F489560
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1075 | 434 | 1037 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10637380|Ga0157380_106373801 |
| Length | 286 |
| Sequence | MVRRKGDIRRNPQGAARALLSSWLEAPIRLFELAANPGYGRRSATPGETAMGRTEILTREIKALAFDQYGTIVDMQKGLTEAVTPFLAKKGWKGSPDSFVTWWRRTHFENSMIDALLDRGHTPYRQIGHRAVAHVMDRCTIAYTQDEVRWLVAEIERLKPFPDVVAALEKLRSAGYKLAILSNGDLDMLRAAGPHIGFAFDHVISVAQAGYFKPHWKTYATAAELMGLDRSSILFVANHAFDCIGAKAFGMRTAFIDRRKRPFGETPHQPDLIVADFAELAAVLNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 9 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 10 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 11 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 12 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 13 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 14 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 15 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 16 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 17 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 18 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 19 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 20 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 21 | 2904699407 | |||
| 22 | 2906610324 | |||
| 23 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 24 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 25 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 26 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 27 | 2922425934 | |||
| 28 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 29 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 30 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 31 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 32 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 33 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 34 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 111 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 112 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 113 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 131 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 132 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 133 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 134 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 135 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 166 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 167 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 244 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 247 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 249 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 265 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 275 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 277 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 279 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 280 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 282 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 283 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 284 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 285 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 286 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 287 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 288 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 289 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 290 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 291 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 292 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 293 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 294 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 295 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 296 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 297 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 298 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 301 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 302 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 303 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 304 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 359 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 360 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 365 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 366 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 367 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 400 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 401 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 403 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 404 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 421 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 422 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 425 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 428 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 429 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 430 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 431 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 432 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 433 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 434 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.55 |
| Metatranscriptomes | 0.19 |
| Isolates | 3.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.19 |
| Nodule | 3.16 |
| Rhizoplane | 3.07 |
| Rhizosphere | 86.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1539896 | 2162886007 | Bacteria | 2189 |
| 2 | JGI25404J52841_10001396 | 3300003659 | Bacteria | 4233 |
| 3 | JGI25404J52841_10027946 | 3300003659 | Bacteria | 1212 |
| 4 | JGI25405J52794_10040079 | 3300003911 | Bacteria | 989 |
| 5 | Ga0065704_10070608 | 3300005289 | Bacteria | 19206 |
| 6 | Ga0065707_10090819 | 3300005295 | Bacteria | 4062 |
| 7 | Ga0065707_10119993 | 3300005295 | Bacteria | 2145 |
| 8 | Ga0070658_10006326 | 3300005327 | Bacteria | 9597 |
| 9 | Ga0070676_10022931 | 3300005328 | Bacteria | 3505 |
| 10 | Ga0070676_10028077 | 3300005328 | Bacteria | 3195 |
| 11 | Ga0070676_10182914 | 3300005328 | Bacteria | 1364 |
| 12 | Ga0070683_100074740 | 3300005329 | Bacteria | 3165 |
| 13 | Ga0070690_100061242 | 3300005330 | Bacteria | 2424 |
| 14 | Ga0070690_100088100 | 3300005330 | Bacteria | 2040 |
| 15 | Ga0070690_100250836 | 3300005330 | Bacteria | 1252 |
| 16 | Ga0070670_100013203 | 3300005331 | Bacteria | 7076 |
| 17 | Ga0068869_100055272 | 3300005334 | Bacteria | 2893 |
| 18 | Ga0070666_10110639 | 3300005335 | Bacteria | 1899 |
| 19 | Ga0070666_10178034 | 3300005335 | Bacteria | 1491 |
| 20 | Ga0070680_100001927 | 3300005336 | Bacteria | 15249 |
| 21 | Ga0070680_100003662 | 3300005336 | Bacteria | 11484 |
| 22 | Ga0070680_100032091 | 3300005336 | Bacteria | 4225 |
| 23 | Ga0070680_100289534 | 3300005336 | Bacteria | 1388 |
| 24 | Ga0070682_100246581 | 3300005337 | Bacteria | 1285 |
| 25 | Ga0070660_100330502 | 3300005339 | Bacteria | 1253 |
| 26 | Ga0070689_100121898 | 3300005340 | Bacteria | 2083 |
| 27 | Ga0070689_100158953 | 3300005340 | Bacteria | 1826 |
| 28 | Ga0070691_10000329 | 3300005341 | Bacteria | 16785 |
| 29 | Ga0070691_10002207 | 3300005341 | Bacteria | 8619 |
| 30 | Ga0070691_10004950 | 3300005341 | Bacteria | 6060 |
| 31 | Ga0070687_100132891 | 3300005343 | Bacteria | 1439 |
| 32 | Ga0070687_100145007 | 3300005343 | Bacteria | 1387 |
| 33 | Ga0070687_100397911 | 3300005343 | Bacteria | 902 |
| 34 | Ga0070692_10033526 | 3300005345 | Bacteria | 2588 |
| 35 | Ga0070668_100122403 | 3300005347 | Bacteria | 2081 |
| 36 | Ga0070669_100026327 | 3300005353 | Bacteria | 4184 |
| 37 | Ga0070669_100039908 | 3300005353 | Bacteria | 3412 |
| 38 | Ga0070675_100003469 | 3300005354 | Bacteria | 11951 |
| 39 | Ga0070675_100019794 | 3300005354 | Bacteria | 5367 |
| 40 | Ga0070675_100070905 | 3300005354 | Bacteria | 2889 |
| 41 | Ga0070671_100000809 | 3300005355 | Bacteria | 22625 |
| 42 | Ga0070671_100032760 | 3300005355 | Bacteria | 4295 |
| 43 | Ga0070671_100227593 | 3300005355 | Bacteria | 1582 |
| 44 | Ga0070674_100011210 | 3300005356 | Bacteria | 5448 |
| 45 | Ga0070674_100351410 | 3300005356 | Bacteria | 1191 |
| 46 | Ga0070673_100019506 | 3300005364 | Bacteria | 4868 |
| 47 | Ga0070673_100051254 | 3300005364 | Bacteria | 3231 |
| 48 | Ga0070673_100062956 | 3300005364 | Bacteria | 2949 |
| 49 | Ga0070673_100063682 | 3300005364 | Bacteria | 2935 |
| 50 | Ga0070673_100155060 | 3300005364 | Bacteria | 1943 |
| 51 | Ga0070673_100846652 | 3300005364 | Bacteria | 846 |
| 52 | Ga0070659_100087438 | 3300005366 | Bacteria | 2495 |
| 53 | Ga0070659_100201221 | 3300005366 | Bacteria | 1639 |
| 54 | Ga0070667_100749712 | 3300005367 | Bacteria | 905 |
| 55 | Ga0070703_10005122 | 3300005406 | Bacteria | 3662 |
| 56 | Ga0070703_10181549 | 3300005406 | Bacteria | 813 |
| 57 | Ga0070709_10019017 | 3300005434 | Bacteria | 3963 |
| 58 | Ga0070709_10029357 | 3300005434 | Bacteria | 3289 |
| 59 | Ga0070709_10088423 | 3300005434 | Bacteria | 2038 |
| 60 | Ga0070709_10519459 | 3300005434 | Bacteria | 907 |
| 61 | Ga0070714_100020841 | 3300005435 | Bacteria | 5358 |
| 62 | Ga0070714_100058150 | 3300005435 | Bacteria | 3312 |
| 63 | Ga0070714_100059244 | 3300005435 | Bacteria | 3282 |
| 64 | Ga0070714_100103757 | 3300005435 | Bacteria | 2508 |
| 65 | Ga0070714_100501319 | 3300005435 | Bacteria | 1158 |
| 66 | Ga0070713_100014977 | 3300005436 | Bacteria | 5774 |
| 67 | Ga0070713_100021097 | 3300005436 | Bacteria | 5004 |
| 68 | Ga0070713_100121851 | 3300005436 | Bacteria | 2289 |
| 69 | Ga0070713_100132084 | 3300005436 | Bacteria | 2203 |
| 70 | Ga0070713_100350499 | 3300005436 | Bacteria | 1369 |
| 71 | Ga0070710_10098204 | 3300005437 | Bacteria | 1739 |
| 72 | Ga0070711_100128931 | 3300005439 | Bacteria | 1881 |
| 73 | Ga0070711_100746120 | 3300005439 | Bacteria | 827 |
| 74 | Ga0070705_100000171 | 3300005440 | Bacteria | 37880 |
| 75 | Ga0070705_100017929 | 3300005440 | Bacteria | 3702 |
| 76 | Ga0070705_100493315 | 3300005440 | Bacteria | 928 |
| 77 | Ga0070700_100000482 | 3300005441 | Bacteria | 19974 |
| 78 | Ga0070700_100029678 | 3300005441 | Bacteria | 3262 |
| 79 | Ga0070694_100000555 | 3300005444 | Bacteria | 20563 |
| 80 | Ga0070694_100105982 | 3300005444 | Bacteria | 1996 |
| 81 | Ga0070694_100167348 | 3300005444 | Bacteria | 1617 |
| 82 | Ga0070708_100197215 | 3300005445 | Bacteria | 1884 |
| 83 | Ga0070708_100197426 | 3300005445 | Bacteria | 1883 |
| 84 | Ga0070708_100246872 | 3300005445 | Bacteria | 1676 |
| 85 | Ga0070708_100337724 | 3300005445 | Bacteria | 1420 |
| 86 | Ga0070663_100085917 | 3300005455 | Bacteria | 2322 |
| 87 | Ga0070663_100823562 | 3300005455 | Bacteria | 797 |
| 88 | Ga0070678_100026383 | 3300005456 | Bacteria | 3927 |
| 89 | Ga0070678_100175988 | 3300005456 | Bacteria | 1747 |
| 90 | Ga0070678_100243734 | 3300005456 | Bacteria | 1504 |
| 91 | Ga0070678_100535080 | 3300005456 | Bacteria | 1038 |
| 92 | Ga0070662_100806967 | 3300005457 | Bacteria | 798 |
| 93 | Ga0070681_10002685 | 3300005458 | Bacteria | 16354 |
| 94 | Ga0070681_10018179 | 3300005458 | Bacteria | 7029 |
| 95 | Ga0070681_10033835 | 3300005458 | Bacteria | 5131 |
| 96 | Ga0070681_10092447 | 3300005458 | Bacteria | 2974 |
| 97 | Ga0068867_100034469 | 3300005459 | Bacteria | 3668 |
| 98 | Ga0070685_10194140 | 3300005466 | Bacteria | 1315 |
| 99 | Ga0070706_100032937 | 3300005467 | Bacteria | 4781 |
| 100 | Ga0070706_100272557 | 3300005467 | Bacteria | 1579 |
| 101 | Ga0070707_100008295 | 3300005468 | Bacteria | 9642 |
| 102 | Ga0070707_100118537 | 3300005468 | Bacteria | 2569 |
| 103 | Ga0070707_100361524 | 3300005468 | Bacteria | 1410 |
| 104 | Ga0070698_100013437 | 3300005471 | Bacteria | 8666 |
| 105 | Ga0070698_100247533 | 3300005471 | Bacteria | 1715 |
| 106 | Ga0070698_100320946 | 3300005471 | Bacteria | 1479 |
| 107 | Ga0070699_100000167 | 3300005518 | Bacteria | 63239 |
| 108 | Ga0070699_100004951 | 3300005518 | Bacteria | 11749 |
| 109 | Ga0070699_100061845 | 3300005518 | Bacteria | 3245 |
| 110 | Ga0070679_100011073 | 3300005530 | Bacteria | 8581 |
| 111 | Ga0070679_100037519 | 3300005530 | Bacteria | 4815 |
| 112 | Ga0070679_100080696 | 3300005530 | Bacteria | 3243 |
| 113 | Ga0070679_100122535 | 3300005530 | Bacteria | 2584 |
| 114 | Ga0070684_100008775 | 3300005535 | Bacteria | 7926 |
| 115 | Ga0070697_100146596 | 3300005536 | Bacteria | 1987 |
| 116 | Ga0070697_100808672 | 3300005536 | Bacteria | 830 |
| 117 | Ga0068853_100653878 | 3300005539 | Bacteria | 1001 |
| 118 | Ga0070672_100434943 | 3300005543 | Bacteria | 1128 |
| 119 | Ga0070672_100885923 | 3300005543 | Bacteria | 788 |
| 120 | Ga0070686_100065014 | 3300005544 | Bacteria | 2368 |
| 121 | Ga0070686_100298485 | 3300005544 | Bacteria | 1194 |
| 122 | Ga0070695_100003493 | 3300005545 | Bacteria | 9175 |
| 123 | Ga0070695_100005467 | 3300005545 | Bacteria | 7478 |
| 124 | Ga0070696_100000097 | 3300005546 | Bacteria | 44009 |
| 125 | Ga0070696_100003174 | 3300005546 | Bacteria | 10946 |
| 126 | Ga0070696_100172418 | 3300005546 | Bacteria | 1600 |
| 127 | Ga0070696_100217350 | 3300005546 | Bacteria | 1433 |
| 128 | Ga0070696_100296519 | 3300005546 | Bacteria | 1237 |
| 129 | Ga0070665_100024997 | 3300005548 | Bacteria | 6021 |
| 130 | Ga0070665_100033840 | 3300005548 | Bacteria | 5140 |
| 131 | Ga0070665_100117938 | 3300005548 | Bacteria | 2657 |
| 132 | Ga0070665_100330026 | 3300005548 | Bacteria | 1530 |
| 133 | Ga0070665_100587604 | 3300005548 | Bacteria | 1126 |
| 134 | Ga0070704_100000416 | 3300005549 | Bacteria | 19780 |
| 135 | Ga0070704_100000566 | 3300005549 | Bacteria | 17827 |
| 136 | Ga0070704_100033822 | 3300005549 | Bacteria | 3460 |
| 137 | Ga0070704_100057400 | 3300005549 | Bacteria | 2768 |
| 138 | Ga0070704_100313406 | 3300005549 | Bacteria | 1312 |
| 139 | Ga0070704_100375629 | 3300005549 | Bacteria | 1206 |
| 140 | Ga0070704_100703976 | 3300005549 | Bacteria | 896 |
| 141 | Ga0068855_100011573 | 3300005563 | Bacteria | 10656 |
| 142 | Ga0068855_100334887 | 3300005563 | Bacteria | 1670 |
| 143 | Ga0070664_100125491 | 3300005564 | Bacteria | 2251 |
| 144 | Ga0068857_100030564 | 3300005577 | Bacteria | 4757 |
| 145 | Ga0068857_100260672 | 3300005577 | Bacteria | 1591 |
| 146 | Ga0068856_100002546 | 3300005614 | Bacteria | 18781 |
| 147 | Ga0068856_100120313 | 3300005614 | Bacteria | 2627 |
| 148 | Ga0068856_100160167 | 3300005614 | Bacteria | 2261 |
| 149 | Ga0068856_100169686 | 3300005614 | Bacteria | 2194 |
| 150 | Ga0070702_100094107 | 3300005615 | Bacteria | 1824 |
| 151 | Ga0068852_100524039 | 3300005616 | Bacteria | 1183 |
| 152 | Ga0068859_100001658 | 3300005617 | Bacteria | 22662 |
| 153 | Ga0068859_100009816 | 3300005617 | Bacteria | 9668 |
| 154 | Ga0068859_100224369 | 3300005617 | Bacteria | 1967 |
| 155 | Ga0068864_100029916 | 3300005618 | Bacteria | 4616 |
| 156 | Ga0068864_100042835 | 3300005618 | Bacteria | 3874 |
| 157 | Ga0068864_100334698 | 3300005618 | Bacteria | 1425 |
| 158 | Ga0068864_100431749 | 3300005618 | Bacteria | 1257 |
| 159 | Ga0068866_10031807 | 3300005718 | Bacteria | 2545 |
| 160 | Ga0068866_10033248 | 3300005718 | Bacteria | 2500 |
| 161 | Ga0068866_10100296 | 3300005718 | Bacteria | 1596 |
| 162 | Ga0068861_100000857 | 3300005719 | Bacteria | 18411 |
| 163 | Ga0068861_100068559 | 3300005719 | Bacteria | 2741 |
| 164 | Ga0068861_100095924 | 3300005719 | Bacteria | 2350 |
| 165 | Ga0068861_100208750 | 3300005719 | Bacteria | 1644 |
| 166 | Ga0068861_100237834 | 3300005719 | Bacteria | 1548 |
| 167 | Ga0068870_10071943 | 3300005840 | Bacteria | 1888 |
| 168 | Ga0068870_10168790 | 3300005840 | Bacteria | 1304 |
| 169 | Ga0068863_100027027 | 3300005841 | Bacteria | 5472 |
| 170 | Ga0068858_100021764 | 3300005842 | Bacteria | 5990 |
| 171 | Ga0068858_100061152 | 3300005842 | Bacteria | 3481 |
| 172 | Ga0068858_100970565 | 3300005842 | Bacteria | 832 |
| 173 | Ga0068860_100001592 | 3300005843 | Bacteria | 24376 |
| 174 | Ga0068860_100161420 | 3300005843 | Bacteria | 2161 |
| 175 | Ga0068860_100340409 | 3300005843 | Bacteria | 1475 |
| 176 | Ga0068862_100001428 | 3300005844 | Bacteria | 22066 |
| 177 | Ga0068862_100176988 | 3300005844 | Bacteria | 1913 |
| 178 | Ga0068862_100333843 | 3300005844 | Bacteria | 1402 |
| 179 | Ga0068862_100481959 | 3300005844 | Bacteria | 1174 |
| 180 | Ga0081455_10000657 | 3300005937 | Bacteria | 44807 |
| 181 | Ga0081455_10000864 | 3300005937 | Bacteria | 39060 |
| 182 | Ga0081455_10001134 | 3300005937 | Bacteria | 33332 |
| 183 | Ga0081455_10001642 | 3300005937 | Bacteria | 27218 |
| 184 | Ga0081455_10002534 | 3300005937 | Bacteria | 21714 |
| 185 | Ga0081455_10003988 | 3300005937 | Bacteria | 16757 |
| 186 | Ga0081455_10006090 | 3300005937 | Bacteria | 13046 |
| 187 | Ga0081455_10032675 | 3300005937 | Bacteria | 4687 |
| 188 | Ga0081455_10035407 | 3300005937 | Bacteria | 4461 |
| 189 | Ga0081455_10068231 | 3300005937 | Bacteria | 2960 |
| 190 | Ga0081538_10011156 | 3300005981 | Bacteria | 7299 |
| 191 | Ga0081538_10017699 | 3300005981 | Bacteria | 5394 |
| 192 | Ga0081538_10040992 | 3300005981 | Bacteria | 2945 |
| 193 | Ga0081538_10081108 | 3300005981 | Bacteria | 1727 |
| 194 | Ga0081538_10109354 | 3300005981 | Bacteria | 1362 |
| 195 | Ga0081540_1000099 | 3300005983 | Bacteria | 91686 |
| 196 | Ga0081540_1000360 | 3300005983 | Bacteria | 45924 |
| 197 | Ga0081540_1001779 | 3300005983 | Bacteria | 18070 |
| 198 | Ga0081540_1004048 | 3300005983 | Bacteria | 11353 |
| 199 | Ga0081540_1011456 | 3300005983 | Bacteria | 5924 |
| 200 | Ga0081540_1023457 | 3300005983 | Bacteria | 3608 |
| 201 | Ga0081540_1069636 | 3300005983 | Bacteria | 1634 |
| 202 | Ga0081540_1072553 | 3300005983 | Unclassified | 1585 |
| 203 | Ga0081539_10009313 | 3300005985 | Bacteria | 8243 |
| 204 | Ga0081539_10014029 | 3300005985 | Bacteria | 5966 |
| 205 | Ga0081539_10055442 | 3300005985 | Bacteria | 2205 |
| 206 | Ga0070717_10005042 | 3300006028 | Bacteria | 9619 |
| 207 | Ga0070717_10022371 | 3300006028 | Bacteria | 4995 |
| 208 | Ga0070717_10049468 | 3300006028 | Bacteria | 3451 |
| 209 | Ga0070717_10090224 | 3300006028 | Bacteria | 2586 |
| 210 | Ga0070717_10243390 | 3300006028 | Bacteria | 1587 |
| 211 | Ga0070717_10396837 | 3300006028 | Bacteria | 1239 |
| 212 | Ga0070717_10564819 | 3300006028 | Bacteria | 1031 |
| 213 | Ga0070717_10757660 | 3300006028 | Bacteria | 883 |
| 214 | Ga0075365_10019392 | 3300006038 | Bacteria | 4197 |
| 215 | Ga0075365_10032160 | 3300006038 | Bacteria | 3370 |
| 216 | Ga0075368_10028054 | 3300006042 | Bacteria | 2174 |
| 217 | Ga0075368_10128725 | 3300006042 | Bacteria | 1051 |
| 218 | Ga0075364_10001339 | 3300006051 | Bacteria | 13277 |
| 219 | Ga0075364_10250362 | 3300006051 | Bacteria | 1204 |
| 220 | Ga0070715_10049600 | 3300006163 | Bacteria | 1799 |
| 221 | Ga0070715_10089219 | 3300006163 | Bacteria | 1415 |
| 222 | Ga0070715_10144294 | 3300006163 | Bacteria | 1160 |
| 223 | Ga0070712_100011352 | 3300006175 | Bacteria | 5644 |
| 224 | Ga0070712_100069757 | 3300006175 | Bacteria | 2508 |
| 225 | Ga0070712_100114181 | 3300006175 | Bacteria | 2021 |
| 226 | Ga0070712_100354892 | 3300006175 | Bacteria | 1201 |
| 227 | Ga0075367_10000626 | 3300006178 | Bacteria | 13524 |
| 228 | Ga0075367_10009405 | 3300006178 | Bacteria | 5107 |
| 229 | Ga0075367_10094349 | 3300006178 | Bacteria | 1824 |
| 230 | Ga0075367_10110687 | 3300006178 | Bacteria | 1685 |
| 231 | Ga0075367_10152045 | 3300006178 | Bacteria | 1437 |
| 232 | Ga0075369_10000923 | 3300006186 | Bacteria | 9741 |
| 233 | Ga0075369_10022620 | 3300006186 | Bacteria | 2594 |
| 234 | Ga0075369_10099908 | 3300006186 | Bacteria | 1301 |
| 235 | Ga0075369_10177593 | 3300006186 | Bacteria | 979 |
| 236 | Ga0075366_10065072 | 3300006195 | Bacteria | 2169 |
| 237 | Ga0097621_100010240 | 3300006237 | Bacteria | 6849 |
| 238 | Ga0097621_100275959 | 3300006237 | Bacteria | 1478 |
| 239 | Ga0097621_100289668 | 3300006237 | Bacteria | 1443 |
| 240 | Ga0075370_10180418 | 3300006353 | Bacteria | 1242 |
| 241 | Ga0068871_100092459 | 3300006358 | Bacteria | 2523 |
| 242 | Ga0068871_100294682 | 3300006358 | Bacteria | 1422 |
| 243 | Ga0075428_100001353 | 3300006844 | Bacteria | 26002 |
| 244 | Ga0075428_100019486 | 3300006844 | Bacteria | 7508 |
| 245 | Ga0075428_100073118 | 3300006844 | Bacteria | 3744 |
| 246 | Ga0075428_100111168 | 3300006844 | Bacteria | 2985 |
| 247 | Ga0075428_100169541 | 3300006844 | Bacteria | 2367 |
| 248 | Ga0075428_100424097 | 3300006844 | Bacteria | 1425 |
| 249 | Ga0075428_100531161 | 3300006844 | Bacteria | 1258 |
| 250 | Ga0075430_100002744 | 3300006846 | Bacteria | 14703 |
| 251 | Ga0075430_100010364 | 3300006846 | Bacteria | 7893 |
| 252 | Ga0075430_100080769 | 3300006846 | Bacteria | 2723 |
| 253 | Ga0075431_100000652 | 3300006847 | Bacteria | 29451 |
| 254 | Ga0075431_100000965 | 3300006847 | Bacteria | 25537 |
| 255 | Ga0075431_100008835 | 3300006847 | Bacteria | 10097 |
| 256 | Ga0075431_100018577 | 3300006847 | Bacteria | 7082 |
| 257 | Ga0075431_100018795 | 3300006847 | Bacteria | 7040 |
| 258 | Ga0075431_100037919 | 3300006847 | Bacteria | 4963 |
| 259 | Ga0075431_100051615 | 3300006847 | Bacteria | 4240 |
| 260 | Ga0075431_100086041 | 3300006847 | Bacteria | 3244 |
| 261 | Ga0075431_100311745 | 3300006847 | Bacteria | 1588 |
| 262 | Ga0075431_100313276 | 3300006847 | Bacteria | 1584 |
| 263 | Ga0075431_100420649 | 3300006847 | Bacteria | 1335 |
| 264 | Ga0075433_10001856 | 3300006852 | Bacteria | 15871 |
| 265 | Ga0075433_10009983 | 3300006852 | Bacteria | 7607 |
| 266 | Ga0075433_10150743 | 3300006852 | Bacteria | 2068 |
| 267 | Ga0075433_10286572 | 3300006852 | Bacteria | 1459 |
| 268 | Ga0075433_10409594 | 3300006852 | Bacteria | 1196 |
| 269 | Ga0075433_10410290 | 3300006852 | Bacteria | 1195 |
| 270 | Ga0075434_100016479 | 3300006871 | Bacteria | 7104 |
| 271 | Ga0075434_100017182 | 3300006871 | Bacteria | 6965 |
| 272 | Ga0075434_100019636 | 3300006871 | Bacteria | 6540 |
| 273 | Ga0075434_100061611 | 3300006871 | Bacteria | 3733 |
| 274 | Ga0075434_100091824 | 3300006871 | Bacteria | 3038 |
| 275 | Ga0075434_100142304 | 3300006871 | Bacteria | 2419 |
| 276 | Ga0075434_100201804 | 3300006871 | Bacteria | 2009 |
| 277 | Ga0075434_100222122 | 3300006871 | Bacteria | 1909 |
| 278 | Ga0075429_100000008 | 3300006880 | Bacteria | 86739 |
| 279 | Ga0075429_100016293 | 3300006880 | Bacteria | 6442 |
| 280 | Ga0075429_100083463 | 3300006880 | Bacteria | 2785 |
| 281 | Ga0075429_100171143 | 3300006880 | Bacteria | 1902 |
| 282 | Ga0068865_100024142 | 3300006881 | Bacteria | 3986 |
| 283 | Ga0068865_100233311 | 3300006881 | Bacteria | 1445 |
| 284 | Ga0075436_100002475 | 3300006914 | Bacteria | 12713 |
| 285 | Ga0075436_100048683 | 3300006914 | Bacteria | 2925 |
| 286 | Ga0075436_100349312 | 3300006914 | Bacteria | 1066 |
| 287 | Ga0075436_100414629 | 3300006914 | Bacteria | 977 |
| 288 | Ga0075436_100563748 | 3300006914 | Bacteria | 837 |
| 289 | Ga0097620_100001658 | 3300006931 | Bacteria | 22662 |
| 290 | Ga0097620_100009816 | 3300006931 | Bacteria | 9668 |
| 291 | Ga0097620_100027068 | 3300006931 | Bacteria | 5751 |
| 292 | Ga0097620_100076460 | 3300006931 | Bacteria | 3389 |
| 293 | Ga0097620_100224378 | 3300006931 | Bacteria | 1967 |
| 294 | Ga0099824_1010358 | 3300006942 | Bacteria | 11033 |
| 295 | Ga0099824_1017393 | 3300006942 | Bacteria | 6238 |
| 296 | Ga0099822_1011679 | 3300006943 | Bacteria | 10670 |
| 297 | Ga0099823_1000008 | 3300006944 | Bacteria | 105646 |
| 298 | Ga0075435_100003479 | 3300007076 | Bacteria | 10682 |
| 299 | Ga0075435_100010249 | 3300007076 | Bacteria | 6847 |
| 300 | Ga0075435_100026643 | 3300007076 | Bacteria | 4513 |
| 301 | Ga0075435_100156033 | 3300007076 | Bacteria | 1920 |
| 302 | Ga0075435_100612103 | 3300007076 | Bacteria | 945 |
| 303 | Ga0099794_10021736 | 3300007265 | Bacteria | 2918 |
| 304 | Ga0099794_10046570 | 3300007265 | Bacteria | 2077 |
| 305 | Ga0099795_10096442 | 3300007788 | Bacteria | 1154 |
| 306 | Ga0099795_10098942 | 3300007788 | Bacteria | 1141 |
| 307 | Ga0105240_10020965 | 3300009093 | Bacteria | 8699 |
| 308 | Ga0105240_10073123 | 3300009093 | Bacteria | 4234 |
| 309 | Ga0105240_10142513 | 3300009093 | Bacteria | 2864 |
| 310 | Ga0111539_10002318 | 3300009094 | Bacteria | 25335 |
| 311 | Ga0111539_10006931 | 3300009094 | Bacteria | 14546 |
| 312 | Ga0111539_10014205 | 3300009094 | Bacteria | 9946 |
| 313 | Ga0111539_10021387 | 3300009094 | Bacteria | 7963 |
| 314 | Ga0111539_10041808 | 3300009094 | Bacteria | 5508 |
| 315 | Ga0111539_10043015 | 3300009094 | Bacteria | 5419 |
| 316 | Ga0111539_10166565 | 3300009094 | Bacteria | 2576 |
| 317 | Ga0111539_10217931 | 3300009094 | Bacteria | 2223 |
| 318 | Ga0111539_10268814 | 3300009094 | Bacteria | 1985 |
| 319 | Ga0111539_10288311 | 3300009094 | Bacteria | 1910 |
| 320 | Ga0111539_10372893 | 3300009094 | Bacteria | 1661 |
| 321 | Ga0111539_10449443 | 3300009094 | Bacteria | 1501 |
| 322 | Ga0105245_10042501 | 3300009098 | Bacteria | 4056 |
| 323 | Ga0105245_10113869 | 3300009098 | Bacteria | 2519 |
| 324 | Ga0105245_10313864 | 3300009098 | Bacteria | 1542 |
| 325 | Ga0105247_10055307 | 3300009101 | Bacteria | 2449 |
| 326 | Ga0114129_10000124 | 3300009147 | Bacteria | 77871 |
| 327 | Ga0114129_10001247 | 3300009147 | Bacteria | 33913 |
| 328 | Ga0114129_10011216 | 3300009147 | Bacteria | 12774 |
| 329 | Ga0114129_10034081 | 3300009147 | Bacteria | 7192 |
| 330 | Ga0114129_10036668 | 3300009147 | Bacteria | 6922 |
| 331 | Ga0114129_10067868 | 3300009147 | Bacteria | 4972 |
| 332 | Ga0114129_10164798 | 3300009147 | Bacteria | 3026 |
| 333 | Ga0114129_10196755 | 3300009147 | Bacteria | 2733 |
| 334 | Ga0114129_10204492 | 3300009147 | Bacteria | 2672 |
| 335 | Ga0114129_10352186 | 3300009147 | Bacteria | 1950 |
| 336 | Ga0114129_10464370 | 3300009147 | Bacteria | 1659 |
| 337 | Ga0114129_10473705 | 3300009147 | Bacteria | 1639 |
| 338 | Ga0114129_10530682 | 3300009147 | Bacteria | 1533 |
| 339 | Ga0114129_10659418 | 3300009147 | Bacteria | 1350 |
| 340 | Ga0114129_10827687 | 3300009147 | Bacteria | 1179 |
| 341 | Ga0114129_10830926 | 3300009147 | Unclassified | 1176 |
| 342 | Ga0114129_10947226 | 3300009147 | Bacteria | 1088 |
| 343 | Ga0105243_10041053 | 3300009148 | Bacteria | 3617 |
| 344 | Ga0105243_10059591 | 3300009148 | Bacteria | 3047 |
| 345 | Ga0105243_10128192 | 3300009148 | Bacteria | 2149 |
| 346 | Ga0105243_10548847 | 3300009148 | Bacteria | 1104 |
| 347 | Ga0105242_10222766 | 3300009176 | Bacteria | 1687 |
| 348 | Ga0105248_10045144 | 3300009177 | Bacteria | 4941 |
| 349 | Ga0105237_10079588 | 3300009545 | Bacteria | 3267 |
| 350 | Ga0105238_10018836 | 3300009551 | Bacteria | 7027 |
| 351 | Ga0105238_10547729 | 3300009551 | Bacteria | 1161 |
| 352 | Ga0105238_10753349 | 3300009551 | Bacteria | 988 |
| 353 | Ga0105238_10977371 | 3300009551 | Bacteria | 867 |
| 354 | Ga0105249_10340101 | 3300009553 | Bacteria | 1517 |
| 355 | Ga0105249_10553884 | 3300009553 | Bacteria | 1201 |
| 356 | Ga0105249_11103158 | 3300009553 | Unclassified | 864 |
| 357 | Ga0099796_10048408 | 3300010159 | Bacteria | 1466 |
| 358 | Ga0105239_10044406 | 3300010375 | Bacteria | 4872 |
| 359 | Ga0105239_10137147 | 3300010375 | Bacteria | 2724 |
| 360 | Ga0105239_10326917 | 3300010375 | Bacteria | 1729 |
| 361 | Ga0105239_10839514 | 3300010375 | Bacteria | 1053 |
| 362 | Ga0105246_10004309 | 3300011119 | Bacteria | 8653 |
| 363 | Ga0105246_10266578 | 3300011119 | Bacteria | 1367 |
| 364 | Ga0105246_10412621 | 3300011119 | Bacteria | 1124 |
| 365 | Ga0157370_10046562 | 3300013104 | Bacteria | 4159 |
| 366 | Ga0157370_10078130 | 3300013104 | Bacteria | 3117 |
| 367 | Ga0157370_10140031 | 3300013104 | Bacteria | 2254 |
| 368 | Ga0157370_10234338 | 3300013104 | Bacteria | 1699 |
| 369 | Ga0157369_10004728 | 3300013105 | Bacteria | 16002 |
| 370 | Ga0157369_10080978 | 3300013105 | Bacteria | 3475 |
| 371 | Ga0157369_10120862 | 3300013105 | Bacteria | 2779 |
| 372 | Ga0157369_10379362 | 3300013105 | Bacteria | 1467 |
| 373 | Ga0157374_10065852 | 3300013296 | Bacteria | 3404 |
| 374 | Ga0157374_10346365 | 3300013296 | Bacteria | 1476 |
| 375 | Ga0157374_10786039 | 3300013296 | Bacteria | 967 |
| 376 | Ga0157378_10084372 | 3300013297 | Bacteria | 2876 |
| 377 | Ga0157378_10104740 | 3300013297 | Bacteria | 2586 |
| 378 | Ga0163162_10088047 | 3300013306 | Bacteria | 3185 |
| 379 | Ga0163162_10203702 | 3300013306 | Bacteria | 2108 |
| 380 | Ga0163162_10324032 | 3300013306 | Bacteria | 1673 |
| 381 | Ga0163162_10422832 | 3300013306 | Bacteria | 1465 |
| 382 | Ga0163162_10922907 | 3300013306 | Bacteria | 985 |
| 383 | Ga0163162_11251087 | 3300013306 | Bacteria | 843 |
| 384 | Ga0157372_10051839 | 3300013307 | Bacteria | 4567 |
| 385 | Ga0157372_10216690 | 3300013307 | Bacteria | 2219 |
| 386 | Ga0157372_10466617 | 3300013307 | Bacteria | 1472 |
| 387 | Ga0157375_10047284 | 3300013308 | Bacteria | 4201 |
| 388 | Ga0157375_10067217 | 3300013308 | Bacteria | 3581 |
| 389 | Ga0157375_10086244 | 3300013308 | Bacteria | 3190 |
| 390 | Ga0157375_10114897 | 3300013308 | Bacteria | 2794 |
| 391 | Ga0163163_10004951 | 3300014325 | Bacteria | 11463 |
| 392 | Ga0163163_10187646 | 3300014325 | Bacteria | 2115 |
| 393 | Ga0163163_10432039 | 3300014325 | Bacteria | 1376 |
| 394 | Ga0157380_10042097 | 3300014326 | Bacteria | 3568 |
| 395 | Ga0157380_10047458 | 3300014326 | Bacteria | 3378 |
| 396 | Ga0157380_10585550 | 3300014326 | Bacteria | 1101 |
| 397 | Ga0157380_10637380 | 3300014326 | Bacteria | 1061 |
| 398 | Ga0182008_10030391 | 3300014497 | Bacteria | 2724 |
| 399 | Ga0157377_10310937 | 3300014745 | Bacteria | 1043 |
| 400 | Ga0157379_10084851 | 3300014968 | Bacteria | 2838 |
| 401 | Ga0157379_10090347 | 3300014968 | Bacteria | 2748 |
| 402 | Ga0157379_10405397 | 3300014968 | Bacteria | 1254 |
| 403 | Ga0157376_10015043 | 3300014969 | Bacteria | 5833 |
| 404 | Ga0157376_10177271 | 3300014969 | Bacteria | 1945 |
| 405 | Ga0157376_10197518 | 3300014969 | Bacteria | 1849 |
| 406 | Ga0163161_10097821 | 3300017792 | Bacteria | 2180 |
| 407 | Ga0163161_10201383 | 3300017792 | Bacteria | 1534 |
| 408 | Ga0163161_10453852 | 3300017792 | Bacteria | 1037 |
| 409 | Ga0206356_11376152 | 3300020070 | Bacteria | 984 |
| 410 | Ga0213872_10074428 | 3300021361 | Bacteria | 1529 |
| 411 | Ga0213872_10149366 | 3300021361 | Bacteria | 1022 |
| 412 | Ga0213876_10283219 | 3300021384 | Bacteria | 881 |
| 413 | Ga0228598_1003914 | 3300024227 | Bacteria | 3176 |
| 414 | Ga0209233_1033592 | 3300025261 | Bacteria | 1176 |
| 415 | Ga0207653_10000520 | 3300025885 | Bacteria | 14672 |
| 416 | Ga0207692_10184043 | 3300025898 | Bacteria | 1219 |
| 417 | Ga0207642_10019878 | 3300025899 | Bacteria | 2610 |
| 418 | Ga0207642_10098722 | 3300025899 | Bacteria | 1461 |
| 419 | Ga0207688_10440605 | 3300025901 | Bacteria | 811 |
| 420 | Ga0207680_10191384 | 3300025903 | Bacteria | 1389 |
| 421 | Ga0207647_10004760 | 3300025904 | Bacteria | 10047 |
| 422 | Ga0207647_10056006 | 3300025904 | Bacteria | 2420 |
| 423 | Ga0207685_10107146 | 3300025905 | Bacteria | 1205 |
| 424 | Ga0207685_10185814 | 3300025905 | Bacteria | 966 |
| 425 | Ga0207699_10027940 | 3300025906 | Bacteria | 3130 |
| 426 | Ga0207699_10106069 | 3300025906 | Bacteria | 1793 |
| 427 | Ga0207699_10229154 | 3300025906 | Bacteria | 1272 |
| 428 | Ga0207699_10329356 | 3300025906 | Bacteria | 1073 |
| 429 | Ga0207645_10004028 | 3300025907 | Bacteria | 10953 |
| 430 | Ga0207645_10050054 | 3300025907 | Bacteria | 2668 |
| 431 | Ga0207643_10017955 | 3300025908 | Bacteria | 3874 |
| 432 | Ga0207643_10170107 | 3300025908 | Bacteria | 1315 |
| 433 | Ga0207643_10453525 | 3300025908 | Bacteria | 816 |
| 434 | Ga0207705_10068507 | 3300025909 | Bacteria | 2569 |
| 435 | Ga0207684_10132915 | 3300025910 | Bacteria | 2136 |
| 436 | Ga0207684_10292596 | 3300025910 | Bacteria | 1404 |
| 437 | Ga0207684_10858669 | 3300025910 | Bacteria | 765 |
| 438 | Ga0207707_10000642 | 3300025912 | Bacteria | 34523 |
| 439 | Ga0207707_10004649 | 3300025912 | Bacteria | 12059 |
| 440 | Ga0207707_10023202 | 3300025912 | Bacteria | 5429 |
| 441 | Ga0207707_10081957 | 3300025912 | Bacteria | 2816 |
| 442 | Ga0207695_10044531 | 3300025913 | Bacteria | 4719 |
| 443 | Ga0207695_10084962 | 3300025913 | Bacteria | 3194 |
| 444 | Ga0207695_10137687 | 3300025913 | Bacteria | 2393 |
| 445 | Ga0207671_10197672 | 3300025914 | Bacteria | 1569 |
| 446 | Ga0207693_10005660 | 3300025915 | Bacteria | 10388 |
| 447 | Ga0207693_10126573 | 3300025915 | Bacteria | 2008 |
| 448 | Ga0207663_10048765 | 3300025916 | Bacteria | 2623 |
| 449 | Ga0207663_10135262 | 3300025916 | Bacteria | 1709 |
| 450 | Ga0207660_10009091 | 3300025917 | Bacteria | 6436 |
| 451 | Ga0207660_10017922 | 3300025917 | Bacteria | 4714 |
| 452 | Ga0207660_10123833 | 3300025917 | Bacteria | 1961 |
| 453 | Ga0207660_10452900 | 3300025917 | Bacteria | 1038 |
| 454 | Ga0207660_10528114 | 3300025917 | Bacteria | 959 |
| 455 | Ga0207662_10041516 | 3300025918 | Bacteria | 2709 |
| 456 | Ga0207652_10039233 | 3300025921 | Bacteria | 4019 |
| 457 | Ga0207652_10041125 | 3300025921 | Bacteria | 3928 |
| 458 | Ga0207652_10053420 | 3300025921 | Bacteria | 3470 |
| 459 | Ga0207652_10071231 | 3300025921 | Bacteria | 3020 |
| 460 | Ga0207652_10120193 | 3300025921 | Bacteria | 2337 |
| 461 | Ga0207646_10193767 | 3300025922 | Bacteria | 1835 |
| 462 | Ga0207646_10523156 | 3300025922 | Bacteria | 1068 |
| 463 | Ga0207681_10088701 | 3300025923 | Bacteria | 2203 |
| 464 | Ga0207681_10097944 | 3300025923 | Bacteria | 2109 |
| 465 | Ga0207694_10114780 | 3300025924 | Bacteria | 2145 |
| 466 | Ga0207694_10503869 | 3300025924 | Bacteria | 1014 |
| 467 | Ga0207650_10000781 | 3300025925 | Bacteria | 24513 |
| 468 | Ga0207650_10016748 | 3300025925 | Bacteria | 5126 |
| 469 | Ga0207659_10000872 | 3300025926 | Bacteria | 17941 |
| 470 | Ga0207659_10021857 | 3300025926 | Bacteria | 4254 |
| 471 | Ga0207659_10038471 | 3300025926 | Bacteria | 3328 |
| 472 | Ga0207687_10050784 | 3300025927 | Bacteria | 2888 |
| 473 | Ga0207687_10170491 | 3300025927 | Bacteria | 1678 |
| 474 | Ga0207687_10210680 | 3300025927 | Bacteria | 1524 |
| 475 | Ga0207700_10041534 | 3300025928 | Bacteria | 3366 |
| 476 | Ga0207700_10136178 | 3300025928 | Bacteria | 2012 |
| 477 | Ga0207700_10184972 | 3300025928 | Bacteria | 1747 |
| 478 | Ga0207700_10196080 | 3300025928 | Bacteria | 1699 |
| 479 | Ga0207700_10356556 | 3300025928 | Bacteria | 1274 |
| 480 | Ga0207664_10018559 | 3300025929 | Bacteria | 5125 |
| 481 | Ga0207664_10055279 | 3300025929 | Bacteria | 3150 |
| 482 | Ga0207664_10173174 | 3300025929 | Bacteria | 1848 |
| 483 | Ga0207664_10191078 | 3300025929 | Bacteria | 1762 |
| 484 | Ga0207664_10192727 | 3300025929 | Bacteria | 1755 |
| 485 | Ga0207664_10297950 | 3300025929 | Bacteria | 1418 |
| 486 | Ga0207644_10000454 | 3300025931 | Bacteria | 26457 |
| 487 | Ga0207644_10033114 | 3300025931 | Bacteria | 3609 |
| 488 | Ga0207690_10066046 | 3300025932 | Bacteria | 2476 |
| 489 | Ga0207686_10074502 | 3300025934 | Bacteria | 2193 |
| 490 | Ga0207686_10438260 | 3300025934 | Bacteria | 1003 |
| 491 | Ga0207709_10297343 | 3300025935 | Bacteria | 1199 |
| 492 | Ga0207709_10461556 | 3300025935 | Bacteria | 984 |
| 493 | Ga0207709_10790345 | 3300025935 | Bacteria | 765 |
| 494 | Ga0207670_10054126 | 3300025936 | Bacteria | 2707 |
| 495 | Ga0207670_10248731 | 3300025936 | Bacteria | 1373 |
| 496 | Ga0207670_10405641 | 3300025936 | Bacteria | 1091 |
| 497 | Ga0207669_10023880 | 3300025937 | Bacteria | 3275 |
| 498 | Ga0207669_10191811 | 3300025937 | Bacteria | 1475 |
| 499 | Ga0207669_10400518 | 3300025937 | Bacteria | 1075 |
| 500 | Ga0207704_10094407 | 3300025938 | Bacteria | 1975 |
| 501 | Ga0207704_10146636 | 3300025938 | Bacteria | 1659 |
| 502 | Ga0207665_10048803 | 3300025939 | Bacteria | 2843 |
| 503 | Ga0207665_10414078 | 3300025939 | Bacteria | 1028 |
| 504 | Ga0207691_10085352 | 3300025940 | Bacteria | 2833 |
| 505 | Ga0207691_10241860 | 3300025940 | Bacteria | 1560 |
| 506 | Ga0207691_10279871 | 3300025940 | Bacteria | 1435 |
| 507 | Ga0207691_10596947 | 3300025940 | Bacteria | 935 |
| 508 | Ga0207689_10142030 | 3300025942 | Bacteria | 1978 |
| 509 | Ga0207661_10001102 | 3300025944 | Bacteria | 17966 |
| 510 | Ga0207661_10032238 | 3300025944 | Bacteria | 4057 |
| 511 | Ga0207661_10406142 | 3300025944 | Bacteria | 1236 |
| 512 | Ga0207679_10092569 | 3300025945 | Bacteria | 2342 |
| 513 | Ga0207667_10019069 | 3300025949 | Bacteria | 7668 |
| 514 | Ga0207651_10006912 | 3300025960 | Bacteria | 5996 |
| 515 | Ga0207651_10164488 | 3300025960 | Bacteria | 1743 |
| 516 | Ga0207651_10230312 | 3300025960 | Bacteria | 1504 |
| 517 | Ga0207712_10121303 | 3300025961 | Bacteria | 1978 |
| 518 | Ga0207712_10245975 | 3300025961 | Bacteria | 1443 |
| 519 | Ga0207712_10439109 | 3300025961 | Bacteria | 1105 |
| 520 | Ga0207668_10166277 | 3300025972 | Bacteria | 1725 |
| 521 | Ga0207668_10948252 | 3300025972 | Bacteria | 767 |
| 522 | Ga0207658_10345281 | 3300025986 | Bacteria | 1295 |
| 523 | Ga0207677_10089296 | 3300026023 | Bacteria | 2237 |
| 524 | Ga0207703_10031065 | 3300026035 | Bacteria | 4222 |
| 525 | Ga0207703_10079632 | 3300026035 | Bacteria | 2726 |
| 526 | Ga0207703_10520719 | 3300026035 | Bacteria | 1118 |
| 527 | Ga0207639_10130448 | 3300026041 | Bacteria | 2080 |
| 528 | Ga0207639_10140780 | 3300026041 | Bacteria | 2009 |
| 529 | Ga0207639_11097192 | 3300026041 | Bacteria | 746 |
| 530 | Ga0207678_10166491 | 3300026067 | Bacteria | 1882 |
| 531 | Ga0207678_10177096 | 3300026067 | Bacteria | 1821 |
| 532 | Ga0207678_10236393 | 3300026067 | Bacteria | 1565 |
| 533 | Ga0207678_10726638 | 3300026067 | Bacteria | 875 |
| 534 | Ga0207708_10000296 | 3300026075 | Bacteria | 39206 |
| 535 | Ga0207708_10004708 | 3300026075 | Bacteria | 10034 |
| 536 | Ga0207708_10051929 | 3300026075 | Bacteria | 3122 |
| 537 | Ga0207708_10472478 | 3300026075 | Bacteria | 1047 |
| 538 | Ga0207702_10002900 | 3300026078 | Bacteria | 16046 |
| 539 | Ga0207702_10111960 | 3300026078 | Bacteria | 2429 |
| 540 | Ga0207702_10278850 | 3300026078 | Bacteria | 1579 |
| 541 | Ga0207641_10820920 | 3300026088 | Bacteria | 920 |
| 542 | Ga0207648_10006984 | 3300026089 | Bacteria | 11167 |
| 543 | Ga0207648_10024842 | 3300026089 | Bacteria | 5344 |
| 544 | Ga0207648_10090889 | 3300026089 | Bacteria | 2668 |
| 545 | Ga0207676_10010115 | 3300026095 | Bacteria | 6712 |
| 546 | Ga0207676_10074308 | 3300026095 | Bacteria | 2738 |
| 547 | Ga0207674_10012981 | 3300026116 | Bacteria | 9286 |
| 548 | Ga0207674_10059853 | 3300026116 | Bacteria | 3854 |
| 549 | Ga0207674_10088227 | 3300026116 | Bacteria | 3095 |
| 550 | Ga0207675_100001111 | 3300026118 | Bacteria | 26632 |
| 551 | Ga0207675_100036432 | 3300026118 | Bacteria | 4589 |
| 552 | Ga0207675_100125857 | 3300026118 | Bacteria | 2427 |
| 553 | Ga0207675_100168994 | 3300026118 | Bacteria | 2089 |
| 554 | Ga0207675_100269764 | 3300026118 | Bacteria | 1651 |
| 555 | Ga0207683_10024977 | 3300026121 | Bacteria | 5151 |
| 556 | Ga0207683_10145399 | 3300026121 | Bacteria | 2138 |
| 557 | Ga0207683_10165211 | 3300026121 | Bacteria | 2003 |
| 558 | Ga0207683_10285093 | 3300026121 | Bacteria | 1510 |
| 559 | Ga0207683_10355926 | 3300026121 | Bacteria | 1344 |
| 560 | Ga0207698_10024188 | 3300026142 | Bacteria | 4259 |
| 561 | Ga0209389_1000032 | 3300027296 | Bacteria | 134064 |
| 562 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 563 | Ga0209969_1013838 | 3300027360 | Bacteria | 1171 |
| 564 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 565 | Ga0209489_100035 | 3300027361 | Bacteria | 168255 |
| 566 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 567 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 568 | Ga0209981_1001056 | 3300027378 | Bacteria | 3497 |
| 569 | Ga0210000_1007327 | 3300027462 | Bacteria | 1613 |
| 570 | Ga0209995_1010700 | 3300027471 | Bacteria | 1489 |
| 571 | Ga0209179_1035288 | 3300027512 | Unclassified | 1039 |
| 572 | Ga0209968_1016241 | 3300027526 | Bacteria | 1182 |
| 573 | Ga0209588_1029541 | 3300027671 | Bacteria | 1748 |
| 574 | Ga0209588_1090079 | 3300027671 | Unclassified | 988 |
| 575 | Ga0209813_10088148 | 3300027866 | Bacteria | 1037 |
| 576 | Ga0207428_10007031 | 3300027907 | Bacteria | 10305 |
| 577 | Ga0207428_10111590 | 3300027907 | Bacteria | 2104 |
| 578 | Ga0207428_10195341 | 3300027907 | Bacteria | 1524 |
| 579 | Ga0207428_10243728 | 3300027907 | Bacteria | 1342 |
| 580 | Ga0268266_10002798 | 3300028379 | Bacteria | 18191 |
| 581 | Ga0268266_10015117 | 3300028379 | Bacteria | 6628 |
| 582 | Ga0268266_10344079 | 3300028379 | Bacteria | 1400 |
| 583 | Ga0268266_10571950 | 3300028379 | Bacteria | 1084 |
| 584 | Ga0268265_10000508 | 3300028380 | Bacteria | 40027 |
| 585 | Ga0268265_10472149 | 3300028380 | Bacteria | 1176 |
| 586 | Ga0268265_10602334 | 3300028380 | Bacteria | 1050 |
| 587 | Ga0268264_10003796 | 3300028381 | Bacteria | 12956 |
| 588 | Ga0268264_10076507 | 3300028381 | Bacteria | 2848 |
| 589 | Ga0265340_10022948 | 3300031247 | Bacteria | 3185 |
| 590 | Ga0265339_10004326 | 3300031249 | Bacteria | 9708 |
| 591 | Ga0307408_100050721 | 3300031548 | Bacteria | 2986 |
| 592 | Ga0307408_100294440 | 3300031548 | Bacteria | 1357 |
| 593 | Ga0316575_10031691 | 3300031665 | Bacteria | 2069 |
| 594 | Ga0265314_10004147 | 3300031711 | Bacteria | 13641 |
| 595 | Ga0316576_10008667 | 3300031727 | Bacteria | 6507 |
| 596 | Ga0316578_10035225 | 3300031728 | Bacteria | 2877 |
| 597 | Ga0307406_10289268 | 3300031901 | Bacteria | 1254 |
| 598 | Ga0307416_100528761 | 3300032002 | Bacteria | 1249 |
| 599 | Ga0315911_1000019 | 3300033442 | Bacteria | 146597 |
| 600 | Ga0373926_0031430 | 3300035083 | Bacteria | 1872 |
| 601 | Ga0373934_0000091 | 3300035086 | Bacteria | 31467 |
| 602 | Ga0373934_0121130 | 3300035086 | Bacteria | 1064 |
| 603 | Ga0373940_0010148 | 3300035088 | Bacteria | 2207 |
| 604 | Ga0373923_0077565 | 3300035111 | Bacteria | 1437 |
| 605 | Ga0373923_0080737 | 3300035111 | Bacteria | 1410 |
| 606 | Ga0373932_0083488 | 3300035112 | Bacteria | 1013 |
| 607 | Ga0373936_0009291 | 3300035113 | Bacteria | 3704 |
| 608 | Ga0373936_0121413 | 3300035113 | Bacteria | 1116 |
| 609 | Ga0373939_0004820 | 3300035114 | Bacteria | 3198 |
| 610 | Ga0373941_0032874 | 3300035115 | Bacteria | 1555 |
| 611 | Ga0373945_0037865 | 3300035116 | Bacteria | 1733 |
| 612 | Ga0373945_0156550 | 3300035116 | Bacteria | 926 |
| 613 | Ga0373954_0033145 | 3300035118 | Bacteria | 2389 |
| 614 | Ga0373954_0085383 | 3300035118 | Bacteria | 1511 |
| 615 | Ga0373954_0119384 | 3300035118 | Bacteria | 1279 |
| 616 | Ga0373956_0001188 | 3300035119 | Bacteria | 10757 |
| 617 | Ga0373956_0032222 | 3300035119 | Bacteria | 2299 |
| 618 | Ga0373956_0035371 | 3300035119 | Bacteria | 2203 |
| 619 | Ga0373956_0117284 | 3300035119 | Bacteria | 1242 |
| 620 | Ga0373957_0021564 | 3300035120 | Bacteria | 2288 |
| 621 | Ga0373960_0004649 | 3300035121 | Bacteria | 3153 |
| 622 | Ga0373943_0027831 | 3300035170 | Bacteria | 2660 |
| 623 | Ga0373943_0176711 | 3300035170 | Bacteria | 1171 |
| 624 | Ga0373946_0020107 | 3300035171 | Bacteria | 2578 |
| 625 | Ga0373946_0047655 | 3300035171 | Bacteria | 1781 |
| 626 | Ga0373955_0004048 | 3300035172 | Bacteria | 6471 |
| 627 | Ga0373955_0017692 | 3300035172 | Bacteria | 3531 |
| 628 | Ga0373955_0037554 | 3300035172 | Bacteria | 2576 |
| 629 | Ga0373955_0043529 | 3300035172 | Bacteria | 2415 |
| 630 | Ga0373961_0002460 | 3300035241 | Bacteria | 4797 |
| 631 | Ga0373962_0016193 | 3300035242 | Bacteria | 1920 |
| 632 | Ga0373924_0022137 | 3300035410 | Bacteria | 2483 |
| 633 | Ga0373931_0003385 | 3300035691 | Bacteria | 7154 |
| 634 | Ga0373931_0005812 | 3300035691 | Bacteria | 5739 |
| 635 | Ga0373931_0208819 | 3300035691 | Bacteria | 1170 |
| 636 | Ga0373935_0031978 | 3300035692 | Bacteria | 3268 |
| 637 | Ga0373935_0046269 | 3300035692 | Bacteria | 2748 |
| 638 | Ga0373935_0216199 | 3300035692 | Bacteria | 1330 |
| 639 | Ga0373935_0291096 | 3300035692 | Bacteria | 1152 |
| 640 | Ga0373927_0051594 | 3300035695 | Bacteria | 2659 |
| 641 | Ga0373927_0106749 | 3300035695 | Bacteria | 1823 |
| 642 | Ga0373927_0215168 | 3300035695 | Bacteria | 1262 |
| 643 | Ga0373927_0234151 | 3300035695 | Bacteria | 1207 |
| 644 | Ga0373933_0000636 | 3300035724 | Bacteria | 21874 |
| 645 | Ga0373933_0001319 | 3300035724 | Bacteria | 14586 |
| 646 | Ga0373933_0023287 | 3300035724 | Bacteria | 3536 |
| 647 | Ga0373933_0066336 | 3300035724 | Bacteria | 2187 |
| 648 | Ga0373933_0384408 | 3300035724 | Bacteria | 914 |
| 649 | Ga0373947_0053109 | 3300035725 | Bacteria | 2443 |
| 650 | Ga0373947_0086015 | 3300035725 | Bacteria | 1953 |
| 651 | Ga0373947_0299973 | 3300035725 | Unclassified | 1071 |
| 652 | Ga0373937_0000929 | 3300036401 | Bacteria | 24822 |
| 653 | Ga0373937_0001593 | 3300036401 | Bacteria | 19081 |
| 654 | Ga0373937_0017678 | 3300036401 | Bacteria | 6362 |
| 655 | Ga0373937_0034276 | 3300036401 | Bacteria | 4618 |
| 656 | Ga0373937_0064468 | 3300036401 | Bacteria | 3370 |
| 657 | Ga0373937_0109026 | 3300036401 | Bacteria | 2574 |
| 658 | Ga0373937_0126081 | 3300036401 | Bacteria | 2388 |
| 659 | Ga0373937_0488068 | 3300036401 | Bacteria | 1170 |
| 660 | Ga0373937_0709727 | 3300036401 | Bacteria | 952 |
| 661 | Ga0372808_005078 | 3300036459 | Bacteria | 1717 |
| 662 | Ga0316584_0010427 | 3300036712 | Bacteria | 6492 |
| 663 | Ga0373925_0029640 | 3300037068 | Bacteria | 4015 |
| 664 | Ga0373925_0071610 | 3300037068 | Bacteria | 2622 |
| 665 | Ga0373925_0226273 | 3300037068 | Bacteria | 1494 |
| 666 | Ga0373925_0341543 | 3300037068 | Bacteria | 1215 |
| 667 | Ga0373925_0354464 | 3300037068 | Bacteria | 1192 |
| 668 | Ga0395899_0332674 | 3300037312 | Bacteria | 1020 |
| 669 | Ga0395900_0007634 | 3300037418 | Bacteria | 11167 |
| 670 | Ga0395900_0323083 | 3300037418 | Bacteria | 1523 |
| 671 | Ga0395898_0004948 | 3300037466 | Bacteria | 14463 |
| 672 | Ga0395898_0038449 | 3300037466 | Bacteria | 4743 |
| 673 | Ga0395898_0044855 | 3300037466 | Bacteria | 4349 |
| 674 | Ga0395898_0064375 | 3300037466 | Bacteria | 3556 |
| 675 | Ga0395898_0222500 | 3300037466 | Bacteria | 1800 |
| 676 | Ga0395898_0418882 | 3300037466 | Bacteria | 1276 |
| 677 | Ga0395905_0966217 | 3300037471 | Bacteria | 755 |
| 678 | Ga0436364_0448530 | 3300037853 | Bacteria | 1330 |
| 679 | Ga0436364_0726557 | 3300037853 | Bacteria | 1181 |
| 680 | Ga0436364_1337618 | 3300037853 | Bacteria | 5053 |
| 681 | Ga0395901_0055306 | 3300038443 | Bacteria | 4127 |
| 682 | Ga0395901_0102296 | 3300038443 | Bacteria | 3007 |
| 683 | Ga0395901_0290885 | 3300038443 | Bacteria | 1695 |
| 684 | Ga0436365_0199779 | 3300039437 | Bacteria | 4132 |
| 685 | Ga0436365_0675434 | 3300039437 | Bacteria | 3737 |
| 686 | Ga0436365_1234709 | 3300039437 | Bacteria | 1185 |
| 687 | Ga0436365_1327472 | 3300039437 | Bacteria | 1714 |
| 688 | Ga0436360_0513745 | 3300039438 | Bacteria | 847 |
| 689 | Ga0436360_1119639 | 3300039438 | Bacteria | 2118 |
| 690 | Ga0436361_0808304 | 3300039447 | Bacteria | 1486 |
| 691 | Ga0436361_0844310 | 3300039447 | Bacteria | 9297 |
| 692 | Ga0436361_1158949 | 3300039447 | Bacteria | 1089 |
| 693 | Ga0436361_1192224 | 3300039447 | Bacteria | 2700 |
| 694 | Ga0436363_0359787 | 3300039450 | Bacteria | 2174 |
| 695 | Ga0436363_1257565 | 3300039450 | Bacteria | 4182 |
| 696 | Ga0436363_1646537 | 3300039450 | Bacteria | 795 |
| 697 | Ga0439441_000158 | 3300042001 | Bacteria | 5928 |
| 698 | Ga0439441_004858 | 3300042001 | Bacteria | 2059 |
| 699 | Ga0439456_046709 | 3300042013 | Bacteria | 943 |
| 700 | Ga0439435_0002921 | 3300042436 | Bacteria | 3474 |
| 701 | Ga0439435_0014803 | 3300042436 | Bacteria | 1932 |
| 702 | Ga0439444_0000818 | 3300042437 | Bacteria | 3750 |
| 703 | Ga0439444_0009740 | 3300042437 | Bacteria | 1520 |
| 704 | Ga0439460_0122877 | 3300042461 | Bacteria | 850 |
| 705 | Ga0453683_0208282 | 3300044673 | Bacteria | 1242 |
| 706 | Ga0466961_0051159 | 3300044693 | Bacteria | 2639 |
| 707 | Ga0466963_0206608 | 3300044694 | Bacteria | 1374 |
| 708 | Ga0466970_0069435 | 3300044765 | Bacteria | 1894 |
| 709 | Ga0466957_0620872 | 3300044842 | Bacteria | 758 |
| 710 | Ga0466959_0036080 | 3300045049 | Bacteria | 3654 |
| 711 | Ga0466959_0549602 | 3300045049 | Bacteria | 779 |
| 712 | Ga0451576_0013568 | 3300045051 | Bacteria | 9110 |
| 713 | Ga0451576_0035215 | 3300045051 | Bacteria | 5313 |
| 714 | Ga0451576_0057652 | 3300045051 | Bacteria | 4060 |
| 715 | Ga0466967_0115925 | 3300045976 | Bacteria | 2468 |
| 716 | Ga0466967_0631939 | 3300045976 | Bacteria | 1058 |
| 717 | Ga0466967_0725797 | 3300045976 | Bacteria | 985 |
| 718 | Ga0495592_0053200 | 3300046454 | Bacteria | 3004 |
| 719 | Ga0495592_0103380 | 3300046454 | Bacteria | 2027 |
| 720 | Ga0495592_0122000 | 3300046454 | Bacteria | 1832 |
| 721 | Ga0495592_0161411 | 3300046454 | Bacteria | 1542 |
| 722 | Ga0495592_0222752 | 3300046454 | Bacteria | 1260 |
| 723 | Ga0495592_0307369 | 3300046454 | Bacteria | 1029 |
| 724 | Ga0495603_0245817 | 3300046455 | Bacteria | 1030 |
| 725 | Ga0495629_0103979 | 3300046459 | Bacteria | 1981 |
| 726 | Ga0495629_0251548 | 3300046459 | Bacteria | 1216 |
| 727 | Ga0495638_0000330 | 3300046460 | Bacteria | 59733 |
| 728 | Ga0495651_0001982 | 3300046462 | Bacteria | 15869 |
| 729 | Ga0495651_0004780 | 3300046462 | Bacteria | 10368 |
| 730 | Ga0495651_0115097 | 3300046462 | Bacteria | 1983 |
| 731 | Ga0495651_0239715 | 3300046462 | Bacteria | 1244 |
| 732 | Ga0495653_0125567 | 3300046463 | Bacteria | 1823 |
| 733 | Ga0495582_0035466 | 3300046473 | Bacteria | 2743 |
| 734 | Ga0495582_0249034 | 3300046473 | Bacteria | 1019 |
| 735 | Ga0495639_0106820 | 3300046475 | Bacteria | 1325 |
| 736 | Ga0495664_0007023 | 3300046477 | Bacteria | 6237 |
| 737 | Ga0495664_0007261 | 3300046477 | Bacteria | 6146 |
| 738 | Ga0495664_0009390 | 3300046477 | Bacteria | 5471 |
| 739 | Ga0495584_0149159 | 3300046491 | Bacteria | 1188 |
| 740 | Ga0495584_0313830 | 3300046491 | Bacteria | 796 |
| 741 | Ga0495608_0008754 | 3300046511 | Bacteria | 7079 |
| 742 | Ga0495608_0049559 | 3300046511 | Bacteria | 2788 |
| 743 | Ga0495628_0103309 | 3300046516 | Bacteria | 2197 |
| 744 | Ga0495630_0121394 | 3300046517 | Bacteria | 1982 |
| 745 | Ga0495630_0127898 | 3300046517 | Bacteria | 1928 |
| 746 | Ga0495652_0249385 | 3300046529 | Bacteria | 1316 |
| 747 | Ga0495652_0284608 | 3300046529 | Bacteria | 1209 |
| 748 | Ga0495652_0412241 | 3300046529 | Bacteria | 954 |
| 749 | Ga0495665_0216230 | 3300046531 | Bacteria | 991 |
| 750 | Ga0495640_0016968 | 3300046533 | Bacteria | 5436 |
| 751 | Ga0495640_0072831 | 3300046533 | Bacteria | 2301 |
| 752 | Ga0495640_0099384 | 3300046533 | Bacteria | 1912 |
| 753 | Ga0495586_0049421 | 3300046535 | Bacteria | 2274 |
| 754 | Ga0495587_0049445 | 3300046536 | Bacteria | 2489 |
| 755 | Ga0495587_0303426 | 3300046536 | Bacteria | 893 |
| 756 | Ga0495621_0017170 | 3300046539 | Bacteria | 2335 |
| 757 | Ga0495645_0000500 | 3300046543 | Bacteria | 27082 |
| 758 | Ga0495645_0010769 | 3300046543 | Bacteria | 6424 |
| 759 | Ga0495645_0199234 | 3300046543 | Bacteria | 1360 |
| 760 | Ga0495667_0042398 | 3300046559 | Bacteria | 3017 |
| 761 | Ga0495667_0097203 | 3300046559 | Bacteria | 1906 |
| 762 | Ga0495667_0160351 | 3300046559 | Bacteria | 1447 |
| 763 | Ga0495667_0167870 | 3300046559 | Bacteria | 1410 |
| 764 | Ga0495656_0031341 | 3300046615 | Bacteria | 2156 |
| 765 | Ga0495668_0105682 | 3300046616 | Bacteria | 1540 |
| 766 | Ga0495635_0074400 | 3300046663 | Bacteria | 2327 |
| 767 | Ga0495659_0069808 | 3300046664 | Bacteria | 1315 |
| 768 | Ga0495657_0032389 | 3300046675 | Bacteria | 3648 |
| 769 | Ga0495657_0187779 | 3300046675 | Bacteria | 1264 |
| 770 | Ga0495599_0055545 | 3300046678 | Bacteria | 2479 |
| 771 | Ga0495623_0143549 | 3300046679 | Bacteria | 1418 |
| 772 | Ga0495646_0056973 | 3300046680 | Bacteria | 2341 |
| 773 | Ga0495646_0354661 | 3300046680 | Bacteria | 768 |
| 774 | Ga0495647_0019335 | 3300046681 | Bacteria | 2434 |
| 775 | Ga0495658_0210128 | 3300046683 | Bacteria | 1216 |
| 776 | Ga0495658_0351561 | 3300046683 | Bacteria | 937 |
| 777 | Ga0495669_0100249 | 3300046684 | Bacteria | 1345 |
| 778 | Ga0495613_0238680 | 3300046689 | Bacteria | 1271 |
| 779 | Ga0495624_0026742 | 3300046690 | Bacteria | 3780 |
| 780 | Ga0495581_0134974 | 3300047315 | Bacteria | 1438 |
| 781 | Ga0495604_0068519 | 3300047317 | Bacteria | 2693 |
| 782 | Ga0495674_0069015 | 3300047319 | Bacteria | 3057 |
| 783 | Ga0495674_0104836 | 3300047319 | Bacteria | 2404 |
| 784 | Ga0495674_0260553 | 3300047319 | Bacteria | 1425 |
| 785 | Ga0495674_0367907 | 3300047319 | Bacteria | 1165 |
| 786 | Ga0495672_0158823 | 3300047320 | Bacteria | 1165 |
| 787 | Ga0495680_0024185 | 3300047322 | Bacteria | 5041 |
| 788 | Ga0495680_0079794 | 3300047322 | Bacteria | 2474 |
| 789 | Ga0495680_0089833 | 3300047322 | Bacteria | 2306 |
| 790 | Ga0495680_0289297 | 3300047322 | Bacteria | 1153 |
| 791 | Ga0495675_0044986 | 3300047444 | Bacteria | 2811 |
| 792 | Ga0495684_0017127 | 3300047471 | Bacteria | 5581 |
| 793 | Ga0495684_0033134 | 3300047471 | Bacteria | 3965 |
| 794 | Ga0495593_0159142 | 3300047673 | Bacteria | 1140 |
| 795 | Ga0495602_0000143 | 3300048088 | Bacteria | 66782 |
| 796 | Ga0496100_0258062 | 3300048903 | Bacteria | 1292 |
| 797 | Ga0496101_0091275 | 3300048904 | Bacteria | 2267 |
| 798 | Ga0496101_0465438 | 3300048904 | Bacteria | 998 |
| 799 | Ga0496102_0002928 | 3300048905 | Bacteria | 14484 |
| 800 | Ga0496102_0507571 | 3300048905 | Bacteria | 1128 |
| 801 | Ga0496103_0003743 | 3300048906 | Bacteria | 9250 |
| 802 | Ga0496104_0000583 | 3300048907 | Bacteria | 31105 |
| 803 | Ga0496104_0012330 | 3300048907 | Bacteria | 7684 |
| 804 | Ga0496104_0245225 | 3300048907 | Bacteria | 1704 |
| 805 | Ga0496105_0008697 | 3300048908 | Bacteria | 7900 |
| 806 | Ga0496105_0050684 | 3300048908 | Bacteria | 3429 |
| 807 | Ga0496105_0256239 | 3300048908 | Bacteria | 1416 |
| 808 | Ga0496106_0022118 | 3300048909 | Bacteria | 4722 |
| 809 | Ga0496106_0299811 | 3300048909 | Bacteria | 1289 |
| 810 | Ga0496107_0001227 | 3300048910 | Bacteria | 15652 |
| 811 | Ga0496108_0049238 | 3300048911 | Bacteria | 3524 |
| 812 | Ga0496108_0173590 | 3300048911 | Bacteria | 1865 |
| 813 | Ga0496108_0225623 | 3300048911 | Bacteria | 1628 |
| 814 | Ga0496108_0365082 | 3300048911 | Bacteria | 1260 |
| 815 | Ga0496109_0057825 | 3300048912 | Bacteria | 3541 |
| 816 | Ga0496109_0118398 | 3300048912 | Bacteria | 2466 |
| 817 | Ga0496109_0886103 | 3300048912 | Bacteria | 830 |
| 818 | Ga0496110_0007441 | 3300048913 | Bacteria | 8747 |
| 819 | Ga0496110_0204667 | 3300048913 | Bacteria | 1794 |
| 820 | Ga0496111_0072319 | 3300048914 | Bacteria | 2510 |
| 821 | Ga0496112_0088621 | 3300048915 | Bacteria | 3062 |
| 822 | Ga0496112_0104855 | 3300048915 | Bacteria | 2797 |
| 823 | Ga0496112_0177127 | 3300048915 | Bacteria | 2097 |
| 824 | Ga0496112_0394726 | 3300048915 | Bacteria | 1323 |
| 825 | Ga0496113_0020887 | 3300048916 | Bacteria | 4612 |
| 826 | Ga0496113_0037774 | 3300048916 | Bacteria | 3547 |
| 827 | Ga0496115_0022061 | 3300048918 | Bacteria | 4926 |
| 828 | Ga0496116_0127278 | 3300048919 | Bacteria | 1460 |
| 829 | Ga0496117_0003630 | 3300048920 | Bacteria | 17770 |
| 830 | Ga0496118_0010798 | 3300048921 | Bacteria | 8997 |
| 831 | Ga0496121_0001572 | 3300048924 | Bacteria | 38031 |
| 832 | Ga0496121_0051858 | 3300048924 | Bacteria | 3452 |
| 833 | Ga0496121_0135321 | 3300048924 | Bacteria | 1837 |
| 834 | Ga0496122_0173024 | 3300048925 | Bacteria | 1298 |
| 835 | Ga0496123_0031626 | 3300048926 | Bacteria | 3847 |
| 836 | Ga0496126_0008605 | 3300048929 | Bacteria | 10983 |
| 837 | Ga0496126_0110482 | 3300048929 | Bacteria | 2395 |
| 838 | Ga0496126_0114982 | 3300048929 | Bacteria | 2340 |
| 839 | Ga0496126_0222400 | 3300048929 | Bacteria | 1585 |
| 840 | Ga0501031_0063494 | 3300049568 | Bacteria | 2406 |
| 841 | Ga0501033_0015021 | 3300049570 | Bacteria | 5878 |
| 842 | Ga0501034_0029827 | 3300049571 | Bacteria | 5544 |
| 843 | Ga0501034_0044973 | 3300049571 | Bacteria | 4462 |
| 844 | Ga0501034_0273259 | 3300049571 | Bacteria | 1631 |
| 845 | Ga0501034_0360463 | 3300049571 | Bacteria | 1381 |
| 846 | Ga0501036_0006734 | 3300049572 | Bacteria | 9341 |
| 847 | Ga0501036_0093588 | 3300049572 | Bacteria | 2539 |
| 848 | Ga0501036_0213089 | 3300049572 | Bacteria | 1623 |
| 849 | Ga0501036_0297152 | 3300049572 | Bacteria | 1351 |
| 850 | Ga0501038_0002157 | 3300049574 | Bacteria | 18290 |
| 851 | Ga0501038_0049869 | 3300049574 | Bacteria | 3618 |
| 852 | Ga0501038_0061036 | 3300049574 | Bacteria | 3225 |
| 853 | Ga0501039_0048849 | 3300049575 | Bacteria | 3271 |
| 854 | Ga0501039_0189821 | 3300049575 | Bacteria | 1616 |
| 855 | Ga0501040_0000906 | 3300049576 | Bacteria | 18608 |
| 856 | Ga0501040_0005522 | 3300049576 | Bacteria | 8189 |
| 857 | Ga0501040_0096766 | 3300049576 | Bacteria | 2056 |
| 858 | Ga0501040_0350384 | 3300049576 | Bacteria | 1058 |
| 859 | Ga0501041_0009565 | 3300049577 | Bacteria | 5715 |
| 860 | Ga0501041_0063399 | 3300049577 | Bacteria | 2263 |
| 861 | Ga0501041_0150096 | 3300049577 | Bacteria | 1455 |
| 862 | Ga0501042_0000035 | 3300049578 | Bacteria | 43703 |
| 863 | Ga0501042_0028580 | 3300049578 | Bacteria | 3930 |
| 864 | Ga0501042_0313151 | 3300049578 | Bacteria | 1134 |
| 865 | Ga0501046_0009529 | 3300049580 | Bacteria | 8389 |
| 866 | Ga0501046_0129428 | 3300049580 | Bacteria | 1915 |
| 867 | Ga0501046_0272008 | 3300049580 | Bacteria | 1242 |
| 868 | Ga0501046_0346596 | 3300049580 | Bacteria | 1079 |
| 869 | Ga0501048_0013519 | 3300049582 | Bacteria | 6057 |
| 870 | Ga0501067_0043894 | 3300049583 | Bacteria | 2484 |
| 871 | Ga0501068_0023383 | 3300049584 | Bacteria | 3621 |
| 872 | Ga0501069_0246373 | 3300049585 | Bacteria | 1042 |
| 873 | Ga0501070_0052327 | 3300049586 | Bacteria | 3389 |
| 874 | Ga0501070_0606219 | 3300049586 | Bacteria | 872 |
| 875 | Ga0501071_0000007 | 3300049587 | Bacteria | 73318 |
| 876 | Ga0501072_0001853 | 3300049588 | Bacteria | 15746 |
| 877 | Ga0501072_0007323 | 3300049588 | Bacteria | 8371 |
| 878 | Ga0501072_0102163 | 3300049588 | Bacteria | 2279 |
| 879 | Ga0501072_0212854 | 3300049588 | Bacteria | 1540 |
| 880 | Ga0501072_0460444 | 3300049588 | Bacteria | 1007 |
| 881 | Ga0501073_0066937 | 3300049589 | Bacteria | 2504 |
| 882 | Ga0501074_0000890 | 3300049590 | Bacteria | 19092 |
| 883 | Ga0501074_0011936 | 3300049590 | Bacteria | 6318 |
| 884 | Ga0501074_0045444 | 3300049590 | Bacteria | 3178 |
| 885 | Ga0501074_0102208 | 3300049590 | Bacteria | 2052 |
| 886 | Ga0501075_0004980 | 3300049591 | Bacteria | 9060 |
| 887 | Ga0501075_0008897 | 3300049591 | Bacteria | 7003 |
| 888 | Ga0501075_0265060 | 3300049591 | Bacteria | 1309 |
| 889 | Ga0501075_0284358 | 3300049591 | Bacteria | 1260 |
| 890 | Ga0501076_0002324 | 3300049592 | Bacteria | 13021 |
| 891 | Ga0501076_0003466 | 3300049592 | Bacteria | 11075 |
| 892 | Ga0501076_0150081 | 3300049592 | Bacteria | 1896 |
| 893 | Ga0501077_0000416 | 3300049593 | Bacteria | 25791 |
| 894 | Ga0501077_0012149 | 3300049593 | Bacteria | 5389 |
| 895 | Ga0501077_0083034 | 3300049593 | Bacteria | 2030 |
| 896 | Ga0501079_0000624 | 3300049741 | Bacteria | 23502 |
| 897 | Ga0501079_0003460 | 3300049741 | Bacteria | 11600 |
| 898 | Ga0501079_0012156 | 3300049741 | Bacteria | 6572 |
| 899 | Ga0501079_0067224 | 3300049741 | Bacteria | 2766 |
| 900 | Ga0501079_0113823 | 3300049741 | Bacteria | 2103 |
| 901 | Ga0501080_0000512 | 3300049742 | Bacteria | 30523 |
| 902 | Ga0501080_0002139 | 3300049742 | Bacteria | 17167 |
| 903 | Ga0501080_0061963 | 3300049742 | Bacteria | 3481 |
| 904 | Ga0501080_0160405 | 3300049742 | Bacteria | 2077 |
| 905 | Ga0501080_0999471 | 3300049742 | Bacteria | 726 |
| 906 | Ga0501081_0008832 | 3300049743 | Bacteria | 6551 |
| 907 | Ga0501081_0016154 | 3300049743 | Bacteria | 4930 |
| 908 | Ga0501081_0017365 | 3300049743 | Bacteria | 4762 |
| 909 | Ga0501081_0145991 | 3300049743 | Bacteria | 1698 |
| 910 | Ga0501081_0249084 | 3300049743 | Bacteria | 1297 |
| 911 | Ga0501081_0254236 | 3300049743 | Bacteria | 1283 |
| 912 | Ga0501081_0417951 | 3300049743 | Bacteria | 994 |
| 913 | Ga0501083_0394444 | 3300049744 | Bacteria | 900 |
| 914 | Ga0501035_0012129 | 3300049822 | Bacteria | 7970 |
| 915 | Ga0501035_0124134 | 3300049822 | Bacteria | 2255 |
| 916 | Ga0501044_0110959 | 3300049823 | Bacteria | 2751 |
| 917 | Ga0501045_0000029 | 3300049824 | Bacteria | 60421 |
| 918 | Ga0501045_0013527 | 3300049824 | Bacteria | 5764 |
| 919 | Ga0501045_0052869 | 3300049824 | Bacteria | 2967 |
| 920 | Ga0501045_0107985 | 3300049824 | Bacteria | 2063 |
| 921 | nmdc:mga03683_41561_c1 | 3300050489 | Bacteria | 1889 |
| 922 | nmdc:mga03n38_1857_c1 | 3300050490 | Bacteria | 6306 |
| 923 | nmdc:mga03n38_20425_c1 | 3300050490 | Bacteria | 2649 |
| 924 | nmdc:mga00v17_366329_c1 | 3300050491 | Bacteria | 937 |
| 925 | nmdc:mga0yw44_286956_c1 | 3300050492 | Bacteria | 1101 |
| 926 | nmdc:mga0yw44_39681_c1 | 3300050492 | Bacteria | 2793 |
| 927 | nmdc:mga0yw44_600552_c1 | 3300050492 | Bacteria | 748 |
| 928 | nmdc:mga0yw44_69373_c1 | 3300050492 | Bacteria | 2183 |
| 929 | nmdc:mga0k408_309391_c1 | 3300050493 | Bacteria | 943 |
| 930 | nmdc:mga0k408_80884_c1 | 3300050493 | Bacteria | 1902 |
| 931 | nmdc:mga06z11_31047_c1 | 3300050494 | Bacteria | 2592 |
| 932 | nmdc:mga06z11_54019_c1 | 3300050494 | Bacteria | 2069 |
| 933 | nmdc:mga06z11_78189_c1 | 3300050494 | Bacteria | 1768 |
| 934 | nmdc:mga06z11_92811_c1 | 3300050494 | Bacteria | 1642 |
| 935 | nmdc:mga04h51_132065_c1 | 3300050495 | Bacteria | 940 |
| 936 | nmdc:mga04h51_92715_c1 | 3300050495 | Bacteria | 1089 |
| 937 | nmdc:mga07m45_14266_c2 | 3300050496 | Bacteria | 1237 |
| 938 | nmdc:mga05p37_109_c1 | 3300050507 | Bacteria | 74571 |
| 939 | nmdc:mga05p37_1198817_c1 | 3300050507 | Bacteria | 784 |
| 940 | nmdc:mga05p37_188231_c1 | 3300050507 | Plasmid | 2508 |
| 941 | nmdc:mga05p37_214957_c1 | 3300050507 | Bacteria | 2323 |
| 942 | nmdc:mga05p37_237746_c1 | 3300050507 | Bacteria | 2192 |
| 943 | nmdc:mga05p37_246642_c1 | 3300050507 | Bacteria | 2144 |
| 944 | nmdc:mga05p37_281300_c1 | 3300050507 | Bacteria | 1984 |
| 945 | nmdc:mga05p37_443652_c1 | 3300050507 | Bacteria | 1504 |
| 946 | nmdc:mga05p37_7536_c1 | 3300050507 | Bacteria | 12830 |
| 947 | nmdc:mga09592_16967_c1 | 3300050508 | Bacteria | 5959 |
| 948 | nmdc:mga09592_26569_c1 | 3300050508 | Bacteria | 4798 |
| 949 | nmdc:mga09592_291128_c1 | 3300050508 | Bacteria | 1416 |
| 950 | nmdc:mga09592_357095_c1 | 3300050508 | Bacteria | 1265 |
| 951 | nmdc:mga09592_654955_c1 | 3300050508 | Bacteria | 896 |
| 952 | nmdc:mga09592_754_c1 | 3300050508 | Bacteria | 24849 |
| 953 | nmdc:mga09592_79346_c1 | 3300050508 | Bacteria | 2794 |
| 954 | nmdc:mga0qj67_10743_c1 | 3300050509 | Bacteria | 6845 |
| 955 | nmdc:mga0qj67_1103_c1 | 3300050509 | Bacteria | 18726 |
| 956 | nmdc:mga0qj67_129978_c1 | 3300050509 | Bacteria | 2040 |
| 957 | nmdc:mga0qj67_220871_c1 | 3300050509 | Bacteria | 1538 |
| 958 | nmdc:mga0qj67_41864_c1 | 3300050509 | Unclassified | 3605 |
| 959 | nmdc:mga0qj67_47826_c1 | 3300050509 | Bacteria | 3379 |
| 960 | nmdc:mga0qj67_7392_c1 | 3300050509 | Bacteria | 8120 |
| 961 | nmdc:mga06r32_117505_c1 | 3300050510 | Bacteria | 2621 |
| 962 | nmdc:mga06r32_168813_c1 | 3300050510 | Bacteria | 2171 |
| 963 | nmdc:mga06r32_199877_c1 | 3300050510 | Bacteria | 1987 |
| 964 | nmdc:mga06r32_29856_c1 | 3300050510 | Bacteria | 5113 |
| 965 | nmdc:mga06r32_553346_c1 | 3300050510 | Bacteria | 1124 |
| 966 | nmdc:mga06r32_63429_c1 | 3300050510 | Bacteria | 3561 |
| 967 | nmdc:mga06r32_63637_c1 | 3300050510 | Bacteria | 3556 |
| 968 | nmdc:mga06r32_6421_c1 | 3300050510 | Bacteria | 10563 |
| 969 | nmdc:mga06r32_661643_c1 | 3300050510 | Bacteria | 1012 |
| 970 | nmdc:mga08y16_198311_c1 | 3300050511 | Bacteria | 2080 |
| 971 | nmdc:mga08y16_21654_c1 | 3300050511 | Bacteria | 6787 |
| 972 | nmdc:mga08y16_310675_c1 | 3300050511 | Bacteria | 1623 |
| 973 | nmdc:mga08y16_355340_c1 | 3300050511 | Bacteria | 1505 |
| 974 | nmdc:mga08y16_36479_c1 | 3300050511 | Bacteria | 5163 |
| 975 | nmdc:mga08y16_454175_c1 | 3300050511 | Bacteria | 1306 |
| 976 | nmdc:mga08y16_56786_c1 | 3300050511 | Bacteria | 4091 |
| 977 | nmdc:mga08y16_607426_c1 | 3300050511 | Bacteria | 1102 |
| 978 | nmdc:mga08y16_677050_c1 | 3300050511 | Unclassified | 1033 |
| 979 | nmdc:mga08y16_77177_c1 | 3300050511 | Bacteria | 3473 |
| 980 | nmdc:mga08y16_80472_c1 | 3300050511 | Bacteria | 3397 |
| 981 | nmdc:mga0n895_16307_c1 | 3300050512 | Bacteria | 6813 |
| 982 | nmdc:mga0n895_175850_c1 | 3300050512 | Bacteria | 2171 |
| 983 | nmdc:mga0n895_202821_c1 | 3300050512 | Bacteria | 2014 |
| 984 | nmdc:mga0n895_42519_c1 | 3300050512 | Bacteria | 4421 |
| 985 | nmdc:mga0n895_663266_c1 | 3300050512 | Bacteria | 1041 |
| 986 | nmdc:mga0n895_7693_c1 | 3300050512 | Bacteria | 9271 |
| 987 | nmdc:mga0n895_87815_c1 | 3300050512 | Bacteria | 3108 |
| 988 | nmdc:mga0rr50_116094_c1 | 3300050513 | Bacteria | 2125 |
| 989 | nmdc:mga0rr50_119942_c1 | 3300050513 | Bacteria | 2092 |
| 990 | nmdc:mga0rr50_15506_c1 | 3300050513 | Bacteria | 5032 |
| 991 | nmdc:mga0rr50_7491_c1 | 3300050513 | Bacteria | 6737 |
| 992 | nmdc:mga08x19_1428_c1 | 3300050514 | Bacteria | 14774 |
| 993 | nmdc:mga08x19_311646_c1 | 3300050514 | Bacteria | 1094 |
| 994 | nmdc:mga08x19_378288_c1 | 3300050514 | Bacteria | 991 |
| 995 | nmdc:mga0a205_12754_c1 | 3300050515 | Bacteria | 7792 |
| 996 | nmdc:mga0a205_1353_c1 | 3300050515 | Bacteria | 20648 |
| 997 | nmdc:mga0a205_308416_c1 | 3300050515 | Bacteria | 1455 |
| 998 | nmdc:mga0sz30_1337_c1 | 3300050516 | Bacteria | 8797 |
| 999 | nmdc:mga0sz30_165760_c1 | 3300050516 | Bacteria | 979 |
| 1000 | nmdc:mga0sz30_4470_c1 | 3300050516 | Bacteria | 2618 |
| 1001 | Ga0495601_0013464 | 3300053077 | Bacteria | 4921 |
| 1002 | Ga0495601_0035902 | 3300053077 | Bacteria | 3095 |
| 1003 | Ga0495601_0084666 | 3300053077 | Bacteria | 2037 |
| 1004 | Ga0495601_0179977 | 3300053077 | Bacteria | 1382 |
| 1005 | Ga0495612_0011345 | 3300053078 | Bacteria | 3592 |
| 1006 | Ga0495595_0058130 | 3300053084 | Bacteria | 1805 |
| 1007 | Ga0495595_0103369 | 3300053084 | Bacteria | 1376 |
| 1008 | Ga0495619_0007665 | 3300053085 | Bacteria | 6836 |
| 1009 | Ga0495619_0023438 | 3300053085 | Bacteria | 3958 |
| 1010 | Ga0495619_0065822 | 3300053085 | Bacteria | 2418 |
| 1011 | Ga0500646_0132143 | 3300053090 | Bacteria | 812 |
| 1012 | Ga0500642_0229206 | 3300053130 | Bacteria | 859 |
| 1013 | Ga0500604_0111355 | 3300053151 | Bacteria | 909 |
| 1014 | Ga0500616_0002472 | 3300053153 | Bacteria | 15337 |
| 1015 | Ga0500616_0077499 | 3300053153 | Bacteria | 1678 |
| 1016 | Ga0500645_033059 | 3300053730 | Bacteria | 1549 |
| 1017 | Ga0501084_0001721 | 3300054114 | Bacteria | 17359 |
| 1018 | Ga0501084_0017907 | 3300054114 | Bacteria | 5898 |
| 1019 | Ga0501084_0025366 | 3300054114 | Bacteria | 4945 |
| 1020 | Ga0501084_0036910 | 3300054114 | Bacteria | 4083 |
| 1021 | Ga0501084_0208733 | 3300054114 | Bacteria | 1648 |
| 1022 | Ga0501084_0209696 | 3300054114 | Bacteria | 1644 |
| 1023 | Ga0501084_0437477 | 3300054114 | Bacteria | 1106 |
| 1024 | Ga0501084_0497065 | 3300054114 | Bacteria | 1031 |
| 1025 | Ga0501084_0899748 | 3300054114 | Bacteria | 744 |
| 1026 | Ga0501082_0014375 | 3300060353 | Bacteria | 6811 |
| 1027 | Ga0501082_0020395 | 3300060353 | Bacteria | 5714 |
| 1028 | Ga0501082_0133887 | 3300060353 | Bacteria | 2150 |
| 1029 | Ga0501082_0259702 | 3300060353 | Bacteria | 1511 |
| 1030 | Ga0501082_0326966 | 3300060353 | Bacteria | 1336 |
| 1031 | Ga0466962_0019244 | 3300061719 | Bacteria | 3280 |
| 1032 | Ga0530510_0003414 | 3300061734 | Bacteria | 10926 |
| 1033 | Ga0530510_0004308 | 3300061734 | Bacteria | 9845 |
| 1034 | Ga0530510_0006430 | 3300061734 | Bacteria | 8184 |
| 1035 | Ga0530510_0024289 | 3300061734 | Bacteria | 4323 |
| 1036 | Ga0530510_0103592 | 3300061734 | Unclassified | 2081 |
| 1037 | Ga0530510_0116450 | 3300061734 | Bacteria | 1959 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8019565922 | 8019572186 | 205 |
| 2 | 3300049742 | Ga0501080_0999471 | Ga0501080_0999471_46_696 | 210 |
| 3 | 3300050511 | nmdc:mga08y16_677050_c1 | nmdc:mga08y16_677050_c1_38_673 | 210 |
| 4 | 3300005355 | Ga0070671_100227593 | Ga0070671_1002275932 | 220 |
| 5 | 3300005434 | Ga0070709_10029357 | Ga0070709_100293573 | 220 |
| 6 | 3300005436 | Ga0070713_100350499 | Ga0070713_1003504991 | 220 |
| 7 | 3300005548 | Ga0070665_100330026 | Ga0070665_1003300263 | 220 |
| 8 | 3300005618 | Ga0068864_100334698 | Ga0068864_1003346981 | 220 |
| 9 | 3300005843 | Ga0068860_100161420 | Ga0068860_1001614203 | 220 |
| 10 | 3300009147 | Ga0114129_10011216 | Ga0114129_100112168 | 220 |
| 11 | 3300013297 | Ga0157378_10084372 | Ga0157378_100843721 | 220 |
| 12 | 3300013306 | Ga0163162_11251087 | Ga0163162_112510871 | 220 |
| 13 | 3300025921 | Ga0207652_10053420 | Ga0207652_100534202 | 220 |
| 14 | 3300025927 | Ga0207687_10210680 | Ga0207687_102106802 | 220 |
| 15 | 3300025929 | Ga0207664_10192727 | Ga0207664_101927272 | 220 |
| 16 | 3300025944 | Ga0207661_10406142 | Ga0207661_104061422 | 220 |
| 17 | 3300028379 | Ga0268266_10344079 | Ga0268266_103440792 | 220 |
| 18 | 3300028381 | Ga0268264_10076507 | Ga0268264_100765073 | 220 |
| 19 | 3300035692 | Ga0373935_0216199 | Ga0373935_0216199_125_787 | 220 |
| 20 | 3300036401 | Ga0373937_0034276 | Ga0373937_0034276_3736_4398 | 220 |
| 21 | 3300042013 | Ga0439456_046709 | Ga0439456_046709_145_807 | 220 |
| 22 | 3300044842 | Ga0466957_0620872 | Ga0466957_0620872_32_694 | 220 |
| 23 | 3300045049 | Ga0466959_0549602 | Ga0466959_0549602_96_758 | 220 |
| 24 | 3300045051 | Ga0451576_0057652 | Ga0451576_0057652_2029_2691 | 220 |
| 25 | 3300045976 | Ga0466967_0725797 | Ga0466967_0725797_311_973 | 220 |
| 26 | 3300046454 | Ga0495592_0307369 | Ga0495592_0307369_54_716 | 220 |
| 27 | 3300046529 | Ga0495652_0412241 | Ga0495652_0412241_130_792 | 220 |
| 28 | 3300046543 | Ga0495645_0199234 | Ga0495645_0199234_88_750 | 220 |
| 29 | 3300048929 | Ga0496126_0114982 | Ga0496126_0114982_1083_1745 | 220 |
| 30 | 3300049585 | Ga0501069_0246373 | Ga0501069_0246373_355_1017 | 220 |
| 31 | 3300050507 | nmdc:mga05p37_7536_c1 | nmdc:mga05p37_7536_c1_4920_5582 | 220 |
| 32 | 3300050515 | nmdc:mga0a205_308416_c1 | nmdc:mga0a205_308416_c1_323_985 | 220 |
| 33 | 3300054114 | Ga0501084_0497065 | Ga0501084_0497065_177_839 | 220 |
| 34 | 3300054114 | Ga0501084_0899748 | Ga0501084_0899748_70_732 | 220 |
| 35 | 3300039438 | Ga0436360_0513745 | Ga0436360_0513745_46_747 | 224 |
| 36 | 3300049742 | Ga0501080_0160405 | Ga0501080_0160405_575_1300 | 224 |
| 37 | 3300035111 | Ga0373923_0077565 | Ga0373923_0077565_13_699 | 228 |
| 38 | 3300035116 | Ga0373945_0037865 | Ga0373945_0037865_501_1187 | 228 |
| 39 | 3300035171 | Ga0373946_0047655 | Ga0373946_0047655_496_1182 | 228 |
| 40 | 3300035692 | Ga0373935_0291096 | Ga0373935_0291096_405_1091 | 228 |
| 41 | 3300035724 | Ga0373933_0066336 | Ga0373933_0066336_872_1558 | 228 |
| 42 | 3300035725 | Ga0373947_0053109 | Ga0373947_0053109_61_747 | 228 |
| 43 | 3300036401 | Ga0373937_0126081 | Ga0373937_0126081_1269_1955 | 228 |
| 44 | 3300046473 | Ga0495582_0249034 | Ga0495582_0249034_295_981 | 228 |
| 45 | 3300003659 | JGI25404J52841_10001396 | JGI25404J52841_100013962 | 229 |
| 46 | 3300005983 | Ga0081540_1004048 | Ga0081540_100404811 | 229 |
| 47 | 3300039450 | Ga0436363_1646537 | Ga0436363_1646537_10_702 | 229 |
| 48 | 3300046459 | Ga0495629_0251548 | Ga0495629_0251548_281_970 | 229 |
| 49 | 3300050510 | nmdc:mga06r32_661643_c1 | nmdc:mga06r32_661643_c1_244_945 | 229 |
| 50 | iso_pu_bacteria | 2513237096 | 2513658547 | 229 |
| 51 | iso_pu_bacteria | 2513237137 | 2513860129 | 229 |
| 52 | iso_pu_bacteria | 2513237141 | 2513890553 | 229 |
| 53 | iso_pu_bacteria | 2513237145 | 2513920663 | 229 |
| 54 | iso_pu_bacteria | 2517572143 | 2517888571 | 229 |
| 55 | iso_pu_bacteria | 2524023228 | 2524535115 | 229 |
| 56 | iso_pu_bacteria | 2667528175 | 2671119751 | 229 |
| 57 | iso_pu_bacteria | 2728368998 | 2728755245 | 229 |
| 58 | iso_pu_bacteria | 2791355197 | 2793067391 | 229 |
| 59 | iso_pu_bacteria | 2885374607 | 2885377867 | 229 |
| 60 | iso_pu_bacteria | 2885409591 | 2885418738 | 229 |
| 61 | iso_pu_bacteria | 2904699407 | 2904708180 | 229 |
| 62 | iso_pu_bacteria | 2906610324 | 2906614074 | 229 |
| 63 | iso_pu_bacteria | 2906635258 | 2906637744 | 229 |
| 64 | iso_pu_bacteria | 2906660503 | 2906668312 | 229 |
| 65 | iso_pu_bacteria | 2908739725 | 2908747107 | 229 |
| 66 | iso_pu_bacteria | 2922425934 | 2922434561 | 229 |
| 67 | iso_pu_bacteria | 2935630451 | 2935637585 | 229 |
| 68 | iso_pu_bacteria | 2941507105 | 2941514178 | 229 |
| 69 | iso_pu_bacteria | 2941515067 | 2941522139 | 229 |
| 70 | iso_pu_bacteria | 2941523033 | 2941529877 | 229 |
| 71 | iso_pu_bacteria | 3005474847 | 3005483668 | 229 |
| 72 | iso_pu_bacteria | 8006933436 | 8006936536 | 229 |
| 73 | iso_pu_bacteria | 8006973647 | 8006976502 | 229 |
| 74 | iso_pu_bacteria | 8019555841 | 8019562120 | 229 |
| 75 | iso_pu_bacteria | 8056681323 | 8056682505 | 229 |
| 76 | 3300005295 | Ga0065707_10119993 | Ga0065707_101199933 | 230 |
| 77 | 3300005434 | Ga0070709_10088423 | Ga0070709_100884231 | 230 |
| 78 | 3300005435 | Ga0070714_100059244 | Ga0070714_1000592443 | 230 |
| 79 | 3300005546 | Ga0070696_100172418 | Ga0070696_1001724182 | 230 |
| 80 | 3300006914 | Ga0075436_100048683 | Ga0075436_1000486832 | 230 |
| 81 | 3300025906 | Ga0207699_10027940 | Ga0207699_100279402 | 230 |
| 82 | 3300025929 | Ga0207664_10018559 | Ga0207664_100185593 | 230 |
| 83 | iso_pu_bacteria | 2511231024 | 2511373584 | 230 |
| 84 | iso_pu_bacteria | 2513237094 | 2513641309 | 230 |
| 85 | iso_pu_bacteria | 2847930680 | 2847935728 | 230 |
| 86 | iso_pu_bacteria | 2876808645 | 2876816650 | 230 |
| 87 | iso_pu_bacteria | 2879110137 | 2879117343 | 230 |
| 88 | iso_pu_bacteria | 2881412998 | 2881415058 | 230 |
| 89 | iso_pu_bacteria | 2887375801 | 2887376900 | 230 |
| 90 | iso_pu_bacteria | 2903748898 | 2903757263 | 230 |
| 91 | iso_pu_bacteria | 2906643746 | 2906645112 | 230 |
| 92 | iso_pu_bacteria | 2928163908 | 2928166181 | 230 |
| 93 | iso_pu_bacteria | 8056689827 | 8056692393 | 230 |
| 94 | 3300005549 | Ga0070704_100057400 | Ga0070704_1000574002 | 231 |
| 95 | 3300005937 | Ga0081455_10001134 | Ga0081455_1000113413 | 231 |
| 96 | 3300049576 | Ga0501040_0350384 | Ga0501040_0350384_123_818 | 231 |
| 97 | 3300005468 | Ga0070707_100118537 | Ga0070707_1001185373 | 232 |
| 98 | 3300006847 | Ga0075431_100018577 | Ga0075431_1000185778 | 232 |
| 99 | 3300009094 | Ga0111539_10021387 | Ga0111539_100213872 | 232 |
| 100 | 3300025907 | Ga0207645_10004028 | Ga0207645_100040284 | 232 |
| 101 | 3300050507 | nmdc:mga05p37_214957_c1 | nmdc:mga05p37_214957_c1_294_995 | 232 |
| 102 | 3300050509 | nmdc:mga0qj67_10743_c1 | nmdc:mga0qj67_10743_c1_5087_5788 | 232 |
| 103 | 3300050510 | nmdc:mga06r32_63429_c1 | nmdc:mga06r32_63429_c1_918_1628 | 232 |
| 104 | 3300050510 | nmdc:mga06r32_6421_c1 | nmdc:mga06r32_6421_c1_8507_9208 | 232 |
| 105 | 3300050511 | nmdc:mga08y16_21654_c1 | nmdc:mga08y16_21654_c1_1330_2031 | 232 |
| 106 | 3300050512 | nmdc:mga0n895_202821_c1 | nmdc:mga0n895_202821_c1_233_934 | 232 |
| 107 | 3300050515 | nmdc:mga0a205_12754_c1 | nmdc:mga0a205_12754_c1_1149_1850 | 232 |
| 108 | 3300003659 | JGI25404J52841_10027946 | JGI25404J52841_100279462 | 233 |
| 109 | 3300005327 | Ga0070658_10006326 | Ga0070658_100063263 | 233 |
| 110 | 3300005328 | Ga0070676_10028077 | Ga0070676_100280772 | 233 |
| 111 | 3300005328 | Ga0070676_10182914 | Ga0070676_101829142 | 233 |
| 112 | 3300005329 | Ga0070683_100074740 | Ga0070683_1000747402 | 233 |
| 113 | 3300005330 | Ga0070690_100061242 | Ga0070690_1000612423 | 233 |
| 114 | 3300005330 | Ga0070690_100088100 | Ga0070690_1000881002 | 233 |
| 115 | 3300005331 | Ga0070670_100013203 | Ga0070670_1000132032 | 233 |
| 116 | 3300005335 | Ga0070666_10110639 | Ga0070666_101106392 | 233 |
| 117 | 3300005336 | Ga0070680_100001927 | Ga0070680_1000019276 | 233 |
| 118 | 3300005336 | Ga0070680_100032091 | Ga0070680_1000320913 | 233 |
| 119 | 3300005336 | Ga0070680_100289534 | Ga0070680_1002895342 | 233 |
| 120 | 3300005337 | Ga0070682_100246581 | Ga0070682_1002465812 | 233 |
| 121 | 3300005340 | Ga0070689_100158953 | Ga0070689_1001589531 | 233 |
| 122 | 3300005341 | Ga0070691_10000329 | Ga0070691_100003294 | 233 |
| 123 | 3300005341 | Ga0070691_10004950 | Ga0070691_100049503 | 233 |
| 124 | 3300005343 | Ga0070687_100132891 | Ga0070687_1001328912 | 233 |
| 125 | 3300005343 | Ga0070687_100145007 | Ga0070687_1001450072 | 233 |
| 126 | 3300005353 | Ga0070669_100026327 | Ga0070669_1000263272 | 233 |
| 127 | 3300005353 | Ga0070669_100039908 | Ga0070669_1000399084 | 233 |
| 128 | 3300005354 | Ga0070675_100003469 | Ga0070675_1000034694 | 233 |
| 129 | 3300005354 | Ga0070675_100070905 | Ga0070675_1000709052 | 233 |
| 130 | 3300005355 | Ga0070671_100032760 | Ga0070671_1000327605 | 233 |
| 131 | 3300005356 | Ga0070674_100011210 | Ga0070674_1000112106 | 233 |
| 132 | 3300005356 | Ga0070674_100351410 | Ga0070674_1003514102 | 233 |
| 133 | 3300005364 | Ga0070673_100051254 | Ga0070673_1000512542 | 233 |
| 134 | 3300005364 | Ga0070673_100062956 | Ga0070673_1000629563 | 233 |
| 135 | 3300005364 | Ga0070673_100155060 | Ga0070673_1001550602 | 233 |
| 136 | 3300005364 | Ga0070673_100846652 | Ga0070673_1008466521 | 233 |
| 137 | 3300005366 | Ga0070659_100201221 | Ga0070659_1002012212 | 233 |
| 138 | 3300005367 | Ga0070667_100749712 | Ga0070667_1007497121 | 233 |
| 139 | 3300005434 | Ga0070709_10019017 | Ga0070709_100190172 | 233 |
| 140 | 3300005435 | Ga0070714_100020841 | Ga0070714_1000208413 | 233 |
| 141 | 3300005435 | Ga0070714_100501319 | Ga0070714_1005013191 | 233 |
| 142 | 3300005436 | Ga0070713_100014977 | Ga0070713_1000149775 | 233 |
| 143 | 3300005436 | Ga0070713_100021097 | Ga0070713_1000210973 | 233 |
| 144 | 3300005436 | Ga0070713_100132084 | Ga0070713_1001320843 | 233 |
| 145 | 3300005437 | Ga0070710_10098204 | Ga0070710_100982043 | 233 |
| 146 | 3300005440 | Ga0070705_100493315 | Ga0070705_1004933151 | 233 |
| 147 | 3300005444 | Ga0070694_100105982 | Ga0070694_1001059821 | 233 |
| 148 | 3300005455 | Ga0070663_100823562 | Ga0070663_1008235621 | 233 |
| 149 | 3300005456 | Ga0070678_100243734 | Ga0070678_1002437342 | 233 |
| 150 | 3300005456 | Ga0070678_100535080 | Ga0070678_1005350802 | 233 |
| 151 | 3300005458 | Ga0070681_10002685 | Ga0070681_1000268517 | 233 |
| 152 | 3300005458 | Ga0070681_10033835 | Ga0070681_100338359 | 233 |
| 153 | 3300005458 | Ga0070681_10092447 | Ga0070681_100924473 | 233 |
| 154 | 3300005459 | Ga0068867_100034469 | Ga0068867_1000344691 | 233 |
| 155 | 3300005466 | Ga0070685_10194140 | Ga0070685_101941402 | 233 |
| 156 | 3300005530 | Ga0070679_100011073 | Ga0070679_1000110734 | 233 |
| 157 | 3300005530 | Ga0070679_100037519 | Ga0070679_1000375191 | 233 |
| 158 | 3300005530 | Ga0070679_100080696 | Ga0070679_1000806962 | 233 |
| 159 | 3300005535 | Ga0070684_100008775 | Ga0070684_1000087758 | 233 |
| 160 | 3300005536 | Ga0070697_100146596 | Ga0070697_1001465962 | 233 |
| 161 | 3300005543 | Ga0070672_100434943 | Ga0070672_1004349432 | 233 |
| 162 | 3300005544 | Ga0070686_100065014 | Ga0070686_1000650142 | 233 |
| 163 | 3300005545 | Ga0070695_100005467 | Ga0070695_1000054675 | 233 |
| 164 | 3300005546 | Ga0070696_100003174 | Ga0070696_1000031744 | 233 |
| 165 | 3300005546 | Ga0070696_100296519 | Ga0070696_1002965192 | 233 |
| 166 | 3300005548 | Ga0070665_100033840 | Ga0070665_1000338403 | 233 |
| 167 | 3300005548 | Ga0070665_100587604 | Ga0070665_1005876041 | 233 |
| 168 | 3300005549 | Ga0070704_100033822 | Ga0070704_1000338222 | 233 |
| 169 | 3300005549 | Ga0070704_100313406 | Ga0070704_1003134061 | 233 |
| 170 | 3300005549 | Ga0070704_100375629 | Ga0070704_1003756292 | 233 |
| 171 | 3300005563 | Ga0068855_100011573 | Ga0068855_10001157311 | 233 |
| 172 | 3300005563 | Ga0068855_100334887 | Ga0068855_1003348872 | 233 |
| 173 | 3300005577 | Ga0068857_100030564 | Ga0068857_1000305643 | 233 |
| 174 | 3300005614 | Ga0068856_100002546 | Ga0068856_10000254614 | 233 |
| 175 | 3300005614 | Ga0068856_100160167 | Ga0068856_1001601673 | 233 |
| 176 | 3300005614 | Ga0068856_100169686 | Ga0068856_1001696862 | 233 |
| 177 | 3300005615 | Ga0070702_100094107 | Ga0070702_1000941072 | 233 |
| 178 | 3300005616 | Ga0068852_100524039 | Ga0068852_1005240392 | 233 |
| 179 | 3300005618 | Ga0068864_100042835 | Ga0068864_1000428353 | 233 |
| 180 | 3300005718 | Ga0068866_10031807 | Ga0068866_100318073 | 233 |
| 181 | 3300005718 | Ga0068866_10033248 | Ga0068866_100332483 | 233 |
| 182 | 3300005719 | Ga0068861_100000857 | Ga0068861_1000008575 | 233 |
| 183 | 3300005719 | Ga0068861_100068559 | Ga0068861_1000685591 | 233 |
| 184 | 3300005841 | Ga0068863_100027027 | Ga0068863_1000270277 | 233 |
| 185 | 3300005842 | Ga0068858_100021764 | Ga0068858_1000217649 | 233 |
| 186 | 3300005844 | Ga0068862_100176988 | Ga0068862_1001769883 | 233 |
| 187 | 3300005844 | Ga0068862_100481959 | Ga0068862_1004819592 | 233 |
| 188 | 3300005981 | Ga0081538_10011156 | Ga0081538_100111566 | 233 |
| 189 | 3300005981 | Ga0081538_10081108 | Ga0081538_100811083 | 233 |
| 190 | 3300005983 | Ga0081540_1000099 | Ga0081540_10000996 | 233 |
| 191 | 3300005983 | Ga0081540_1069636 | Ga0081540_10696361 | 233 |
| 192 | 3300006028 | Ga0070717_10005042 | Ga0070717_100050427 | 233 |
| 193 | 3300006028 | Ga0070717_10049468 | Ga0070717_100494683 | 233 |
| 194 | 3300006028 | Ga0070717_10090224 | Ga0070717_100902243 | 233 |
| 195 | 3300006028 | Ga0070717_10243390 | Ga0070717_102433902 | 233 |
| 196 | 3300006028 | Ga0070717_10564819 | Ga0070717_105648192 | 233 |
| 197 | 3300006028 | Ga0070717_10757660 | Ga0070717_107576601 | 233 |
| 198 | 3300006042 | Ga0075368_10128725 | Ga0075368_101287251 | 233 |
| 199 | 3300006051 | Ga0075364_10250362 | Ga0075364_102503622 | 233 |
| 200 | 3300006163 | Ga0070715_10089219 | Ga0070715_100892191 | 233 |
| 201 | 3300006175 | Ga0070712_100069757 | Ga0070712_1000697572 | 233 |
| 202 | 3300006178 | Ga0075367_10094349 | Ga0075367_100943493 | 233 |
| 203 | 3300006186 | Ga0075369_10022620 | Ga0075369_100226204 | 233 |
| 204 | 3300006186 | Ga0075369_10177593 | Ga0075369_101775932 | 233 |
| 205 | 3300006237 | Ga0097621_100275959 | Ga0097621_1002759592 | 233 |
| 206 | 3300006237 | Ga0097621_100289668 | Ga0097621_1002896681 | 233 |
| 207 | 3300006846 | Ga0075430_100002744 | Ga0075430_10000274415 | 233 |
| 208 | 3300006846 | Ga0075430_100010364 | Ga0075430_1000103642 | 233 |
| 209 | 3300006847 | Ga0075431_100313276 | Ga0075431_1003132763 | 233 |
| 210 | 3300006852 | Ga0075433_10001856 | Ga0075433_1000185611 | 233 |
| 211 | 3300006852 | Ga0075433_10150743 | Ga0075433_101507433 | 233 |
| 212 | 3300006871 | Ga0075434_100017182 | Ga0075434_1000171828 | 233 |
| 213 | 3300006871 | Ga0075434_100019636 | Ga0075434_1000196361 | 233 |
| 214 | 3300006871 | Ga0075434_100061611 | Ga0075434_1000616112 | 233 |
| 215 | 3300006871 | Ga0075434_100222122 | Ga0075434_1002221222 | 233 |
| 216 | 3300006881 | Ga0068865_100024142 | Ga0068865_1000241424 | 233 |
| 217 | 3300006881 | Ga0068865_100233311 | Ga0068865_1002333112 | 233 |
| 218 | 3300006914 | Ga0075436_100002475 | Ga0075436_1000024756 | 233 |
| 219 | 3300006914 | Ga0075436_100349312 | Ga0075436_1003493121 | 233 |
| 220 | 3300006914 | Ga0075436_100563748 | Ga0075436_1005637481 | 233 |
| 221 | 3300006942 | Ga0099824_1010358 | Ga0099824_101035814 | 233 |
| 222 | 3300006943 | Ga0099822_1011679 | Ga0099822_10116799 | 233 |
| 223 | 3300007076 | Ga0075435_100010249 | Ga0075435_10001024911 | 233 |
| 224 | 3300007076 | Ga0075435_100026643 | Ga0075435_1000266434 | 233 |
| 225 | 3300009093 | Ga0105240_10020965 | Ga0105240_100209655 | 233 |
| 226 | 3300009093 | Ga0105240_10073123 | Ga0105240_100731237 | 233 |
| 227 | 3300009093 | Ga0105240_10142513 | Ga0105240_101425133 | 233 |
| 228 | 3300009094 | Ga0111539_10268814 | Ga0111539_102688143 | 233 |
| 229 | 3300009094 | Ga0111539_10449443 | Ga0111539_104494432 | 233 |
| 230 | 3300009098 | Ga0105245_10313864 | Ga0105245_103138641 | 233 |
| 231 | 3300009147 | Ga0114129_10034081 | Ga0114129_100340815 | 233 |
| 232 | 3300009147 | Ga0114129_10830926 | Ga0114129_108309262 | 233 |
| 233 | 3300009148 | Ga0105243_10041053 | Ga0105243_100410532 | 233 |
| 234 | 3300009148 | Ga0105243_10059591 | Ga0105243_100595912 | 233 |
| 235 | 3300009176 | Ga0105242_10222766 | Ga0105242_102227662 | 233 |
| 236 | 3300009551 | Ga0105238_10018836 | Ga0105238_100188364 | 233 |
| 237 | 3300009551 | Ga0105238_10753349 | Ga0105238_107533491 | 233 |
| 238 | 3300009553 | Ga0105249_10553884 | Ga0105249_105538842 | 233 |
| 239 | 3300010375 | Ga0105239_10044406 | Ga0105239_100444066 | 233 |
| 240 | 3300010375 | Ga0105239_10326917 | Ga0105239_103269172 | 233 |
| 241 | 3300013104 | Ga0157370_10046562 | Ga0157370_100465622 | 233 |
| 242 | 3300013104 | Ga0157370_10078130 | Ga0157370_100781303 | 233 |
| 243 | 3300013104 | Ga0157370_10140031 | Ga0157370_101400312 | 233 |
| 244 | 3300013104 | Ga0157370_10234338 | Ga0157370_102343382 | 233 |
| 245 | 3300013105 | Ga0157369_10004728 | Ga0157369_100047289 | 233 |
| 246 | 3300013105 | Ga0157369_10120862 | Ga0157369_101208622 | 233 |
| 247 | 3300013105 | Ga0157369_10379362 | Ga0157369_103793622 | 233 |
| 248 | 3300013296 | Ga0157374_10346365 | Ga0157374_103463651 | 233 |
| 249 | 3300013296 | Ga0157374_10786039 | Ga0157374_107860392 | 233 |
| 250 | 3300013306 | Ga0163162_10203702 | Ga0163162_102037023 | 233 |
| 251 | 3300013306 | Ga0163162_10922907 | Ga0163162_109229072 | 233 |
| 252 | 3300013307 | Ga0157372_10051839 | Ga0157372_100518394 | 233 |
| 253 | 3300013308 | Ga0157375_10086244 | Ga0157375_100862443 | 233 |
| 254 | 3300013308 | Ga0157375_10114897 | Ga0157375_101148973 | 233 |
| 255 | 3300014326 | Ga0157380_10042097 | Ga0157380_100420973 | 233 |
| 256 | 3300014497 | Ga0182008_10030391 | Ga0182008_100303912 | 233 |
| 257 | 3300014745 | Ga0157377_10310937 | Ga0157377_103109371 | 233 |
| 258 | 3300014968 | Ga0157379_10090347 | Ga0157379_100903474 | 233 |
| 259 | 3300014969 | Ga0157376_10015043 | Ga0157376_100150432 | 233 |
| 260 | 3300020070 | Ga0206356_11376152 | Ga0206356_113761522 | 233 |
| 261 | 3300021361 | Ga0213872_10149366 | Ga0213872_101493661 | 233 |
| 262 | 3300021384 | Ga0213876_10283219 | Ga0213876_102832191 | 233 |
| 263 | 3300025261 | Ga0209233_1033592 | Ga0209233_10335922 | 233 |
| 264 | 3300025899 | Ga0207642_10019878 | Ga0207642_100198782 | 233 |
| 265 | 3300025899 | Ga0207642_10098722 | Ga0207642_100987222 | 233 |
| 266 | 3300025901 | Ga0207688_10440605 | Ga0207688_104406051 | 233 |
| 267 | 3300025904 | Ga0207647_10056006 | Ga0207647_100560062 | 233 |
| 268 | 3300025905 | Ga0207685_10107146 | Ga0207685_101071462 | 233 |
| 269 | 3300025906 | Ga0207699_10106069 | Ga0207699_101060692 | 233 |
| 270 | 3300025906 | Ga0207699_10229154 | Ga0207699_102291542 | 233 |
| 271 | 3300025906 | Ga0207699_10329356 | Ga0207699_103293562 | 233 |
| 272 | 3300025907 | Ga0207645_10050054 | Ga0207645_100500545 | 233 |
| 273 | 3300025908 | Ga0207643_10017955 | Ga0207643_100179554 | 233 |
| 274 | 3300025909 | Ga0207705_10068507 | Ga0207705_100685073 | 233 |
| 275 | 3300025910 | Ga0207684_10292596 | Ga0207684_102925961 | 233 |
| 276 | 3300025912 | Ga0207707_10000642 | Ga0207707_100006421 | 233 |
| 277 | 3300025912 | Ga0207707_10004649 | Ga0207707_1000464918 | 233 |
| 278 | 3300025912 | Ga0207707_10081957 | Ga0207707_100819571 | 233 |
| 279 | 3300025913 | Ga0207695_10044531 | Ga0207695_100445315 | 233 |
| 280 | 3300025913 | Ga0207695_10084962 | Ga0207695_100849622 | 233 |
| 281 | 3300025913 | Ga0207695_10137687 | Ga0207695_101376871 | 233 |
| 282 | 3300025914 | Ga0207671_10197672 | Ga0207671_101976722 | 233 |
| 283 | 3300025915 | Ga0207693_10005660 | Ga0207693_100056606 | 233 |
| 284 | 3300025917 | Ga0207660_10017922 | Ga0207660_100179222 | 233 |
| 285 | 3300025917 | Ga0207660_10123833 | Ga0207660_101238331 | 233 |
| 286 | 3300025917 | Ga0207660_10528114 | Ga0207660_105281141 | 233 |
| 287 | 3300025918 | Ga0207662_10041516 | Ga0207662_100415162 | 233 |
| 288 | 3300025921 | Ga0207652_10039233 | Ga0207652_100392333 | 233 |
| 289 | 3300025921 | Ga0207652_10041125 | Ga0207652_100411253 | 233 |
| 290 | 3300025921 | Ga0207652_10071231 | Ga0207652_100712312 | 233 |
| 291 | 3300025921 | Ga0207652_10120193 | Ga0207652_101201931 | 233 |
| 292 | 3300025922 | Ga0207646_10193767 | Ga0207646_101937672 | 233 |
| 293 | 3300025922 | Ga0207646_10523156 | Ga0207646_105231561 | 233 |
| 294 | 3300025923 | Ga0207681_10088701 | Ga0207681_100887014 | 233 |
| 295 | 3300025923 | Ga0207681_10097944 | Ga0207681_100979442 | 233 |
| 296 | 3300025924 | Ga0207694_10114780 | Ga0207694_101147802 | 233 |
| 297 | 3300025925 | Ga0207650_10000781 | Ga0207650_1000078118 | 233 |
| 298 | 3300025926 | Ga0207659_10000872 | Ga0207659_1000087211 | 233 |
| 299 | 3300025926 | Ga0207659_10021857 | Ga0207659_100218573 | 233 |
| 300 | 3300025928 | Ga0207700_10184972 | Ga0207700_101849722 | 233 |
| 301 | 3300025928 | Ga0207700_10356556 | Ga0207700_103565562 | 233 |
| 302 | 3300025929 | Ga0207664_10055279 | Ga0207664_100552792 | 233 |
| 303 | 3300025929 | Ga0207664_10297950 | Ga0207664_102979502 | 233 |
| 304 | 3300025931 | Ga0207644_10033114 | Ga0207644_100331144 | 233 |
| 305 | 3300025934 | Ga0207686_10074502 | Ga0207686_100745022 | 233 |
| 306 | 3300025934 | Ga0207686_10438260 | Ga0207686_104382602 | 233 |
| 307 | 3300025935 | Ga0207709_10297343 | Ga0207709_102973432 | 233 |
| 308 | 3300025935 | Ga0207709_10461556 | Ga0207709_104615561 | 233 |
| 309 | 3300025936 | Ga0207670_10054126 | Ga0207670_100541262 | 233 |
| 310 | 3300025937 | Ga0207669_10023880 | Ga0207669_100238802 | 233 |
| 311 | 3300025937 | Ga0207669_10191811 | Ga0207669_101918113 | 233 |
| 312 | 3300025938 | Ga0207704_10094407 | Ga0207704_100944072 | 233 |
| 313 | 3300025938 | Ga0207704_10146636 | Ga0207704_101466362 | 233 |
| 314 | 3300025939 | Ga0207665_10414078 | Ga0207665_104140782 | 233 |
| 315 | 3300025940 | Ga0207691_10279871 | Ga0207691_102798712 | 233 |
| 316 | 3300025944 | Ga0207661_10001102 | Ga0207661_1000110214 | 233 |
| 317 | 3300025944 | Ga0207661_10032238 | Ga0207661_100322382 | 233 |
| 318 | 3300025945 | Ga0207679_10092569 | Ga0207679_100925692 | 233 |
| 319 | 3300025949 | Ga0207667_10019069 | Ga0207667_100190695 | 233 |
| 320 | 3300025960 | Ga0207651_10006912 | Ga0207651_100069124 | 233 |
| 321 | 3300025960 | Ga0207651_10230312 | Ga0207651_102303121 | 233 |
| 322 | 3300025961 | Ga0207712_10439109 | Ga0207712_104391092 | 233 |
| 323 | 3300025972 | Ga0207668_10166277 | Ga0207668_101662772 | 233 |
| 324 | 3300025972 | Ga0207668_10948252 | Ga0207668_109482521 | 233 |
| 325 | 3300026035 | Ga0207703_10079632 | Ga0207703_100796323 | 233 |
| 326 | 3300026041 | Ga0207639_10140780 | Ga0207639_101407802 | 233 |
| 327 | 3300026041 | Ga0207639_11097192 | Ga0207639_110971921 | 233 |
| 328 | 3300026067 | Ga0207678_10726638 | Ga0207678_107266381 | 233 |
| 329 | 3300026075 | Ga0207708_10004708 | Ga0207708_100047088 | 233 |
| 330 | 3300026075 | Ga0207708_10472478 | Ga0207708_104724781 | 233 |
| 331 | 3300026078 | Ga0207702_10002900 | Ga0207702_100029009 | 233 |
| 332 | 3300026078 | Ga0207702_10111960 | Ga0207702_101119602 | 233 |
| 333 | 3300026078 | Ga0207702_10278850 | Ga0207702_102788502 | 233 |
| 334 | 3300026088 | Ga0207641_10820920 | Ga0207641_108209202 | 233 |
| 335 | 3300026089 | Ga0207648_10006984 | Ga0207648_1000698412 | 233 |
| 336 | 3300026089 | Ga0207648_10090889 | Ga0207648_100908892 | 233 |
| 337 | 3300026095 | Ga0207676_10010115 | Ga0207676_100101153 | 233 |
| 338 | 3300026116 | Ga0207674_10088227 | Ga0207674_100882273 | 233 |
| 339 | 3300026118 | Ga0207675_100001111 | Ga0207675_10000111112 | 233 |
| 340 | 3300026121 | Ga0207683_10145399 | Ga0207683_101453992 | 233 |
| 341 | 3300026121 | Ga0207683_10165211 | Ga0207683_101652112 | 233 |
| 342 | 3300026121 | Ga0207683_10285093 | Ga0207683_102850932 | 233 |
| 343 | 3300026121 | Ga0207683_10355926 | Ga0207683_103559262 | 233 |
| 344 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001456 | 233 |
| 345 | 3300027360 | Ga0209969_1013838 | Ga0209969_10138382 | 233 |
| 346 | 3300027361 | Ga0209489_100001 | Ga0209489_100001456 | 233 |
| 347 | 3300027363 | Ga0209700_100001 | Ga0209700_100001456 | 233 |
| 348 | 3300027378 | Ga0209981_1001056 | Ga0209981_10010562 | 233 |
| 349 | 3300027462 | Ga0210000_1007327 | Ga0210000_10073272 | 233 |
| 350 | 3300027471 | Ga0209995_1010700 | Ga0209995_10107002 | 233 |
| 351 | 3300027526 | Ga0209968_1016241 | Ga0209968_10162412 | 233 |
| 352 | 3300028379 | Ga0268266_10002798 | Ga0268266_1000279816 | 233 |
| 353 | 3300028379 | Ga0268266_10571950 | Ga0268266_105719501 | 233 |
| 354 | 3300028380 | Ga0268265_10472149 | Ga0268265_104721491 | 233 |
| 355 | 3300031247 | Ga0265340_10022948 | Ga0265340_100229482 | 233 |
| 356 | 3300031249 | Ga0265339_10004326 | Ga0265339_100043263 | 233 |
| 357 | 3300031548 | Ga0307408_100294440 | Ga0307408_1002944401 | 233 |
| 358 | 3300031711 | Ga0265314_10004147 | Ga0265314_100041472 | 233 |
| 359 | 3300033442 | Ga0315911_1000019 | Ga0315911_1000019126 | 233 |
| 360 | 3300035083 | Ga0373926_0031430 | Ga0373926_0031430_540_1241 | 233 |
| 361 | 3300035086 | Ga0373934_0121130 | Ga0373934_0121130_19_720 | 233 |
| 362 | 3300035111 | Ga0373923_0080737 | Ga0373923_0080737_282_983 | 233 |
| 363 | 3300035113 | Ga0373936_0009291 | Ga0373936_0009291_2141_2842 | 233 |
| 364 | 3300035113 | Ga0373936_0121413 | Ga0373936_0121413_243_944 | 233 |
| 365 | 3300035116 | Ga0373945_0156550 | Ga0373945_0156550_70_771 | 233 |
| 366 | 3300035118 | Ga0373954_0033145 | Ga0373954_0033145_1165_1866 | 233 |
| 367 | 3300035118 | Ga0373954_0085383 | Ga0373954_0085383_211_960 | 233 |
| 368 | 3300035119 | Ga0373956_0032222 | Ga0373956_0032222_747_1448 | 233 |
| 369 | 3300035119 | Ga0373956_0117284 | Ga0373956_0117284_146_847 | 233 |
| 370 | 3300035120 | Ga0373957_0021564 | Ga0373957_0021564_1483_2184 | 233 |
| 371 | 3300035170 | Ga0373943_0027831 | Ga0373943_0027831_1771_2472 | 233 |
| 372 | 3300035170 | Ga0373943_0176711 | Ga0373943_0176711_277_978 | 233 |
| 373 | 3300035171 | Ga0373946_0020107 | Ga0373946_0020107_632_1333 | 233 |
| 374 | 3300035172 | Ga0373955_0017692 | Ga0373955_0017692_173_919 | 233 |
| 375 | 3300035172 | Ga0373955_0037554 | Ga0373955_0037554_1191_1892 | 233 |
| 376 | 3300035172 | Ga0373955_0043529 | Ga0373955_0043529_579_1280 | 233 |
| 377 | 3300035410 | Ga0373924_0022137 | Ga0373924_0022137_1496_2197 | 233 |
| 378 | 3300035691 | Ga0373931_0208819 | Ga0373931_0208819_278_979 | 233 |
| 379 | 3300035692 | Ga0373935_0031978 | Ga0373935_0031978_1555_2256 | 233 |
| 380 | 3300035695 | Ga0373927_0051594 | Ga0373927_0051594_368_1114 | 233 |
| 381 | 3300035695 | Ga0373927_0215168 | Ga0373927_0215168_534_1235 | 233 |
| 382 | 3300035724 | Ga0373933_0000636 | Ga0373933_0000636_12648_13349 | 233 |
| 383 | 3300035724 | Ga0373933_0023287 | Ga0373933_0023287_2037_2738 | 233 |
| 384 | 3300035725 | Ga0373947_0086015 | Ga0373947_0086015_229_930 | 233 |
| 385 | 3300036401 | Ga0373937_0109026 | Ga0373937_0109026_1435_2136 | 233 |
| 386 | 3300036401 | Ga0373937_0709727 | Ga0373937_0709727_121_822 | 233 |
| 387 | 3300036459 | Ga0372808_005078 | Ga0372808_005078_443_1144 | 233 |
| 388 | 3300037068 | Ga0373925_0071610 | Ga0373925_0071610_1579_2280 | 233 |
| 389 | 3300037312 | Ga0395899_0332674 | Ga0395899_0332674_242_943 | 233 |
| 390 | 3300037418 | Ga0395900_0007634 | Ga0395900_0007634_980_1681 | 233 |
| 391 | 3300037466 | Ga0395898_0004948 | Ga0395898_0004948_8394_9095 | 233 |
| 392 | 3300037466 | Ga0395898_0038449 | Ga0395898_0038449_834_1535 | 233 |
| 393 | 3300037466 | Ga0395898_0222500 | Ga0395898_0222500_496_1197 | 233 |
| 394 | 3300037853 | Ga0436364_0726557 | Ga0436364_0726557_119_820 | 233 |
| 395 | 3300038443 | Ga0395901_0102296 | Ga0395901_0102296_451_1152 | 233 |
| 396 | 3300039437 | Ga0436365_0199779 | Ga0436365_0199779_896_1597 | 233 |
| 397 | 3300039437 | Ga0436365_0675434 | Ga0436365_0675434_2382_3083 | 233 |
| 398 | 3300039437 | Ga0436365_1234709 | Ga0436365_1234709_338_1039 | 233 |
| 399 | 3300039437 | Ga0436365_1327472 | Ga0436365_1327472_263_964 | 233 |
| 400 | 3300039438 | Ga0436360_1119639 | Ga0436360_1119639_93_794 | 233 |
| 401 | 3300039447 | Ga0436361_0808304 | Ga0436361_0808304_255_956 | 233 |
| 402 | 3300039450 | Ga0436363_0359787 | Ga0436363_0359787_795_1496 | 233 |
| 403 | 3300039450 | Ga0436363_1257565 | Ga0436363_1257565_2183_2884 | 233 |
| 404 | 3300042001 | Ga0439441_000158 | Ga0439441_000158_3487_4188 | 233 |
| 405 | 3300042436 | Ga0439435_0014803 | Ga0439435_0014803_831_1532 | 233 |
| 406 | 3300042437 | Ga0439444_0000818 | Ga0439444_0000818_743_1444 | 233 |
| 407 | 3300044693 | Ga0466961_0051159 | Ga0466961_0051159_616_1317 | 233 |
| 408 | 3300044694 | Ga0466963_0206608 | Ga0466963_0206608_103_804 | 233 |
| 409 | 3300044765 | Ga0466970_0069435 | Ga0466970_0069435_436_1137 | 233 |
| 410 | 3300045049 | Ga0466959_0036080 | Ga0466959_0036080_2811_3512 | 233 |
| 411 | 3300045051 | Ga0451576_0013568 | Ga0451576_0013568_956_1660 | 233 |
| 412 | 3300045976 | Ga0466967_0115925 | Ga0466967_0115925_1543_2244 | 233 |
| 413 | 3300046454 | Ga0495592_0053200 | Ga0495592_0053200_2286_2987 | 233 |
| 414 | 3300046454 | Ga0495592_0122000 | Ga0495592_0122000_62_763 | 233 |
| 415 | 3300046459 | Ga0495629_0103979 | Ga0495629_0103979_190_891 | 233 |
| 416 | 3300046460 | Ga0495638_0000330 | Ga0495638_0000330_54501_55202 | 233 |
| 417 | 3300046462 | Ga0495651_0115097 | Ga0495651_0115097_847_1548 | 233 |
| 418 | 3300046473 | Ga0495582_0035466 | Ga0495582_0035466_931_1632 | 233 |
| 419 | 3300046475 | Ga0495639_0106820 | Ga0495639_0106820_321_1022 | 233 |
| 420 | 3300046477 | Ga0495664_0007023 | Ga0495664_0007023_2189_2950 | 233 |
| 421 | 3300046477 | Ga0495664_0007261 | Ga0495664_0007261_2047_2748 | 233 |
| 422 | 3300046477 | Ga0495664_0009390 | Ga0495664_0009390_1385_2086 | 233 |
| 423 | 3300046511 | Ga0495608_0008754 | Ga0495608_0008754_1373_2074 | 233 |
| 424 | 3300046511 | Ga0495608_0049559 | Ga0495608_0049559_529_1230 | 233 |
| 425 | 3300046516 | Ga0495628_0103309 | Ga0495628_0103309_1102_1803 | 233 |
| 426 | 3300046517 | Ga0495630_0121394 | Ga0495630_0121394_747_1448 | 233 |
| 427 | 3300046517 | Ga0495630_0127898 | Ga0495630_0127898_1213_1914 | 233 |
| 428 | 3300046529 | Ga0495652_0249385 | Ga0495652_0249385_446_1147 | 233 |
| 429 | 3300046529 | Ga0495652_0284608 | Ga0495652_0284608_496_1197 | 233 |
| 430 | 3300046531 | Ga0495665_0216230 | Ga0495665_0216230_86_787 | 233 |
| 431 | 3300046533 | Ga0495640_0016968 | Ga0495640_0016968_968_1669 | 233 |
| 432 | 3300046533 | Ga0495640_0099384 | Ga0495640_0099384_1155_1856 | 233 |
| 433 | 3300046535 | Ga0495586_0049421 | Ga0495586_0049421_991_1692 | 233 |
| 434 | 3300046543 | Ga0495645_0000500 | Ga0495645_0000500_1370_2071 | 233 |
| 435 | 3300046543 | Ga0495645_0010769 | Ga0495645_0010769_1323_2084 | 233 |
| 436 | 3300046559 | Ga0495667_0042398 | Ga0495667_0042398_1979_2680 | 233 |
| 437 | 3300046559 | Ga0495667_0097203 | Ga0495667_0097203_1047_1748 | 233 |
| 438 | 3300046559 | Ga0495667_0167870 | Ga0495667_0167870_41_742 | 233 |
| 439 | 3300046663 | Ga0495635_0074400 | Ga0495635_0074400_648_1349 | 233 |
| 440 | 3300046675 | Ga0495657_0187779 | Ga0495657_0187779_453_1154 | 233 |
| 441 | 3300046678 | Ga0495599_0055545 | Ga0495599_0055545_499_1200 | 233 |
| 442 | 3300046679 | Ga0495623_0143549 | Ga0495623_0143549_565_1266 | 233 |
| 443 | 3300046680 | Ga0495646_0056973 | Ga0495646_0056973_770_1471 | 233 |
| 444 | 3300046681 | Ga0495647_0019335 | Ga0495647_0019335_178_879 | 233 |
| 445 | 3300046690 | Ga0495624_0026742 | Ga0495624_0026742_554_1255 | 233 |
| 446 | 3300047315 | Ga0495581_0134974 | Ga0495581_0134974_540_1241 | 233 |
| 447 | 3300047319 | Ga0495674_0069015 | Ga0495674_0069015_2217_2918 | 233 |
| 448 | 3300047319 | Ga0495674_0104836 | Ga0495674_0104836_115_816 | 233 |
| 449 | 3300047319 | Ga0495674_0260553 | Ga0495674_0260553_511_1212 | 233 |
| 450 | 3300047322 | Ga0495680_0024185 | Ga0495680_0024185_3392_4093 | 233 |
| 451 | 3300047322 | Ga0495680_0079794 | Ga0495680_0079794_1568_2269 | 233 |
| 452 | 3300047444 | Ga0495675_0044986 | Ga0495675_0044986_1363_2064 | 233 |
| 453 | 3300047471 | Ga0495684_0017127 | Ga0495684_0017127_1951_2652 | 233 |
| 454 | 3300047471 | Ga0495684_0033134 | Ga0495684_0033134_653_1354 | 233 |
| 455 | 3300047673 | Ga0495593_0159142 | Ga0495593_0159142_428_1129 | 233 |
| 456 | 3300048088 | Ga0495602_0000143 | Ga0495602_0000143_1366_2067 | 233 |
| 457 | 3300048904 | Ga0496101_0465438 | Ga0496101_0465438_146_847 | 233 |
| 458 | 3300048905 | Ga0496102_0507571 | Ga0496102_0507571_165_869 | 233 |
| 459 | 3300048911 | Ga0496108_0225623 | Ga0496108_0225623_102_806 | 233 |
| 460 | 3300048911 | Ga0496108_0365082 | Ga0496108_0365082_382_1089 | 233 |
| 461 | 3300048916 | Ga0496113_0037774 | Ga0496113_0037774_666_1370 | 233 |
| 462 | 3300048924 | Ga0496121_0135321 | Ga0496121_0135321_505_1230 | 233 |
| 463 | 3300048929 | Ga0496126_0110482 | Ga0496126_0110482_970_1671 | 233 |
| 464 | 3300048929 | Ga0496126_0222400 | Ga0496126_0222400_305_1006 | 233 |
| 465 | 3300049580 | Ga0501046_0129428 | Ga0501046_0129428_816_1517 | 233 |
| 466 | 3300049580 | Ga0501046_0272008 | Ga0501046_0272008_494_1195 | 233 |
| 467 | 3300049584 | Ga0501068_0023383 | Ga0501068_0023383_982_1719 | 233 |
| 468 | 3300049586 | Ga0501070_0052327 | Ga0501070_0052327_2292_2993 | 233 |
| 469 | 3300049589 | Ga0501073_0066937 | Ga0501073_0066937_25_726 | 233 |
| 470 | 3300049590 | Ga0501074_0045444 | Ga0501074_0045444_1603_2304 | 233 |
| 471 | 3300049593 | Ga0501077_0083034 | Ga0501077_0083034_173_883 | 233 |
| 472 | 3300049823 | Ga0501044_0110959 | Ga0501044_0110959_2038_2739 | 233 |
| 473 | 3300050493 | nmdc:mga0k408_309391_c1 | nmdc:mga0k408_309391_c1_65_766 | 233 |
| 474 | 3300050494 | nmdc:mga06z11_92811_c1 | nmdc:mga06z11_92811_c1_214_915 | 233 |
| 475 | 3300050507 | nmdc:mga05p37_188231_c1 | nmdc:mga05p37_188231_c1_121_936 | 233 |
| 476 | 3300050508 | nmdc:mga09592_26569_c1 | nmdc:mga09592_26569_c1_1052_1756 | 233 |
| 477 | 3300050508 | nmdc:mga09592_357095_c1 | nmdc:mga09592_357095_c1_476_1177 | 233 |
| 478 | 3300050509 | nmdc:mga0qj67_1103_c1 | nmdc:mga0qj67_1103_c1_7958_8659 | 233 |
| 479 | 3300050509 | nmdc:mga0qj67_129978_c1 | nmdc:mga0qj67_129978_c1_712_1422 | 233 |
| 480 | 3300050509 | nmdc:mga0qj67_220871_c1 | nmdc:mga0qj67_220871_c1_114_815 | 233 |
| 481 | 3300050509 | nmdc:mga0qj67_41864_c1 | nmdc:mga0qj67_41864_c1_1044_1748 | 233 |
| 482 | 3300050510 | nmdc:mga06r32_168813_c1 | nmdc:mga06r32_168813_c1_111_830 | 233 |
| 483 | 3300050510 | nmdc:mga06r32_199877_c1 | nmdc:mga06r32_199877_c1_239_943 | 233 |
| 484 | 3300050511 | nmdc:mga08y16_454175_c1 | nmdc:mga08y16_454175_c1_555_1259 | 233 |
| 485 | 3300050511 | nmdc:mga08y16_56786_c1 | nmdc:mga08y16_56786_c1_2567_3268 | 233 |
| 486 | 3300050512 | nmdc:mga0n895_16307_c1 | nmdc:mga0n895_16307_c1_5860_6561 | 233 |
| 487 | 3300050512 | nmdc:mga0n895_7693_c1 | nmdc:mga0n895_7693_c1_3289_3990 | 233 |
| 488 | 3300050513 | nmdc:mga0rr50_116094_c1 | nmdc:mga0rr50_116094_c1_1242_1943 | 233 |
| 489 | 3300050513 | nmdc:mga0rr50_7491_c1 | nmdc:mga0rr50_7491_c1_2853_3554 | 233 |
| 490 | 3300050514 | nmdc:mga08x19_1428_c1 | nmdc:mga08x19_1428_c1_9056_9757 | 233 |
| 491 | 3300050514 | nmdc:mga08x19_378288_c1 | nmdc:mga08x19_378288_c1_182_883 | 233 |
| 492 | 3300050515 | nmdc:mga0a205_1353_c1 | nmdc:mga0a205_1353_c1_940_1641 | 233 |
| 493 | 3300050516 | nmdc:mga0sz30_165760_c1 | nmdc:mga0sz30_165760_c1_208_915 | 233 |
| 494 | 3300050516 | nmdc:mga0sz30_4470_c1 | nmdc:mga0sz30_4470_c1_1435_2136 | 233 |
| 495 | 3300053077 | Ga0495601_0035902 | Ga0495601_0035902_1421_2122 | 233 |
| 496 | 3300053077 | Ga0495601_0084666 | Ga0495601_0084666_162_863 | 233 |
| 497 | 3300053078 | Ga0495612_0011345 | Ga0495612_0011345_298_999 | 233 |
| 498 | 3300053084 | Ga0495595_0103369 | Ga0495595_0103369_645_1346 | 233 |
| 499 | 3300053090 | Ga0500646_0132143 | Ga0500646_0132143_31_732 | 233 |
| 500 | 3300053130 | Ga0500642_0229206 | Ga0500642_0229206_101_802 | 233 |
| 501 | 3300053153 | Ga0500616_0002472 | Ga0500616_0002472_12139_12840 | 233 |
| 502 | 3300053730 | Ga0500645_033059 | Ga0500645_033059_625_1326 | 233 |
| 503 | 3300061719 | Ga0466962_0019244 | Ga0466962_0019244_1565_2266 | 233 |
| 504 | 2162886007 | SwRhRL2b_contig_1539896 | SwRhRL2b_0706.00001320 | 234 |
| 505 | 3300003911 | JGI25405J52794_10040079 | JGI25405J52794_100400792 | 234 |
| 506 | 3300005289 | Ga0065704_10070608 | Ga0065704_1007060817 | 234 |
| 507 | 3300005295 | Ga0065707_10090819 | Ga0065707_100908199 | 234 |
| 508 | 3300005328 | Ga0070676_10022931 | Ga0070676_100229314 | 234 |
| 509 | 3300005330 | Ga0070690_100250836 | Ga0070690_1002508362 | 234 |
| 510 | 3300005334 | Ga0068869_100055272 | Ga0068869_1000552722 | 234 |
| 511 | 3300005335 | Ga0070666_10178034 | Ga0070666_101780342 | 234 |
| 512 | 3300005336 | Ga0070680_100003662 | Ga0070680_10000366211 | 234 |
| 513 | 3300005339 | Ga0070660_100330502 | Ga0070660_1003305022 | 234 |
| 514 | 3300005340 | Ga0070689_100121898 | Ga0070689_1001218982 | 234 |
| 515 | 3300005341 | Ga0070691_10002207 | Ga0070691_100022077 | 234 |
| 516 | 3300005343 | Ga0070687_100397911 | Ga0070687_1003979111 | 234 |
| 517 | 3300005345 | Ga0070692_10033526 | Ga0070692_100335265 | 234 |
| 518 | 3300005347 | Ga0070668_100122403 | Ga0070668_1001224032 | 234 |
| 519 | 3300005354 | Ga0070675_100019794 | Ga0070675_1000197945 | 234 |
| 520 | 3300005355 | Ga0070671_100000809 | Ga0070671_1000008095 | 234 |
| 521 | 3300005364 | Ga0070673_100019506 | Ga0070673_1000195064 | 234 |
| 522 | 3300005364 | Ga0070673_100063682 | Ga0070673_1000636824 | 234 |
| 523 | 3300005366 | Ga0070659_100087438 | Ga0070659_1000874383 | 234 |
| 524 | 3300005406 | Ga0070703_10005122 | Ga0070703_100051225 | 234 |
| 525 | 3300005406 | Ga0070703_10181549 | Ga0070703_101815491 | 234 |
| 526 | 3300005434 | Ga0070709_10519459 | Ga0070709_105194591 | 234 |
| 527 | 3300005435 | Ga0070714_100058150 | Ga0070714_1000581502 | 234 |
| 528 | 3300005435 | Ga0070714_100103757 | Ga0070714_1001037572 | 234 |
| 529 | 3300005436 | Ga0070713_100121851 | Ga0070713_1001218512 | 234 |
| 530 | 3300005439 | Ga0070711_100128931 | Ga0070711_1001289312 | 234 |
| 531 | 3300005439 | Ga0070711_100746120 | Ga0070711_1007461201 | 234 |
| 532 | 3300005440 | Ga0070705_100000171 | Ga0070705_10000017113 | 234 |
| 533 | 3300005440 | Ga0070705_100017929 | Ga0070705_1000179293 | 234 |
| 534 | 3300005441 | Ga0070700_100000482 | Ga0070700_1000004829 | 234 |
| 535 | 3300005441 | Ga0070700_100029678 | Ga0070700_1000296783 | 234 |
| 536 | 3300005444 | Ga0070694_100000555 | Ga0070694_1000005556 | 234 |
| 537 | 3300005444 | Ga0070694_100167348 | Ga0070694_1001673482 | 234 |
| 538 | 3300005445 | Ga0070708_100197215 | Ga0070708_1001972152 | 234 |
| 539 | 3300005445 | Ga0070708_100197426 | Ga0070708_1001974262 | 234 |
| 540 | 3300005445 | Ga0070708_100246872 | Ga0070708_1002468723 | 234 |
| 541 | 3300005445 | Ga0070708_100337724 | Ga0070708_1003377242 | 234 |
| 542 | 3300005455 | Ga0070663_100085917 | Ga0070663_1000859173 | 234 |
| 543 | 3300005456 | Ga0070678_100026383 | Ga0070678_1000263833 | 234 |
| 544 | 3300005456 | Ga0070678_100175988 | Ga0070678_1001759882 | 234 |
| 545 | 3300005457 | Ga0070662_100806967 | Ga0070662_1008069671 | 234 |
| 546 | 3300005458 | Ga0070681_10018179 | Ga0070681_100181793 | 234 |
| 547 | 3300005467 | Ga0070706_100032937 | Ga0070706_1000329373 | 234 |
| 548 | 3300005467 | Ga0070706_100272557 | Ga0070706_1002725573 | 234 |
| 549 | 3300005468 | Ga0070707_100008295 | Ga0070707_1000082955 | 234 |
| 550 | 3300005468 | Ga0070707_100361524 | Ga0070707_1003615242 | 234 |
| 551 | 3300005471 | Ga0070698_100013437 | Ga0070698_1000134375 | 234 |
| 552 | 3300005471 | Ga0070698_100247533 | Ga0070698_1002475333 | 234 |
| 553 | 3300005471 | Ga0070698_100320946 | Ga0070698_1003209461 | 234 |
| 554 | 3300005518 | Ga0070699_100000167 | Ga0070699_10000016725 | 234 |
| 555 | 3300005518 | Ga0070699_100004951 | Ga0070699_1000049514 | 234 |
| 556 | 3300005518 | Ga0070699_100061845 | Ga0070699_1000618452 | 234 |
| 557 | 3300005530 | Ga0070679_100122535 | Ga0070679_1001225352 | 234 |
| 558 | 3300005536 | Ga0070697_100808672 | Ga0070697_1008086721 | 234 |
| 559 | 3300005539 | Ga0068853_100653878 | Ga0068853_1006538781 | 234 |
| 560 | 3300005543 | Ga0070672_100885923 | Ga0070672_1008859231 | 234 |
| 561 | 3300005544 | Ga0070686_100298485 | Ga0070686_1002984852 | 234 |
| 562 | 3300005545 | Ga0070695_100003493 | Ga0070695_1000034932 | 234 |
| 563 | 3300005546 | Ga0070696_100000097 | Ga0070696_1000000972 | 234 |
| 564 | 3300005546 | Ga0070696_100217350 | Ga0070696_1002173502 | 234 |
| 565 | 3300005548 | Ga0070665_100024997 | Ga0070665_1000249974 | 234 |
| 566 | 3300005548 | Ga0070665_100117938 | Ga0070665_1001179384 | 234 |
| 567 | 3300005549 | Ga0070704_100000416 | Ga0070704_10000041611 | 234 |
| 568 | 3300005549 | Ga0070704_100000566 | Ga0070704_10000056614 | 234 |
| 569 | 3300005549 | Ga0070704_100703976 | Ga0070704_1007039761 | 234 |
| 570 | 3300005564 | Ga0070664_100125491 | Ga0070664_1001254912 | 234 |
| 571 | 3300005577 | Ga0068857_100260672 | Ga0068857_1002606722 | 234 |
| 572 | 3300005614 | Ga0068856_100120313 | Ga0068856_1001203132 | 234 |
| 573 | 3300005617 | Ga0068859_100001658 | Ga0068859_10000165825 | 234 |
| 574 | 3300005617 | Ga0068859_100009816 | Ga0068859_1000098165 | 234 |
| 575 | 3300005617 | Ga0068859_100224369 | Ga0068859_1002243692 | 234 |
| 576 | 3300005618 | Ga0068864_100029916 | Ga0068864_1000299167 | 234 |
| 577 | 3300005618 | Ga0068864_100431749 | Ga0068864_1004317492 | 234 |
| 578 | 3300005718 | Ga0068866_10100296 | Ga0068866_101002962 | 234 |
| 579 | 3300005719 | Ga0068861_100095924 | Ga0068861_1000959243 | 234 |
| 580 | 3300005719 | Ga0068861_100208750 | Ga0068861_1002087502 | 234 |
| 581 | 3300005719 | Ga0068861_100237834 | Ga0068861_1002378341 | 234 |
| 582 | 3300005840 | Ga0068870_10071943 | Ga0068870_100719432 | 234 |
| 583 | 3300005840 | Ga0068870_10168790 | Ga0068870_101687902 | 234 |
| 584 | 3300005842 | Ga0068858_100061152 | Ga0068858_1000611526 | 234 |
| 585 | 3300005842 | Ga0068858_100970565 | Ga0068858_1009705651 | 234 |
| 586 | 3300005843 | Ga0068860_100001592 | Ga0068860_10000159222 | 234 |
| 587 | 3300005843 | Ga0068860_100340409 | Ga0068860_1003404092 | 234 |
| 588 | 3300005844 | Ga0068862_100001428 | Ga0068862_10000142823 | 234 |
| 589 | 3300005844 | Ga0068862_100333843 | Ga0068862_1003338431 | 234 |
| 590 | 3300005937 | Ga0081455_10000657 | Ga0081455_1000065712 | 234 |
| 591 | 3300005937 | Ga0081455_10000864 | Ga0081455_1000086417 | 234 |
| 592 | 3300005937 | Ga0081455_10001642 | Ga0081455_100016422 | 234 |
| 593 | 3300005937 | Ga0081455_10002534 | Ga0081455_1000253412 | 234 |
| 594 | 3300005937 | Ga0081455_10003988 | Ga0081455_100039888 | 234 |
| 595 | 3300005937 | Ga0081455_10006090 | Ga0081455_1000609011 | 234 |
| 596 | 3300005937 | Ga0081455_10032675 | Ga0081455_100326752 | 234 |
| 597 | 3300005937 | Ga0081455_10035407 | Ga0081455_100354071 | 234 |
| 598 | 3300005937 | Ga0081455_10068231 | Ga0081455_100682313 | 234 |
| 599 | 3300005981 | Ga0081538_10017699 | Ga0081538_100176991 | 234 |
| 600 | 3300005981 | Ga0081538_10040992 | Ga0081538_100409922 | 234 |
| 601 | 3300005981 | Ga0081538_10109354 | Ga0081538_101093541 | 234 |
| 602 | 3300005983 | Ga0081540_1000360 | Ga0081540_10003603 | 234 |
| 603 | 3300005983 | Ga0081540_1001779 | Ga0081540_100177921 | 234 |
| 604 | 3300005983 | Ga0081540_1011456 | Ga0081540_10114563 | 234 |
| 605 | 3300005983 | Ga0081540_1023457 | Ga0081540_10234574 | 234 |
| 606 | 3300005983 | Ga0081540_1072553 | Ga0081540_10725532 | 234 |
| 607 | 3300005985 | Ga0081539_10009313 | Ga0081539_100093138 | 234 |
| 608 | 3300005985 | Ga0081539_10014029 | Ga0081539_100140299 | 234 |
| 609 | 3300005985 | Ga0081539_10055442 | Ga0081539_100554422 | 234 |
| 610 | 3300006028 | Ga0070717_10022371 | Ga0070717_100223712 | 234 |
| 611 | 3300006028 | Ga0070717_10396837 | Ga0070717_103968372 | 234 |
| 612 | 3300006038 | Ga0075365_10019392 | Ga0075365_100193923 | 234 |
| 613 | 3300006038 | Ga0075365_10032160 | Ga0075365_100321603 | 234 |
| 614 | 3300006042 | Ga0075368_10028054 | Ga0075368_100280543 | 234 |
| 615 | 3300006051 | Ga0075364_10001339 | Ga0075364_100013399 | 234 |
| 616 | 3300006163 | Ga0070715_10049600 | Ga0070715_100496002 | 234 |
| 617 | 3300006163 | Ga0070715_10144294 | Ga0070715_101442942 | 234 |
| 618 | 3300006175 | Ga0070712_100011352 | Ga0070712_1000113525 | 234 |
| 619 | 3300006175 | Ga0070712_100114181 | Ga0070712_1001141812 | 234 |
| 620 | 3300006175 | Ga0070712_100354892 | Ga0070712_1003548922 | 234 |
| 621 | 3300006178 | Ga0075367_10000626 | Ga0075367_100006263 | 234 |
| 622 | 3300006178 | Ga0075367_10009405 | Ga0075367_100094052 | 234 |
| 623 | 3300006178 | Ga0075367_10110687 | Ga0075367_101106872 | 234 |
| 624 | 3300006178 | Ga0075367_10152045 | Ga0075367_101520452 | 234 |
| 625 | 3300006186 | Ga0075369_10000923 | Ga0075369_100009239 | 234 |
| 626 | 3300006186 | Ga0075369_10099908 | Ga0075369_100999081 | 234 |
| 627 | 3300006195 | Ga0075366_10065072 | Ga0075366_100650722 | 234 |
| 628 | 3300006237 | Ga0097621_100010240 | Ga0097621_10001024010 | 234 |
| 629 | 3300006353 | Ga0075370_10180418 | Ga0075370_101804182 | 234 |
| 630 | 3300006358 | Ga0068871_100092459 | Ga0068871_1000924594 | 234 |
| 631 | 3300006358 | Ga0068871_100294682 | Ga0068871_1002946821 | 234 |
| 632 | 3300006844 | Ga0075428_100001353 | Ga0075428_10000135317 | 234 |
| 633 | 3300006844 | Ga0075428_100019486 | Ga0075428_1000194866 | 234 |
| 634 | 3300006844 | Ga0075428_100073118 | Ga0075428_1000731182 | 234 |
| 635 | 3300006844 | Ga0075428_100111168 | Ga0075428_1001111684 | 234 |
| 636 | 3300006844 | Ga0075428_100169541 | Ga0075428_1001695412 | 234 |
| 637 | 3300006844 | Ga0075428_100424097 | Ga0075428_1004240972 | 234 |
| 638 | 3300006844 | Ga0075428_100531161 | Ga0075428_1005311612 | 234 |
| 639 | 3300006846 | Ga0075430_100080769 | Ga0075430_1000807693 | 234 |
| 640 | 3300006847 | Ga0075431_100000652 | Ga0075431_10000065225 | 234 |
| 641 | 3300006847 | Ga0075431_100000965 | Ga0075431_10000096520 | 234 |
| 642 | 3300006847 | Ga0075431_100008835 | Ga0075431_1000088353 | 234 |
| 643 | 3300006847 | Ga0075431_100018795 | Ga0075431_1000187954 | 234 |
| 644 | 3300006847 | Ga0075431_100037919 | Ga0075431_1000379198 | 234 |
| 645 | 3300006847 | Ga0075431_100051615 | Ga0075431_1000516156 | 234 |
| 646 | 3300006847 | Ga0075431_100086041 | Ga0075431_1000860415 | 234 |
| 647 | 3300006847 | Ga0075431_100311745 | Ga0075431_1003117453 | 234 |
| 648 | 3300006847 | Ga0075431_100420649 | Ga0075431_1004206492 | 234 |
| 649 | 3300006852 | Ga0075433_10009983 | Ga0075433_100099832 | 234 |
| 650 | 3300006852 | Ga0075433_10286572 | Ga0075433_102865722 | 234 |
| 651 | 3300006852 | Ga0075433_10409594 | Ga0075433_104095942 | 234 |
| 652 | 3300006852 | Ga0075433_10410290 | Ga0075433_104102902 | 234 |
| 653 | 3300006871 | Ga0075434_100016479 | Ga0075434_1000164796 | 234 |
| 654 | 3300006871 | Ga0075434_100091824 | Ga0075434_1000918243 | 234 |
| 655 | 3300006871 | Ga0075434_100142304 | Ga0075434_1001423042 | 234 |
| 656 | 3300006871 | Ga0075434_100201804 | Ga0075434_1002018042 | 234 |
| 657 | 3300006880 | Ga0075429_100000008 | Ga0075429_10000000882 | 234 |
| 658 | 3300006880 | Ga0075429_100016293 | Ga0075429_1000162937 | 234 |
| 659 | 3300006880 | Ga0075429_100083463 | Ga0075429_1000834631 | 234 |
| 660 | 3300006880 | Ga0075429_100171143 | Ga0075429_1001711432 | 234 |
| 661 | 3300006914 | Ga0075436_100414629 | Ga0075436_1004146291 | 234 |
| 662 | 3300006931 | Ga0097620_100001658 | Ga0097620_10000165825 | 234 |
| 663 | 3300006931 | Ga0097620_100009816 | Ga0097620_10000981613 | 234 |
| 664 | 3300006931 | Ga0097620_100027068 | Ga0097620_1000270686 | 234 |
| 665 | 3300006931 | Ga0097620_100076460 | Ga0097620_1000764603 | 234 |
| 666 | 3300006931 | Ga0097620_100224378 | Ga0097620_1002243782 | 234 |
| 667 | 3300006942 | Ga0099824_1017393 | Ga0099824_10173934 | 234 |
| 668 | 3300006944 | Ga0099823_1000008 | Ga0099823_100000843 | 234 |
| 669 | 3300007076 | Ga0075435_100003479 | Ga0075435_10000347912 | 234 |
| 670 | 3300007076 | Ga0075435_100156033 | Ga0075435_1001560332 | 234 |
| 671 | 3300007076 | Ga0075435_100612103 | Ga0075435_1006121031 | 234 |
| 672 | 3300007265 | Ga0099794_10021736 | Ga0099794_100217363 | 234 |
| 673 | 3300007265 | Ga0099794_10046570 | Ga0099794_100465702 | 234 |
| 674 | 3300007788 | Ga0099795_10096442 | Ga0099795_100964422 | 234 |
| 675 | 3300007788 | Ga0099795_10098942 | Ga0099795_100989421 | 234 |
| 676 | 3300009094 | Ga0111539_10002318 | Ga0111539_100023188 | 234 |
| 677 | 3300009094 | Ga0111539_10006931 | Ga0111539_100069317 | 234 |
| 678 | 3300009094 | Ga0111539_10014205 | Ga0111539_100142058 | 234 |
| 679 | 3300009094 | Ga0111539_10041808 | Ga0111539_100418084 | 234 |
| 680 | 3300009094 | Ga0111539_10043015 | Ga0111539_100430154 | 234 |
| 681 | 3300009094 | Ga0111539_10166565 | Ga0111539_101665652 | 234 |
| 682 | 3300009094 | Ga0111539_10217931 | Ga0111539_102179312 | 234 |
| 683 | 3300009094 | Ga0111539_10288311 | Ga0111539_102883112 | 234 |
| 684 | 3300009094 | Ga0111539_10372893 | Ga0111539_103728932 | 234 |
| 685 | 3300009098 | Ga0105245_10042501 | Ga0105245_100425017 | 234 |
| 686 | 3300009098 | Ga0105245_10113869 | Ga0105245_101138692 | 234 |
| 687 | 3300009101 | Ga0105247_10055307 | Ga0105247_100553074 | 234 |
| 688 | 3300009147 | Ga0114129_10000124 | Ga0114129_1000012452 | 234 |
| 689 | 3300009147 | Ga0114129_10001247 | Ga0114129_1000124736 | 234 |
| 690 | 3300009147 | Ga0114129_10036668 | Ga0114129_100366689 | 234 |
| 691 | 3300009147 | Ga0114129_10067868 | Ga0114129_100678682 | 234 |
| 692 | 3300009147 | Ga0114129_10164798 | Ga0114129_101647983 | 234 |
| 693 | 3300009147 | Ga0114129_10196755 | Ga0114129_101967553 | 234 |
| 694 | 3300009147 | Ga0114129_10204492 | Ga0114129_102044922 | 234 |
| 695 | 3300009147 | Ga0114129_10352186 | Ga0114129_103521862 | 234 |
| 696 | 3300009147 | Ga0114129_10464370 | Ga0114129_104643702 | 234 |
| 697 | 3300009147 | Ga0114129_10473705 | Ga0114129_104737052 | 234 |
| 698 | 3300009147 | Ga0114129_10530682 | Ga0114129_105306822 | 234 |
| 699 | 3300009147 | Ga0114129_10659418 | Ga0114129_106594182 | 234 |
| 700 | 3300009147 | Ga0114129_10827687 | Ga0114129_108276872 | 234 |
| 701 | 3300009147 | Ga0114129_10947226 | Ga0114129_109472262 | 234 |
| 702 | 3300009148 | Ga0105243_10128192 | Ga0105243_101281922 | 234 |
| 703 | 3300009148 | Ga0105243_10548847 | Ga0105243_105488472 | 234 |
| 704 | 3300009177 | Ga0105248_10045144 | Ga0105248_100451445 | 234 |
| 705 | 3300009545 | Ga0105237_10079588 | Ga0105237_100795882 | 234 |
| 706 | 3300009551 | Ga0105238_10547729 | Ga0105238_105477292 | 234 |
| 707 | 3300009551 | Ga0105238_10977371 | Ga0105238_109773712 | 234 |
| 708 | 3300009553 | Ga0105249_10340101 | Ga0105249_103401011 | 234 |
| 709 | 3300009553 | Ga0105249_11103158 | Ga0105249_111031581 | 234 |
| 710 | 3300010159 | Ga0099796_10048408 | Ga0099796_100484082 | 234 |
| 711 | 3300010375 | Ga0105239_10137147 | Ga0105239_101371474 | 234 |
| 712 | 3300010375 | Ga0105239_10839514 | Ga0105239_108395142 | 234 |
| 713 | 3300011119 | Ga0105246_10004309 | Ga0105246_100043097 | 234 |
| 714 | 3300011119 | Ga0105246_10266578 | Ga0105246_102665782 | 234 |
| 715 | 3300011119 | Ga0105246_10412621 | Ga0105246_104126212 | 234 |
| 716 | 3300013105 | Ga0157369_10080978 | Ga0157369_100809783 | 234 |
| 717 | 3300013296 | Ga0157374_10065852 | Ga0157374_100658525 | 234 |
| 718 | 3300013297 | Ga0157378_10104740 | Ga0157378_101047402 | 234 |
| 719 | 3300013306 | Ga0163162_10088047 | Ga0163162_100880474 | 234 |
| 720 | 3300013306 | Ga0163162_10324032 | Ga0163162_103240322 | 234 |
| 721 | 3300013306 | Ga0163162_10422832 | Ga0163162_104228322 | 234 |
| 722 | 3300013307 | Ga0157372_10216690 | Ga0157372_102166902 | 234 |
| 723 | 3300013307 | Ga0157372_10466617 | Ga0157372_104666171 | 234 |
| 724 | 3300013308 | Ga0157375_10047284 | Ga0157375_100472845 | 234 |
| 725 | 3300013308 | Ga0157375_10067217 | Ga0157375_100672172 | 234 |
| 726 | 3300014325 | Ga0163163_10004951 | Ga0163163_100049514 | 234 |
| 727 | 3300014325 | Ga0163163_10187646 | Ga0163163_101876462 | 234 |
| 728 | 3300014325 | Ga0163163_10432039 | Ga0163163_104320392 | 234 |
| 729 | 3300014326 | Ga0157380_10047458 | Ga0157380_100474582 | 234 |
| 730 | 3300014326 | Ga0157380_10585550 | Ga0157380_105855501 | 234 |
| 731 | 3300014326 | Ga0157380_10637380 | Ga0157380_106373801 | 234 |
| 732 | 3300014968 | Ga0157379_10084851 | Ga0157379_100848512 | 234 |
| 733 | 3300014968 | Ga0157379_10405397 | Ga0157379_104053972 | 234 |
| 734 | 3300014969 | Ga0157376_10177271 | Ga0157376_101772712 | 234 |
| 735 | 3300014969 | Ga0157376_10197518 | Ga0157376_101975182 | 234 |
| 736 | 3300017792 | Ga0163161_10097821 | Ga0163161_100978212 | 234 |
| 737 | 3300017792 | Ga0163161_10201383 | Ga0163161_102013832 | 234 |
| 738 | 3300017792 | Ga0163161_10453852 | Ga0163161_104538521 | 234 |
| 739 | 3300021361 | Ga0213872_10074428 | Ga0213872_100744282 | 234 |
| 740 | 3300024227 | Ga0228598_1003914 | Ga0228598_10039142 | 234 |
| 741 | 3300025885 | Ga0207653_10000520 | Ga0207653_100005204 | 234 |
| 742 | 3300025898 | Ga0207692_10184043 | Ga0207692_101840432 | 234 |
| 743 | 3300025903 | Ga0207680_10191384 | Ga0207680_101913842 | 234 |
| 744 | 3300025904 | Ga0207647_10004760 | Ga0207647_100047602 | 234 |
| 745 | 3300025905 | Ga0207685_10185814 | Ga0207685_101858141 | 234 |
| 746 | 3300025908 | Ga0207643_10170107 | Ga0207643_101701072 | 234 |
| 747 | 3300025908 | Ga0207643_10453525 | Ga0207643_104535251 | 234 |
| 748 | 3300025910 | Ga0207684_10132915 | Ga0207684_101329152 | 234 |
| 749 | 3300025910 | Ga0207684_10858669 | Ga0207684_108586691 | 234 |
| 750 | 3300025912 | Ga0207707_10023202 | Ga0207707_100232026 | 234 |
| 751 | 3300025915 | Ga0207693_10126573 | Ga0207693_101265732 | 234 |
| 752 | 3300025916 | Ga0207663_10048765 | Ga0207663_100487651 | 234 |
| 753 | 3300025916 | Ga0207663_10135262 | Ga0207663_101352621 | 234 |
| 754 | 3300025917 | Ga0207660_10009091 | Ga0207660_100090917 | 234 |
| 755 | 3300025917 | Ga0207660_10452900 | Ga0207660_104529001 | 234 |
| 756 | 3300025924 | Ga0207694_10503869 | Ga0207694_105038692 | 234 |
| 757 | 3300025925 | Ga0207650_10016748 | Ga0207650_100167485 | 234 |
| 758 | 3300025926 | Ga0207659_10038471 | Ga0207659_100384712 | 234 |
| 759 | 3300025927 | Ga0207687_10050784 | Ga0207687_100507842 | 234 |
| 760 | 3300025927 | Ga0207687_10170491 | Ga0207687_101704912 | 234 |
| 761 | 3300025928 | Ga0207700_10041534 | Ga0207700_100415342 | 234 |
| 762 | 3300025928 | Ga0207700_10136178 | Ga0207700_101361782 | 234 |
| 763 | 3300025928 | Ga0207700_10196080 | Ga0207700_101960802 | 234 |
| 764 | 3300025929 | Ga0207664_10173174 | Ga0207664_101731742 | 234 |
| 765 | 3300025929 | Ga0207664_10191078 | Ga0207664_101910782 | 234 |
| 766 | 3300025931 | Ga0207644_10000454 | Ga0207644_100004545 | 234 |
| 767 | 3300025932 | Ga0207690_10066046 | Ga0207690_100660463 | 234 |
| 768 | 3300025935 | Ga0207709_10790345 | Ga0207709_107903451 | 234 |
| 769 | 3300025936 | Ga0207670_10248731 | Ga0207670_102487312 | 234 |
| 770 | 3300025936 | Ga0207670_10405641 | Ga0207670_104056411 | 234 |
| 771 | 3300025937 | Ga0207669_10400518 | Ga0207669_104005182 | 234 |
| 772 | 3300025939 | Ga0207665_10048803 | Ga0207665_100488034 | 234 |
| 773 | 3300025940 | Ga0207691_10085352 | Ga0207691_100853522 | 234 |
| 774 | 3300025940 | Ga0207691_10241860 | Ga0207691_102418601 | 234 |
| 775 | 3300025940 | Ga0207691_10596947 | Ga0207691_105969472 | 234 |
| 776 | 3300025942 | Ga0207689_10142030 | Ga0207689_101420303 | 234 |
| 777 | 3300025960 | Ga0207651_10164488 | Ga0207651_101644882 | 234 |
| 778 | 3300025961 | Ga0207712_10121303 | Ga0207712_101213031 | 234 |
| 779 | 3300025961 | Ga0207712_10245975 | Ga0207712_102459752 | 234 |
| 780 | 3300025986 | Ga0207658_10345281 | Ga0207658_103452812 | 234 |
| 781 | 3300026023 | Ga0207677_10089296 | Ga0207677_100892963 | 234 |
| 782 | 3300026035 | Ga0207703_10031065 | Ga0207703_100310654 | 234 |
| 783 | 3300026035 | Ga0207703_10520719 | Ga0207703_105207192 | 234 |
| 784 | 3300026041 | Ga0207639_10130448 | Ga0207639_101304482 | 234 |
| 785 | 3300026067 | Ga0207678_10166491 | Ga0207678_101664912 | 234 |
| 786 | 3300026067 | Ga0207678_10177096 | Ga0207678_101770961 | 234 |
| 787 | 3300026067 | Ga0207678_10236393 | Ga0207678_102363932 | 234 |
| 788 | 3300026075 | Ga0207708_10000296 | Ga0207708_1000029620 | 234 |
| 789 | 3300026075 | Ga0207708_10051929 | Ga0207708_100519293 | 234 |
| 790 | 3300026089 | Ga0207648_10024842 | Ga0207648_100248427 | 234 |
| 791 | 3300026095 | Ga0207676_10074308 | Ga0207676_100743085 | 234 |
| 792 | 3300026116 | Ga0207674_10012981 | Ga0207674_100129812 | 234 |
| 793 | 3300026116 | Ga0207674_10059853 | Ga0207674_100598535 | 234 |
| 794 | 3300026118 | Ga0207675_100036432 | Ga0207675_1000364323 | 234 |
| 795 | 3300026118 | Ga0207675_100125857 | Ga0207675_1001258572 | 234 |
| 796 | 3300026118 | Ga0207675_100168994 | Ga0207675_1001689943 | 234 |
| 797 | 3300026118 | Ga0207675_100269764 | Ga0207675_1002697642 | 234 |
| 798 | 3300026121 | Ga0207683_10024977 | Ga0207683_100249774 | 234 |
| 799 | 3300026142 | Ga0207698_10024188 | Ga0207698_100241882 | 234 |
| 800 | 3300027296 | Ga0209389_1000032 | Ga0209389_100003272 | 234 |
| 801 | 3300027361 | Ga0209489_100035 | Ga0209489_100035107 | 234 |
| 802 | 3300027363 | Ga0209700_100005 | Ga0209700_100005110 | 234 |
| 803 | 3300027512 | Ga0209179_1035288 | Ga0209179_10352881 | 234 |
| 804 | 3300027671 | Ga0209588_1029541 | Ga0209588_10295412 | 234 |
| 805 | 3300027671 | Ga0209588_1090079 | Ga0209588_10900791 | 234 |
| 806 | 3300027866 | Ga0209813_10088148 | Ga0209813_100881482 | 234 |
| 807 | 3300027907 | Ga0207428_10007031 | Ga0207428_100070312 | 234 |
| 808 | 3300027907 | Ga0207428_10111590 | Ga0207428_101115902 | 234 |
| 809 | 3300027907 | Ga0207428_10195341 | Ga0207428_101953412 | 234 |
| 810 | 3300027907 | Ga0207428_10243728 | Ga0207428_102437282 | 234 |
| 811 | 3300028379 | Ga0268266_10015117 | Ga0268266_100151171 | 234 |
| 812 | 3300028380 | Ga0268265_10000508 | Ga0268265_1000050813 | 234 |
| 813 | 3300028380 | Ga0268265_10602334 | Ga0268265_106023342 | 234 |
| 814 | 3300028381 | Ga0268264_10003796 | Ga0268264_1000379612 | 234 |
| 815 | 3300031548 | Ga0307408_100050721 | Ga0307408_1000507214 | 234 |
| 816 | 3300031665 | Ga0316575_10031691 | Ga0316575_100316912 | 234 |
| 817 | 3300031727 | Ga0316576_10008667 | Ga0316576_100086675 | 234 |
| 818 | 3300031728 | Ga0316578_10035225 | Ga0316578_100352253 | 234 |
| 819 | 3300031901 | Ga0307406_10289268 | Ga0307406_102892682 | 234 |
| 820 | 3300032002 | Ga0307416_100528761 | Ga0307416_1005287612 | 234 |
| 821 | 3300035086 | Ga0373934_0000091 | Ga0373934_0000091_22933_23640 | 234 |
| 822 | 3300035088 | Ga0373940_0010148 | Ga0373940_0010148_1245_1952 | 234 |
| 823 | 3300035112 | Ga0373932_0083488 | Ga0373932_0083488_191_913 | 234 |
| 824 | 3300035114 | Ga0373939_0004820 | Ga0373939_0004820_762_1469 | 234 |
| 825 | 3300035115 | Ga0373941_0032874 | Ga0373941_0032874_46_768 | 234 |
| 826 | 3300035118 | Ga0373954_0119384 | Ga0373954_0119384_69_776 | 234 |
| 827 | 3300035119 | Ga0373956_0001188 | Ga0373956_0001188_8655_9362 | 234 |
| 828 | 3300035119 | Ga0373956_0035371 | Ga0373956_0035371_297_1007 | 234 |
| 829 | 3300035121 | Ga0373960_0004649 | Ga0373960_0004649_1394_2101 | 234 |
| 830 | 3300035172 | Ga0373955_0004048 | Ga0373955_0004048_562_1269 | 234 |
| 831 | 3300035241 | Ga0373961_0002460 | Ga0373961_0002460_1231_1938 | 234 |
| 832 | 3300035242 | Ga0373962_0016193 | Ga0373962_0016193_965_1672 | 234 |
| 833 | 3300035691 | Ga0373931_0003385 | Ga0373931_0003385_3337_4044 | 234 |
| 834 | 3300035691 | Ga0373931_0005812 | Ga0373931_0005812_766_1473 | 234 |
| 835 | 3300035692 | Ga0373935_0046269 | Ga0373935_0046269_559_1335 | 234 |
| 836 | 3300035695 | Ga0373927_0106749 | Ga0373927_0106749_802_1578 | 234 |
| 837 | 3300035695 | Ga0373927_0234151 | Ga0373927_0234151_315_1025 | 234 |
| 838 | 3300035724 | Ga0373933_0001319 | Ga0373933_0001319_1608_2315 | 234 |
| 839 | 3300035724 | Ga0373933_0384408 | Ga0373933_0384408_161_865 | 234 |
| 840 | 3300035725 | Ga0373947_0299973 | Ga0373947_0299973_170_946 | 234 |
| 841 | 3300036401 | Ga0373937_0000929 | Ga0373937_0000929_15436_16140 | 234 |
| 842 | 3300036401 | Ga0373937_0001593 | Ga0373937_0001593_2725_3432 | 234 |
| 843 | 3300036401 | Ga0373937_0017678 | Ga0373937_0017678_1035_1742 | 234 |
| 844 | 3300036401 | Ga0373937_0064468 | Ga0373937_0064468_1803_2513 | 234 |
| 845 | 3300036401 | Ga0373937_0488068 | Ga0373937_0488068_303_1010 | 234 |
| 846 | 3300036712 | Ga0316584_0010427 | Ga0316584_0010427_1107_1817 | 234 |
| 847 | 3300037068 | Ga0373925_0029640 | Ga0373925_0029640_3043_3747 | 234 |
| 848 | 3300037068 | Ga0373925_0226273 | Ga0373925_0226273_698_1474 | 234 |
| 849 | 3300037068 | Ga0373925_0341543 | Ga0373925_0341543_40_747 | 234 |
| 850 | 3300037068 | Ga0373925_0354464 | Ga0373925_0354464_337_1044 | 234 |
| 851 | 3300037418 | Ga0395900_0323083 | Ga0395900_0323083_326_1030 | 234 |
| 852 | 3300037466 | Ga0395898_0044855 | Ga0395898_0044855_570_1274 | 234 |
| 853 | 3300037466 | Ga0395898_0064375 | Ga0395898_0064375_2574_3278 | 234 |
| 854 | 3300037466 | Ga0395898_0418882 | Ga0395898_0418882_412_1119 | 234 |
| 855 | 3300037471 | Ga0395905_0966217 | Ga0395905_0966217_19_726 | 234 |
| 856 | 3300037853 | Ga0436364_0448530 | Ga0436364_0448530_233_937 | 234 |
| 857 | 3300037853 | Ga0436364_1337618 | Ga0436364_1337618_2837_3541 | 234 |
| 858 | 3300038443 | Ga0395901_0055306 | Ga0395901_0055306_2916_3620 | 234 |
| 859 | 3300038443 | Ga0395901_0290885 | Ga0395901_0290885_129_836 | 234 |
| 860 | 3300039447 | Ga0436361_0844310 | Ga0436361_0844310_521_1228 | 234 |
| 861 | 3300039447 | Ga0436361_1158949 | Ga0436361_1158949_362_1066 | 234 |
| 862 | 3300039447 | Ga0436361_1192224 | Ga0436361_1192224_588_1292 | 234 |
| 863 | 3300042001 | Ga0439441_004858 | Ga0439441_004858_660_1370 | 234 |
| 864 | 3300042436 | Ga0439435_0002921 | Ga0439435_0002921_594_1301 | 234 |
| 865 | 3300042437 | Ga0439444_0009740 | Ga0439444_0009740_243_950 | 234 |
| 866 | 3300042461 | Ga0439460_0122877 | Ga0439460_0122877_38_745 | 234 |
| 867 | 3300044673 | Ga0453683_0208282 | Ga0453683_0208282_496_1200 | 234 |
| 868 | 3300045051 | Ga0451576_0035215 | Ga0451576_0035215_3889_4620 | 234 |
| 869 | 3300045976 | Ga0466967_0631939 | Ga0466967_0631939_118_822 | 234 |
| 870 | 3300046454 | Ga0495592_0103380 | Ga0495592_0103380_230_940 | 234 |
| 871 | 3300046454 | Ga0495592_0161411 | Ga0495592_0161411_558_1265 | 234 |
| 872 | 3300046454 | Ga0495592_0222752 | Ga0495592_0222752_346_1050 | 234 |
| 873 | 3300046455 | Ga0495603_0245817 | Ga0495603_0245817_50_826 | 234 |
| 874 | 3300046462 | Ga0495651_0001982 | Ga0495651_0001982_1564_2271 | 234 |
| 875 | 3300046462 | Ga0495651_0004780 | Ga0495651_0004780_8218_8922 | 234 |
| 876 | 3300046462 | Ga0495651_0239715 | Ga0495651_0239715_396_1103 | 234 |
| 877 | 3300046463 | Ga0495653_0125567 | Ga0495653_0125567_718_1428 | 234 |
| 878 | 3300046491 | Ga0495584_0149159 | Ga0495584_0149159_366_1070 | 234 |
| 879 | 3300046491 | Ga0495584_0313830 | Ga0495584_0313830_64_771 | 234 |
| 880 | 3300046533 | Ga0495640_0072831 | Ga0495640_0072831_1478_2182 | 234 |
| 881 | 3300046536 | Ga0495587_0049445 | Ga0495587_0049445_1283_1990 | 234 |
| 882 | 3300046536 | Ga0495587_0303426 | Ga0495587_0303426_157_867 | 234 |
| 883 | 3300046539 | Ga0495621_0017170 | Ga0495621_0017170_939_1643 | 234 |
| 884 | 3300046559 | Ga0495667_0160351 | Ga0495667_0160351_129_836 | 234 |
| 885 | 3300046615 | Ga0495656_0031341 | Ga0495656_0031341_1245_1949 | 234 |
| 886 | 3300046616 | Ga0495668_0105682 | Ga0495668_0105682_554_1261 | 234 |
| 887 | 3300046664 | Ga0495659_0069808 | Ga0495659_0069808_528_1232 | 234 |
| 888 | 3300046675 | Ga0495657_0032389 | Ga0495657_0032389_1833_2540 | 234 |
| 889 | 3300046680 | Ga0495646_0354661 | Ga0495646_0354661_16_723 | 234 |
| 890 | 3300046683 | Ga0495658_0210128 | Ga0495658_0210128_432_1136 | 234 |
| 891 | 3300046683 | Ga0495658_0351561 | Ga0495658_0351561_105_809 | 234 |
| 892 | 3300046684 | Ga0495669_0100249 | Ga0495669_0100249_302_1006 | 234 |
| 893 | 3300046689 | Ga0495613_0238680 | Ga0495613_0238680_389_1099 | 234 |
| 894 | 3300047317 | Ga0495604_0068519 | Ga0495604_0068519_604_1311 | 234 |
| 895 | 3300047319 | Ga0495674_0367907 | Ga0495674_0367907_300_1007 | 234 |
| 896 | 3300047320 | Ga0495672_0158823 | Ga0495672_0158823_30_737 | 234 |
| 897 | 3300047322 | Ga0495680_0089833 | Ga0495680_0089833_224_931 | 234 |
| 898 | 3300047322 | Ga0495680_0289297 | Ga0495680_0289297_432_1139 | 234 |
| 899 | 3300048903 | Ga0496100_0258062 | Ga0496100_0258062_551_1255 | 234 |
| 900 | 3300048904 | Ga0496101_0091275 | Ga0496101_0091275_1118_1825 | 234 |
| 901 | 3300048905 | Ga0496102_0002928 | Ga0496102_0002928_13075_13794 | 234 |
| 902 | 3300048906 | Ga0496103_0003743 | Ga0496103_0003743_7389_8108 | 234 |
| 903 | 3300048907 | Ga0496104_0000583 | Ga0496104_0000583_1066_1770 | 234 |
| 904 | 3300048907 | Ga0496104_0012330 | Ga0496104_0012330_5732_6436 | 234 |
| 905 | 3300048907 | Ga0496104_0245225 | Ga0496104_0245225_330_1049 | 234 |
| 906 | 3300048908 | Ga0496105_0008697 | Ga0496105_0008697_63_767 | 234 |
| 907 | 3300048908 | Ga0496105_0050684 | Ga0496105_0050684_1564_2268 | 234 |
| 908 | 3300048908 | Ga0496105_0256239 | Ga0496105_0256239_634_1341 | 234 |
| 909 | 3300048909 | Ga0496106_0022118 | Ga0496106_0022118_1341_2060 | 234 |
| 910 | 3300048909 | Ga0496106_0299811 | Ga0496106_0299811_125_835 | 234 |
| 911 | 3300048910 | Ga0496107_0001227 | Ga0496107_0001227_1299_2018 | 234 |
| 912 | 3300048911 | Ga0496108_0049238 | Ga0496108_0049238_1502_2206 | 234 |
| 913 | 3300048911 | Ga0496108_0173590 | Ga0496108_0173590_138_845 | 234 |
| 914 | 3300048912 | Ga0496109_0057825 | Ga0496109_0057825_898_1602 | 234 |
| 915 | 3300048912 | Ga0496109_0118398 | Ga0496109_0118398_783_1502 | 234 |
| 916 | 3300048912 | Ga0496109_0886103 | Ga0496109_0886103_21_728 | 234 |
| 917 | 3300048913 | Ga0496110_0007441 | Ga0496110_0007441_4634_5338 | 234 |
| 918 | 3300048913 | Ga0496110_0204667 | Ga0496110_0204667_1030_1737 | 234 |
| 919 | 3300048914 | Ga0496111_0072319 | Ga0496111_0072319_740_1447 | 234 |
| 920 | 3300048915 | Ga0496112_0088621 | Ga0496112_0088621_2340_3050 | 234 |
| 921 | 3300048915 | Ga0496112_0104855 | Ga0496112_0104855_545_1249 | 234 |
| 922 | 3300048915 | Ga0496112_0177127 | Ga0496112_0177127_817_1524 | 234 |
| 923 | 3300048915 | Ga0496112_0394726 | Ga0496112_0394726_336_1040 | 234 |
| 924 | 3300048916 | Ga0496113_0020887 | Ga0496113_0020887_1858_2562 | 234 |
| 925 | 3300048918 | Ga0496115_0022061 | Ga0496115_0022061_1373_2092 | 234 |
| 926 | 3300048919 | Ga0496116_0127278 | Ga0496116_0127278_525_1229 | 234 |
| 927 | 3300048920 | Ga0496117_0003630 | Ga0496117_0003630_3351_4055 | 234 |
| 928 | 3300048921 | Ga0496118_0010798 | Ga0496118_0010798_4847_5551 | 234 |
| 929 | 3300048924 | Ga0496121_0001572 | Ga0496121_0001572_4820_5524 | 234 |
| 930 | 3300048924 | Ga0496121_0051858 | Ga0496121_0051858_912_1658 | 234 |
| 931 | 3300048925 | Ga0496122_0173024 | Ga0496122_0173024_171_875 | 234 |
| 932 | 3300048926 | Ga0496123_0031626 | Ga0496123_0031626_1493_2197 | 234 |
| 933 | 3300048929 | Ga0496126_0008605 | Ga0496126_0008605_6030_6776 | 234 |
| 934 | 3300049568 | Ga0501031_0063494 | Ga0501031_0063494_363_1067 | 234 |
| 935 | 3300049570 | Ga0501033_0015021 | Ga0501033_0015021_3356_4075 | 234 |
| 936 | 3300049571 | Ga0501034_0029827 | Ga0501034_0029827_865_1590 | 234 |
| 937 | 3300049571 | Ga0501034_0044973 | Ga0501034_0044973_237_956 | 234 |
| 938 | 3300049571 | Ga0501034_0273259 | Ga0501034_0273259_640_1368 | 234 |
| 939 | 3300049571 | Ga0501034_0360463 | Ga0501034_0360463_92_814 | 234 |
| 940 | 3300049572 | Ga0501036_0006734 | Ga0501036_0006734_2659_3363 | 234 |
| 941 | 3300049572 | Ga0501036_0093588 | Ga0501036_0093588_844_1551 | 234 |
| 942 | 3300049572 | Ga0501036_0213089 | Ga0501036_0213089_255_977 | 234 |
| 943 | 3300049572 | Ga0501036_0297152 | Ga0501036_0297152_403_1110 | 234 |
| 944 | 3300049574 | Ga0501038_0002157 | Ga0501038_0002157_13239_13943 | 234 |
| 945 | 3300049574 | Ga0501038_0049869 | Ga0501038_0049869_452_1171 | 234 |
| 946 | 3300049574 | Ga0501038_0061036 | Ga0501038_0061036_767_1474 | 234 |
| 947 | 3300049575 | Ga0501039_0048849 | Ga0501039_0048849_1028_1735 | 234 |
| 948 | 3300049575 | Ga0501039_0189821 | Ga0501039_0189821_499_1206 | 234 |
| 949 | 3300049576 | Ga0501040_0000906 | Ga0501040_0000906_11829_12533 | 234 |
| 950 | 3300049576 | Ga0501040_0005522 | Ga0501040_0005522_1533_2240 | 234 |
| 951 | 3300049576 | Ga0501040_0096766 | Ga0501040_0096766_1161_1868 | 234 |
| 952 | 3300049577 | Ga0501041_0009565 | Ga0501041_0009565_903_1610 | 234 |
| 953 | 3300049577 | Ga0501041_0063399 | Ga0501041_0063399_368_1093 | 234 |
| 954 | 3300049577 | Ga0501041_0150096 | Ga0501041_0150096_673_1380 | 234 |
| 955 | 3300049578 | Ga0501042_0000035 | Ga0501042_0000035_355_1059 | 234 |
| 956 | 3300049578 | Ga0501042_0028580 | Ga0501042_0028580_2501_3208 | 234 |
| 957 | 3300049578 | Ga0501042_0313151 | Ga0501042_0313151_166_873 | 234 |
| 958 | 3300049580 | Ga0501046_0009529 | Ga0501046_0009529_1611_2315 | 234 |
| 959 | 3300049580 | Ga0501046_0346596 | Ga0501046_0346596_24_731 | 234 |
| 960 | 3300049582 | Ga0501048_0013519 | Ga0501048_0013519_1683_2390 | 234 |
| 961 | 3300049583 | Ga0501067_0043894 | Ga0501067_0043894_660_1382 | 234 |
| 962 | 3300049586 | Ga0501070_0606219 | Ga0501070_0606219_55_759 | 234 |
| 963 | 3300049587 | Ga0501071_0000007 | Ga0501071_0000007_72410_73114 | 234 |
| 964 | 3300049588 | Ga0501072_0001853 | Ga0501072_0001853_14159_14863 | 234 |
| 965 | 3300049588 | Ga0501072_0007323 | Ga0501072_0007323_5379_6086 | 234 |
| 966 | 3300049588 | Ga0501072_0102163 | Ga0501072_0102163_1277_1984 | 234 |
| 967 | 3300049588 | Ga0501072_0212854 | Ga0501072_0212854_267_986 | 234 |
| 968 | 3300049588 | Ga0501072_0460444 | Ga0501072_0460444_26_733 | 234 |
| 969 | 3300049590 | Ga0501074_0000890 | Ga0501074_0000890_12957_13661 | 234 |
| 970 | 3300049590 | Ga0501074_0011936 | Ga0501074_0011936_274_999 | 234 |
| 971 | 3300049590 | Ga0501074_0102208 | Ga0501074_0102208_994_1701 | 234 |
| 972 | 3300049591 | Ga0501075_0004980 | Ga0501075_0004980_3327_4034 | 234 |
| 973 | 3300049591 | Ga0501075_0008897 | Ga0501075_0008897_885_1589 | 234 |
| 974 | 3300049591 | Ga0501075_0265060 | Ga0501075_0265060_76_783 | 234 |
| 975 | 3300049591 | Ga0501075_0284358 | Ga0501075_0284358_484_1188 | 234 |
| 976 | 3300049592 | Ga0501076_0002324 | Ga0501076_0002324_300_1004 | 234 |
| 977 | 3300049592 | Ga0501076_0003466 | Ga0501076_0003466_4701_5408 | 234 |
| 978 | 3300049592 | Ga0501076_0150081 | Ga0501076_0150081_867_1574 | 234 |
| 979 | 3300049593 | Ga0501077_0000416 | Ga0501077_0000416_14083_14787 | 234 |
| 980 | 3300049593 | Ga0501077_0012149 | Ga0501077_0012149_3722_4429 | 234 |
| 981 | 3300049741 | Ga0501079_0000624 | Ga0501079_0000624_129_833 | 234 |
| 982 | 3300049741 | Ga0501079_0003460 | Ga0501079_0003460_2991_3716 | 234 |
| 983 | 3300049741 | Ga0501079_0012156 | Ga0501079_0012156_2527_3234 | 234 |
| 984 | 3300049741 | Ga0501079_0067224 | Ga0501079_0067224_43_750 | 234 |
| 985 | 3300049741 | Ga0501079_0113823 | Ga0501079_0113823_787_1494 | 234 |
| 986 | 3300049742 | Ga0501080_0000512 | Ga0501080_0000512_29741_30445 | 234 |
| 987 | 3300049742 | Ga0501080_0002139 | Ga0501080_0002139_8987_9712 | 234 |
| 988 | 3300049742 | Ga0501080_0061963 | Ga0501080_0061963_702_1421 | 234 |
| 989 | 3300049743 | Ga0501081_0008832 | Ga0501081_0008832_1320_2024 | 234 |
| 990 | 3300049743 | Ga0501081_0016154 | Ga0501081_0016154_1690_2397 | 234 |
| 991 | 3300049743 | Ga0501081_0017365 | Ga0501081_0017365_1291_1998 | 234 |
| 992 | 3300049743 | Ga0501081_0145991 | Ga0501081_0145991_778_1485 | 234 |
| 993 | 3300049743 | Ga0501081_0249084 | Ga0501081_0249084_308_1018 | 234 |
| 994 | 3300049743 | Ga0501081_0254236 | Ga0501081_0254236_367_1074 | 234 |
| 995 | 3300049743 | Ga0501081_0417951 | Ga0501081_0417951_40_747 | 234 |
| 996 | 3300049744 | Ga0501083_0394444 | Ga0501083_0394444_127_843 | 234 |
| 997 | 3300049822 | Ga0501035_0012129 | Ga0501035_0012129_385_1089 | 234 |
| 998 | 3300049822 | Ga0501035_0124134 | Ga0501035_0124134_1009_1728 | 234 |
| 999 | 3300049824 | Ga0501045_0000029 | Ga0501045_0000029_40600_41304 | 234 |
| 1000 | 3300049824 | Ga0501045_0013527 | Ga0501045_0013527_1095_1802 | 234 |
| 1001 | 3300049824 | Ga0501045_0052869 | Ga0501045_0052869_673_1380 | 234 |
| 1002 | 3300049824 | Ga0501045_0107985 | Ga0501045_0107985_1036_1743 | 234 |
| 1003 | 3300050489 | nmdc:mga03683_41561_c1 | nmdc:mga03683_41561_c1_876_1586 | 234 |
| 1004 | 3300050490 | nmdc:mga03n38_1857_c1 | nmdc:mga03n38_1857_c1_3199_3903 | 234 |
| 1005 | 3300050490 | nmdc:mga03n38_20425_c1 | nmdc:mga03n38_20425_c1_1461_2168 | 234 |
| 1006 | 3300050491 | nmdc:mga00v17_366329_c1 | nmdc:mga00v17_366329_c1_90_800 | 234 |
| 1007 | 3300050492 | nmdc:mga0yw44_286956_c1 | nmdc:mga0yw44_286956_c1_223_933 | 234 |
| 1008 | 3300050492 | nmdc:mga0yw44_39681_c1 | nmdc:mga0yw44_39681_c1_921_1628 | 234 |
| 1009 | 3300050492 | nmdc:mga0yw44_600552_c1 | nmdc:mga0yw44_600552_c1_26_730 | 234 |
| 1010 | 3300050492 | nmdc:mga0yw44_69373_c1 | nmdc:mga0yw44_69373_c1_767_1477 | 234 |
| 1011 | 3300050493 | nmdc:mga0k408_80884_c1 | nmdc:mga0k408_80884_c1_254_964 | 234 |
| 1012 | 3300050494 | nmdc:mga06z11_31047_c1 | nmdc:mga06z11_31047_c1_1295_2002 | 234 |
| 1013 | 3300050494 | nmdc:mga06z11_54019_c1 | nmdc:mga06z11_54019_c1_109_816 | 234 |
| 1014 | 3300050494 | nmdc:mga06z11_78189_c1 | nmdc:mga06z11_78189_c1_677_1387 | 234 |
| 1015 | 3300050495 | nmdc:mga04h51_132065_c1 | nmdc:mga04h51_132065_c1_85_792 | 234 |
| 1016 | 3300050495 | nmdc:mga04h51_92715_c1 | nmdc:mga04h51_92715_c1_59_766 | 234 |
| 1017 | 3300050496 | nmdc:mga07m45_14266_c2 | nmdc:mga07m45_14266_c2_319_1029 | 234 |
| 1018 | 3300050507 | nmdc:mga05p37_109_c1 | nmdc:mga05p37_109_c1_59204_59911 | 234 |
| 1019 | 3300050507 | nmdc:mga05p37_1198817_c1 | nmdc:mga05p37_1198817_c1_38_742 | 234 |
| 1020 | 3300050507 | nmdc:mga05p37_237746_c1 | nmdc:mga05p37_237746_c1_301_1014 | 234 |
| 1021 | 3300050507 | nmdc:mga05p37_246642_c1 | nmdc:mga05p37_246642_c1_884_1591 | 234 |
| 1022 | 3300050507 | nmdc:mga05p37_281300_c1 | nmdc:mga05p37_281300_c1_598_1302 | 234 |
| 1023 | 3300050507 | nmdc:mga05p37_443652_c1 | nmdc:mga05p37_443652_c1_715_1425 | 234 |
| 1024 | 3300050508 | nmdc:mga09592_16967_c1 | nmdc:mga09592_16967_c1_2808_3518 | 234 |
| 1025 | 3300050508 | nmdc:mga09592_291128_c1 | nmdc:mga09592_291128_c1_400_1113 | 234 |
| 1026 | 3300050508 | nmdc:mga09592_654955_c1 | nmdc:mga09592_654955_c1_81_785 | 234 |
| 1027 | 3300050508 | nmdc:mga09592_754_c1 | nmdc:mga09592_754_c1_9483_10190 | 234 |
| 1028 | 3300050508 | nmdc:mga09592_79346_c1 | nmdc:mga09592_79346_c1_1493_2197 | 234 |
| 1029 | 3300050509 | nmdc:mga0qj67_47826_c1 | nmdc:mga0qj67_47826_c1_992_1696 | 234 |
| 1030 | 3300050509 | nmdc:mga0qj67_7392_c1 | nmdc:mga0qj67_7392_c1_7131_7835 | 234 |
| 1031 | 3300050510 | nmdc:mga06r32_117505_c1 | nmdc:mga06r32_117505_c1_249_956 | 234 |
| 1032 | 3300050510 | nmdc:mga06r32_29856_c1 | nmdc:mga06r32_29856_c1_1066_1770 | 234 |
| 1033 | 3300050510 | nmdc:mga06r32_553346_c1 | nmdc:mga06r32_553346_c1_229_1014 | 234 |
| 1034 | 3300050510 | nmdc:mga06r32_63637_c1 | nmdc:mga06r32_63637_c1_1498_2205 | 234 |
| 1035 | 3300050511 | nmdc:mga08y16_198311_c1 | nmdc:mga08y16_198311_c1_442_1146 | 234 |
| 1036 | 3300050511 | nmdc:mga08y16_310675_c1 | nmdc:mga08y16_310675_c1_139_864 | 234 |
| 1037 | 3300050511 | nmdc:mga08y16_355340_c1 | nmdc:mga08y16_355340_c1_545_1252 | 234 |
| 1038 | 3300050511 | nmdc:mga08y16_36479_c1 | nmdc:mga08y16_36479_c1_2645_3352 | 234 |
| 1039 | 3300050511 | nmdc:mga08y16_607426_c1 | nmdc:mga08y16_607426_c1_71_778 | 234 |
| 1040 | 3300050511 | nmdc:mga08y16_77177_c1 | nmdc:mga08y16_77177_c1_1826_2533 | 234 |
| 1041 | 3300050511 | nmdc:mga08y16_80472_c1 | nmdc:mga08y16_80472_c1_563_1267 | 234 |
| 1042 | 3300050512 | nmdc:mga0n895_175850_c1 | nmdc:mga0n895_175850_c1_1063_1767 | 234 |
| 1043 | 3300050512 | nmdc:mga0n895_42519_c1 | nmdc:mga0n895_42519_c1_2428_3135 | 234 |
| 1044 | 3300050512 | nmdc:mga0n895_663266_c1 | nmdc:mga0n895_663266_c1_30_737 | 234 |
| 1045 | 3300050512 | nmdc:mga0n895_87815_c1 | nmdc:mga0n895_87815_c1_384_1091 | 234 |
| 1046 | 3300050513 | nmdc:mga0rr50_119942_c1 | nmdc:mga0rr50_119942_c1_588_1295 | 234 |
| 1047 | 3300050513 | nmdc:mga0rr50_15506_c1 | nmdc:mga0rr50_15506_c1_3687_4394 | 234 |
| 1048 | 3300050514 | nmdc:mga08x19_311646_c1 | nmdc:mga08x19_311646_c1_91_798 | 234 |
| 1049 | 3300050516 | nmdc:mga0sz30_1337_c1 | nmdc:mga0sz30_1337_c1_3569_4279 | 234 |
| 1050 | 3300053077 | Ga0495601_0013464 | Ga0495601_0013464_2877_3584 | 234 |
| 1051 | 3300053077 | Ga0495601_0179977 | Ga0495601_0179977_637_1344 | 234 |
| 1052 | 3300053084 | Ga0495595_0058130 | Ga0495595_0058130_692_1402 | 234 |
| 1053 | 3300053085 | Ga0495619_0007665 | Ga0495619_0007665_1409_2116 | 234 |
| 1054 | 3300053085 | Ga0495619_0023438 | Ga0495619_0023438_2391_3101 | 234 |
| 1055 | 3300053085 | Ga0495619_0065822 | Ga0495619_0065822_393_1103 | 234 |
| 1056 | 3300053151 | Ga0500604_0111355 | Ga0500604_0111355_156_860 | 234 |
| 1057 | 3300053153 | Ga0500616_0077499 | Ga0500616_0077499_552_1274 | 234 |
| 1058 | 3300054114 | Ga0501084_0001721 | Ga0501084_0001721_11114_11818 | 234 |
| 1059 | 3300054114 | Ga0501084_0017907 | Ga0501084_0017907_3530_4255 | 234 |
| 1060 | 3300054114 | Ga0501084_0025366 | Ga0501084_0025366_2882_3589 | 234 |
| 1061 | 3300054114 | Ga0501084_0036910 | Ga0501084_0036910_1505_2212 | 234 |
| 1062 | 3300054114 | Ga0501084_0208733 | Ga0501084_0208733_514_1221 | 234 |
| 1063 | 3300054114 | Ga0501084_0209696 | Ga0501084_0209696_623_1342 | 234 |
| 1064 | 3300054114 | Ga0501084_0437477 | Ga0501084_0437477_372_1079 | 234 |
| 1065 | 3300060353 | Ga0501082_0014375 | Ga0501082_0014375_807_1514 | 234 |
| 1066 | 3300060353 | Ga0501082_0020395 | Ga0501082_0020395_3100_3819 | 234 |
| 1067 | 3300060353 | Ga0501082_0133887 | Ga0501082_0133887_131_835 | 234 |
| 1068 | 3300060353 | Ga0501082_0259702 | Ga0501082_0259702_185_901 | 234 |
| 1069 | 3300060353 | Ga0501082_0326966 | Ga0501082_0326966_570_1289 | 234 |
| 1070 | 3300061734 | Ga0530510_0003414 | Ga0530510_0003414_110_814 | 234 |
| 1071 | 3300061734 | Ga0530510_0004308 | Ga0530510_0004308_7623_8330 | 234 |
| 1072 | 3300061734 | Ga0530510_0006430 | Ga0530510_0006430_4584_5318 | 234 |
| 1073 | 3300061734 | Ga0530510_0024289 | Ga0530510_0024289_1486_2205 | 234 |
| 1074 | 3300061734 | Ga0530510_0103592 | Ga0530510_0103592_171_881 | 234 |
| 1075 | 3300061734 | Ga0530510_0116450 | Ga0530510_0116450_979_1686 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3um9-assembly1.cif.gz_B | crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 | 0.9373 | 11 | 231 |
| 1zrm-assembly1.cif.gz_A | crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate | 0.9362 | 11 | 232 |
| 1jud-assembly1.cif.gz_A | l-2-haloacid dehalogenase | 0.9326 | 11 | 232 |
| 7arp-assembly1.cif.gz_B | native l-2-haloacid dehalogenase from zobellia galactanivorans | 0.9313 | 10 | 234 |
| 7asz-assembly1.cif.gz_B | l-2-haloacid dehalogenase h190a mutant from zobellia galactanivorans | 0.9301 | 10 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2no5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9498 | 106 | 233 | 3.40.50.1000 |
| 3umbA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9414 | 10 | 233 | 3.40.50.1000 |
| 2w43A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9293 | 11 | 231 | 3.40.50.1000 |
| 1zrmA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9243 | 11 | 232 | 3.40.50.1000 |
| 3umbA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9163 | 10 | 233 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537X363-F1-model_v4 | Haloacid dehalogenase type II | 0.9989 | 134 | 234 |
|
| AF-A0A537R4E4-F1-model_v4 | (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) | 0.9951 | 11 | 231 |
GO:0018784
|
| AF-A0A800A625-F1-model_v4 | Haloacid dehalogenase type II | 0.9939 | 71 | 234 |
|
| AF-A0A537X363-F1-model_v4 | Haloacid dehalogenase type II | 0.9891 | 134 | 234 |
|
| AF-A0A382J578-F1-model_v4 | Haloacid dehalogenase, type II | 0.9836 | 125 | 234 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar