631 234
660 3300006880 Ga0075429_100171143 Ga0075429_1001711432 234
661 3300006914 Ga0075436_100414629 Ga0075436_1004146291 234
662 3300006931 Ga0097620_100001658 Ga0097620_10000165825 234
663 3300006931 Ga0097620_100009816 Ga0097620_10000981613 234
664 3300006931 Ga0097620_100027068 Ga0097620_1000270686 234
665 3300006931 Ga0097620_100076460 Ga0097620_1000764603 234
666 3300006931 Ga0097620_100224378 Ga0097620_1002243782 234
667 3300006942 Ga0099824_1017393 Ga0099824_10173934 234
668 3300006944 Ga0099823_1000008 Ga0099823_100000843 234
669 3300007076 Ga0075435_100003479 Ga0075435_10000347912 234
670 3300007076 Ga0075435_100156033 Ga0075435_1001560332 234
671 3300007076 Ga0075435_100612103 Ga0075435_1006121031 234
672 3300007265 Ga0099794_10021736 Ga0099794_100217363 234
673 3300007265 Ga0099794_10046570 Ga0099794_100465702 234
674 3300007788 Ga0099795_10096442 Ga0099795_100964422 234
675 3300007788 Ga0099795_10098942 Ga0099795_100989421 234
676 3300009094 Ga0111539_10002318 Ga0111539_100023188 234
677 3300009094 Ga0111539_10006931 Ga0111539_100069317 234
678 3300009094 Ga0111539_10014205 Ga0111539_100142058 234
679 3300009094 Ga0111539_10041808 Ga0111539_100418084 234
680 3300009094 Ga0111539_10043015 Ga0111539_100430154 234
681 3300009094 Ga0111539_10166565 Ga0111539_101665652 234
682 3300009094 Ga0111539_10217931 Ga0111539_102179312 234
683 3300009094 Ga0111539_10288311 Ga0111539_102883112 234
684 3300009094 Ga0111539_10372893 Ga0111539_103728932 234
685 3300009098 Ga0105245_10042501 Ga0105245_100425017 234
686 3300009098 Ga0105245_10113869 Ga0105245_101138692 234
687 3300009101 Ga0105247_10055307 Ga0105247_100553074 234
688 3300009147 Ga0114129_10000124 Ga0114129_1000012452 234
689 3300009147 Ga0114129_10001247 Ga0114129_1000124736 234
690 3300009147 Ga0114129_10036668 Ga0114129_100366689 234
691 3300009147 Ga0114129_10067868 Ga0114129_100678682 234
692 3300009147 Ga0114129_10164798 Ga0114129_101647983 234
693 3300009147 Ga0114129_10196755 Ga0114129_101967553 234
694 3300009147 Ga0114129_10204492 Ga0114129_102044922 234
695 3300009147 Ga0114129_10352186 Ga0114129_103521862 234
696 3300009147 Ga0114129_10464370 Ga0114129_104643702 234
697 3300009147 Ga0114129_10473705 Ga0114129_104737052 234
698 3300009147 Ga0114129_10530682 Ga0114129_105306822 234
699 3300009147 Ga0114129_10659418 Ga0114129_106594182 234
700 3300009147 Ga0114129_10827687 Ga0114129_108276872 234
701 3300009147 Ga0114129_10947226 Ga0114129_109472262 234
702 3300009148 Ga0105243_10128192 Ga0105243_101281922 234
703 3300009148 Ga0105243_10548847 Ga0105243_105488472 234
704 3300009177 Ga0105248_10045144 Ga0105248_100451445 234
705 3300009545 Ga0105237_10079588 Ga0105237_100795882 234
706 3300009551 Ga0105238_10547729 Ga0105238_105477292 234
707 3300009551 Ga0105238_10977371 Ga0105238_109773712 234
708 3300009553 Ga0105249_10340101 Ga0105249_103401011 234
709 3300009553 Ga0105249_11103158 Ga0105249_111031581 234
710 3300010159 Ga0099796_10048408 Ga0099796_100484082 234
711 3300010375 Ga0105239_10137147 Ga0105239_101371474 234
712 3300010375 Ga0105239_10839514 Ga0105239_108395142 234
713 3300011119 Ga0105246_10004309 Ga0105246_100043097 234
714 3300011119 Ga0105246_10266578 Ga0105246_102665782 234
715 3300011119 Ga0105246_10412621 Ga0105246_104126212 234
716 3300013105 Ga0157369_10080978 Ga0157369_100809783 234
717 3300013296 Ga0157374_10065852 Ga0157374_100658525 234
718 3300013297 Ga0157378_10104740 Ga0157378_101047402 234
719 3300013306 Ga0163162_10088047 Ga0163162_100880474 234
720 3300013306 Ga0163162_10324032 Ga0163162_103240322 234
721 3300013306 Ga0163162_10422832 Ga0163162_104228322 234
722 3300013307 Ga0157372_10216690 Ga0157372_102166902 234
723 3300013307 Ga0157372_10466617 Ga0157372_104666171 234
724 3300013308 Ga0157375_10047284 Ga0157375_100472845 234
725 3300013308 Ga0157375_10067217 Ga0157375_100672172 234
726 3300014325 Ga0163163_10004951 Ga0163163_100049514 234
727 3300014325 Ga0163163_10187646 Ga0163163_101876462 234
728 3300014325 Ga0163163_10432039 Ga0163163_104320392 234
729 3300014326 Ga0157380_10047458 Ga0157380_100474582 234
730 3300014326 Ga0157380_10585550 Ga0157380_105855501 234
731 3300014326 Ga0157380_10637380 Ga0157380_106373801 234
732 3300014968 Ga0157379_10084851 Ga0157379_100848512 234
733 3300014968 Ga0157379_10405397 Ga0157379_104053972 234
734 3300014969 Ga0157376_10177271 Ga0157376_101772712 234
735 3300014969 Ga0157376_10197518 Ga0157376_101975182 234
736 3300017792 Ga0163161_10097821 Ga0163161_100978212 234
737 3300017792 Ga0163161_10201383 Ga0163161_102013832 234
738 3300017792 Ga0163161_10453852 Ga0163161_104538521 234
739 3300021361 Ga0213872_10074428 Ga0213872_100744282 234
740 3300024227 Ga0228598_1003914 Ga0228598_10039142 234
741 3300025885 Ga0207653_10000520 Ga0207653_100005204 234
742 3300025898 Ga0207692_10184043 Ga0207692_101840432 234
743 3300025903 Ga0207680_10191384 Ga0207680_101913842 234
744 3300025904 Ga0207647_10004760 Ga0207647_100047602 234
745 3300025905 Ga0207685_10185814 Ga0207685_101858141 234
746 3300025908 Ga0207643_10170107 Ga0207643_101701072 234
747 3300025908 Ga0207643_10453525 Ga0207643_104535251 234
748 3300025910 Ga0207684_10132915 Ga0207684_101329152 234
749 3300025910 Ga0207684_10858669 Ga0207684_108586691 234
750 3300025912 Ga0207707_10023202 Ga0207707_100232026 234
751 3300025915 Ga0207693_10126573 Ga0207693_101265732 234
752 3300025916 Ga0207663_10048765 Ga0207663_100487651 234
753 3300025916 Ga0207663_10135262 Ga0207663_101352621 234
754 3300025917 Ga0207660_10009091 Ga0207660_100090917 234
755 3300025917 Ga0207660_10452900 Ga0207660_104529001 234
756 3300025924 Ga0207694_10503869 Ga0207694_105038692 234
757 3300025925 Ga0207650_10016748 Ga0207650_100167485 234
758 3300025926 Ga0207659_10038471 Ga0207659_100384712 234
759 3300025927 Ga0207687_10050784 Ga0207687_100507842 234
760 3300025927 Ga0207687_10170491 Ga0207687_101704912 234
761 3300025928 Ga0207700_10041534 Ga0207700_100415342 234
762 3300025928 Ga0207700_10136178 Ga0207700_101361782 234
763 3300025928 Ga0207700_10196080 Ga0207700_101960802 234
764 3300025929 Ga0207664_10173174 Ga0207664_101731742 234
765 3300025929 Ga0207664_10191078 Ga0207664_101910782 234
766 3300025931 Ga0207644_10000454 Ga0207644_100004545 234
767 3300025932 Ga0207690_10066046 Ga0207690_100660463 234
768 3300025935 Ga0207709_10790345 Ga0207709_107903451 234
769 3300025936 Ga0207670_10248731 Ga0207670_102487312 234
770 3300025936 Ga0207670_10405641 Ga0207670_104056411 234
771 3300025937 Ga0207669_10400518 Ga0207669_104005182 234
772 3300025939 Ga0207665_10048803 Ga0207665_100488034 234
773 3300025940 Ga0207691_10085352 Ga0207691_100853522 234
774 3300025940 Ga0207691_10241860 Ga0207691_102418601 234
775 3300025940 Ga0207691_10596947 Ga0207691_105969472 234
776 3300025942 Ga0207689_10142030 Ga0207689_101420303 234
777 3300025960 Ga0207651_10164488 Ga0207651_101644882 234
778 3300025961 Ga0207712_10121303 Ga0207712_101213031 234
779 3300025961 Ga0207712_10245975 Ga0207712_102459752 234
780 3300025986 Ga0207658_10345281 Ga0207658_103452812 234
781 3300026023 Ga0207677_10089296 Ga0207677_100892963 234
782 3300026035 Ga0207703_10031065 Ga0207703_100310654 234
783 3300026035 Ga0207703_10520719 Ga0207703_105207192 234
784 3300026041 Ga0207639_10130448 Ga0207639_101304482 234
785 3300026067 Ga0207678_10166491 Ga0207678_101664912 234
786 3300026067 Ga0207678_10177096 Ga0207678_101770961 234
787 3300026067 Ga0207678_10236393 Ga0207678_102363932 234
788 3300026075 Ga0207708_10000296 Ga0207708_1000029620 234
789 3300026075 Ga0207708_10051929 Ga0207708_100519293 234
790 3300026089 Ga0207648_10024842 Ga0207648_100248427 234
791 3300026095 Ga0207676_10074308 Ga0207676_100743085 234
792 3300026116 Ga0207674_10012981 Ga0207674_100129812 234
793 3300026116 Ga0207674_10059853 Ga0207674_100598535 234
794 3300026118 Ga0207675_100036432 Ga0207675_1000364323 234
795 3300026118 Ga0207675_100125857 Ga0207675_1001258572 234
796 3300026118 Ga0207675_100168994 Ga0207675_1001689943 234
797 3300026118 Ga0207675_100269764 Ga0207675_1002697642 234
798 3300026121 Ga0207683_10024977 Ga0207683_100249774 234
799 3300026142 Ga0207698_10024188 Ga0207698_100241882 234
800 3300027296 Ga0209389_1000032 Ga0209389_100003272 234
801 3300027361 Ga0209489_100035 Ga0209489_100035107 234
802 3300027363 Ga0209700_100005 Ga0209700_100005110 234
803 3300027512 Ga0209179_1035288 Ga0209179_10352881 234
804 3300027671 Ga0209588_1029541 Ga0209588_10295412 234
805 3300027671 Ga0209588_1090079 Ga0209588_10900791 234
806 3300027866 Ga0209813_10088148 Ga0209813_100881482 234
807 3300027907 Ga0207428_10007031 Ga0207428_100070312 234
808 3300027907 Ga0207428_10111590 Ga0207428_101115902 234
809 3300027907 Ga0207428_10195341 Ga0207428_101953412 234
810 3300027907 Ga0207428_10243728 Ga0207428_102437282 234
811 3300028379 Ga0268266_10015117 Ga0268266_100151171 234
812 3300028380 Ga0268265_10000508 Ga0268265_1000050813 234
813 3300028380 Ga0268265_10602334 Ga0268265_106023342 234
814 3300028381 Ga0268264_10003796 Ga0268264_1000379612 234
815 3300031548 Ga0307408_100050721 Ga0307408_1000507214 234
816 3300031665 Ga0316575_10031691 Ga0316575_100316912 234
817 3300031727 Ga0316576_10008667 Ga0316576_100086675 234
818 3300031728 Ga0316578_10035225 Ga0316578_100352253 234
819 3300031901 Ga0307406_10289268 Ga0307406_102892682 234
820 3300032002 Ga0307416_100528761 Ga0307416_1005287612 234
821 3300035086 Ga0373934_0000091 Ga0373934_0000091_22933_23640 234
822 3300035088 Ga0373940_0010148 Ga0373940_0010148_1245_1952 234
823 3300035112 Ga0373932_0083488 Ga0373932_0083488_191_913 234
824 3300035114 Ga0373939_0004820 Ga0373939_0004820_762_1469 234
825 3300035115 Ga0373941_0032874 Ga0373941_0032874_46_768 234
826 3300035118 Ga0373954_0119384 Ga0373954_0119384_69_776 234
827 3300035119 Ga0373956_0001188 Ga0373956_0001188_8655_9362 234
828 3300035119 Ga0373956_0035371 Ga0373956_0035371_297_1007 234
829 3300035121 Ga0373960_0004649 Ga0373960_0004649_1394_2101 234
830 3300035172 Ga0373955_0004048 Ga0373955_0004048_562_1269 234
831 3300035241 Ga0373961_0002460 Ga0373961_0002460_1231_1938 234
832 3300035242 Ga0373962_0016193 Ga0373962_0016193_965_1672 234
833 3300035691 Ga0373931_0003385 Ga0373931_0003385_3337_4044 234
834 3300035691 Ga0373931_0005812 Ga0373931_0005812_766_1473 234
835 3300035692 Ga0373935_0046269 Ga0373935_0046269_559_1335 234
836 3300035695 Ga0373927_0106749 Ga0373927_0106749_802_1578 234
837 3300035695 Ga0373927_0234151 Ga0373927_0234151_315_1025 234
838 3300035724 Ga0373933_0001319 Ga0373933_0001319_1608_2315 234
839 3300035724 Ga0373933_0384408 Ga0373933_0384408_161_865 234
840 3300035725 Ga0373947_0299973 Ga0373947_0299973_170_946 234
841 3300036401 Ga0373937_0000929 Ga0373937_0000929_15436_16140 234
842 3300036401 Ga0373937_0001593 Ga0373937_0001593_2725_3432 234
843 3300036401 Ga0373937_0017678 Ga0373937_0017678_1035_1742 234
844 3300036401 Ga0373937_0064468 Ga0373937_0064468_1803_2513 234
845 3300036401 Ga0373937_0488068 Ga0373937_0488068_303_1010 234
846 3300036712 Ga0316584_0010427 Ga0316584_0010427_1107_1817 234
847 3300037068 Ga0373925_0029640 Ga0373925_0029640_3043_3747 234
848 3300037068 Ga0373925_0226273 Ga0373925_0226273_698_1474 234
849 3300037068 Ga0373925_0341543 Ga0373925_0341543_40_747 234
850 3300037068 Ga0373925_0354464 Ga0373925_0354464_337_1044 234
851 3300037418 Ga0395900_0323083 Ga0395900_0323083_326_1030 234
852 3300037466 Ga0395898_0044855 Ga0395898_0044855_570_1274 234
853 3300037466 Ga0395898_0064375 Ga0395898_0064375_2574_3278 234
854 3300037466 Ga0395898_0418882 Ga0395898_0418882_412_1119 234
855 3300037471 Ga0395905_0966217 Ga0395905_0966217_19_726 234
856 3300037853 Ga0436364_0448530 Ga0436364_0448530_233_937 234
857 3300037853 Ga0436364_1337618 Ga0436364_1337618_2837_3541 234
858 3300038443 Ga0395901_0055306 Ga0395901_0055306_2916_3620 234
859 3300038443 Ga0395901_0290885 Ga0395901_0290885_129_836 234
860 3300039447 Ga0436361_0844310 Ga0436361_0844310_521_1228 234
861 3300039447 Ga0436361_1158949 Ga0436361_1158949_362_1066 234
862 3300039447 Ga0436361_1192224 Ga0436361_1192224_588_1292 234
863 3300042001 Ga0439441_004858 Ga0439441_004858_660_1370 234
864 3300042436 Ga0439435_0002921 Ga0439435_0002921_594_1301 234
865 3300042437 Ga0439444_0009740 Ga0439444_0009740_243_950 234
866 3300042461 Ga0439460_0122877 Ga0439460_0122877_38_745 234
867 3300044673 Ga0453683_0208282 Ga0453683_0208282_496_1200 234
868 3300045051 Ga0451576_0035215 Ga0451576_0035215_3889_4620 234
869 3300045976 Ga0466967_0631939 Ga0466967_0631939_118_822 234
870 3300046454 Ga0495592_0103380 Ga0495592_0103380_230_940 234
871 3300046454 Ga0495592_0161411 Ga0495592_0161411_558_1265 234
872 3300046454 Ga0495592_0222752 Ga0495592_0222752_346_1050 234
873 3300046455 Ga0495603_0245817 Ga0495603_0245817_50_826 234
874 3300046462 Ga0495651_0001982 Ga0495651_0001982_1564_2271 234
875 3300046462 Ga0495651_0004780 Ga0495651_0004780_8218_8922 234
876 3300046462 Ga0495651_0239715 Ga0495651_0239715_396_1103 234
877 3300046463 Ga0495653_0125567 Ga0495653_0125567_718_1428 234
878 3300046491 Ga0495584_0149159 Ga0495584_0149159_366_1070 234
879 3300046491 Ga0495584_0313830 Ga0495584_0313830_64_771 234
880 3300046533 Ga0495640_0072831 Ga0495640_0072831_1478_2182 234
881 3300046536 Ga0495587_0049445 Ga0495587_0049445_1283_1990 234
882 3300046536 Ga0495587_0303426 Ga0495587_0303426_157_867 234
883 3300046539 Ga0495621_0017170 Ga0495621_0017170_939_1643 234
884 3300046559 Ga0495667_0160351 Ga0495667_0160351_129_836 234
885 3300046615 Ga0495656_0031341 Ga0495656_0031341_1245_1949 234
886 3300046616 Ga0495668_0105682 Ga0495668_0105682_554_1261 234
887 3300046664 Ga0495659_0069808 Ga0495659_0069808_528_1232 234
888 3300046675 Ga0495657_0032389 Ga0495657_0032389_1833_2540 234
889 3300046680 Ga0495646_0354661 Ga0495646_0354661_16_723 234
890 3300046683 Ga0495658_0210128 Ga0495658_0210128_432_1136 234
891 3300046683 Ga0495658_0351561 Ga0495658_0351561_105_809 234
892 3300046684 Ga0495669_0100249 Ga0495669_0100249_302_1006 234
893 3300046689 Ga0495613_0238680 Ga0495613_0238680_389_1099 234
894 3300047317 Ga0495604_0068519 Ga0495604_0068519_604_1311 234
895 3300047319 Ga0495674_0367907 Ga0495674_0367907_300_1007 234
896 3300047320 Ga0495672_0158823 Ga0495672_0158823_30_737 234
897 3300047322 Ga0495680_0089833 Ga0495680_0089833_224_931 234
898 3300047322 Ga0495680_0289297 Ga0495680_0289297_432_1139 234
899 3300048903 Ga0496100_0258062 Ga0496100_0258062_551_1255 234
900 3300048904 Ga0496101_0091275 Ga0496101_0091275_1118_1825 234
901 3300048905 Ga0496102_0002928 Ga0496102_0002928_13075_13794 234
902 3300048906 Ga0496103_0003743 Ga0496103_0003743_7389_8108 234
903 3300048907 Ga0496104_0000583 Ga0496104_0000583_1066_1770 234
904 3300048907 Ga0496104_0012330 Ga0496104_0012330_5732_6436 234
905 3300048907 Ga0496104_0245225 Ga0496104_0245225_330_1049 234
906 3300048908 Ga0496105_0008697 Ga0496105_0008697_63_767 234
907 3300048908 Ga0496105_0050684 Ga0496105_0050684_1564_2268 234
908 3300048908 Ga0496105_0256239 Ga0496105_0256239_634_1341 234
909 3300048909 Ga0496106_0022118 Ga0496106_0022118_1341_2060 234
910 3300048909 Ga0496106_0299811 Ga0496106_0299811_125_835 234
911 3300048910 Ga0496107_0001227 Ga0496107_0001227_1299_2018 234
912 3300048911 Ga0496108_0049238 Ga0496108_0049238_1502_2206 234
913 3300048911 Ga0496108_0173590 Ga0496108_0173590_138_845 234
914 3300048912 Ga0496109_0057825 Ga0496109_0057825_898_1602 234
915 3300048912 Ga0496109_0118398 Ga0496109_0118398_783_1502 234
916 3300048912 Ga0496109_0886103 Ga0496109_0886103_21_728 234
917 3300048913 Ga0496110_0007441 Ga0496110_0007441_4634_5338 234
918 3300048913 Ga0496110_0204667 Ga0496110_0204667_1030_1737 234
919 3300048914 Ga0496111_0072319 Ga0496111_0072319_740_1447 234
920 3300048915 Ga0496112_0088621 Ga0496112_0088621_2340_3050 234
921 3300048915 Ga0496112_0104855 Ga0496112_0104855_545_1249 234
922 3300048915 Ga0496112_0177127 Ga0496112_0177127_817_1524 234
923 3300048915 Ga0496112_0394726 Ga0496112_0394726_336_1040 234
924 3300048916 Ga0496113_0020887 Ga0496113_0020887_1858_2562 234
925 3300048918 Ga0496115_0022061 Ga0496115_0022061_1373_2092 234
926 3300048919 Ga0496116_0127278 Ga0496116_0127278_525_1229 234
927 3300048920 Ga0496117_0003630 Ga0496117_0003630_3351_4055 234
928 3300048921 Ga0496118_0010798 Ga0496118_0010798_4847_5551 234
929 3300048924 Ga0496121_0001572 Ga0496121_0001572_4820_5524 234
930 3300048924 Ga0496121_0051858 Ga0496121_0051858_912_1658 234
931 3300048925 Ga0496122_0173024 Ga0496122_0173024_171_875 234
932 3300048926 Ga0496123_0031626 Ga0496123_0031626_1493_2197 234
933 3300048929 Ga0496126_0008605 Ga0496126_0008605_6030_6776 234
934 3300049568 Ga0501031_0063494 Ga0501031_0063494_363_1067 234
935 3300049570 Ga0501033_0015021 Ga0501033_0015021_3356_4075 234
936 3300049571 Ga0501034_0029827 Ga0501034_0029827_865_1590 234
937 3300049571 Ga0501034_0044973 Ga0501034_0044973_237_956 234
938 3300049571 Ga0501034_0273259 Ga0501034_0273259_640_1368 234
939 3300049571 Ga0501034_0360463 Ga0501034_0360463_92_814 234
940 3300049572 Ga0501036_0006734 Ga0501036_0006734_2659_3363 234
941 3300049572 Ga0501036_0093588 Ga0501036_0093588_844_1551 234
942 3300049572 Ga0501036_0213089 Ga0501036_0213089_255_977 234
943 3300049572 Ga0501036_0297152 Ga0501036_0297152_403_1110 234
944 3300049574 Ga0501038_0002157 Ga0501038_0002157_13239_13943 234
945 3300049574 Ga0501038_0049869 Ga0501038_0049869_452_1171 234
946 3300049574 Ga0501038_0061036 Ga0501038_0061036_767_1474 234
947 3300049575 Ga0501039_0048849 Ga0501039_0048849_1028_1735 234
948 3300049575 Ga0501039_0189821 Ga0501039_0189821_499_1206 234
949 3300049576 Ga0501040_0000906 Ga0501040_0000906_11829_12533 234
950 3300049576 Ga0501040_0005522 Ga0501040_0005522_1533_2240 234
951 3300049576 Ga0501040_0096766 Ga0501040_0096766_1161_1868 234
952 3300049577 Ga0501041_0009565 Ga0501041_0009565_903_1610 234
953 3300049577 Ga0501041_0063399 Ga0501041_0063399_368_1093 234
954 3300049577 Ga0501041_0150096 Ga0501041_0150096_673_1380 234
955 3300049578 Ga0501042_0000035 Ga0501042_0000035_355_1059 234
956 3300049578 Ga0501042_0028580 Ga0501042_0028580_2501_3208 234
957 3300049578 Ga0501042_0313151 Ga0501042_0313151_166_873 234
958 3300049580 Ga0501046_0009529 Ga0501046_0009529_1611_2315 234
959 3300049580 Ga0501046_0346596 Ga0501046_0346596_24_731 234
960 3300049582 Ga0501048_0013519 Ga0501048_0013519_1683_2390 234
961 3300049583 Ga0501067_0043894 Ga0501067_0043894_660_1382 234
962 3300049586 Ga0501070_0606219 Ga0501070_0606219_55_759 234
963 3300049587 Ga0501071_0000007 Ga0501071_0000007_72410_73114 234
964 3300049588 Ga0501072_0001853 Ga0501072_0001853_14159_14863 234
965 3300049588 Ga0501072_0007323 Ga0501072_0007323_5379_6086 234
966 3300049588 Ga0501072_0102163 Ga0501072_0102163_1277_1984 234
967 3300049588 Ga0501072_0212854 Ga0501072_0212854_267_986 234
968 3300049588 Ga0501072_0460444 Ga0501072_0460444_26_733 234
969 3300049590 Ga0501074_0000890 Ga0501074_0000890_12957_13661 234
970 3300049590 Ga0501074_0011936 Ga0501074_0011936_274_999 234
971 3300049590 Ga0501074_0102208 Ga0501074_0102208_994_1701 234
972 3300049591 Ga0501075_0004980 Ga0501075_0004980_3327_4034 234
973 3300049591 Ga0501075_0008897 Ga0501075_0008897_885_1589 234
974 3300049591 Ga0501075_0265060 Ga0501075_0265060_76_783 234
975 3300049591 Ga0501075_0284358 Ga0501075_0284358_484_1188 234
976 3300049592 Ga0501076_0002324 Ga0501076_0002324_300_1004 234
977 3300049592 Ga0501076_0003466 Ga0501076_0003466_4701_5408 234
978 3300049592 Ga0501076_0150081 Ga0501076_0150081_867_1574 234
979 3300049593 Ga0501077_0000416 Ga0501077_0000416_14083_14787 234
980 3300049593 Ga0501077_0012149 Ga0501077_0012149_3722_4429 234
981 3300049741 Ga0501079_0000624 Ga0501079_0000624_129_833 234
982 3300049741 Ga0501079_0003460 Ga0501079_0003460_2991_3716 234
983 3300049741 Ga0501079_0012156 Ga0501079_0012156_2527_3234 234
984 3300049741 Ga0501079_0067224 Ga0501079_0067224_43_750 234
985 3300049741 Ga0501079_0113823 Ga0501079_0113823_787_1494 234
986 3300049742 Ga0501080_0000512 Ga0501080_0000512_29741_30445 234
987 3300049742 Ga0501080_0002139 Ga0501080_0002139_8987_9712 234
988 3300049742 Ga0501080_0061963 Ga0501080_0061963_702_1421 234
989 3300049743 Ga0501081_0008832 Ga0501081_0008832_1320_2024 234
990 3300049743 Ga0501081_0016154 Ga0501081_0016154_1690_2397 234
991 3300049743 Ga0501081_0017365 Ga0501081_0017365_1291_1998 234
992 3300049743 Ga0501081_0145991 Ga0501081_0145991_778_1485 234
993 3300049743 Ga0501081_0249084 Ga0501081_0249084_308_1018 234
994 3300049743 Ga0501081_0254236 Ga0501081_0254236_367_1074 234
995 3300049743 Ga0501081_0417951 Ga0501081_0417951_40_747 234
996 3300049744 Ga0501083_0394444 Ga0501083_0394444_127_843 234
997 3300049822 Ga0501035_0012129 Ga0501035_0012129_385_1089 234
998 3300049822 Ga0501035_0124134 Ga0501035_0124134_1009_1728 234
999 3300049824 Ga0501045_0000029 Ga0501045_0000029_40600_41304 234
1000 3300049824 Ga0501045_0013527 Ga0501045_0013527_1095_1802 234
1001 3300049824 Ga0501045_0052869 Ga0501045_0052869_673_1380 234
1002 3300049824 Ga0501045_0107985 Ga0501045_0107985_1036_1743 234
1003 3300050489 nmdc:mga03683_41561_c1 nmdc:mga03683_41561_c1_876_1586 234
1004 3300050490 nmdc:mga03n38_1857_c1 nmdc:mga03n38_1857_c1_3199_3903 234
1005 3300050490 nmdc:mga03n38_20425_c1 nmdc:mga03n38_20425_c1_1461_2168 234
1006 3300050491 nmdc:mga00v17_366329_c1 nmdc:mga00v17_366329_c1_90_800 234
1007 3300050492 nmdc:mga0yw44_286956_c1 nmdc:mga0yw44_286956_c1_223_933 234
1008 3300050492 nmdc:mga0yw44_39681_c1 nmdc:mga0yw44_39681_c1_921_1628 234
1009 3300050492 nmdc:mga0yw44_600552_c1 nmdc:mga0yw44_600552_c1_26_730 234
1010 3300050492 nmdc:mga0yw44_69373_c1 nmdc:mga0yw44_69373_c1_767_1477 234
1011 3300050493 nmdc:mga0k408_80884_c1 nmdc:mga0k408_80884_c1_254_964 234
1012 3300050494 nmdc:mga06z11_31047_c1 nmdc:mga06z11_31047_c1_1295_2002 234
1013 3300050494 nmdc:mga06z11_54019_c1 nmdc:mga06z11_54019_c1_109_816 234
1014 3300050494 nmdc:mga06z11_78189_c1 nmdc:mga06z11_78189_c1_677_1387 234
1015 3300050495 nmdc:mga04h51_132065_c1 nmdc:mga04h51_132065_c1_85_792 234
1016 3300050495 nmdc:mga04h51_92715_c1 nmdc:mga04h51_92715_c1_59_766 234
1017 3300050496 nmdc:mga07m45_14266_c2 nmdc:mga07m45_14266_c2_319_1029 234
1018 3300050507 nmdc:mga05p37_109_c1 nmdc:mga05p37_109_c1_59204_59911 234
1019 3300050507 nmdc:mga05p37_1198817_c1 nmdc:mga05p37_1198817_c1_38_742 234
1020 3300050507 nmdc:mga05p37_237746_c1 nmdc:mga05p37_237746_c1_301_1014 234
1021 3300050507 nmdc:mga05p37_246642_c1 nmdc:mga05p37_246642_c1_884_1591 234
1022 3300050507 nmdc:mga05p37_281300_c1 nmdc:mga05p37_281300_c1_598_1302 234
1023 3300050507 nmdc:mga05p37_443652_c1 nmdc:mga05p37_443652_c1_715_1425 234
1024 3300050508 nmdc:mga09592_16967_c1 nmdc:mga09592_16967_c1_2808_3518 234
1025 3300050508 nmdc:mga09592_291128_c1 nmdc:mga09592_291128_c1_400_1113 234
1026 3300050508 nmdc:mga09592_654955_c1 nmdc:mga09592_654955_c1_81_785 234
1027 3300050508 nmdc:mga09592_754_c1 nmdc:mga09592_754_c1_9483_10190 234
1028 3300050508 nmdc:mga09592_79346_c1 nmdc:mga09592_79346_c1_1493_2197 234
1029 3300050509 nmdc:mga0qj67_47826_c1 nmdc:mga0qj67_47826_c1_992_1696 234
1030 3300050509 nmdc:mga0qj67_7392_c1 nmdc:mga0qj67_7392_c1_7131_7835 234
1031 3300050510 nmdc:mga06r32_117505_c1 nmdc:mga06r32_117505_c1_249_956 234
1032 3300050510 nmdc:mga06r32_29856_c1 nmdc:mga06r32_29856_c1_1066_1770 234
1033 3300050510 nmdc:mga06r32_553346_c1 nmdc:mga06r32_553346_c1_229_1014 234
1034 3300050510 nmdc:mga06r32_63637_c1 nmdc:mga06r32_63637_c1_1498_2205 234
1035 3300050511 nmdc:mga08y16_198311_c1 nmdc:mga08y16_198311_c1_442_1146 234
1036 3300050511 nmdc:mga08y16_310675_c1 nmdc:mga08y16_310675_c1_139_864 234
1037 3300050511 nmdc:mga08y16_355340_c1 nmdc:mga08y16_355340_c1_545_1252 234
1038 3300050511 nmdc:mga08y16_36479_c1 nmdc:mga08y16_36479_c1_2645_3352 234
1039 3300050511 nmdc:mga08y16_607426_c1 nmdc:mga08y16_607426_c1_71_778 234
1040 3300050511 nmdc:mga08y16_77177_c1 nmdc:mga08y16_77177_c1_1826_2533 234
1041 3300050511 nmdc:mga08y16_80472_c1 nmdc:mga08y16_80472_c1_563_1267 234
1042 3300050512 nmdc:mga0n895_175850_c1 nmdc:mga0n895_175850_c1_1063_1767 234
1043 3300050512 nmdc:mga0n895_42519_c1 nmdc:mga0n895_42519_c1_2428_3135 234
1044 3300050512 nmdc:mga0n895_663266_c1 nmdc:mga0n895_663266_c1_30_737 234
1045 3300050512 nmdc:mga0n895_87815_c1 nmdc:mga0n895_87815_c1_384_1091 234
1046 3300050513 nmdc:mga0rr50_119942_c1 nmdc:mga0rr50_119942_c1_588_1295 234
1047 3300050513 nmdc:mga0rr50_15506_c1 nmdc:mga0rr50_15506_c1_3687_4394 234
1048 3300050514 nmdc:mga08x19_311646_c1 nmdc:mga08x19_311646_c1_91_798 234
1049 3300050516 nmdc:mga0sz30_1337_c1 nmdc:mga0sz30_1337_c1_3569_4279 234
1050 3300053077 Ga0495601_0013464 Ga0495601_0013464_2877_3584 234
1051 3300053077 Ga0495601_0179977 Ga0495601_0179977_637_1344 234
1052 3300053084 Ga0495595_0058130 Ga0495595_0058130_692_1402 234
1053 3300053085 Ga0495619_0007665 Ga0495619_0007665_1409_2116 234
1054 3300053085 Ga0495619_0023438 Ga0495619_0023438_2391_3101 234
1055 3300053085 Ga0495619_0065822 Ga0495619_0065822_393_1103 234
1056 3300053151 Ga0500604_0111355 Ga0500604_0111355_156_860 234
1057 3300053153 Ga0500616_0077499 Ga0500616_0077499_552_1274 234
1058 3300054114 Ga0501084_0001721 Ga0501084_0001721_11114_11818 234
1059 3300054114 Ga0501084_0017907 Ga0501084_0017907_3530_4255 234
1060 3300054114 Ga0501084_0025366 Ga0501084_0025366_2882_3589 234
1061 3300054114 Ga0501084_0036910 Ga0501084_0036910_1505_2212 234
1062 3300054114 Ga0501084_0208733 Ga0501084_0208733_514_1221 234
1063 3300054114 Ga0501084_0209696 Ga0501084_0209696_623_1342 234
1064 3300054114 Ga0501084_0437477 Ga0501084_0437477_372_1079 234
1065 3300060353 Ga0501082_0014375 Ga0501082_0014375_807_1514 234
1066 3300060353 Ga0501082_0020395 Ga0501082_0020395_3100_3819 234
1067 3300060353 Ga0501082_0133887 Ga0501082_0133887_131_835 234
1068 3300060353 Ga0501082_0259702 Ga0501082_0259702_185_901 234
1069 3300060353 Ga0501082_0326966 Ga0501082_0326966_570_1289 234
1070 3300061734 Ga0530510_0003414 Ga0530510_0003414_110_814 234
1071 3300061734 Ga0530510_0004308 Ga0530510_0004308_7623_8330 234
1072 3300061734 Ga0530510_0006430 Ga0530510_0006430_4584_5318 234
1073 3300061734 Ga0530510_0024289 Ga0530510_0024289_1486_2205 234
1074 3300061734 Ga0530510_0103592 Ga0530510_0103592_171_881 234
1075 3300061734 Ga0530510_0116450 Ga0530510_0116450_979_1686 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

61

250

0.83

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

64

256

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.9373 11 231
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.9362 11 232
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.9326 11 232
7arp-assembly1.cif.gz_B native l-2-haloacid dehalogenase from zobellia galactanivorans 0.9313 10 234
7asz-assembly1.cif.gz_B l-2-haloacid dehalogenase h190a mutant from zobellia galactanivorans 0.9301 10 231
ID Description Score Start End Superfamily
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9498 106 233 3.40.50.1000
3umbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9414 10 233 3.40.50.1000
2w43A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9293 11 231 3.40.50.1000
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9243 11 232 3.40.50.1000
3umbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9163 10 233 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A537X363-F1-model_v4 Haloacid dehalogenase type II 0.9989 134 234
AF-A0A537R4E4-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9951 11 231 GO:0018784
AF-A0A800A625-F1-model_v4 Haloacid dehalogenase type II 0.9939 71 234
AF-A0A537X363-F1-model_v4 Haloacid dehalogenase type II 0.9891 134 234
AF-A0A382J578-F1-model_v4 Haloacid dehalogenase, type II 0.9836 125 234

Feature Viewer

pLDDT pTM Quality
96.36 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map