F489568
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1075 | 379 | 1055 | 351 |
Family's Representative Sequence
| Representative Sequence | 3300047443|Ga0495687_000517|Ga0495687_000517_43977_45200 |
| Length | 407 |
| Sequence | MSDLDQLKSDLLAAIGSADLAGLEDIRVSALGKSGSVTGLLKTLGGMSPEERQTTGPRIHALREAVSEALTARKTGLEREALNARLAGETLDMTLPADVPAAGTVHPVSQVMDELAEIFADLGFAVATGPEIEDDWHNFTALNIPESHPARAMHDTFYMSPSPHWGEGRXXXXSRATPLGAAPLPDQHRVDRAPRDQGHAGGMADPMLPGGEREQKRMLLRTHTSPVQIRTMVAQKPPIRIIAPGRTYRSDSDATHTPMFHQVEGLVIDKGITLGHLKWTLETFLKAYFERDDIVLRLRPSYFPFTEPSAEVDVGYTIQNGKRVIGGSDHWMEVLGSGMVHPKVIAACGLDPDEWQGFAFGCGIDRLAMLKYGMDDLRAFFDGDIRWLKHYGFAALDVPTLSGGVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 2 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 5 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 6 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 7 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 8 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 9 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 10 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 11 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 12 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 13 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 14 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 15 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 16 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 17 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 18 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 19 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 20 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 21 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 22 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 23 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 24 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 25 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 26 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 27 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 28 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 29 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 30 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 31 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 32 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 33 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 34 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 35 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 139 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 235 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 254 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 255 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 259 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 260 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 261 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 306 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 307 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 316 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 331 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 332 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 337 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 338 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 341 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 342 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 343 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 348 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 359 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 360 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 364 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 365 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 366 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 367 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 369 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 370 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 373 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 374 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 375 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 379 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.05 |
| Metatranscriptomes | 0.09 |
| Isolates | 1.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.47 |
| Bulb | 0 |
| Endosphere | 4.47 |
| Nodule | 0 |
| Rhizoplane | 3.07 |
| Rhizosphere | 87.35 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 4.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000036 | 3300001904 | Bacteria | 22294 |
| 2 | JGI24736J21556_1000435 | 3300001904 | Bacteria | 7880 |
| 3 | JGI24736J21556_1000841 | 3300001904 | Bacteria | 5661 |
| 4 | JGI24736J21556_1004342 | 3300001904 | Bacteria | 2425 |
| 5 | JGI24752J21851_1000209 | 3300001976 | Bacteria | 8171 |
| 6 | JGI24752J21851_1000362 | 3300001976 | Bacteria | 6344 |
| 7 | JGI24740J21852_10000820 | 3300001979 | Bacteria | 13657 |
| 8 | JGI24740J21852_10046622 | 3300001979 | Bacteria | 1271 |
| 9 | JGI24739J22299_10000237 | 3300001989 | Bacteria | 18648 |
| 10 | JGI24739J22299_10007848 | 3300001989 | Bacteria | 3992 |
| 11 | JGI24737J22298_10000061 | 3300001990 | Bacteria | 32526 |
| 12 | JGI24737J22298_10014465 | 3300001990 | Bacteria | 2562 |
| 13 | JGI24737J22298_10016354 | 3300001990 | Bacteria | 2395 |
| 14 | JGI24750J21931_1000040 | 3300002070 | Bacteria | 17215 |
| 15 | JGI24748J21848_1000053 | 3300002074 | Bacteria | 50665 |
| 16 | JGI24738J21930_10000766 | 3300002075 | Bacteria | 9206 |
| 17 | JGI24738J21930_10001175 | 3300002075 | Bacteria | 7369 |
| 18 | JGI24749J21850_1000019 | 3300002076 | Bacteria | 32251 |
| 19 | JGI24749J21850_1004036 | 3300002076 | Bacteria | 2049 |
| 20 | JGI24749J21850_1009649 | 3300002076 | Bacteria | 1349 |
| 21 | JGI24035J26624_1001486 | 3300002126 | Bacteria | 2212 |
| 22 | JGI24033J26618_1003599 | 3300002155 | Bacteria | 1640 |
| 23 | JGI24034J26672_10000036 | 3300002239 | Bacteria | 84333 |
| 24 | JGI24742J22300_10004660 | 3300002244 | Bacteria | 2250 |
| 25 | JGI24751J29686_10000519 | 3300002459 | Bacteria | 11120 |
| 26 | JGI24751J29686_10007551 | 3300002459 | Bacteria | 2222 |
| 27 | JGI25165J46597_1000010 | 3300003214 | Bacteria | 442113 |
| 28 | JGI25153J46596_10000417 | 3300003215 | Bacteria | 27933 |
| 29 | Ga0055537_1003859 | 3300003773 | Bacteria | 4479 |
| 30 | Ga0055524_1000154 | 3300003775 | Bacteria | 80540 |
| 31 | Ga0065704_10003962 | 3300005289 | Bacteria | 4806 |
| 32 | Ga0065704_10075440 | 3300005289 | Bacteria | 5588 |
| 33 | Ga0065712_10088801 | 3300005290 | Bacteria | 2480 |
| 34 | Ga0065712_10157228 | 3300005290 | Bacteria | 1325 |
| 35 | Ga0065707_10081963 | 3300005295 | Bacteria | 27052 |
| 36 | Ga0065707_10084228 | 3300005295 | Bacteria | 7485 |
| 37 | Ga0065707_10090430 | 3300005295 | Bacteria | 4137 |
| 38 | Ga0065707_10112939 | 3300005295 | Bacteria | 2344 |
| 39 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 40 | Ga0070658_10001555 | 3300005327 | Bacteria | 19441 |
| 41 | Ga0070658_10001818 | 3300005327 | Bacteria | 17955 |
| 42 | Ga0070658_10005891 | 3300005327 | Bacteria | 9941 |
| 43 | Ga0070658_10037354 | 3300005327 | Bacteria | 3915 |
| 44 | Ga0070658_10041579 | 3300005327 | Bacteria | 3709 |
| 45 | Ga0070658_10083347 | 3300005327 | Bacteria | 2628 |
| 46 | Ga0070658_10258356 | 3300005327 | Bacteria | 1479 |
| 47 | Ga0070676_10000367 | 3300005328 | Bacteria | 20719 |
| 48 | Ga0070676_10003382 | 3300005328 | Bacteria | 8305 |
| 49 | Ga0070676_10009609 | 3300005328 | Bacteria | 5226 |
| 50 | Ga0070683_100006609 | 3300005329 | Bacteria | 9739 |
| 51 | Ga0070683_100117064 | 3300005329 | Bacteria | 2516 |
| 52 | Ga0070690_100000093 | 3300005330 | Bacteria | 44990 |
| 53 | Ga0070670_100000060 | 3300005331 | Bacteria | 113477 |
| 54 | Ga0070670_100000202 | 3300005331 | Bacteria | 55420 |
| 55 | Ga0070670_100000657 | 3300005331 | Bacteria | 26873 |
| 56 | Ga0070670_100020267 | 3300005331 | Bacteria | 5713 |
| 57 | Ga0070670_100031324 | 3300005331 | Bacteria | 4579 |
| 58 | Ga0070670_100094950 | 3300005331 | Bacteria | 2565 |
| 59 | Ga0070670_100122039 | 3300005331 | Bacteria | 2248 |
| 60 | Ga0070670_100171019 | 3300005331 | Bacteria | 1884 |
| 61 | Ga0070677_10010369 | 3300005333 | Bacteria | 3187 |
| 62 | Ga0068869_100000493 | 3300005334 | Bacteria | 21956 |
| 63 | Ga0068869_100000552 | 3300005334 | Bacteria | 20946 |
| 64 | Ga0068869_100028462 | 3300005334 | Bacteria | 3905 |
| 65 | Ga0070666_10000009 | 3300005335 | Bacteria | 279209 |
| 66 | Ga0070680_100000105 | 3300005336 | Bacteria | 48515 |
| 67 | Ga0070680_100024107 | 3300005336 | Bacteria | 4855 |
| 68 | Ga0070682_100013327 | 3300005337 | Bacteria | 4727 |
| 69 | Ga0068868_100000057 | 3300005338 | Bacteria | 62946 |
| 70 | Ga0068868_100022988 | 3300005338 | Bacteria | 4714 |
| 71 | Ga0070660_100000511 | 3300005339 | Bacteria | 25935 |
| 72 | Ga0070660_100001813 | 3300005339 | Bacteria | 14658 |
| 73 | Ga0070660_100059267 | 3300005339 | Bacteria | 2968 |
| 74 | Ga0070660_100086867 | 3300005339 | Bacteria | 2461 |
| 75 | Ga0070660_100177987 | 3300005339 | Bacteria | 1720 |
| 76 | Ga0070660_100244616 | 3300005339 | Bacteria | 1462 |
| 77 | Ga0070689_100152187 | 3300005340 | Bacteria | 1866 |
| 78 | Ga0070691_10004772 | 3300005341 | Bacteria | 6168 |
| 79 | Ga0070661_100027477 | 3300005344 | Bacteria | 4098 |
| 80 | Ga0070692_10000469 | 3300005345 | Bacteria | 12367 |
| 81 | Ga0070692_10001745 | 3300005345 | Bacteria | 8106 |
| 82 | Ga0070668_100000050 | 3300005347 | Bacteria | 73885 |
| 83 | Ga0070668_100000245 | 3300005347 | Bacteria | 35846 |
| 84 | Ga0070668_100153205 | 3300005347 | Bacteria | 1866 |
| 85 | Ga0070668_100221644 | 3300005347 | Bacteria | 1560 |
| 86 | Ga0070669_100000053 | 3300005353 | Bacteria | 113601 |
| 87 | Ga0070669_100000103 | 3300005353 | Bacteria | 81387 |
| 88 | Ga0070669_100000532 | 3300005353 | Bacteria | 28333 |
| 89 | Ga0070669_100005571 | 3300005353 | Bacteria | 9097 |
| 90 | Ga0070669_100028765 | 3300005353 | Bacteria | 4003 |
| 91 | Ga0070669_100064293 | 3300005353 | Bacteria | 2702 |
| 92 | Ga0070669_100083318 | 3300005353 | Bacteria | 2384 |
| 93 | Ga0070669_100187623 | 3300005353 | Bacteria | 1621 |
| 94 | Ga0070675_100008142 | 3300005354 | Bacteria | 8125 |
| 95 | Ga0070675_100095684 | 3300005354 | Bacteria | 2494 |
| 96 | Ga0070671_100000620 | 3300005355 | Bacteria | 25349 |
| 97 | Ga0070671_100002015 | 3300005355 | Bacteria | 15619 |
| 98 | Ga0070671_100024436 | 3300005355 | Bacteria | 4946 |
| 99 | Ga0070674_100016920 | 3300005356 | Bacteria | 4576 |
| 100 | Ga0070674_100056431 | 3300005356 | Bacteria | 2723 |
| 101 | Ga0070673_100000005 | 3300005364 | Bacteria | 193513 |
| 102 | Ga0070673_100000058 | 3300005364 | Bacteria | 45772 |
| 103 | Ga0070673_100006165 | 3300005364 | Bacteria | 7771 |
| 104 | Ga0070673_100084491 | 3300005364 | Bacteria | 2582 |
| 105 | Ga0070673_100132181 | 3300005364 | Bacteria | 2096 |
| 106 | Ga0070673_100297556 | 3300005364 | Bacteria | 1420 |
| 107 | Ga0070688_100016969 | 3300005365 | Bacteria | 4172 |
| 108 | Ga0070659_100000005 | 3300005366 | Bacteria | 259902 |
| 109 | Ga0070659_100003757 | 3300005366 | Bacteria | 10832 |
| 110 | Ga0070659_100004495 | 3300005366 | Bacteria | 9962 |
| 111 | Ga0070659_100006101 | 3300005366 | Bacteria | 8698 |
| 112 | Ga0070659_100022244 | 3300005366 | Bacteria | 4838 |
| 113 | Ga0070659_100026584 | 3300005366 | Bacteria | 4454 |
| 114 | Ga0070659_100036650 | 3300005366 | Bacteria | 3823 |
| 115 | Ga0070659_100039832 | 3300005366 | Bacteria | 3670 |
| 116 | Ga0070659_100055678 | 3300005366 | Bacteria | 3118 |
| 117 | Ga0070659_100113372 | 3300005366 | Bacteria | 2190 |
| 118 | Ga0070667_100000025 | 3300005367 | Bacteria | 190744 |
| 119 | Ga0070667_100000101 | 3300005367 | Bacteria | 108015 |
| 120 | Ga0070667_100000339 | 3300005367 | Bacteria | 52285 |
| 121 | Ga0070667_100001658 | 3300005367 | Bacteria | 19885 |
| 122 | Ga0070667_100004233 | 3300005367 | Bacteria | 12118 |
| 123 | Ga0070667_100013033 | 3300005367 | Bacteria | 6872 |
| 124 | Ga0070667_100042831 | 3300005367 | Bacteria | 3798 |
| 125 | Ga0070667_100147964 | 3300005367 | Bacteria | 2061 |
| 126 | Ga0070694_100040643 | 3300005444 | Bacteria | 3100 |
| 127 | Ga0070663_100002096 | 3300005455 | Bacteria | 11158 |
| 128 | Ga0070663_100024870 | 3300005455 | Bacteria | 4036 |
| 129 | Ga0070663_100098573 | 3300005455 | Bacteria | 2178 |
| 130 | Ga0070663_100170137 | 3300005455 | Bacteria | 1683 |
| 131 | Ga0070678_100192392 | 3300005456 | Bacteria | 1678 |
| 132 | Ga0070662_100002227 | 3300005457 | Bacteria | 11895 |
| 133 | Ga0070662_100006902 | 3300005457 | Bacteria | 7350 |
| 134 | Ga0070662_100013733 | 3300005457 | Bacteria | 5394 |
| 135 | Ga0070662_100034379 | 3300005457 | Bacteria | 3574 |
| 136 | Ga0070662_100084612 | 3300005457 | Bacteria | 2369 |
| 137 | Ga0070662_100233670 | 3300005457 | Bacteria | 1472 |
| 138 | Ga0070681_10056174 | 3300005458 | Bacteria | 3919 |
| 139 | Ga0070681_10135359 | 3300005458 | Bacteria | 2395 |
| 140 | Ga0068867_100000071 | 3300005459 | Bacteria | 61808 |
| 141 | Ga0068867_100001818 | 3300005459 | Bacteria | 14861 |
| 142 | Ga0068867_100090015 | 3300005459 | Bacteria | 2327 |
| 143 | Ga0070685_10000076 | 3300005466 | Bacteria | 59090 |
| 144 | Ga0070679_100000125 | 3300005530 | Bacteria | 61348 |
| 145 | Ga0070679_100008091 | 3300005530 | Bacteria | 9881 |
| 146 | Ga0070679_100193348 | 3300005530 | Bacteria | 2003 |
| 147 | Ga0068853_100000783 | 3300005539 | Bacteria | 22097 |
| 148 | Ga0068853_100005580 | 3300005539 | Bacteria | 9880 |
| 149 | Ga0068853_100020734 | 3300005539 | Bacteria | 5466 |
| 150 | Ga0070672_100000716 | 3300005543 | Bacteria | 19668 |
| 151 | Ga0070672_100013878 | 3300005543 | Bacteria | 5699 |
| 152 | Ga0070672_100124888 | 3300005543 | Bacteria | 2110 |
| 153 | Ga0070686_100000018 | 3300005544 | Bacteria | 140685 |
| 154 | Ga0070695_100002848 | 3300005545 | Bacteria | 10058 |
| 155 | Ga0070696_100003697 | 3300005546 | Bacteria | 10202 |
| 156 | Ga0070696_100037829 | 3300005546 | Bacteria | 3328 |
| 157 | Ga0070693_100007429 | 3300005547 | Bacteria | 5358 |
| 158 | Ga0070665_100000071 | 3300005548 | Bacteria | 200675 |
| 159 | Ga0070665_100001540 | 3300005548 | Bacteria | 26631 |
| 160 | Ga0070665_100058303 | 3300005548 | Bacteria | 3871 |
| 161 | Ga0070665_100187057 | 3300005548 | Bacteria | 2072 |
| 162 | Ga0068855_100000380 | 3300005563 | Bacteria | 54664 |
| 163 | Ga0068855_100001416 | 3300005563 | Bacteria | 29777 |
| 164 | Ga0068855_100007934 | 3300005563 | Bacteria | 12829 |
| 165 | Ga0068855_100008046 | 3300005563 | Bacteria | 12739 |
| 166 | Ga0068855_100011666 | 3300005563 | Bacteria | 10621 |
| 167 | Ga0068855_100022265 | 3300005563 | Bacteria | 7593 |
| 168 | Ga0068855_100296707 | 3300005563 | Bacteria | 1791 |
| 169 | Ga0068855_100381109 | 3300005563 | Bacteria | 1548 |
| 170 | Ga0070664_100003017 | 3300005564 | Bacteria | 13609 |
| 171 | Ga0070664_100021584 | 3300005564 | Bacteria | 5310 |
| 172 | Ga0070664_100049081 | 3300005564 | Bacteria | 3569 |
| 173 | Ga0070664_100084855 | 3300005564 | Bacteria | 2734 |
| 174 | Ga0070664_100110229 | 3300005564 | Bacteria | 2401 |
| 175 | Ga0070664_100116006 | 3300005564 | Bacteria | 2341 |
| 176 | Ga0070664_100130374 | 3300005564 | Bacteria | 2208 |
| 177 | Ga0070664_100172029 | 3300005564 | Bacteria | 1922 |
| 178 | Ga0070664_100365893 | 3300005564 | Bacteria | 1314 |
| 179 | Ga0068857_100004724 | 3300005577 | Bacteria | 11541 |
| 180 | Ga0068857_100092128 | 3300005577 | Bacteria | 2713 |
| 181 | Ga0068857_100108161 | 3300005577 | Bacteria | 2498 |
| 182 | Ga0068857_100114134 | 3300005577 | Bacteria | 2429 |
| 183 | Ga0068857_100150099 | 3300005577 | Bacteria | 2111 |
| 184 | Ga0068857_100242743 | 3300005577 | Bacteria | 1650 |
| 185 | Ga0068854_100001025 | 3300005578 | Bacteria | 16746 |
| 186 | Ga0068854_100006061 | 3300005578 | Bacteria | 7667 |
| 187 | Ga0068854_100012217 | 3300005578 | Bacteria | 5619 |
| 188 | Ga0068854_100021404 | 3300005578 | Bacteria | 4388 |
| 189 | Ga0068854_100035059 | 3300005578 | Bacteria | 3510 |
| 190 | Ga0068854_100062705 | 3300005578 | Bacteria | 2696 |
| 191 | Ga0068854_100103485 | 3300005578 | Bacteria | 2137 |
| 192 | Ga0068856_100001220 | 3300005614 | Bacteria | 26928 |
| 193 | Ga0068856_100002574 | 3300005614 | Bacteria | 18686 |
| 194 | Ga0068856_100049902 | 3300005614 | Bacteria | 4125 |
| 195 | Ga0068856_100105955 | 3300005614 | Bacteria | 2806 |
| 196 | Ga0068856_100108554 | 3300005614 | Bacteria | 2771 |
| 197 | Ga0070702_100058941 | 3300005615 | Bacteria | 2226 |
| 198 | Ga0068852_100002771 | 3300005616 | Bacteria | 12138 |
| 199 | Ga0068852_100059481 | 3300005616 | Bacteria | 3314 |
| 200 | Ga0068852_100110699 | 3300005616 | Bacteria | 2496 |
| 201 | Ga0068852_100208572 | 3300005616 | Bacteria | 1852 |
| 202 | Ga0068852_100334449 | 3300005616 | Bacteria | 1474 |
| 203 | Ga0068859_100000136 | 3300005617 | Bacteria | 68907 |
| 204 | Ga0068859_100000623 | 3300005617 | Bacteria | 35426 |
| 205 | Ga0068859_100006620 | 3300005617 | Bacteria | 11765 |
| 206 | Ga0068859_100007966 | 3300005617 | Bacteria | 10750 |
| 207 | Ga0068859_100031499 | 3300005617 | Bacteria | 5325 |
| 208 | Ga0068859_100049550 | 3300005617 | Bacteria | 4218 |
| 209 | Ga0068859_100231493 | 3300005617 | Bacteria | 1936 |
| 210 | Ga0068864_100000069 | 3300005618 | Bacteria | 114134 |
| 211 | Ga0068864_100000194 | 3300005618 | Bacteria | 55652 |
| 212 | Ga0068864_100000235 | 3300005618 | Bacteria | 49611 |
| 213 | Ga0068864_100000711 | 3300005618 | Bacteria | 27933 |
| 214 | Ga0068864_100006624 | 3300005618 | Bacteria | 9479 |
| 215 | Ga0068864_100159474 | 3300005618 | Bacteria | 2050 |
| 216 | Ga0068864_100230836 | 3300005618 | Bacteria | 1711 |
| 217 | Ga0068861_100000004 | 3300005719 | Bacteria | 105907 |
| 218 | Ga0068861_100004343 | 3300005719 | Bacteria | 9511 |
| 219 | Ga0068861_100007263 | 3300005719 | Bacteria | 7592 |
| 220 | Ga0068861_100008680 | 3300005719 | Bacteria | 6991 |
| 221 | Ga0068863_100000103 | 3300005841 | Bacteria | 91380 |
| 222 | Ga0068863_100000140 | 3300005841 | Bacteria | 76175 |
| 223 | Ga0068863_100000187 | 3300005841 | Bacteria | 65873 |
| 224 | Ga0068863_100000258 | 3300005841 | Bacteria | 55428 |
| 225 | Ga0068863_100002289 | 3300005841 | Bacteria | 19027 |
| 226 | Ga0068863_100003456 | 3300005841 | Bacteria | 15582 |
| 227 | Ga0068863_100004622 | 3300005841 | Bacteria | 13561 |
| 228 | Ga0068863_100004697 | 3300005841 | Bacteria | 13461 |
| 229 | Ga0068863_100016390 | 3300005841 | Bacteria | 7108 |
| 230 | Ga0068863_100029062 | 3300005841 | Bacteria | 5280 |
| 231 | Ga0068863_100109995 | 3300005841 | Bacteria | 2624 |
| 232 | Ga0068858_100000514 | 3300005842 | Bacteria | 40588 |
| 233 | Ga0068858_100000695 | 3300005842 | Bacteria | 35157 |
| 234 | Ga0068858_100001621 | 3300005842 | Bacteria | 22962 |
| 235 | Ga0068858_100002738 | 3300005842 | Bacteria | 17727 |
| 236 | Ga0068858_100069876 | 3300005842 | Bacteria | 3255 |
| 237 | Ga0068860_100000022 | 3300005843 | Bacteria | 279209 |
| 238 | Ga0068860_100000442 | 3300005843 | Bacteria | 52295 |
| 239 | Ga0068860_100001488 | 3300005843 | Bacteria | 25286 |
| 240 | Ga0068860_100004667 | 3300005843 | Bacteria | 13989 |
| 241 | Ga0068860_100018036 | 3300005843 | Bacteria | 6872 |
| 242 | Ga0068860_100076957 | 3300005843 | Bacteria | 3173 |
| 243 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 244 | Ga0068862_100000070 | 3300005844 | Bacteria | 122289 |
| 245 | Ga0068862_100000082 | 3300005844 | Bacteria | 113125 |
| 246 | Ga0068862_100000289 | 3300005844 | Bacteria | 55428 |
| 247 | Ga0068862_100002718 | 3300005844 | Bacteria | 15522 |
| 248 | Ga0068862_100016013 | 3300005844 | Bacteria | 6235 |
| 249 | Ga0068862_100182504 | 3300005844 | Bacteria | 1884 |
| 250 | Ga0081455_10000029 | 3300005937 | Bacteria | 155672 |
| 251 | Ga0081455_10000392 | 3300005937 | Bacteria | 57696 |
| 252 | Ga0081540_1000048 | 3300005983 | Bacteria | 127924 |
| 253 | Ga0081539_10014655 | 3300005985 | Bacteria | 5772 |
| 254 | Ga0075368_10008487 | 3300006042 | Bacteria | 3661 |
| 255 | Ga0075364_10008502 | 3300006051 | Bacteria | 6139 |
| 256 | Ga0075367_10017386 | 3300006178 | Bacteria | 3947 |
| 257 | Ga0075367_10116249 | 3300006178 | Bacteria | 1645 |
| 258 | Ga0075366_10000241 | 3300006195 | Bacteria | 24314 |
| 259 | Ga0068871_100053035 | 3300006358 | Bacteria | 3286 |
| 260 | Ga0075428_100084896 | 3300006844 | Bacteria | 3454 |
| 261 | Ga0075428_100119007 | 3300006844 | Bacteria | 2876 |
| 262 | Ga0075428_100268097 | 3300006844 | Bacteria | 1837 |
| 263 | Ga0075430_100022172 | 3300006846 | Bacteria | 5399 |
| 264 | Ga0075430_100039288 | 3300006846 | Bacteria | 4007 |
| 265 | Ga0075431_100009478 | 3300006847 | Bacteria | 9776 |
| 266 | Ga0075431_100019995 | 3300006847 | Bacteria | 6836 |
| 267 | Ga0075431_100272780 | 3300006847 | Bacteria | 1714 |
| 268 | Ga0075433_10005933 | 3300006852 | Bacteria | 9619 |
| 269 | Ga0075434_100003078 | 3300006871 | Bacteria | 14838 |
| 270 | Ga0075434_100006345 | 3300006871 | Bacteria | 10841 |
| 271 | Ga0075429_100172609 | 3300006880 | Bacteria | 1894 |
| 272 | Ga0068865_100000032 | 3300006881 | Bacteria | 88205 |
| 273 | Ga0068865_100012549 | 3300006881 | Bacteria | 5337 |
| 274 | Ga0097620_100000136 | 3300006931 | Bacteria | 68907 |
| 275 | Ga0097620_100000623 | 3300006931 | Bacteria | 35426 |
| 276 | Ga0097620_100006621 | 3300006931 | Bacteria | 11765 |
| 277 | Ga0097620_100007966 | 3300006931 | Bacteria | 10750 |
| 278 | Ga0097620_100031502 | 3300006931 | Bacteria | 5325 |
| 279 | Ga0097620_100049551 | 3300006931 | Bacteria | 4218 |
| 280 | Ga0097620_100231486 | 3300006931 | Bacteria | 1936 |
| 281 | Ga0105251_10000815 | 3300009011 | Bacteria | 28051 |
| 282 | Ga0105251_10031794 | 3300009011 | Bacteria | 2637 |
| 283 | Ga0105240_10011600 | 3300009093 | Bacteria | 12261 |
| 284 | Ga0105240_10095948 | 3300009093 | Bacteria | 3615 |
| 285 | Ga0105240_10179509 | 3300009093 | Bacteria | 2500 |
| 286 | Ga0111539_10067078 | 3300009094 | Bacteria | 4238 |
| 287 | Ga0111539_10114699 | 3300009094 | Bacteria | 3160 |
| 288 | Ga0111539_10223978 | 3300009094 | Bacteria | 2191 |
| 289 | Ga0111539_10231512 | 3300009094 | Bacteria | 2151 |
| 290 | Ga0111539_10235181 | 3300009094 | Bacteria | 2133 |
| 291 | Ga0111539_10323458 | 3300009094 | Bacteria | 1795 |
| 292 | Ga0105245_10000170 | 3300009098 | Bacteria | 61721 |
| 293 | Ga0105245_10001290 | 3300009098 | Bacteria | 22584 |
| 294 | Ga0105245_10182092 | 3300009098 | Bacteria | 2008 |
| 295 | Ga0105247_10000483 | 3300009101 | Bacteria | 33208 |
| 296 | Ga0105247_10103828 | 3300009101 | Bacteria | 1820 |
| 297 | Ga0105243_10000933 | 3300009148 | Bacteria | 27415 |
| 298 | Ga0105243_10081629 | 3300009148 | Bacteria | 2640 |
| 299 | Ga0105243_10207048 | 3300009148 | Bacteria | 1724 |
| 300 | Ga0105241_10018566 | 3300009174 | Bacteria | 5117 |
| 301 | Ga0105241_10170578 | 3300009174 | Bacteria | 1797 |
| 302 | Ga0105242_10007089 | 3300009176 | Bacteria | 8658 |
| 303 | Ga0105248_10000012 | 3300009177 | Bacteria | 333963 |
| 304 | Ga0105248_10000101 | 3300009177 | Bacteria | 95328 |
| 305 | Ga0105248_10000184 | 3300009177 | Bacteria | 72728 |
| 306 | Ga0105248_10001646 | 3300009177 | Bacteria | 24849 |
| 307 | Ga0105248_10002069 | 3300009177 | Bacteria | 22227 |
| 308 | Ga0105248_10004489 | 3300009177 | Bacteria | 15445 |
| 309 | Ga0105248_10040085 | 3300009177 | Bacteria | 5249 |
| 310 | Ga0105248_10058095 | 3300009177 | Bacteria | 4343 |
| 311 | Ga0105248_10084464 | 3300009177 | Bacteria | 3571 |
| 312 | Ga0105248_10665958 | 3300009177 | Bacteria | 1174 |
| 313 | Ga0105237_10024781 | 3300009545 | Bacteria | 6138 |
| 314 | Ga0105237_10065812 | 3300009545 | Bacteria | 3619 |
| 315 | Ga0105238_10019570 | 3300009551 | Bacteria | 6894 |
| 316 | Ga0105238_10069194 | 3300009551 | Bacteria | 3530 |
| 317 | Ga0105238_10105601 | 3300009551 | Bacteria | 2798 |
| 318 | Ga0105238_10187714 | 3300009551 | Bacteria | 2043 |
| 319 | Ga0105238_10273984 | 3300009551 | Bacteria | 1668 |
| 320 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 321 | Ga0105249_10000014 | 3300009553 | Bacteria | 283274 |
| 322 | Ga0105249_10000099 | 3300009553 | Bacteria | 119885 |
| 323 | Ga0105249_10009606 | 3300009553 | Bacteria | 8476 |
| 324 | Ga0105249_10019397 | 3300009553 | Bacteria | 6067 |
| 325 | Ga0105246_10031393 | 3300011119 | Bacteria | 3515 |
| 326 | Ga0105246_10034472 | 3300011119 | Bacteria | 3374 |
| 327 | Ga0105246_10065734 | 3300011119 | Bacteria | 2536 |
| 328 | Ga0157373_10115137 | 3300013100 | Bacteria | 1890 |
| 329 | Ga0157373_10201695 | 3300013100 | Bacteria | 1402 |
| 330 | Ga0157373_10248426 | 3300013100 | Bacteria | 1258 |
| 331 | Ga0157373_10302024 | 3300013100 | Bacteria | 1136 |
| 332 | Ga0157371_10000443 | 3300013102 | Bacteria | 50736 |
| 333 | Ga0157371_10002185 | 3300013102 | Bacteria | 18986 |
| 334 | Ga0157371_10036317 | 3300013102 | Bacteria | 3529 |
| 335 | Ga0157371_10101373 | 3300013102 | Bacteria | 2042 |
| 336 | Ga0157371_10138748 | 3300013102 | Bacteria | 1732 |
| 337 | Ga0157370_10005863 | 3300013104 | Bacteria | 13714 |
| 338 | Ga0157370_10010104 | 3300013104 | Bacteria | 9968 |
| 339 | Ga0157370_10125144 | 3300013104 | Bacteria | 2400 |
| 340 | Ga0157370_10151588 | 3300013104 | Bacteria | 2157 |
| 341 | Ga0157369_10000043 | 3300013105 | Bacteria | 180713 |
| 342 | Ga0157369_10014002 | 3300013105 | Bacteria | 9061 |
| 343 | Ga0157369_10021037 | 3300013105 | Bacteria | 7293 |
| 344 | Ga0157369_10047977 | 3300013105 | Bacteria | 4635 |
| 345 | Ga0157369_10099382 | 3300013105 | Bacteria | 3102 |
| 346 | Ga0157369_10159054 | 3300013105 | Bacteria | 2385 |
| 347 | Ga0157374_10001444 | 3300013296 | Bacteria | 20100 |
| 348 | Ga0157374_10008229 | 3300013296 | Bacteria | 8910 |
| 349 | Ga0157378_10000312 | 3300013297 | Bacteria | 47527 |
| 350 | Ga0157378_10001339 | 3300013297 | Bacteria | 22132 |
| 351 | Ga0157378_10093283 | 3300013297 | Bacteria | 2740 |
| 352 | Ga0157378_10196811 | 3300013297 | Bacteria | 1904 |
| 353 | Ga0157378_10323661 | 3300013297 | Bacteria | 1498 |
| 354 | Ga0163162_10004881 | 3300013306 | Bacteria | 12932 |
| 355 | Ga0163162_10050805 | 3300013306 | Bacteria | 4158 |
| 356 | Ga0163162_10164709 | 3300013306 | Bacteria | 2340 |
| 357 | Ga0157372_10141581 | 3300013307 | Bacteria | 2771 |
| 358 | Ga0157372_10208642 | 3300013307 | Bacteria | 2263 |
| 359 | Ga0157372_10403546 | 3300013307 | Bacteria | 1593 |
| 360 | Ga0157372_10559854 | 3300013307 | Bacteria | 1333 |
| 361 | Ga0157375_10006351 | 3300013308 | Bacteria | 10301 |
| 362 | Ga0157375_10014738 | 3300013308 | Bacteria | 6987 |
| 363 | Ga0157375_10389614 | 3300013308 | Bacteria | 1560 |
| 364 | Ga0163163_10000131 | 3300014325 | Bacteria | 76809 |
| 365 | Ga0163163_10112163 | 3300014325 | Bacteria | 2756 |
| 366 | Ga0157380_10000681 | 3300014326 | Bacteria | 21070 |
| 367 | Ga0157380_10000793 | 3300014326 | Bacteria | 19836 |
| 368 | Ga0157380_10020827 | 3300014326 | Bacteria | 4909 |
| 369 | Ga0157380_10060921 | 3300014326 | Bacteria | 3018 |
| 370 | Ga0157380_10157232 | 3300014326 | Bacteria | 1971 |
| 371 | Ga0157379_10009221 | 3300014968 | Bacteria | 8594 |
| 372 | Ga0157379_10011780 | 3300014968 | Bacteria | 7637 |
| 373 | Ga0157379_10028865 | 3300014968 | Bacteria | 4934 |
| 374 | Ga0157379_10041621 | 3300014968 | Bacteria | 4102 |
| 375 | Ga0157376_10000678 | 3300014969 | Bacteria | 22046 |
| 376 | Ga0183363_1010 | 3300015690 | Bacteria | 108191 |
| 377 | Ga0183361_10895 | 3300016635 | Bacteria | 1437 |
| 378 | Ga0163161_10000186 | 3300017792 | Bacteria | 57200 |
| 379 | Ga0163161_10102018 | 3300017792 | Bacteria | 2137 |
| 380 | Ga0206353_12009786 | 3300020082 | Bacteria | 8481 |
| 381 | Ga0213876_10000371 | 3300021384 | Bacteria | 38154 |
| 382 | Ga0213876_10022864 | 3300021384 | Bacteria | 3303 |
| 383 | Ga0213876_10038133 | 3300021384 | Bacteria | 2535 |
| 384 | Ga0213875_10005028 | 3300021388 | Bacteria | 7167 |
| 385 | Ga0213875_10005786 | 3300021388 | Bacteria | 6580 |
| 386 | Ga0207672_1000691 | 3300025223 | Bacteria | 3886 |
| 387 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 388 | Ga0209233_1021520 | 3300025261 | Bacteria | 1667 |
| 389 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 390 | Ga0209673_1003983 | 3300025273 | Bacteria | 8216 |
| 391 | Ga0209675_1009823 | 3300025291 | Bacteria | 3337 |
| 392 | Ga0209564_1016878 | 3300025295 | Bacteria | 2879 |
| 393 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 394 | Ga0209050_1003356 | 3300025298 | Bacteria | 11930 |
| 395 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 396 | Ga0209257_1002535 | 3300025304 | Bacteria | 17892 |
| 397 | Ga0209257_1008172 | 3300025304 | Bacteria | 6056 |
| 398 | Ga0207697_10000063 | 3300025315 | Bacteria | 45019 |
| 399 | Ga0207697_10028821 | 3300025315 | Bacteria | 2271 |
| 400 | Ga0207713_1006255 | 3300025735 | Bacteria | 7287 |
| 401 | Ga0207713_1027808 | 3300025735 | Bacteria | 2561 |
| 402 | Ga0207682_10005874 | 3300025893 | Bacteria | 4976 |
| 403 | Ga0207682_10029749 | 3300025893 | Bacteria | 2185 |
| 404 | Ga0207710_10001070 | 3300025900 | Bacteria | 14117 |
| 405 | Ga0207710_10055700 | 3300025900 | Bacteria | 1782 |
| 406 | Ga0207688_10000106 | 3300025901 | Bacteria | 33178 |
| 407 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 408 | Ga0207680_10008448 | 3300025903 | Bacteria | 5055 |
| 409 | Ga0207647_10000246 | 3300025904 | Bacteria | 44259 |
| 410 | Ga0207647_10000331 | 3300025904 | Bacteria | 38861 |
| 411 | Ga0207647_10009560 | 3300025904 | Bacteria | 6881 |
| 412 | Ga0207647_10020217 | 3300025904 | Bacteria | 4466 |
| 413 | Ga0207647_10054146 | 3300025904 | Bacteria | 2469 |
| 414 | Ga0207645_10010447 | 3300025907 | Bacteria | 6372 |
| 415 | Ga0207645_10051608 | 3300025907 | Bacteria | 2628 |
| 416 | Ga0207643_10033521 | 3300025908 | Bacteria | 2873 |
| 417 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 418 | Ga0207705_10000033 | 3300025909 | Bacteria | 223997 |
| 419 | Ga0207705_10000037 | 3300025909 | Bacteria | 197951 |
| 420 | Ga0207705_10000067 | 3300025909 | Bacteria | 136004 |
| 421 | Ga0207705_10000809 | 3300025909 | Bacteria | 25712 |
| 422 | Ga0207705_10000978 | 3300025909 | Bacteria | 23330 |
| 423 | Ga0207705_10004300 | 3300025909 | Bacteria | 10784 |
| 424 | Ga0207705_10015141 | 3300025909 | Bacteria | 5544 |
| 425 | Ga0207705_10017324 | 3300025909 | Bacteria | 5158 |
| 426 | Ga0207705_10039863 | 3300025909 | Bacteria | 3367 |
| 427 | Ga0207705_10188112 | 3300025909 | Bacteria | 1560 |
| 428 | Ga0207705_10247395 | 3300025909 | Bacteria | 1359 |
| 429 | Ga0207654_10004414 | 3300025911 | Bacteria | 7097 |
| 430 | Ga0207707_10093083 | 3300025912 | Bacteria | 2633 |
| 431 | Ga0207707_10095823 | 3300025912 | Bacteria | 2593 |
| 432 | Ga0207707_10148459 | 3300025912 | Bacteria | 2050 |
| 433 | Ga0207695_10001498 | 3300025913 | Bacteria | 38870 |
| 434 | Ga0207695_10003382 | 3300025913 | Bacteria | 22540 |
| 435 | Ga0207695_10051931 | 3300025913 | Bacteria | 4300 |
| 436 | Ga0207695_10063442 | 3300025913 | Bacteria | 3809 |
| 437 | Ga0207695_10177724 | 3300025913 | Bacteria | 2050 |
| 438 | Ga0207695_10222370 | 3300025913 | Bacteria | 1795 |
| 439 | Ga0207671_10000350 | 3300025914 | Bacteria | 66648 |
| 440 | Ga0207671_10014386 | 3300025914 | Bacteria | 6257 |
| 441 | Ga0207660_10000024 | 3300025917 | Bacteria | 71220 |
| 442 | Ga0207660_10000379 | 3300025917 | Bacteria | 29073 |
| 443 | Ga0207660_10038338 | 3300025917 | Bacteria | 3344 |
| 444 | Ga0207662_10157465 | 3300025918 | Bacteria | 1449 |
| 445 | Ga0207657_10002106 | 3300025919 | Bacteria | 21522 |
| 446 | Ga0207657_10003198 | 3300025919 | Bacteria | 17527 |
| 447 | Ga0207657_10006174 | 3300025919 | Bacteria | 12455 |
| 448 | Ga0207657_10013805 | 3300025919 | Bacteria | 7906 |
| 449 | Ga0207657_10028113 | 3300025919 | Bacteria | 5137 |
| 450 | Ga0207657_10070581 | 3300025919 | Bacteria | 2960 |
| 451 | Ga0207657_10080802 | 3300025919 | Bacteria | 2732 |
| 452 | Ga0207657_10172193 | 3300025919 | Bacteria | 1753 |
| 453 | Ga0207649_10002320 | 3300025920 | Bacteria | 10689 |
| 454 | Ga0207649_10020713 | 3300025920 | Bacteria | 3774 |
| 455 | Ga0207649_10046858 | 3300025920 | Bacteria | 2658 |
| 456 | Ga0207649_10106389 | 3300025920 | Bacteria | 1866 |
| 457 | Ga0207649_10111966 | 3300025920 | Bacteria | 1825 |
| 458 | Ga0207652_10000058 | 3300025921 | Bacteria | 113620 |
| 459 | Ga0207652_10118010 | 3300025921 | Bacteria | 2358 |
| 460 | Ga0207652_10239491 | 3300025921 | Bacteria | 1635 |
| 461 | Ga0207652_10326415 | 3300025921 | Bacteria | 1385 |
| 462 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 463 | Ga0207681_10000074 | 3300025923 | Bacteria | 89861 |
| 464 | Ga0207681_10006262 | 3300025923 | Bacteria | 7302 |
| 465 | Ga0207681_10019791 | 3300025923 | Bacteria | 4259 |
| 466 | Ga0207681_10020235 | 3300025923 | Bacteria | 4214 |
| 467 | Ga0207681_10057287 | 3300025923 | Bacteria | 2662 |
| 468 | Ga0207681_10066779 | 3300025923 | Bacteria | 2490 |
| 469 | Ga0207681_10117248 | 3300025923 | Bacteria | 1947 |
| 470 | Ga0207694_10000447 | 3300025924 | Bacteria | 38252 |
| 471 | Ga0207694_10032047 | 3300025924 | Bacteria | 4021 |
| 472 | Ga0207694_10096889 | 3300025924 | Bacteria | 2333 |
| 473 | Ga0207650_10000148 | 3300025925 | Bacteria | 85425 |
| 474 | Ga0207650_10000881 | 3300025925 | Bacteria | 22724 |
| 475 | Ga0207650_10002874 | 3300025925 | Bacteria | 11892 |
| 476 | Ga0207650_10002923 | 3300025925 | Bacteria | 11787 |
| 477 | Ga0207650_10010288 | 3300025925 | Bacteria | 6413 |
| 478 | Ga0207650_10010656 | 3300025925 | Bacteria | 6313 |
| 479 | Ga0207650_10101664 | 3300025925 | Bacteria | 2214 |
| 480 | Ga0207659_10006612 | 3300025926 | Bacteria | 7119 |
| 481 | Ga0207659_10008219 | 3300025926 | Bacteria | 6467 |
| 482 | Ga0207687_10004280 | 3300025927 | Bacteria | 9538 |
| 483 | Ga0207700_10028022 | 3300025928 | Bacteria | 3952 |
| 484 | Ga0207644_10001029 | 3300025931 | Bacteria | 17849 |
| 485 | Ga0207644_10002933 | 3300025931 | Bacteria | 10986 |
| 486 | Ga0207644_10157182 | 3300025931 | Bacteria | 1764 |
| 487 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 488 | Ga0207690_10005149 | 3300025932 | Bacteria | 7716 |
| 489 | Ga0207690_10005477 | 3300025932 | Bacteria | 7487 |
| 490 | Ga0207690_10014175 | 3300025932 | Bacteria | 4809 |
| 491 | Ga0207690_10031844 | 3300025932 | Bacteria | 3379 |
| 492 | Ga0207690_10032243 | 3300025932 | Bacteria | 3360 |
| 493 | Ga0207690_10036018 | 3300025932 | Bacteria | 3202 |
| 494 | Ga0207690_10061849 | 3300025932 | Bacteria | 2547 |
| 495 | Ga0207690_10072352 | 3300025932 | Bacteria | 2381 |
| 496 | Ga0207690_10139457 | 3300025932 | Bacteria | 1785 |
| 497 | Ga0207706_10000224 | 3300025933 | Bacteria | 62043 |
| 498 | Ga0207706_10004809 | 3300025933 | Bacteria | 12649 |
| 499 | Ga0207706_10005888 | 3300025933 | Bacteria | 11401 |
| 500 | Ga0207706_10005974 | 3300025933 | Bacteria | 11322 |
| 501 | Ga0207706_10020915 | 3300025933 | Bacteria | 5875 |
| 502 | Ga0207686_10015896 | 3300025934 | Bacteria | 4216 |
| 503 | Ga0207709_10000276 | 3300025935 | Bacteria | 59937 |
| 504 | Ga0207670_10026322 | 3300025936 | Bacteria | 3664 |
| 505 | Ga0207669_10009446 | 3300025937 | Bacteria | 4645 |
| 506 | Ga0207704_10000034 | 3300025938 | Bacteria | 98810 |
| 507 | Ga0207691_10000750 | 3300025940 | Bacteria | 32085 |
| 508 | Ga0207691_10007047 | 3300025940 | Bacteria | 10845 |
| 509 | Ga0207691_10136897 | 3300025940 | Bacteria | 2159 |
| 510 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 511 | Ga0207711_10000105 | 3300025941 | Bacteria | 90036 |
| 512 | Ga0207711_10000917 | 3300025941 | Bacteria | 28411 |
| 513 | Ga0207711_10005144 | 3300025941 | Bacteria | 11089 |
| 514 | Ga0207711_10013512 | 3300025941 | Bacteria | 6779 |
| 515 | Ga0207711_10013792 | 3300025941 | Bacteria | 6710 |
| 516 | Ga0207711_10150956 | 3300025941 | Bacteria | 2096 |
| 517 | Ga0207689_10000051 | 3300025942 | Bacteria | 88480 |
| 518 | Ga0207689_10001065 | 3300025942 | Bacteria | 26408 |
| 519 | Ga0207689_10093018 | 3300025942 | Bacteria | 2477 |
| 520 | Ga0207661_10014353 | 3300025944 | Bacteria | 5804 |
| 521 | Ga0207679_10008122 | 3300025945 | Bacteria | 6678 |
| 522 | Ga0207679_10033900 | 3300025945 | Bacteria | 3597 |
| 523 | Ga0207679_10095984 | 3300025945 | Bacteria | 2306 |
| 524 | Ga0207679_10108531 | 3300025945 | Bacteria | 2185 |
| 525 | Ga0207679_10143950 | 3300025945 | Bacteria | 1930 |
| 526 | Ga0207667_10000013 | 3300025949 | Bacteria | 435875 |
| 527 | Ga0207667_10000314 | 3300025949 | Bacteria | 67212 |
| 528 | Ga0207667_10000828 | 3300025949 | Bacteria | 39983 |
| 529 | Ga0207667_10006507 | 3300025949 | Bacteria | 14135 |
| 530 | Ga0207667_10007100 | 3300025949 | Bacteria | 13519 |
| 531 | Ga0207667_10007493 | 3300025949 | Bacteria | 13099 |
| 532 | Ga0207667_10028577 | 3300025949 | Bacteria | 6055 |
| 533 | Ga0207667_10064744 | 3300025949 | Bacteria | 3815 |
| 534 | Ga0207667_10133914 | 3300025949 | Bacteria | 2552 |
| 535 | Ga0207667_10255812 | 3300025949 | Bacteria | 1791 |
| 536 | Ga0207667_10282364 | 3300025949 | Bacteria | 1696 |
| 537 | Ga0207667_10348085 | 3300025949 | Bacteria | 1511 |
| 538 | Ga0207667_10405370 | 3300025949 | Bacteria | 1388 |
| 539 | Ga0207651_10000010 | 3300025960 | Bacteria | 193754 |
| 540 | Ga0207651_10000232 | 3300025960 | Bacteria | 24043 |
| 541 | Ga0207651_10218034 | 3300025960 | Bacteria | 1540 |
| 542 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 543 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 544 | Ga0207712_10000161 | 3300025961 | Bacteria | 69260 |
| 545 | Ga0207712_10014190 | 3300025961 | Bacteria | 5117 |
| 546 | Ga0207712_10025579 | 3300025961 | Bacteria | 3923 |
| 547 | Ga0207668_10000094 | 3300025972 | Bacteria | 63810 |
| 548 | Ga0207668_10000416 | 3300025972 | Bacteria | 26868 |
| 549 | Ga0207668_10004688 | 3300025972 | Bacteria | 8043 |
| 550 | Ga0207668_10031542 | 3300025972 | Bacteria | 3492 |
| 551 | Ga0207668_10066395 | 3300025972 | Bacteria | 2557 |
| 552 | Ga0207668_10069875 | 3300025972 | Bacteria | 2502 |
| 553 | Ga0207668_10107533 | 3300025972 | Bacteria | 2086 |
| 554 | Ga0207668_10146770 | 3300025972 | Bacteria | 1821 |
| 555 | Ga0207640_10002534 | 3300025981 | Bacteria | 9792 |
| 556 | Ga0207640_10003179 | 3300025981 | Bacteria | 8837 |
| 557 | Ga0207640_10004079 | 3300025981 | Bacteria | 7893 |
| 558 | Ga0207640_10099354 | 3300025981 | Bacteria | 2037 |
| 559 | Ga0207640_10175318 | 3300025981 | Bacteria | 1602 |
| 560 | Ga0207658_10000023 | 3300025986 | Bacteria | 190806 |
| 561 | Ga0207658_10000077 | 3300025986 | Bacteria | 108352 |
| 562 | Ga0207658_10000232 | 3300025986 | Bacteria | 58908 |
| 563 | Ga0207658_10000260 | 3300025986 | Bacteria | 55292 |
| 564 | Ga0207658_10000492 | 3300025986 | Bacteria | 36290 |
| 565 | Ga0207658_10001737 | 3300025986 | Bacteria | 16425 |
| 566 | Ga0207658_10001956 | 3300025986 | Bacteria | 15383 |
| 567 | Ga0207677_10000021 | 3300026023 | Bacteria | 131828 |
| 568 | Ga0207677_10000100 | 3300026023 | Bacteria | 70908 |
| 569 | Ga0207703_10001299 | 3300026035 | Bacteria | 23105 |
| 570 | Ga0207703_10001367 | 3300026035 | Bacteria | 22279 |
| 571 | Ga0207703_10002288 | 3300026035 | Bacteria | 16700 |
| 572 | Ga0207703_10003246 | 3300026035 | Bacteria | 13663 |
| 573 | Ga0207639_10002776 | 3300026041 | Bacteria | 11763 |
| 574 | Ga0207639_10006433 | 3300026041 | Bacteria | 7987 |
| 575 | Ga0207639_10030466 | 3300026041 | Bacteria | 3957 |
| 576 | Ga0207639_10032279 | 3300026041 | Bacteria | 3854 |
| 577 | Ga0207639_10065494 | 3300026041 | Bacteria | 2821 |
| 578 | Ga0207639_10086092 | 3300026041 | Bacteria | 2501 |
| 579 | Ga0207678_10001937 | 3300026067 | Bacteria | 18896 |
| 580 | Ga0207678_10002816 | 3300026067 | Bacteria | 15773 |
| 581 | Ga0207678_10008447 | 3300026067 | Bacteria | 9082 |
| 582 | Ga0207678_10019305 | 3300026067 | Bacteria | 5988 |
| 583 | Ga0207678_10037617 | 3300026067 | Bacteria | 4208 |
| 584 | Ga0207678_10091269 | 3300026067 | Bacteria | 2603 |
| 585 | Ga0207678_10123604 | 3300026067 | Bacteria | 2208 |
| 586 | Ga0207702_10000566 | 3300026078 | Bacteria | 41185 |
| 587 | Ga0207702_10001153 | 3300026078 | Bacteria | 27012 |
| 588 | Ga0207702_10005396 | 3300026078 | Bacteria | 11197 |
| 589 | Ga0207702_10033715 | 3300026078 | Bacteria | 4278 |
| 590 | Ga0207702_10056561 | 3300026078 | Bacteria | 3331 |
| 591 | Ga0207702_10058096 | 3300026078 | Bacteria | 3291 |
| 592 | Ga0207702_10073246 | 3300026078 | Bacteria | 2953 |
| 593 | Ga0207702_10257847 | 3300026078 | Bacteria | 1640 |
| 594 | Ga0207702_10430719 | 3300026078 | Bacteria | 1277 |
| 595 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 596 | Ga0207641_10000113 | 3300026088 | Bacteria | 119188 |
| 597 | Ga0207641_10000172 | 3300026088 | Bacteria | 90549 |
| 598 | Ga0207641_10000192 | 3300026088 | Bacteria | 83746 |
| 599 | Ga0207641_10000243 | 3300026088 | Bacteria | 70600 |
| 600 | Ga0207641_10000269 | 3300026088 | Bacteria | 66008 |
| 601 | Ga0207641_10003354 | 3300026088 | Bacteria | 14239 |
| 602 | Ga0207641_10003551 | 3300026088 | Bacteria | 13782 |
| 603 | Ga0207641_10004624 | 3300026088 | Bacteria | 11886 |
| 604 | Ga0207641_10007289 | 3300026088 | Bacteria | 9215 |
| 605 | Ga0207641_10371123 | 3300026088 | Bacteria | 1368 |
| 606 | Ga0207648_10000219 | 3300026089 | Bacteria | 61792 |
| 607 | Ga0207648_10000221 | 3300026089 | Bacteria | 61280 |
| 608 | Ga0207648_10022651 | 3300026089 | Bacteria | 5639 |
| 609 | Ga0207676_10000009 | 3300026095 | Bacteria | 545256 |
| 610 | Ga0207676_10000046 | 3300026095 | Bacteria | 149037 |
| 611 | Ga0207676_10000300 | 3300026095 | Bacteria | 42535 |
| 612 | Ga0207676_10000709 | 3300026095 | Bacteria | 26254 |
| 613 | Ga0207676_10032624 | 3300026095 | Bacteria | 3926 |
| 614 | Ga0207676_10048363 | 3300026095 | Bacteria | 3301 |
| 615 | Ga0207676_10066411 | 3300026095 | Bacteria | 2877 |
| 616 | Ga0207674_10002274 | 3300026116 | Bacteria | 24350 |
| 617 | Ga0207674_10009750 | 3300026116 | Bacteria | 10940 |
| 618 | Ga0207674_10026673 | 3300026116 | Bacteria | 6129 |
| 619 | Ga0207674_10132360 | 3300026116 | Bacteria | 2456 |
| 620 | Ga0207674_10155587 | 3300026116 | Bacteria | 2241 |
| 621 | Ga0207674_10162057 | 3300026116 | Bacteria | 2191 |
| 622 | Ga0207674_10185975 | 3300026116 | Bacteria | 2028 |
| 623 | Ga0207674_10218544 | 3300026116 | Bacteria | 1854 |
| 624 | Ga0207675_100000032 | 3300026118 | Bacteria | 108677 |
| 625 | Ga0207675_100000370 | 3300026118 | Bacteria | 43070 |
| 626 | Ga0207675_100001422 | 3300026118 | Bacteria | 23981 |
| 627 | Ga0207675_100032035 | 3300026118 | Bacteria | 4897 |
| 628 | Ga0207683_10087090 | 3300026121 | Bacteria | 2777 |
| 629 | Ga0207683_10185608 | 3300026121 | Bacteria | 1887 |
| 630 | Ga0207698_10002929 | 3300026142 | Bacteria | 10207 |
| 631 | Ga0207698_10016134 | 3300026142 | Bacteria | 5025 |
| 632 | Ga0207698_10032606 | 3300026142 | Bacteria | 3776 |
| 633 | Ga0207698_10042867 | 3300026142 | Bacteria | 3385 |
| 634 | Ga0207698_10132459 | 3300026142 | Bacteria | 2133 |
| 635 | Ga0209813_10006694 | 3300027866 | Bacteria | 2854 |
| 636 | Ga0209974_10006485 | 3300027876 | Bacteria | 4083 |
| 637 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 638 | Ga0268266_10000200 | 3300028379 | Bacteria | 104456 |
| 639 | Ga0268266_10035494 | 3300028379 | Bacteria | 4241 |
| 640 | Ga0268266_10169509 | 3300028379 | Bacteria | 1981 |
| 641 | Ga0268266_10246760 | 3300028379 | Bacteria | 1650 |
| 642 | Ga0268265_10000026 | 3300028380 | Bacteria | 246653 |
| 643 | Ga0268265_10000030 | 3300028380 | Bacteria | 228157 |
| 644 | Ga0268265_10000176 | 3300028380 | Bacteria | 76619 |
| 645 | Ga0268265_10000334 | 3300028380 | Bacteria | 51202 |
| 646 | Ga0268265_10000808 | 3300028380 | Bacteria | 29755 |
| 647 | Ga0268265_10068743 | 3300028380 | Bacteria | 2748 |
| 648 | Ga0268265_10092209 | 3300028380 | Bacteria | 2424 |
| 649 | Ga0268265_10142110 | 3300028380 | Bacteria | 2011 |
| 650 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 651 | Ga0268264_10000214 | 3300028381 | Bacteria | 114177 |
| 652 | Ga0268264_10000491 | 3300028381 | Bacteria | 52312 |
| 653 | Ga0268264_10000548 | 3300028381 | Bacteria | 47198 |
| 654 | Ga0268264_10008037 | 3300028381 | Bacteria | 8772 |
| 655 | Ga0268264_10013846 | 3300028381 | Bacteria | 6633 |
| 656 | Ga0268264_10056951 | 3300028381 | Bacteria | 3268 |
| 657 | Ga0268264_10197413 | 3300028381 | Bacteria | 1838 |
| 658 | Ga0307517_10025548 | 3300028786 | Bacteria | 7216 |
| 659 | Ga0265330_10002833 | 3300031235 | Bacteria | 9286 |
| 660 | Ga0265340_10000018 | 3300031247 | Bacteria | 90851 |
| 661 | Ga0265340_10040091 | 3300031247 | Bacteria | 2307 |
| 662 | Ga0265316_10005193 | 3300031344 | Bacteria | 12739 |
| 663 | Ga0307513_10018836 | 3300031456 | Bacteria | 8237 |
| 664 | Ga0307408_100004543 | 3300031548 | Bacteria | 9400 |
| 665 | Ga0307408_100008196 | 3300031548 | Bacteria | 6903 |
| 666 | Ga0307408_100039656 | 3300031548 | Bacteria | 3331 |
| 667 | Ga0307408_100070852 | 3300031548 | Bacteria | 2575 |
| 668 | Ga0307408_100133248 | 3300031548 | Bacteria | 1941 |
| 669 | Ga0307408_100145470 | 3300031548 | Bacteria | 1865 |
| 670 | Ga0307408_100209744 | 3300031548 | Bacteria | 1582 |
| 671 | Ga0307408_100303929 | 3300031548 | Bacteria | 1337 |
| 672 | Ga0265313_10055027 | 3300031595 | Bacteria | 1886 |
| 673 | Ga0265342_10024398 | 3300031712 | Bacteria | 3817 |
| 674 | Ga0307405_10000196 | 3300031731 | Bacteria | 22239 |
| 675 | Ga0307405_10010011 | 3300031731 | Bacteria | 4889 |
| 676 | Ga0307405_10020967 | 3300031731 | Bacteria | 3664 |
| 677 | Ga0307405_10033892 | 3300031731 | Bacteria | 3034 |
| 678 | Ga0307405_10127120 | 3300031731 | Bacteria | 1754 |
| 679 | Ga0307405_10186398 | 3300031731 | Bacteria | 1494 |
| 680 | Ga0307405_10305661 | 3300031731 | Bacteria | 1208 |
| 681 | Ga0307413_10000695 | 3300031824 | Bacteria | 11515 |
| 682 | Ga0307413_10006405 | 3300031824 | Bacteria | 5370 |
| 683 | Ga0307413_10025856 | 3300031824 | Bacteria | 3226 |
| 684 | Ga0307413_10031748 | 3300031824 | Bacteria | 2984 |
| 685 | Ga0307413_10049490 | 3300031824 | Bacteria | 2519 |
| 686 | Ga0307413_10076582 | 3300031824 | Bacteria | 2126 |
| 687 | Ga0307413_10080372 | 3300031824 | Bacteria | 2087 |
| 688 | Ga0307410_10000465 | 3300031852 | Bacteria | 16378 |
| 689 | Ga0307410_10012804 | 3300031852 | Bacteria | 4868 |
| 690 | Ga0307410_10014819 | 3300031852 | Bacteria | 4602 |
| 691 | Ga0307410_10018653 | 3300031852 | Bacteria | 4197 |
| 692 | Ga0307410_10020233 | 3300031852 | Bacteria | 4066 |
| 693 | Ga0307410_10025056 | 3300031852 | Bacteria | 3736 |
| 694 | Ga0307410_10027323 | 3300031852 | Bacteria | 3605 |
| 695 | Ga0307410_10082987 | 3300031852 | Bacteria | 2255 |
| 696 | Ga0307410_10087127 | 3300031852 | Bacteria | 2207 |
| 697 | Ga0307410_10091953 | 3300031852 | Bacteria | 2155 |
| 698 | Ga0307410_10092942 | 3300031852 | Bacteria | 2145 |
| 699 | Ga0307410_10146797 | 3300031852 | Bacteria | 1751 |
| 700 | Ga0307410_10149917 | 3300031852 | Bacteria | 1735 |
| 701 | Ga0307410_10151460 | 3300031852 | Bacteria | 1727 |
| 702 | Ga0307406_10003621 | 3300031901 | Bacteria | 8414 |
| 703 | Ga0307406_10014836 | 3300031901 | Bacteria | 4491 |
| 704 | Ga0307406_10025324 | 3300031901 | Bacteria | 3551 |
| 705 | Ga0307406_10048602 | 3300031901 | Bacteria | 2681 |
| 706 | Ga0307406_10050582 | 3300031901 | Bacteria | 2635 |
| 707 | Ga0307406_10063689 | 3300031901 | Bacteria | 2389 |
| 708 | Ga0307406_10077269 | 3300031901 | Bacteria | 2202 |
| 709 | Ga0307406_10145119 | 3300031901 | Bacteria | 1685 |
| 710 | Ga0307406_10170992 | 3300031901 | Bacteria | 1572 |
| 711 | Ga0307406_10244896 | 3300031901 | Bacteria | 1347 |
| 712 | Ga0307407_10006235 | 3300031903 | Bacteria | 5271 |
| 713 | Ga0307407_10016129 | 3300031903 | Bacteria | 3712 |
| 714 | Ga0307407_10034934 | 3300031903 | Bacteria | 2757 |
| 715 | Ga0307407_10064472 | 3300031903 | Bacteria | 2153 |
| 716 | Ga0307407_10086314 | 3300031903 | Bacteria | 1912 |
| 717 | Ga0307412_10000104 | 3300031911 | Bacteria | 67823 |
| 718 | Ga0307412_10007957 | 3300031911 | Bacteria | 6041 |
| 719 | Ga0307412_10011087 | 3300031911 | Bacteria | 5211 |
| 720 | Ga0307412_10042034 | 3300031911 | Bacteria | 2966 |
| 721 | Ga0307412_10058277 | 3300031911 | Bacteria | 2582 |
| 722 | Ga0307412_10074378 | 3300031911 | Bacteria | 2327 |
| 723 | Ga0307412_10076904 | 3300031911 | Bacteria | 2294 |
| 724 | Ga0307412_10080888 | 3300031911 | Bacteria | 2245 |
| 725 | Ga0307412_10136904 | 3300031911 | Bacteria | 1788 |
| 726 | Ga0307412_10142850 | 3300031911 | Bacteria | 1755 |
| 727 | Ga0307409_100002678 | 3300031995 | Bacteria | 9377 |
| 728 | Ga0307409_100005317 | 3300031995 | Bacteria | 7392 |
| 729 | Ga0307409_100011157 | 3300031995 | Bacteria | 5643 |
| 730 | Ga0307409_100045058 | 3300031995 | Bacteria | 3327 |
| 731 | Ga0307409_100074227 | 3300031995 | Bacteria | 2717 |
| 732 | Ga0307409_100080295 | 3300031995 | Bacteria | 2631 |
| 733 | Ga0307409_100089477 | 3300031995 | Bacteria | 2517 |
| 734 | Ga0307409_100118569 | 3300031995 | Bacteria | 2235 |
| 735 | Ga0307409_100119967 | 3300031995 | Bacteria | 2225 |
| 736 | Ga0307409_100318463 | 3300031995 | Bacteria | 1454 |
| 737 | Ga0307416_100011423 | 3300032002 | Bacteria | 5922 |
| 738 | Ga0307416_100022527 | 3300032002 | Bacteria | 4550 |
| 739 | Ga0307416_100023804 | 3300032002 | Bacteria | 4454 |
| 740 | Ga0307416_100025969 | 3300032002 | Bacteria | 4307 |
| 741 | Ga0307416_100036396 | 3300032002 | Bacteria | 3774 |
| 742 | Ga0307416_100076022 | 3300032002 | Bacteria | 2813 |
| 743 | Ga0307416_100079397 | 3300032002 | Bacteria | 2765 |
| 744 | Ga0307414_10000371 | 3300032004 | Bacteria | 24637 |
| 745 | Ga0307414_10004392 | 3300032004 | Bacteria | 7655 |
| 746 | Ga0307414_10004937 | 3300032004 | Bacteria | 7287 |
| 747 | Ga0307414_10009432 | 3300032004 | Bacteria | 5607 |
| 748 | Ga0307414_10011366 | 3300032004 | Bacteria | 5217 |
| 749 | Ga0307414_10037398 | 3300032004 | Bacteria | 3250 |
| 750 | Ga0307414_10041933 | 3300032004 | Bacteria | 3105 |
| 751 | Ga0307414_10042294 | 3300032004 | Bacteria | 3094 |
| 752 | Ga0307414_10055198 | 3300032004 | Bacteria | 2780 |
| 753 | Ga0307414_10058269 | 3300032004 | Bacteria | 2720 |
| 754 | Ga0307414_10078957 | 3300032004 | Bacteria | 2401 |
| 755 | Ga0307414_10119758 | 3300032004 | Bacteria | 2021 |
| 756 | Ga0307414_10135177 | 3300032004 | Bacteria | 1921 |
| 757 | Ga0307414_10180923 | 3300032004 | Bacteria | 1695 |
| 758 | Ga0307411_10001823 | 3300032005 | Bacteria | 9039 |
| 759 | Ga0307411_10003306 | 3300032005 | Bacteria | 7453 |
| 760 | Ga0307411_10009223 | 3300032005 | Bacteria | 5172 |
| 761 | Ga0307411_10020964 | 3300032005 | Bacteria | 3813 |
| 762 | Ga0307411_10024440 | 3300032005 | Bacteria | 3602 |
| 763 | Ga0307411_10028219 | 3300032005 | Bacteria | 3409 |
| 764 | Ga0307411_10039534 | 3300032005 | Bacteria | 2984 |
| 765 | Ga0307411_10045853 | 3300032005 | Bacteria | 2814 |
| 766 | Ga0307411_10107857 | 3300032005 | Bacteria | 1985 |
| 767 | Ga0307411_10327735 | 3300032005 | Bacteria | 1239 |
| 768 | Ga0307415_100002323 | 3300032126 | Bacteria | 9447 |
| 769 | Ga0307415_100006910 | 3300032126 | Bacteria | 6162 |
| 770 | Ga0307415_100016016 | 3300032126 | Bacteria | 4455 |
| 771 | Ga0307415_100021970 | 3300032126 | Bacteria | 3931 |
| 772 | Ga0307415_100048271 | 3300032126 | Bacteria | 2872 |
| 773 | Ga0307415_100082652 | 3300032126 | Bacteria | 2298 |
| 774 | Ga0307415_100132670 | 3300032126 | Bacteria | 1888 |
| 775 | Ga0307415_100242397 | 3300032126 | Bacteria | 1459 |
| 776 | Ga0307415_100332275 | 3300032126 | Bacteria | 1272 |
| 777 | Ga0373930_0017365 | 3300034816 | Bacteria | 1371 |
| 778 | Ga0373959_0004347 | 3300034820 | Bacteria | 2280 |
| 779 | Ga0373940_0026616 | 3300035088 | Bacteria | 1514 |
| 780 | Ga0373949_0011675 | 3300035090 | Bacteria | 1937 |
| 781 | Ga0373932_0048726 | 3300035112 | Bacteria | 1249 |
| 782 | Ga0373941_0008874 | 3300035115 | Bacteria | 2516 |
| 783 | Ga0373956_0017500 | 3300035119 | Bacteria | 3023 |
| 784 | Ga0373942_0011599 | 3300035207 | Bacteria | 2092 |
| 785 | Ga0373961_0001549 | 3300035241 | Bacteria | 6599 |
| 786 | Ga0373962_0001250 | 3300035242 | Bacteria | 5964 |
| 787 | Ga0373931_0000143 | 3300035691 | Bacteria | 31467 |
| 788 | Ga0373931_0006522 | 3300035691 | Bacteria | 5455 |
| 789 | Ga0373931_0099584 | 3300035691 | Bacteria | 1633 |
| 790 | Ga0373935_0219522 | 3300035692 | Bacteria | 1320 |
| 791 | Ga0373927_0080693 | 3300035695 | Bacteria | 2108 |
| 792 | Ga0395899_0000129 | 3300037312 | Bacteria | 118043 |
| 793 | Ga0395899_0009175 | 3300037312 | Bacteria | 7595 |
| 794 | Ga0395899_0027364 | 3300037312 | Bacteria | 4300 |
| 795 | Ga0395899_0031414 | 3300037312 | Bacteria | 3991 |
| 796 | Ga0395899_0062686 | 3300037312 | Bacteria | 2737 |
| 797 | Ga0395899_0084827 | 3300037312 | Bacteria | 2302 |
| 798 | Ga0395899_0090625 | 3300037312 | Bacteria | 2216 |
| 799 | Ga0395899_0169837 | 3300037312 | Bacteria | 1536 |
| 800 | Ga0395900_0002105 | 3300037418 | Bacteria | 22295 |
| 801 | Ga0395900_0003168 | 3300037418 | Bacteria | 17835 |
| 802 | Ga0395900_0004480 | 3300037418 | Bacteria | 14789 |
| 803 | Ga0395900_0038265 | 3300037418 | Bacteria | 4944 |
| 804 | Ga0395900_0045525 | 3300037418 | Bacteria | 4519 |
| 805 | Ga0395900_0117775 | 3300037418 | Bacteria | 2725 |
| 806 | Ga0395900_0141635 | 3300037418 | Bacteria | 2462 |
| 807 | Ga0395900_0161135 | 3300037418 | Bacteria | 2288 |
| 808 | Ga0395900_0168212 | 3300037418 | Bacteria | 2233 |
| 809 | Ga0395900_0191910 | 3300037418 | Bacteria | 2071 |
| 810 | Ga0395900_0205317 | 3300037418 | Bacteria | 1991 |
| 811 | Ga0395900_0214746 | 3300037418 | Bacteria | 1941 |
| 812 | Ga0395900_0232961 | 3300037418 | Bacteria | 1851 |
| 813 | Ga0395898_0030471 | 3300037466 | Bacteria | 5398 |
| 814 | Ga0395898_0055723 | 3300037466 | Bacteria | 3856 |
| 815 | Ga0395898_0064148 | 3300037466 | Bacteria | 3563 |
| 816 | Ga0395898_0067120 | 3300037466 | Bacteria | 3473 |
| 817 | Ga0395898_0098687 | 3300037466 | Bacteria | 2804 |
| 818 | Ga0395898_0162916 | 3300037466 | Bacteria | 2133 |
| 819 | Ga0395898_0164232 | 3300037466 | Bacteria | 2124 |
| 820 | Ga0395898_0180383 | 3300037466 | Bacteria | 2018 |
| 821 | Ga0395898_0183234 | 3300037466 | Bacteria | 2001 |
| 822 | Ga0395898_0241432 | 3300037466 | Bacteria | 1723 |
| 823 | Ga0395898_0362930 | 3300037466 | Bacteria | 1381 |
| 824 | Ga0395905_0000232 | 3300037471 | Bacteria | 84233 |
| 825 | Ga0395905_0010696 | 3300037471 | Bacteria | 8898 |
| 826 | Ga0395905_0020610 | 3300037471 | Bacteria | 6242 |
| 827 | Ga0395905_0038255 | 3300037471 | Bacteria | 4501 |
| 828 | Ga0395905_0056198 | 3300037471 | Bacteria | 3682 |
| 829 | Ga0395905_0068245 | 3300037471 | Bacteria | 3331 |
| 830 | Ga0395905_0091212 | 3300037471 | Bacteria | 2857 |
| 831 | Ga0395905_0093123 | 3300037471 | Bacteria | 2826 |
| 832 | Ga0395905_0136804 | 3300037471 | Bacteria | 2305 |
| 833 | Ga0395905_0399462 | 3300037471 | Bacteria | 1269 |
| 834 | Ga0436364_0411459 | 3300037853 | Bacteria | 10009 |
| 835 | Ga0436364_0689048 | 3300037853 | Bacteria | 11902 |
| 836 | Ga0395901_0000031 | 3300038443 | Bacteria | 241733 |
| 837 | Ga0395901_0000131 | 3300038443 | Bacteria | 96504 |
| 838 | Ga0395901_0011353 | 3300038443 | Bacteria | 9026 |
| 839 | Ga0395901_0019979 | 3300038443 | Bacteria | 6854 |
| 840 | Ga0395901_0058196 | 3300038443 | Bacteria | 4020 |
| 841 | Ga0395901_0066872 | 3300038443 | Bacteria | 3743 |
| 842 | Ga0395901_0070084 | 3300038443 | Bacteria | 3652 |
| 843 | Ga0395901_0085045 | 3300038443 | Bacteria | 3306 |
| 844 | Ga0395901_0094403 | 3300038443 | Bacteria | 3133 |
| 845 | Ga0395901_0131281 | 3300038443 | Bacteria | 2632 |
| 846 | Ga0395901_0530036 | 3300038443 | Bacteria | 1196 |
| 847 | Ga0395901_0561501 | 3300038443 | Bacteria | 1156 |
| 848 | Ga0237819_00270 | 3300038705 | Bacteria | 18995 |
| 849 | Ga0400486_21858 | 3300038742 | Bacteria | 1879 |
| 850 | Ga0400483_026085 | 3300039062 | Bacteria | 1747 |
| 851 | Ga0436365_0083543 | 3300039437 | Bacteria | 85224 |
| 852 | Ga0436365_0922968 | 3300039437 | Bacteria | 9993 |
| 853 | Ga0436365_0935722 | 3300039437 | Bacteria | 2018 |
| 854 | Ga0436365_1110654 | 3300039437 | Bacteria | 2490 |
| 855 | Ga0436363_0310243 | 3300039450 | Bacteria | 3465 |
| 856 | Ga0436363_0946284 | 3300039450 | Bacteria | 1473 |
| 857 | Ga0436363_1058292 | 3300039450 | Bacteria | 2564 |
| 858 | Ga0439445_0020665 | 3300042004 | Bacteria | 1649 |
| 859 | Ga0439448_0001832 | 3300042005 | Bacteria | 5628 |
| 860 | Ga0439448_0020533 | 3300042005 | Bacteria | 2044 |
| 861 | Ga0439449_0002667 | 3300042007 | Bacteria | 6948 |
| 862 | Ga0450917_003182 | 3300042120 | Bacteria | 1184 |
| 863 | Ga0466969_0010778 | 3300044656 | Bacteria | 4842 |
| 864 | Ga0466966_0000021 | 3300044684 | Bacteria | 116714 |
| 865 | Ga0466966_0001996 | 3300044684 | Bacteria | 13224 |
| 866 | Ga0466961_0008264 | 3300044693 | Bacteria | 6630 |
| 867 | Ga0466961_0045825 | 3300044693 | Bacteria | 2797 |
| 868 | Ga0466963_0016990 | 3300044694 | Bacteria | 4532 |
| 869 | Ga0466963_0032406 | 3300044694 | Bacteria | 3384 |
| 870 | Ga0453684_0038771 | 3300044712 | Bacteria | 6504 |
| 871 | Ga0453684_0369532 | 3300044712 | Bacteria | 1613 |
| 872 | Ga0466971_0000846 | 3300044719 | Bacteria | 12460 |
| 873 | Ga0466957_0002162 | 3300044842 | Bacteria | 10524 |
| 874 | Ga0466959_0006500 | 3300045049 | Bacteria | 8102 |
| 875 | Ga0466959_0038377 | 3300045049 | Bacteria | 3539 |
| 876 | Ga0451576_0000024 | 3300045051 | Bacteria | 470499 |
| 877 | Ga0451576_0014154 | 3300045051 | Bacteria | 8889 |
| 878 | Ga0451576_0068605 | 3300045051 | Bacteria | 3690 |
| 879 | Ga0466958_0009405 | 3300045836 | Bacteria | 5446 |
| 880 | Ga0466958_0074986 | 3300045836 | Bacteria | 2074 |
| 881 | Ga0466958_0102598 | 3300045836 | Bacteria | 1780 |
| 882 | Ga0495638_0000068 | 3300046460 | Bacteria | 167596 |
| 883 | Ga0495638_0000207 | 3300046460 | Bacteria | 83805 |
| 884 | Ga0495580_0226880 | 3300046472 | Bacteria | 1283 |
| 885 | Ga0495585_0003769 | 3300046492 | Bacteria | 10119 |
| 886 | Ga0495596_0044318 | 3300046500 | Bacteria | 1751 |
| 887 | Ga0495607_0009022 | 3300046501 | Bacteria | 6780 |
| 888 | Ga0495607_0056998 | 3300046501 | Bacteria | 2241 |
| 889 | Ga0495583_0051417 | 3300046506 | Bacteria | 1879 |
| 890 | Ga0495606_0000470 | 3300046507 | Bacteria | 66278 |
| 891 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 892 | Ga0495616_0011390 | 3300046513 | Bacteria | 5100 |
| 893 | Ga0495616_0039134 | 3300046513 | Bacteria | 2430 |
| 894 | Ga0495648_0059764 | 3300046524 | Bacteria | 2272 |
| 895 | Ga0495663_0001729 | 3300046525 | Bacteria | 6781 |
| 896 | Ga0495621_0000875 | 3300046539 | Bacteria | 7690 |
| 897 | Ga0495633_0015032 | 3300046558 | Bacteria | 4024 |
| 898 | Ga0495668_0008332 | 3300046616 | Bacteria | 6490 |
| 899 | Ga0495669_0001501 | 3300046684 | Bacteria | 9626 |
| 900 | Ga0495669_0002438 | 3300046684 | Bacteria | 7603 |
| 901 | Ga0495670_0002065 | 3300046691 | Bacteria | 9907 |
| 902 | Ga0495687_000517 | 3300047443 | Bacteria | 46300 |
| 903 | Ga0495686_0000273 | 3300047472 | Bacteria | 91936 |
| 904 | Ga0495686_0000916 | 3300047472 | Bacteria | 36998 |
| 905 | Ga0495686_0006459 | 3300047472 | Bacteria | 8969 |
| 906 | Ga0495686_0017144 | 3300047472 | Bacteria | 4889 |
| 907 | Ga0495615_0000114 | 3300048090 | Bacteria | 20560 |
| 908 | Ga0496100_0043927 | 3300048903 | Bacteria | 2860 |
| 909 | Ga0496100_0142523 | 3300048903 | Bacteria | 1700 |
| 910 | Ga0496101_0065998 | 3300048904 | Bacteria | 2639 |
| 911 | Ga0496102_0000049 | 3300048905 | Bacteria | 179480 |
| 912 | Ga0496102_0012793 | 3300048905 | Bacteria | 7264 |
| 913 | Ga0496102_0030551 | 3300048905 | Bacteria | 4823 |
| 914 | Ga0496102_0038529 | 3300048905 | Bacteria | 4314 |
| 915 | Ga0496102_0110297 | 3300048905 | Bacteria | 2565 |
| 916 | Ga0496102_0157832 | 3300048905 | Bacteria | 2133 |
| 917 | Ga0496103_0000037 | 3300048906 | Bacteria | 179474 |
| 918 | Ga0496103_0001324 | 3300048906 | Bacteria | 16800 |
| 919 | Ga0496104_0052893 | 3300048907 | Bacteria | 3836 |
| 920 | Ga0496104_0264349 | 3300048907 | Bacteria | 1633 |
| 921 | Ga0496105_0000224 | 3300048908 | Bacteria | 38048 |
| 922 | Ga0496105_0045068 | 3300048908 | Bacteria | 3639 |
| 923 | Ga0496106_0015255 | 3300048909 | Bacteria | 5685 |
| 924 | Ga0496106_0263598 | 3300048909 | Bacteria | 1379 |
| 925 | Ga0496107_0051593 | 3300048910 | Bacteria | 2967 |
| 926 | Ga0496108_0121555 | 3300048911 | Bacteria | 2240 |
| 927 | Ga0496109_0018512 | 3300048912 | Bacteria | 6117 |
| 928 | Ga0496109_0063831 | 3300048912 | Bacteria | 3369 |
| 929 | Ga0496109_0247692 | 3300048912 | Bacteria | 1678 |
| 930 | Ga0496110_0005561 | 3300048913 | Bacteria | 9892 |
| 931 | Ga0496110_0029322 | 3300048913 | Bacteria | 4734 |
| 932 | Ga0496111_0011559 | 3300048914 | Bacteria | 5954 |
| 933 | Ga0496111_0032922 | 3300048914 | Bacteria | 3696 |
| 934 | Ga0496111_0084793 | 3300048914 | Bacteria | 2316 |
| 935 | Ga0496112_0138104 | 3300048915 | Bacteria | 2407 |
| 936 | Ga0496112_0185924 | 3300048915 | Bacteria | 2041 |
| 937 | Ga0496114_0065139 | 3300048917 | Bacteria | 3053 |
| 938 | Ga0496115_0000325 | 3300048918 | Bacteria | 40655 |
| 939 | Ga0496115_0165412 | 3300048918 | Bacteria | 1829 |
| 940 | Ga0496116_0000664 | 3300048919 | Bacteria | 44805 |
| 941 | Ga0496116_0012690 | 3300048919 | Bacteria | 6856 |
| 942 | Ga0496117_0000115 | 3300048920 | Bacteria | 179488 |
| 943 | Ga0496118_0000086 | 3300048921 | Bacteria | 179488 |
| 944 | Ga0496118_0001765 | 3300048921 | Bacteria | 31299 |
| 945 | Ga0496118_0053610 | 3300048921 | Bacteria | 3063 |
| 946 | Ga0496120_0037633 | 3300048923 | Bacteria | 2869 |
| 947 | Ga0496120_0086404 | 3300048923 | Bacteria | 1686 |
| 948 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 949 | Ga0496121_0009718 | 3300048924 | Bacteria | 11005 |
| 950 | Ga0496121_0012133 | 3300048924 | Bacteria | 9459 |
| 951 | Ga0496122_0010014 | 3300048925 | Bacteria | 9863 |
| 952 | Ga0496122_0011314 | 3300048925 | Bacteria | 9058 |
| 953 | Ga0496122_0012455 | 3300048925 | Bacteria | 8464 |
| 954 | Ga0496123_0002815 | 3300048926 | Bacteria | 20643 |
| 955 | Ga0496123_0010116 | 3300048926 | Bacteria | 8386 |
| 956 | Ga0496124_0000102 | 3300048927 | Bacteria | 179488 |
| 957 | Ga0496124_0002035 | 3300048927 | Bacteria | 27471 |
| 958 | Ga0496124_0006985 | 3300048927 | Bacteria | 12109 |
| 959 | Ga0496124_0019874 | 3300048927 | Bacteria | 6231 |
| 960 | Ga0496125_0024159 | 3300048928 | Bacteria | 5593 |
| 961 | Ga0496125_0104914 | 3300048928 | Bacteria | 2068 |
| 962 | Ga0496126_0174418 | 3300048929 | Bacteria | 1830 |
| 963 | Ga0501290_000064 | 3300049513 | Bacteria | 14897 |
| 964 | Ga0501292_000022 | 3300049515 | Bacteria | 47432 |
| 965 | Ga0501294_002490 | 3300049517 | Bacteria | 1743 |
| 966 | Ga0501032_0013776 | 3300049569 | Bacteria | 5737 |
| 967 | Ga0501034_0000068 | 3300049571 | Bacteria | 182904 |
| 968 | Ga0501034_0006843 | 3300049571 | Bacteria | 12198 |
| 969 | Ga0501037_0008627 | 3300049573 | Bacteria | 7473 |
| 970 | Ga0501038_0080357 | 3300049574 | Bacteria | 2748 |
| 971 | Ga0501039_0000205 | 3300049575 | Bacteria | 43025 |
| 972 | Ga0501043_0074585 | 3300049579 | Bacteria | 2665 |
| 973 | Ga0501046_0000058 | 3300049580 | Bacteria | 127462 |
| 974 | Ga0501046_0007334 | 3300049580 | Bacteria | 9701 |
| 975 | Ga0501046_0030319 | 3300049580 | Bacteria | 4390 |
| 976 | Ga0501047_0000152 | 3300049581 | Bacteria | 84703 |
| 977 | Ga0501047_0088462 | 3300049581 | Bacteria | 2974 |
| 978 | Ga0501047_0138116 | 3300049581 | Bacteria | 2317 |
| 979 | Ga0501048_0002175 | 3300049582 | Bacteria | 14919 |
| 980 | Ga0501067_0018422 | 3300049583 | Bacteria | 3868 |
| 981 | Ga0501067_0020300 | 3300049583 | Bacteria | 3677 |
| 982 | Ga0501069_0011632 | 3300049585 | Bacteria | 4666 |
| 983 | Ga0501070_0035400 | 3300049586 | Bacteria | 4172 |
| 984 | Ga0501206_001253 | 3300049653 | Bacteria | 3180 |
| 985 | Ga0501222_000369 | 3300049662 | Bacteria | 6926 |
| 986 | Ga0501223_000171 | 3300049663 | Bacteria | 16960 |
| 987 | Ga0501224_000028 | 3300049664 | Bacteria | 53596 |
| 988 | Ga0501224_003103 | 3300049664 | Bacteria | 2301 |
| 989 | Ga0501233_000230 | 3300049668 | Bacteria | 8380 |
| 990 | Ga0501235_000282 | 3300049669 | Bacteria | 9520 |
| 991 | Ga0501235_005237 | 3300049669 | Bacteria | 2821 |
| 992 | Ga0501249_000063 | 3300049679 | Bacteria | 38978 |
| 993 | Ga0501261_000144 | 3300049690 | Bacteria | 10348 |
| 994 | Ga0501225_0000317 | 3300049705 | Bacteria | 15084 |
| 995 | Ga0501225_0010379 | 3300049705 | Bacteria | 2638 |
| 996 | Ga0501225_0010787 | 3300049705 | Bacteria | 2581 |
| 997 | Ga0501080_0000001 | 3300049742 | Bacteria | 241365 |
| 998 | Ga0501279_000012 | 3300049775 | Bacteria | 80359 |
| 999 | Ga0501280_000005 | 3300049776 | Bacteria | 85174 |
| 1000 | Ga0501281_00328 | 3300049777 | Bacteria | 4877 |
| 1001 | Ga0501282_000707 | 3300049778 | Bacteria | 3828 |
| 1002 | Ga0501035_0000015 | 3300049822 | Bacteria | 246493 |
| 1003 | Ga0501035_0091158 | 3300049822 | Bacteria | 2683 |
| 1004 | Ga0501035_0273131 | 3300049822 | Bacteria | 1430 |
| 1005 | Ga0501044_0000390 | 3300049823 | Bacteria | 54419 |
| 1006 | Ga0501044_0000572 | 3300049823 | Bacteria | 44721 |
| 1007 | Ga0501044_0027379 | 3300049823 | Bacteria | 6026 |
| 1008 | Ga0501045_0079987 | 3300049824 | Bacteria | 2410 |
| 1009 | Ga0501045_0142665 | 3300049824 | Bacteria | 1781 |
| 1010 | Ga0501226_000115 | 3300049853 | Bacteria | 17816 |
| 1011 | nmdc:mga03683_11464_c1 | 3300050489 | Bacteria | 1718 |
| 1012 | nmdc:mga0yw44_19458_c1 | 3300050492 | Bacteria | 3745 |
| 1013 | nmdc:mga06z11_3726_c1 | 3300050494 | Bacteria | 5921 |
| 1014 | nmdc:mga06z11_38986_c1 | 3300050494 | Bacteria | 2363 |
| 1015 | nmdc:mga05p37_125491_c1 | 3300050507 | Bacteria | 3152 |
| 1016 | nmdc:mga05p37_507715_c1 | 3300050507 | Bacteria | 1382 |
| 1017 | nmdc:mga09592_112735_c1 | 3300050508 | Bacteria | 2333 |
| 1018 | nmdc:mga09592_84040_c1 | 3300050508 | Bacteria | 2714 |
| 1019 | nmdc:mga0qj67_347153_c1 | 3300050509 | Bacteria | 1200 |
| 1020 | nmdc:mga0qj67_69878_c1 | 3300050509 | Bacteria | 2801 |
| 1021 | nmdc:mga06r32_1441_c1 | 3300050510 | Bacteria | 21480 |
| 1022 | nmdc:mga06r32_56755_c1 | 3300050510 | Bacteria | 3759 |
| 1023 | nmdc:mga06r32_8364_c1 | 3300050510 | Bacteria | 9317 |
| 1024 | nmdc:mga06r32_94296_c1 | 3300050510 | Bacteria | 2929 |
| 1025 | nmdc:mga08y16_117003_c1 | 3300050511 | Bacteria | 2775 |
| 1026 | nmdc:mga0n895_2524_c1 | 3300050512 | Bacteria | 14345 |
| 1027 | nmdc:mga0n895_6781_c1 | 3300050512 | Bacteria | 9771 |
| 1028 | nmdc:mga0rr50_47105_c1 | 3300050513 | Bacteria | 3178 |
| 1029 | Ga0500643_000134 | 3300053087 | Bacteria | 75321 |
| 1030 | Ga0500643_000235 | 3300053087 | Bacteria | 51395 |
| 1031 | Ga0500643_005223 | 3300053087 | Bacteria | 5649 |
| 1032 | Ga0500651_0008965 | 3300053093 | Bacteria | 5918 |
| 1033 | Ga0500566_0000436 | 3300053094 | Bacteria | 23297 |
| 1034 | Ga0500641_0006777 | 3300053096 | Bacteria | 4075 |
| 1035 | Ga0500641_0051800 | 3300053096 | Bacteria | 1690 |
| 1036 | Ga0500556_0001468 | 3300053104 | Bacteria | 9867 |
| 1037 | Ga0500562_012400 | 3300053108 | Bacteria | 2168 |
| 1038 | Ga0500592_000314 | 3300053116 | Bacteria | 8300 |
| 1039 | Ga0500595_014502 | 3300053119 | Bacteria | 2989 |
| 1040 | Ga0500655_000244 | 3300053133 | Bacteria | 12709 |
| 1041 | Ga0500658_0055351 | 3300053134 | Bacteria | 1633 |
| 1042 | Ga0500573_0000010 | 3300053140 | Bacteria | 210704 |
| 1043 | Ga0500573_0114034 | 3300053140 | Bacteria | 1510 |
| 1044 | Ga0500577_0107520 | 3300053142 | Bacteria | 1147 |
| 1045 | Ga0500590_000141 | 3300053148 | Bacteria | 20020 |
| 1046 | Ga0500616_0005539 | 3300053153 | Bacteria | 8555 |
| 1047 | Ga0500616_0007417 | 3300053153 | Bacteria | 6978 |
| 1048 | Ga0500622_0028152 | 3300053156 | Bacteria | 2959 |
| 1049 | Ga0500624_000003 | 3300053157 | Bacteria | 253364 |
| 1050 | Ga0500637_0000024 | 3300053178 | Bacteria | 59926 |
| 1051 | Ga0500570_003712 | 3300053724 | Bacteria | 7919 |
| 1052 | Ga0501084_0182434 | 3300054114 | Bacteria | 1772 |
| 1053 | Ga0501082_0022902 | 3300060353 | Bacteria | 5382 |
| 1054 | Ga0466962_0002938 | 3300061719 | Bacteria | 8127 |
| 1055 | Ga0530510_0136306 | 3300061734 | Bacteria | 1807 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_0946284 | Ga0436363_0946284_547_1461 | 292 |
| 2 | 3300048912 | Ga0496109_0247692 | Ga0496109_0247692_715_1653 | 298 |
| 3 | 3300025923 | Ga0207681_10117248 | Ga0207681_101172482 | 305 |
| 4 | 3300034816 | Ga0373930_0017365 | Ga0373930_0017365_124_1197 | 305 |
| 5 | 3300034820 | Ga0373959_0004347 | Ga0373959_0004347_549_1622 | 305 |
| 6 | 3300035090 | Ga0373949_0011675 | Ga0373949_0011675_27_1100 | 305 |
| 7 | 3300035115 | Ga0373941_0008874 | Ga0373941_0008874_743_1816 | 305 |
| 8 | 3300035691 | Ga0373931_0000143 | Ga0373931_0000143_9862_10935 | 305 |
| 9 | 3300006852 | Ga0075433_10005933 | Ga0075433_100059332 | 308 |
| 10 | 3300006871 | Ga0075434_100006345 | Ga0075434_1000063453 | 308 |
| 11 | 3300009094 | Ga0111539_10114699 | Ga0111539_101146992 | 308 |
| 12 | 3300050512 | nmdc:mga0n895_2524_c1 | nmdc:mga0n895_2524_c1_6199_7272 | 308 |
| 13 | 3300053142 | Ga0500577_0107520 | Ga0500577_0107520_187_1128 | 311 |
| 14 | 3300038443 | Ga0395901_0530036 | Ga0395901_0530036_31_975 | 313 |
| 15 | 3300048914 | Ga0496111_0011559 | Ga0496111_0011559_2494_3570 | 315 |
| 16 | 3300048925 | Ga0496122_0010014 | Ga0496122_0010014_2484_3560 | 315 |
| 17 | 3300048927 | Ga0496124_0002035 | Ga0496124_0002035_25112_26188 | 315 |
| 18 | 3300053156 | Ga0500622_0028152 | Ga0500622_0028152_1990_2940 | 315 |
| 19 | 3300005341 | Ga0070691_10004772 | Ga0070691_100047726 | 318 |
| 20 | 3300005347 | Ga0070668_100221644 | Ga0070668_1002216442 | 318 |
| 21 | 3300005545 | Ga0070695_100002848 | Ga0070695_1000028486 | 318 |
| 22 | 3300005719 | Ga0068861_100007263 | Ga0068861_1000072633 | 318 |
| 23 | 3300025972 | Ga0207668_10146770 | Ga0207668_101467702 | 318 |
| 24 | 3300026118 | Ga0207675_100032035 | Ga0207675_1000320352 | 318 |
| 25 | 3300053108 | Ga0500562_012400 | Ga0500562_012400_668_1750 | 318 |
| 26 | 3300031852 | Ga0307410_10082987 | Ga0307410_100829872 | 323 |
| 27 | 3300032004 | Ga0307414_10037398 | Ga0307414_100373982 | 323 |
| 28 | 3300032005 | Ga0307411_10045853 | Ga0307411_100458531 | 323 |
| 29 | 3300037471 | Ga0395905_0093123 | Ga0395905_0093123_1416_2492 | 323 |
| 30 | 3300031548 | Ga0307408_100070852 | Ga0307408_1000708522 | 325 |
| 31 | 3300031731 | Ga0307405_10127120 | Ga0307405_101271202 | 325 |
| 32 | 3300031852 | Ga0307410_10012804 | Ga0307410_100128044 | 325 |
| 33 | 3300031901 | Ga0307406_10025324 | Ga0307406_100253242 | 325 |
| 34 | 3300031903 | Ga0307407_10064472 | Ga0307407_100644722 | 325 |
| 35 | 3300031995 | Ga0307409_100005317 | Ga0307409_1000053172 | 325 |
| 36 | 3300032002 | Ga0307416_100025969 | Ga0307416_1000259694 | 325 |
| 37 | 3300032004 | Ga0307414_10055198 | Ga0307414_100551982 | 325 |
| 38 | 3300032005 | Ga0307411_10009223 | Ga0307411_100092232 | 325 |
| 39 | 3300032126 | Ga0307415_100006910 | Ga0307415_1000069105 | 325 |
| 40 | 3300005353 | Ga0070669_100064293 | Ga0070669_1000642932 | 326 |
| 41 | 3300009148 | Ga0105243_10081629 | Ga0105243_100816292 | 326 |
| 42 | 3300025972 | Ga0207668_10069875 | Ga0207668_100698752 | 326 |
| 43 | 3300031824 | Ga0307413_10031748 | Ga0307413_100317483 | 326 |
| 44 | 3300031852 | Ga0307410_10018653 | Ga0307410_100186532 | 326 |
| 45 | 3300031901 | Ga0307406_10014836 | Ga0307406_100148362 | 326 |
| 46 | 3300031901 | Ga0307406_10077269 | Ga0307406_100772692 | 326 |
| 47 | 3300031903 | Ga0307407_10034934 | Ga0307407_100349343 | 326 |
| 48 | 3300031995 | Ga0307409_100080295 | Ga0307409_1000802952 | 326 |
| 49 | 3300032004 | Ga0307414_10119758 | Ga0307414_101197582 | 326 |
| 50 | 3300032005 | Ga0307411_10039534 | Ga0307411_100395343 | 326 |
| 51 | 3300049585 | Ga0501069_0011632 | Ga0501069_0011632_1341_2423 | 326 |
| 52 | 3300005548 | Ga0070665_100001540 | Ga0070665_10000154024 | 327 |
| 53 | 3300009545 | Ga0105237_10024781 | Ga0105237_100247813 | 327 |
| 54 | 3300028379 | Ga0268266_10000200 | Ga0268266_1000020029 | 327 |
| 55 | 3300032126 | Ga0307415_100242397 | Ga0307415_1002423971 | 327 |
| 56 | 3300035691 | Ga0373931_0099584 | Ga0373931_0099584_429_1541 | 327 |
| 57 | 3300037471 | Ga0395905_0399462 | Ga0395905_0399462_35_1096 | 327 |
| 58 | 3300001904 | JGI24736J21556_1004342 | JGI24736J21556_10043422 | 328 |
| 59 | 3300001979 | JGI24740J21852_10046622 | JGI24740J21852_100466221 | 328 |
| 60 | 3300001989 | JGI24739J22299_10000237 | JGI24739J22299_1000023710 | 328 |
| 61 | 3300001990 | JGI24737J22298_10000061 | JGI24737J22298_1000006131 | 328 |
| 62 | 3300001990 | JGI24737J22298_10014465 | JGI24737J22298_100144653 | 328 |
| 63 | 3300002075 | JGI24738J21930_10000766 | JGI24738J21930_100007664 | 328 |
| 64 | 3300002076 | JGI24749J21850_1009649 | JGI24749J21850_10096491 | 328 |
| 65 | 3300002126 | JGI24035J26624_1001486 | JGI24035J26624_10014862 | 328 |
| 66 | 3300005328 | Ga0070676_10003382 | Ga0070676_1000338210 | 328 |
| 67 | 3300005328 | Ga0070676_10009609 | Ga0070676_100096092 | 328 |
| 68 | 3300005331 | Ga0070670_100020267 | Ga0070670_1000202672 | 328 |
| 69 | 3300005331 | Ga0070670_100122039 | Ga0070670_1001220392 | 328 |
| 70 | 3300005334 | Ga0068869_100000493 | Ga0068869_10000049318 | 328 |
| 71 | 3300005334 | Ga0068869_100028462 | Ga0068869_1000284623 | 328 |
| 72 | 3300005338 | Ga0068868_100022988 | Ga0068868_1000229881 | 328 |
| 73 | 3300005339 | Ga0070660_100086867 | Ga0070660_1000868672 | 328 |
| 74 | 3300005353 | Ga0070669_100000532 | Ga0070669_1000005322 | 328 |
| 75 | 3300005364 | Ga0070673_100000058 | Ga0070673_10000005829 | 328 |
| 76 | 3300005366 | Ga0070659_100006101 | Ga0070659_1000061012 | 328 |
| 77 | 3300005367 | Ga0070667_100004233 | Ga0070667_1000042332 | 328 |
| 78 | 3300005459 | Ga0068867_100001818 | Ga0068867_10000181814 | 328 |
| 79 | 3300005459 | Ga0068867_100090015 | Ga0068867_1000900152 | 328 |
| 80 | 3300005539 | Ga0068853_100000783 | Ga0068853_10000078320 | 328 |
| 81 | 3300005543 | Ga0070672_100000716 | Ga0070672_10000071615 | 328 |
| 82 | 3300005563 | Ga0068855_100001416 | Ga0068855_10000141629 | 328 |
| 83 | 3300005564 | Ga0070664_100130374 | Ga0070664_1001303742 | 328 |
| 84 | 3300005577 | Ga0068857_100004724 | Ga0068857_1000047244 | 328 |
| 85 | 3300005578 | Ga0068854_100001025 | Ga0068854_10000102513 | 328 |
| 86 | 3300005616 | Ga0068852_100059481 | Ga0068852_1000594815 | 328 |
| 87 | 3300005617 | Ga0068859_100007966 | Ga0068859_10000796613 | 328 |
| 88 | 3300005618 | Ga0068864_100000235 | Ga0068864_10000023535 | 328 |
| 89 | 3300005618 | Ga0068864_100159474 | Ga0068864_1001594742 | 328 |
| 90 | 3300005841 | Ga0068863_100002289 | Ga0068863_10000228910 | 328 |
| 91 | 3300005842 | Ga0068858_100000514 | Ga0068858_10000051435 | 328 |
| 92 | 3300005844 | Ga0068862_100182504 | Ga0068862_1001825042 | 328 |
| 93 | 3300006358 | Ga0068871_100053035 | Ga0068871_1000530352 | 328 |
| 94 | 3300006881 | Ga0068865_100012549 | Ga0068865_1000125492 | 328 |
| 95 | 3300006931 | Ga0097620_100007966 | Ga0097620_1000079662 | 328 |
| 96 | 3300009098 | Ga0105245_10000170 | Ga0105245_1000017033 | 328 |
| 97 | 3300009098 | Ga0105245_10182092 | Ga0105245_101820921 | 328 |
| 98 | 3300009148 | Ga0105243_10207048 | Ga0105243_102070482 | 328 |
| 99 | 3300009177 | Ga0105248_10004489 | Ga0105248_1000448914 | 328 |
| 100 | 3300011119 | Ga0105246_10034472 | Ga0105246_100344725 | 328 |
| 101 | 3300013102 | Ga0157371_10000443 | Ga0157371_1000044330 | 328 |
| 102 | 3300013297 | Ga0157378_10000312 | Ga0157378_1000031243 | 328 |
| 103 | 3300013297 | Ga0157378_10093283 | Ga0157378_100932832 | 328 |
| 104 | 3300013307 | Ga0157372_10403546 | Ga0157372_104035462 | 328 |
| 105 | 3300013308 | Ga0157375_10389614 | Ga0157375_103896141 | 328 |
| 106 | 3300025315 | Ga0207697_10000063 | Ga0207697_100000638 | 328 |
| 107 | 3300025315 | Ga0207697_10028821 | Ga0207697_100288212 | 328 |
| 108 | 3300025901 | Ga0207688_10000106 | Ga0207688_1000010620 | 328 |
| 109 | 3300025904 | Ga0207647_10000246 | Ga0207647_1000024631 | 328 |
| 110 | 3300025907 | Ga0207645_10010447 | Ga0207645_100104472 | 328 |
| 111 | 3300025908 | Ga0207643_10033521 | Ga0207643_100335215 | 328 |
| 112 | 3300025919 | Ga0207657_10002106 | Ga0207657_100021068 | 328 |
| 113 | 3300025920 | Ga0207649_10046858 | Ga0207649_100468582 | 328 |
| 114 | 3300025923 | Ga0207681_10066779 | Ga0207681_100667792 | 328 |
| 115 | 3300025925 | Ga0207650_10010656 | Ga0207650_100106563 | 328 |
| 116 | 3300025932 | Ga0207690_10005149 | Ga0207690_100051492 | 328 |
| 117 | 3300025933 | Ga0207706_10000224 | Ga0207706_1000022447 | 328 |
| 118 | 3300025937 | Ga0207669_10009446 | Ga0207669_100094462 | 328 |
| 119 | 3300025940 | Ga0207691_10000750 | Ga0207691_1000075018 | 328 |
| 120 | 3300025942 | Ga0207689_10000051 | Ga0207689_1000005155 | 328 |
| 121 | 3300025945 | Ga0207679_10008122 | Ga0207679_100081224 | 328 |
| 122 | 3300025945 | Ga0207679_10095984 | Ga0207679_100959842 | 328 |
| 123 | 3300025949 | Ga0207667_10006507 | Ga0207667_100065076 | 328 |
| 124 | 3300025960 | Ga0207651_10000232 | Ga0207651_100002329 | 328 |
| 125 | 3300025960 | Ga0207651_10218034 | Ga0207651_102180342 | 328 |
| 126 | 3300025981 | Ga0207640_10003179 | Ga0207640_1000317910 | 328 |
| 127 | 3300026035 | Ga0207703_10003246 | Ga0207703_100032469 | 328 |
| 128 | 3300026041 | Ga0207639_10002776 | Ga0207639_1000277614 | 328 |
| 129 | 3300026067 | Ga0207678_10091269 | Ga0207678_100912692 | 328 |
| 130 | 3300026088 | Ga0207641_10007289 | Ga0207641_100072899 | 328 |
| 131 | 3300026088 | Ga0207641_10371123 | Ga0207641_103711232 | 328 |
| 132 | 3300026089 | Ga0207648_10000221 | Ga0207648_1000022155 | 328 |
| 133 | 3300026089 | Ga0207648_10022651 | Ga0207648_100226516 | 328 |
| 134 | 3300026095 | Ga0207676_10066411 | Ga0207676_100664112 | 328 |
| 135 | 3300026116 | Ga0207674_10002274 | Ga0207674_1000227418 | 328 |
| 136 | 3300026142 | Ga0207698_10002929 | Ga0207698_100029294 | 328 |
| 137 | 3300028380 | Ga0268265_10092209 | Ga0268265_100922092 | 328 |
| 138 | 3300028381 | Ga0268264_10013846 | Ga0268264_100138462 | 328 |
| 139 | 3300042005 | Ga0439448_0020533 | Ga0439448_0020533_945_2021 | 328 |
| 140 | 3300048915 | Ga0496112_0185924 | Ga0496112_0185924_641_1708 | 328 |
| 141 | 3300049581 | Ga0501047_0138116 | Ga0501047_0138116_390_1466 | 328 |
| 142 | 3300009094 | Ga0111539_10323458 | Ga0111539_103234582 | 329 |
| 143 | 3300025928 | Ga0207700_10028022 | Ga0207700_100280223 | 329 |
| 144 | 3300031731 | Ga0307405_10033892 | Ga0307405_100338923 | 329 |
| 145 | 3300031824 | Ga0307413_10000695 | Ga0307413_100006956 | 329 |
| 146 | 3300031852 | Ga0307410_10025056 | Ga0307410_100250563 | 329 |
| 147 | 3300031852 | Ga0307410_10027323 | Ga0307410_100273232 | 329 |
| 148 | 3300032002 | Ga0307416_100011423 | Ga0307416_1000114232 | 329 |
| 149 | 3300032004 | Ga0307414_10058269 | Ga0307414_100582693 | 329 |
| 150 | 3300032005 | Ga0307411_10020964 | Ga0307411_100209643 | 329 |
| 151 | 3300032126 | Ga0307415_100002323 | Ga0307415_1000023231 | 329 |
| 152 | 3300032126 | Ga0307415_100048271 | Ga0307415_1000482712 | 329 |
| 153 | 3300050489 | nmdc:mga03683_11464_c1 | nmdc:mga03683_11464_c1_221_1282 | 329 |
| 154 | 3300005457 | Ga0070662_100013733 | Ga0070662_1000137332 | 330 |
| 155 | 3300005546 | Ga0070696_100003697 | Ga0070696_1000036977 | 330 |
| 156 | 3300005578 | Ga0068854_100021404 | Ga0068854_1000214042 | 330 |
| 157 | 3300005937 | Ga0081455_10000029 | Ga0081455_10000029121 | 330 |
| 158 | 3300009094 | Ga0111539_10223978 | Ga0111539_102239782 | 330 |
| 159 | 3300031548 | Ga0307408_100133248 | Ga0307408_1001332482 | 330 |
| 160 | 3300031824 | Ga0307413_10076582 | Ga0307413_100765822 | 330 |
| 161 | 3300031901 | Ga0307406_10170992 | Ga0307406_101709921 | 330 |
| 162 | 3300032005 | Ga0307411_10327735 | Ga0307411_103277351 | 330 |
| 163 | 3300044712 | Ga0453684_0038771 | Ga0453684_0038771_5119_6195 | 330 |
| 164 | 3300048905 | Ga0496102_0000049 | Ga0496102_0000049_139080_140156 | 330 |
| 165 | 3300048906 | Ga0496103_0000037 | Ga0496103_0000037_39319_40395 | 330 |
| 166 | 3300048919 | Ga0496116_0000664 | Ga0496116_0000664_39020_40096 | 330 |
| 167 | 3300048920 | Ga0496117_0000115 | Ga0496117_0000115_139080_140156 | 330 |
| 168 | 3300048921 | Ga0496118_0000086 | Ga0496118_0000086_39333_40409 | 330 |
| 169 | 3300048921 | Ga0496118_0053610 | Ga0496118_0053610_1149_2168 | 330 |
| 170 | 3300048923 | Ga0496120_0086404 | Ga0496120_0086404_215_1291 | 330 |
| 171 | 3300048924 | Ga0496121_0012133 | Ga0496121_0012133_3362_4381 | 330 |
| 172 | 3300048925 | Ga0496122_0011314 | Ga0496122_0011314_5709_6728 | 330 |
| 173 | 3300048927 | Ga0496124_0000102 | Ga0496124_0000102_39333_40409 | 330 |
| 174 | 3300005339 | Ga0070660_100000511 | Ga0070660_10000051124 | 331 |
| 175 | 3300005366 | Ga0070659_100000005 | Ga0070659_100000005159 | 331 |
| 176 | 3300005539 | Ga0068853_100005580 | Ga0068853_10000558010 | 331 |
| 177 | 3300005614 | Ga0068856_100105955 | Ga0068856_1001059552 | 331 |
| 178 | 3300005616 | Ga0068852_100002771 | Ga0068852_1000027712 | 331 |
| 179 | 3300009551 | Ga0105238_10019570 | Ga0105238_100195706 | 331 |
| 180 | 3300013100 | Ga0157373_10248426 | Ga0157373_102484261 | 331 |
| 181 | 3300013104 | Ga0157370_10125144 | Ga0157370_101251442 | 331 |
| 182 | 3300013105 | Ga0157369_10014002 | Ga0157369_100140029 | 331 |
| 183 | 3300013307 | Ga0157372_10208642 | Ga0157372_102086422 | 331 |
| 184 | 3300025909 | Ga0207705_10017324 | Ga0207705_100173242 | 331 |
| 185 | 3300025914 | Ga0207671_10014386 | Ga0207671_100143863 | 331 |
| 186 | 3300025932 | Ga0207690_10000002 | Ga0207690_10000002804 | 331 |
| 187 | 3300026023 | Ga0207677_10000100 | Ga0207677_100001005 | 331 |
| 188 | 3300026041 | Ga0207639_10030466 | Ga0207639_100304662 | 331 |
| 189 | 3300026078 | Ga0207702_10073246 | Ga0207702_100732462 | 331 |
| 190 | 3300026116 | Ga0207674_10132360 | Ga0207674_101323602 | 331 |
| 191 | 3300026142 | Ga0207698_10032606 | Ga0207698_100326061 | 331 |
| 192 | 3300037418 | Ga0395900_0232961 | Ga0395900_0232961_786_1841 | 331 |
| 193 | 3300042005 | Ga0439448_0001832 | Ga0439448_0001832_1081_2190 | 331 |
| 194 | 3300050507 | nmdc:mga05p37_125491_c1 | nmdc:mga05p37_125491_c1_1854_2927 | 331 |
| 195 | 3300001979 | JGI24740J21852_10000820 | JGI24740J21852_100008206 | 332 |
| 196 | 3300005329 | Ga0070683_100006609 | Ga0070683_10000660910 | 332 |
| 197 | 3300005336 | Ga0070680_100000105 | Ga0070680_1000001057 | 332 |
| 198 | 3300005455 | Ga0070663_100002096 | Ga0070663_1000020965 | 332 |
| 199 | 3300005457 | Ga0070662_100084612 | Ga0070662_1000846121 | 332 |
| 200 | 3300005530 | Ga0070679_100000125 | Ga0070679_10000012556 | 332 |
| 201 | 3300005577 | Ga0068857_100108161 | Ga0068857_1001081611 | 332 |
| 202 | 3300005578 | Ga0068854_100103485 | Ga0068854_1001034852 | 332 |
| 203 | 3300005614 | Ga0068856_100001220 | Ga0068856_10000122030 | 332 |
| 204 | 3300005616 | Ga0068852_100110699 | Ga0068852_1001106992 | 332 |
| 205 | 3300013104 | Ga0157370_10010104 | Ga0157370_100101043 | 332 |
| 206 | 3300025904 | Ga0207647_10020217 | Ga0207647_100202172 | 332 |
| 207 | 3300025909 | Ga0207705_10000067 | Ga0207705_1000006713 | 332 |
| 208 | 3300025909 | Ga0207705_10188112 | Ga0207705_101881121 | 332 |
| 209 | 3300025917 | Ga0207660_10000379 | Ga0207660_1000037930 | 332 |
| 210 | 3300025921 | Ga0207652_10000058 | Ga0207652_1000005855 | 332 |
| 211 | 3300025944 | Ga0207661_10014353 | Ga0207661_100143532 | 332 |
| 212 | 3300025949 | Ga0207667_10000828 | Ga0207667_1000082813 | 332 |
| 213 | 3300026041 | Ga0207639_10065494 | Ga0207639_100654942 | 332 |
| 214 | 3300026067 | Ga0207678_10002816 | Ga0207678_100028169 | 332 |
| 215 | 3300026078 | Ga0207702_10001153 | Ga0207702_100011533 | 332 |
| 216 | 3300026116 | Ga0207674_10155587 | Ga0207674_101555872 | 332 |
| 217 | 3300026142 | Ga0207698_10132459 | Ga0207698_101324592 | 332 |
| 218 | 3300031903 | Ga0307407_10086314 | Ga0307407_100863142 | 332 |
| 219 | 3300035088 | Ga0373940_0026616 | Ga0373940_0026616_179_1252 | 332 |
| 220 | 3300035112 | Ga0373932_0048726 | Ga0373932_0048726_143_1216 | 332 |
| 221 | 3300035207 | Ga0373942_0011599 | Ga0373942_0011599_409_1482 | 332 |
| 222 | 3300035241 | Ga0373961_0001549 | Ga0373961_0001549_1500_2573 | 332 |
| 223 | 3300035242 | Ga0373962_0001250 | Ga0373962_0001250_4035_5108 | 332 |
| 224 | 3300035691 | Ga0373931_0006522 | Ga0373931_0006522_2690_3763 | 332 |
| 225 | 3300061734 | Ga0530510_0136306 | Ga0530510_0136306_305_1378 | 332 |
| 226 | 3300005354 | Ga0070675_100095684 | Ga0070675_1000956842 | 333 |
| 227 | 3300005364 | Ga0070673_100132181 | Ga0070673_1001321812 | 333 |
| 228 | 3300025919 | Ga0207657_10028113 | Ga0207657_100281132 | 333 |
| 229 | 3300026067 | Ga0207678_10037617 | Ga0207678_100376174 | 333 |
| 230 | 3300031548 | Ga0307408_100039656 | Ga0307408_1000396562 | 333 |
| 231 | 3300032004 | Ga0307414_10009432 | Ga0307414_100094324 | 333 |
| 232 | 3300032005 | Ga0307411_10024440 | Ga0307411_100244401 | 333 |
| 233 | 3300037312 | Ga0395899_0062686 | Ga0395899_0062686_164_1231 | 333 |
| 234 | 3300037466 | Ga0395898_0098687 | Ga0395898_0098687_231_1298 | 333 |
| 235 | 3300037471 | Ga0395905_0056198 | Ga0395905_0056198_1109_2176 | 333 |
| 236 | 3300038443 | Ga0395901_0011353 | Ga0395901_0011353_1441_2508 | 333 |
| 237 | 3300005353 | Ga0070669_100187623 | Ga0070669_1001876232 | 334 |
| 238 | 3300005364 | Ga0070673_100084491 | Ga0070673_1000844912 | 334 |
| 239 | 3300005367 | Ga0070667_100013033 | Ga0070667_1000130336 | 334 |
| 240 | 3300005457 | Ga0070662_100002227 | Ga0070662_1000022277 | 334 |
| 241 | 3300005564 | Ga0070664_100110229 | Ga0070664_1001102293 | 334 |
| 242 | 3300005577 | Ga0068857_100114134 | Ga0068857_1001141343 | 334 |
| 243 | 3300005617 | Ga0068859_100000136 | Ga0068859_10000013669 | 334 |
| 244 | 3300005618 | Ga0068864_100000711 | Ga0068864_10000071125 | 334 |
| 245 | 3300005841 | Ga0068863_100000140 | Ga0068863_10000014071 | 334 |
| 246 | 3300005841 | Ga0068863_100029062 | Ga0068863_1000290626 | 334 |
| 247 | 3300005842 | Ga0068858_100000695 | Ga0068858_1000006958 | 334 |
| 248 | 3300006844 | Ga0075428_100119007 | Ga0075428_1001190072 | 334 |
| 249 | 3300006846 | Ga0075430_100039288 | Ga0075430_1000392883 | 334 |
| 250 | 3300006931 | Ga0097620_100000136 | Ga0097620_10000013669 | 334 |
| 251 | 3300009177 | Ga0105248_10000184 | Ga0105248_1000018450 | 334 |
| 252 | 3300009553 | Ga0105249_10019397 | Ga0105249_100193973 | 334 |
| 253 | 3300013306 | Ga0163162_10050805 | Ga0163162_100508052 | 334 |
| 254 | 3300014325 | Ga0163163_10000131 | Ga0163163_1000013142 | 334 |
| 255 | 3300014968 | Ga0157379_10011780 | Ga0157379_100117802 | 334 |
| 256 | 3300025921 | Ga0207652_10239491 | Ga0207652_102394912 | 334 |
| 257 | 3300025933 | Ga0207706_10005974 | Ga0207706_100059748 | 334 |
| 258 | 3300025941 | Ga0207711_10000105 | Ga0207711_1000010563 | 334 |
| 259 | 3300025942 | Ga0207689_10093018 | Ga0207689_100930182 | 334 |
| 260 | 3300025961 | Ga0207712_10014190 | Ga0207712_100141905 | 334 |
| 261 | 3300025986 | Ga0207658_10001956 | Ga0207658_1000195613 | 334 |
| 262 | 3300026035 | Ga0207703_10002288 | Ga0207703_100022888 | 334 |
| 263 | 3300026067 | Ga0207678_10019305 | Ga0207678_100193056 | 334 |
| 264 | 3300026088 | Ga0207641_10000172 | Ga0207641_1000017232 | 334 |
| 265 | 3300026095 | Ga0207676_10000300 | Ga0207676_1000030030 | 334 |
| 266 | 3300026095 | Ga0207676_10032624 | Ga0207676_100326242 | 334 |
| 267 | 3300026116 | Ga0207674_10026673 | Ga0207674_100266731 | 334 |
| 268 | 3300028381 | Ga0268264_10008037 | Ga0268264_100080376 | 334 |
| 269 | 3300031852 | Ga0307410_10087127 | Ga0307410_100871272 | 334 |
| 270 | 3300031995 | Ga0307409_100045058 | Ga0307409_1000450582 | 334 |
| 271 | 3300031995 | Ga0307409_100318463 | Ga0307409_1003184631 | 334 |
| 272 | 3300037312 | Ga0395899_0031414 | Ga0395899_0031414_2402_3463 | 334 |
| 273 | 3300037418 | Ga0395900_0205317 | Ga0395900_0205317_643_1704 | 334 |
| 274 | 3300037466 | Ga0395898_0055723 | Ga0395898_0055723_691_1752 | 334 |
| 275 | 3300037471 | Ga0395905_0020610 | Ga0395905_0020610_336_1397 | 334 |
| 276 | 3300038443 | Ga0395901_0085045 | Ga0395901_0085045_1837_2898 | 334 |
| 277 | 3300050509 | nmdc:mga0qj67_69878_c1 | nmdc:mga0qj67_69878_c1_1362_2447 | 334 |
| 278 | 3300050510 | nmdc:mga06r32_94296_c1 | nmdc:mga06r32_94296_c1_880_1965 | 334 |
| 279 | 3300005366 | Ga0070659_100113372 | Ga0070659_1001133722 | 335 |
| 280 | 3300005577 | Ga0068857_100150099 | Ga0068857_1001500992 | 335 |
| 281 | 3300013296 | Ga0157374_10008229 | Ga0157374_100082296 | 335 |
| 282 | 3300025932 | Ga0207690_10072352 | Ga0207690_100723522 | 335 |
| 283 | 3300026078 | Ga0207702_10430719 | Ga0207702_104307192 | 335 |
| 284 | 3300026116 | Ga0207674_10162057 | Ga0207674_101620572 | 335 |
| 285 | 3300045051 | Ga0451576_0000024 | Ga0451576_0000024_320408_321508 | 335 |
| 286 | 3300046524 | Ga0495648_0059764 | Ga0495648_0059764_640_1722 | 335 |
| 287 | 3300005578 | Ga0068854_100012217 | Ga0068854_1000122175 | 336 |
| 288 | 3300031852 | Ga0307410_10151460 | Ga0307410_101514602 | 336 |
| 289 | 3300031901 | Ga0307406_10003621 | Ga0307406_100036216 | 336 |
| 290 | 3300031901 | Ga0307406_10244896 | Ga0307406_102448961 | 336 |
| 291 | 3300031911 | Ga0307412_10000104 | Ga0307412_1000010416 | 336 |
| 292 | 3300031911 | Ga0307412_10058277 | Ga0307412_100582772 | 336 |
| 293 | 3300031995 | Ga0307409_100118569 | Ga0307409_1001185692 | 336 |
| 294 | 3300032002 | Ga0307416_100022527 | Ga0307416_1000225273 | 336 |
| 295 | 3300032126 | Ga0307415_100132670 | Ga0307415_1001326701 | 336 |
| 296 | 3300037312 | Ga0395899_0027364 | Ga0395899_0027364_2466_3527 | 336 |
| 297 | 3300037418 | Ga0395900_0003168 | Ga0395900_0003168_11220_12281 | 336 |
| 298 | 3300038443 | Ga0395901_0000131 | Ga0395901_0000131_19862_20923 | 336 |
| 299 | 3300045049 | Ga0466959_0038377 | Ga0466959_0038377_659_1732 | 336 |
| 300 | 3300045836 | Ga0466958_0074986 | Ga0466958_0074986_111_1184 | 336 |
| 301 | 3300048923 | Ga0496120_0037633 | Ga0496120_0037633_1166_2257 | 336 |
| 302 | 3300005290 | Ga0065712_10157228 | Ga0065712_101572282 | 337 |
| 303 | 3300005331 | Ga0070670_100171019 | Ga0070670_1001710192 | 337 |
| 304 | 3300005333 | Ga0070677_10010369 | Ga0070677_100103693 | 337 |
| 305 | 3300005564 | Ga0070664_100084855 | Ga0070664_1000848552 | 337 |
| 306 | 3300005719 | Ga0068861_100000004 | Ga0068861_10000000445 | 337 |
| 307 | 3300025893 | Ga0207682_10005874 | Ga0207682_100058742 | 337 |
| 308 | 3300025917 | Ga0207660_10000024 | Ga0207660_1000002451 | 337 |
| 309 | 3300025941 | Ga0207711_10000917 | Ga0207711_1000091719 | 337 |
| 310 | 3300025945 | Ga0207679_10108531 | Ga0207679_101085311 | 337 |
| 311 | 3300025972 | Ga0207668_10107533 | Ga0207668_101075332 | 337 |
| 312 | 3300026116 | Ga0207674_10185975 | Ga0207674_101859751 | 337 |
| 313 | 3300026118 | Ga0207675_100000032 | Ga0207675_10000003239 | 337 |
| 314 | 3300032002 | Ga0307416_100079397 | Ga0307416_1000793972 | 337 |
| 315 | 3300037471 | Ga0395905_0091212 | Ga0395905_0091212_92_1159 | 337 |
| 316 | 3300044693 | Ga0466961_0045825 | Ga0466961_0045825_1358_2431 | 337 |
| 317 | 3300044712 | Ga0453684_0369532 | Ga0453684_0369532_450_1517 | 337 |
| 318 | 3300048911 | Ga0496108_0121555 | Ga0496108_0121555_249_1316 | 337 |
| 319 | 3300048912 | Ga0496109_0063831 | Ga0496109_0063831_484_1551 | 337 |
| 320 | 3300048928 | Ga0496125_0024159 | Ga0496125_0024159_181_1272 | 337 |
| 321 | 3300025931 | Ga0207644_10157182 | Ga0207644_101571822 | 338 |
| 322 | 3300031731 | Ga0307405_10186398 | Ga0307405_101863982 | 338 |
| 323 | 3300031852 | Ga0307410_10000465 | Ga0307410_100004657 | 338 |
| 324 | 3300031901 | Ga0307406_10048602 | Ga0307406_100486022 | 338 |
| 325 | 3300031903 | Ga0307407_10016129 | Ga0307407_100161292 | 338 |
| 326 | 3300031995 | Ga0307409_100002678 | Ga0307409_1000026788 | 338 |
| 327 | 3300032004 | Ga0307414_10004937 | Ga0307414_100049372 | 338 |
| 328 | 3300032005 | Ga0307411_10028219 | Ga0307411_100282192 | 338 |
| 329 | 3300053140 | Ga0500573_0114034 | Ga0500573_0114034_237_1322 | 338 |
| 330 | 3300005530 | Ga0070679_100193348 | Ga0070679_1001933482 | 339 |
| 331 | 3300005563 | Ga0068855_100381109 | Ga0068855_1003811092 | 339 |
| 332 | 3300005614 | Ga0068856_100108554 | Ga0068856_1001085542 | 339 |
| 333 | 3300009177 | Ga0105248_10665958 | Ga0105248_106659581 | 339 |
| 334 | 3300025913 | Ga0207695_10222370 | Ga0207695_102223702 | 339 |
| 335 | 3300025917 | Ga0207660_10038338 | Ga0207660_100383382 | 339 |
| 336 | 3300025921 | Ga0207652_10326415 | Ga0207652_103264152 | 339 |
| 337 | 3300027876 | Ga0209974_10006485 | Ga0209974_100064852 | 339 |
| 338 | 3300028380 | Ga0268265_10142110 | Ga0268265_101421102 | 339 |
| 339 | 3300032004 | Ga0307414_10078957 | Ga0307414_100789572 | 339 |
| 340 | 3300037466 | Ga0395898_0241432 | Ga0395898_0241432_243_1304 | 339 |
| 341 | 3300037471 | Ga0395905_0000232 | Ga0395905_0000232_6192_7253 | 339 |
| 342 | 3300044694 | Ga0466963_0032406 | Ga0466963_0032406_116_1183 | 339 |
| 343 | 3300005843 | Ga0068860_100018036 | Ga0068860_1000180366 | 340 |
| 344 | 3300013102 | Ga0157371_10138748 | Ga0157371_101387482 | 340 |
| 345 | 3300025972 | Ga0207668_10031542 | Ga0207668_100315422 | 340 |
| 346 | 3300028381 | Ga0268264_10197413 | Ga0268264_101974132 | 340 |
| 347 | 3300031995 | Ga0307409_100089477 | Ga0307409_1000894772 | 340 |
| 348 | 3300035119 | Ga0373956_0017500 | Ga0373956_0017500_735_1886 | 340 |
| 349 | 3300037466 | Ga0395898_0164232 | Ga0395898_0164232_810_1877 | 340 |
| 350 | 3300038443 | Ga0395901_0066872 | Ga0395901_0066872_2113_3180 | 340 |
| 351 | 3300045836 | Ga0466958_0102598 | Ga0466958_0102598_651_1718 | 340 |
| 352 | 3300046616 | Ga0495668_0008332 | Ga0495668_0008332_1974_3041 | 340 |
| 353 | 3300046684 | Ga0495669_0002438 | Ga0495669_0002438_1380_2447 | 340 |
| 354 | 3300005290 | Ga0065712_10088801 | Ga0065712_100888012 | 341 |
| 355 | 3300005331 | Ga0070670_100000657 | Ga0070670_1000006572 | 341 |
| 356 | 3300005344 | Ga0070661_100027477 | Ga0070661_1000274773 | 341 |
| 357 | 3300005355 | Ga0070671_100000620 | Ga0070671_10000062027 | 341 |
| 358 | 3300005364 | Ga0070673_100006165 | Ga0070673_1000061652 | 341 |
| 359 | 3300005366 | Ga0070659_100055678 | Ga0070659_1000556783 | 341 |
| 360 | 3300005457 | Ga0070662_100034379 | Ga0070662_1000343792 | 341 |
| 361 | 3300005543 | Ga0070672_100013878 | Ga0070672_1000138783 | 341 |
| 362 | 3300005564 | Ga0070664_100003017 | Ga0070664_10000301710 | 341 |
| 363 | 3300005578 | Ga0068854_100006061 | Ga0068854_1000060616 | 341 |
| 364 | 3300005618 | Ga0068864_100230836 | Ga0068864_1002308362 | 341 |
| 365 | 3300005841 | Ga0068863_100000103 | Ga0068863_1000001036 | 341 |
| 366 | 3300005844 | Ga0068862_100016013 | Ga0068862_1000160134 | 341 |
| 367 | 3300009177 | Ga0105248_10002069 | Ga0105248_1000206918 | 341 |
| 368 | 3300009177 | Ga0105248_10040085 | Ga0105248_100400854 | 341 |
| 369 | 3300013100 | Ga0157373_10201695 | Ga0157373_102016952 | 341 |
| 370 | 3300013105 | Ga0157369_10021037 | Ga0157369_100210374 | 341 |
| 371 | 3300013308 | Ga0157375_10006351 | Ga0157375_100063516 | 341 |
| 372 | 3300025920 | Ga0207649_10020713 | Ga0207649_100207132 | 341 |
| 373 | 3300025925 | Ga0207650_10002874 | Ga0207650_100028743 | 341 |
| 374 | 3300025926 | Ga0207659_10008219 | Ga0207659_100082193 | 341 |
| 375 | 3300025933 | Ga0207706_10004809 | Ga0207706_100048098 | 341 |
| 376 | 3300025940 | Ga0207691_10007047 | Ga0207691_100070474 | 341 |
| 377 | 3300025941 | Ga0207711_10150956 | Ga0207711_101509562 | 341 |
| 378 | 3300025945 | Ga0207679_10033900 | Ga0207679_100339001 | 341 |
| 379 | 3300025949 | Ga0207667_10405370 | Ga0207667_104053702 | 341 |
| 380 | 3300025981 | Ga0207640_10175318 | Ga0207640_101753182 | 341 |
| 381 | 3300026088 | Ga0207641_10000113 | Ga0207641_100001136 | 341 |
| 382 | 3300026116 | Ga0207674_10218544 | Ga0207674_102185442 | 341 |
| 383 | 3300028379 | Ga0268266_10246760 | Ga0268266_102467602 | 341 |
| 384 | 3300028380 | Ga0268265_10068743 | Ga0268265_100687432 | 341 |
| 385 | 3300031995 | Ga0307409_100074227 | Ga0307409_1000742272 | 341 |
| 386 | 3300046506 | Ga0495583_0051417 | Ga0495583_0051417_587_1723 | 341 |
| 387 | 3300046513 | Ga0495616_0039134 | Ga0495616_0039134_1163_2299 | 341 |
| 388 | 3300046684 | Ga0495669_0001501 | Ga0495669_0001501_601_1668 | 341 |
| 389 | 3300048090 | Ga0495615_0000114 | Ga0495615_0000114_14546_15682 | 341 |
| 390 | 3300048913 | Ga0496110_0005561 | Ga0496110_0005561_1049_2116 | 341 |
| 391 | 3300048914 | Ga0496111_0032922 | Ga0496111_0032922_2607_3674 | 341 |
| 392 | 3300048917 | Ga0496114_0065139 | Ga0496114_0065139_881_1948 | 341 |
| 393 | 3300048925 | Ga0496122_0012455 | Ga0496122_0012455_4831_5943 | 341 |
| 394 | 3300048926 | Ga0496123_0002815 | Ga0496123_0002815_4884_5996 | 341 |
| 395 | 3300048927 | Ga0496124_0019874 | Ga0496124_0019874_4795_5907 | 341 |
| 396 | 3300002155 | JGI24033J26618_1003599 | JGI24033J26618_10035991 | 342 |
| 397 | 3300005327 | Ga0070658_10041579 | Ga0070658_100415792 | 342 |
| 398 | 3300005331 | Ga0070670_100094950 | Ga0070670_1000949502 | 342 |
| 399 | 3300005339 | Ga0070660_100059267 | Ga0070660_1000592672 | 342 |
| 400 | 3300005353 | Ga0070669_100028765 | Ga0070669_1000287653 | 342 |
| 401 | 3300005354 | Ga0070675_100008142 | Ga0070675_1000081423 | 342 |
| 402 | 3300005356 | Ga0070674_100016920 | Ga0070674_1000169202 | 342 |
| 403 | 3300005366 | Ga0070659_100022244 | Ga0070659_1000222442 | 342 |
| 404 | 3300005455 | Ga0070663_100098573 | Ga0070663_1000985732 | 342 |
| 405 | 3300005456 | Ga0070678_100192392 | Ga0070678_1001923922 | 342 |
| 406 | 3300005457 | Ga0070662_100233670 | Ga0070662_1002336702 | 342 |
| 407 | 3300005564 | Ga0070664_100021584 | Ga0070664_1000215842 | 342 |
| 408 | 3300014326 | Ga0157380_10060921 | Ga0157380_100609212 | 342 |
| 409 | 3300025893 | Ga0207682_10029749 | Ga0207682_100297492 | 342 |
| 410 | 3300025907 | Ga0207645_10051608 | Ga0207645_100516082 | 342 |
| 411 | 3300025909 | Ga0207705_10039863 | Ga0207705_100398632 | 342 |
| 412 | 3300025919 | Ga0207657_10006174 | Ga0207657_100061749 | 342 |
| 413 | 3300025920 | Ga0207649_10106389 | Ga0207649_101063892 | 342 |
| 414 | 3300025923 | Ga0207681_10019791 | Ga0207681_100197912 | 342 |
| 415 | 3300025925 | Ga0207650_10010288 | Ga0207650_100102882 | 342 |
| 416 | 3300025926 | Ga0207659_10006612 | Ga0207659_100066123 | 342 |
| 417 | 3300025932 | Ga0207690_10014175 | Ga0207690_100141753 | 342 |
| 418 | 3300025933 | Ga0207706_10020915 | Ga0207706_100209152 | 342 |
| 419 | 3300025949 | Ga0207667_10282364 | Ga0207667_102823642 | 342 |
| 420 | 3300026121 | Ga0207683_10185608 | Ga0207683_101856082 | 342 |
| 421 | 3300031731 | Ga0307405_10000196 | Ga0307405_1000019612 | 342 |
| 422 | 3300037312 | Ga0395899_0084827 | Ga0395899_0084827_630_1691 | 342 |
| 423 | 3300037418 | Ga0395900_0004480 | Ga0395900_0004480_6030_7091 | 342 |
| 424 | 3300037471 | Ga0395905_0010696 | Ga0395905_0010696_652_1713 | 342 |
| 425 | 3300038443 | Ga0395901_0019979 | Ga0395901_0019979_4084_5145 | 342 |
| 426 | 3300049583 | Ga0501067_0020300 | Ga0501067_0020300_2131_3204 | 342 |
| 427 | 3300005366 | Ga0070659_100039832 | Ga0070659_1000398322 | 343 |
| 428 | 3300005564 | Ga0070664_100172029 | Ga0070664_1001720292 | 343 |
| 429 | 3300005617 | Ga0068859_100000623 | Ga0068859_10000062325 | 343 |
| 430 | 3300006871 | Ga0075434_100003078 | Ga0075434_1000030788 | 343 |
| 431 | 3300006931 | Ga0097620_100000623 | Ga0097620_10000062325 | 343 |
| 432 | 3300009177 | Ga0105248_10001646 | Ga0105248_100016463 | 343 |
| 433 | 3300014325 | Ga0163163_10112163 | Ga0163163_101121632 | 343 |
| 434 | 3300014968 | Ga0157379_10041621 | Ga0157379_100416215 | 343 |
| 435 | 3300025919 | Ga0207657_10172193 | Ga0207657_101721932 | 343 |
| 436 | 3300025932 | Ga0207690_10031844 | Ga0207690_100318442 | 343 |
| 437 | 3300025941 | Ga0207711_10013792 | Ga0207711_100137923 | 343 |
| 438 | 3300025945 | Ga0207679_10143950 | Ga0207679_101439502 | 343 |
| 439 | 3300042007 | Ga0439449_0002667 | Ga0439449_0002667_2861_3928 | 343 |
| 440 | 3300048903 | Ga0496100_0043927 | Ga0496100_0043927_1274_2359 | 343 |
| 441 | 3300048905 | Ga0496102_0038529 | Ga0496102_0038529_1273_2331 | 343 |
| 442 | 3300048908 | Ga0496105_0045068 | Ga0496105_0045068_814_1899 | 343 |
| 443 | 3300048909 | Ga0496106_0263598 | Ga0496106_0263598_100_1158 | 343 |
| 444 | 3300048913 | Ga0496110_0029322 | Ga0496110_0029322_1693_2751 | 343 |
| 445 | 3300048914 | Ga0496111_0084793 | Ga0496111_0084793_920_2005 | 343 |
| 446 | 3300048915 | Ga0496112_0138104 | Ga0496112_0138104_651_1736 | 343 |
| 447 | 3300048918 | Ga0496115_0165412 | Ga0496115_0165412_229_1314 | 343 |
| 448 | 3300050512 | nmdc:mga0n895_6781_c1 | nmdc:mga0n895_6781_c1_2570_3667 | 343 |
| 449 | 3300050513 | nmdc:mga0rr50_47105_c1 | nmdc:mga0rr50_47105_c1_1086_2183 | 343 |
| 450 | 3300053134 | Ga0500658_0055351 | Ga0500658_0055351_221_1318 | 343 |
| 451 | 3300053157 | Ga0500624_000003 | Ga0500624_000003_130377_131447 | 343 |
| 452 | 3300053178 | Ga0500637_0000024 | Ga0500637_0000024_38622_39692 | 343 |
| 453 | iso_pu_bacteria | 2895880812 | 2895881214 | 343 |
| 454 | 3300005329 | Ga0070683_100117064 | Ga0070683_1001170641 | 344 |
| 455 | 3300005455 | Ga0070663_100024870 | Ga0070663_1000248703 | 344 |
| 456 | 3300026067 | Ga0207678_10008447 | Ga0207678_100084473 | 344 |
| 457 | 3300026121 | Ga0207683_10087090 | Ga0207683_100870904 | 344 |
| 458 | 3300031548 | Ga0307408_100004543 | Ga0307408_1000045436 | 344 |
| 459 | 3300031824 | Ga0307413_10049490 | Ga0307413_100494903 | 344 |
| 460 | 3300037312 | Ga0395899_0090625 | Ga0395899_0090625_519_1589 | 344 |
| 461 | 3300037418 | Ga0395900_0214746 | Ga0395900_0214746_154_1224 | 344 |
| 462 | 3300037466 | Ga0395898_0180383 | Ga0395898_0180383_290_1360 | 344 |
| 463 | 3300038443 | Ga0395901_0094403 | Ga0395901_0094403_1847_2917 | 344 |
| 464 | 3300048927 | Ga0496124_0006985 | Ga0496124_0006985_3160_4251 | 344 |
| 465 | 3300005548 | Ga0070665_100058303 | Ga0070665_1000583032 | 345 |
| 466 | 3300021388 | Ga0213875_10005028 | Ga0213875_100050282 | 345 |
| 467 | 3300026067 | Ga0207678_10123604 | Ga0207678_101236042 | 345 |
| 468 | 3300028379 | Ga0268266_10035494 | Ga0268266_100354945 | 345 |
| 469 | 3300037853 | Ga0436364_0411459 | Ga0436364_0411459_4088_5233 | 345 |
| 470 | 3300053096 | Ga0500641_0006777 | Ga0500641_0006777_1536_2678 | 345 |
| 471 | 3300005985 | Ga0081539_10014655 | Ga0081539_100146556 | 346 |
| 472 | 3300021384 | Ga0213876_10000371 | Ga0213876_1000037135 | 346 |
| 473 | 3300031852 | Ga0307410_10149917 | Ga0307410_101499172 | 346 |
| 474 | 3300046460 | Ga0495638_0000207 | Ga0495638_0000207_22736_23890 | 346 |
| 475 | 3300039437 | Ga0436365_1110654 | Ga0436365_1110654_57_1151 | 347 |
| 476 | 3300049824 | Ga0501045_0079987 | Ga0501045_0079987_1064_2134 | 347 |
| 477 | 3300053116 | Ga0500592_000314 | Ga0500592_000314_4069_5118 | 347 |
| 478 | 3300005616 | Ga0068852_100208572 | Ga0068852_1002085722 | 348 |
| 479 | 3300005336 | Ga0070680_100024107 | Ga0070680_1000241071 | 349 |
| 480 | 3300005337 | Ga0070682_100013327 | Ga0070682_1000133273 | 349 |
| 481 | 3300005366 | Ga0070659_100036650 | Ga0070659_1000366502 | 349 |
| 482 | 3300005530 | Ga0070679_100008091 | Ga0070679_10000809114 | 349 |
| 483 | 3300005546 | Ga0070696_100037829 | Ga0070696_1000378294 | 349 |
| 484 | 3300005547 | Ga0070693_100007429 | Ga0070693_1000074298 | 349 |
| 485 | 3300005564 | Ga0070664_100049081 | Ga0070664_1000490812 | 349 |
| 486 | 3300005615 | Ga0070702_100058941 | Ga0070702_1000589411 | 349 |
| 487 | 3300005983 | Ga0081540_1000048 | Ga0081540_100004881 | 349 |
| 488 | 3300006042 | Ga0075368_10008487 | Ga0075368_100084871 | 349 |
| 489 | 3300006051 | Ga0075364_10008502 | Ga0075364_100085028 | 349 |
| 490 | 3300006178 | Ga0075367_10017386 | Ga0075367_100173862 | 349 |
| 491 | 3300006178 | Ga0075367_10116249 | Ga0075367_101162492 | 349 |
| 492 | 3300006844 | Ga0075428_100084896 | Ga0075428_1000848962 | 349 |
| 493 | 3300006847 | Ga0075431_100019995 | Ga0075431_1000199952 | 349 |
| 494 | 3300006880 | Ga0075429_100172609 | Ga0075429_1001726091 | 349 |
| 495 | 3300009094 | Ga0111539_10067078 | Ga0111539_100670785 | 349 |
| 496 | 3300009174 | Ga0105241_10018566 | Ga0105241_100185664 | 349 |
| 497 | 3300009545 | Ga0105237_10065812 | Ga0105237_100658125 | 349 |
| 498 | 3300009551 | Ga0105238_10105601 | Ga0105238_101056014 | 349 |
| 499 | 3300011119 | Ga0105246_10031393 | Ga0105246_100313932 | 349 |
| 500 | 3300013297 | Ga0157378_10323661 | Ga0157378_103236611 | 349 |
| 501 | 3300014326 | Ga0157380_10157232 | Ga0157380_101572322 | 349 |
| 502 | 3300025912 | Ga0207707_10148459 | Ga0207707_101484591 | 349 |
| 503 | 3300025919 | Ga0207657_10080802 | Ga0207657_100808023 | 349 |
| 504 | 3300025921 | Ga0207652_10118010 | Ga0207652_101180102 | 349 |
| 505 | 3300025932 | Ga0207690_10061849 | Ga0207690_100618492 | 349 |
| 506 | 3300026067 | Ga0207678_10001937 | Ga0207678_1000193723 | 349 |
| 507 | 3300027866 | Ga0209813_10006694 | Ga0209813_100066941 | 349 |
| 508 | 3300032004 | Ga0307414_10000371 | Ga0307414_100003717 | 349 |
| 509 | 3300035692 | Ga0373935_0219522 | Ga0373935_0219522_68_1144 | 349 |
| 510 | 3300037418 | Ga0395900_0168212 | Ga0395900_0168212_488_1555 | 349 |
| 511 | 3300038742 | Ga0400486_21858 | Ga0400486_21858_685_1773 | 349 |
| 512 | 3300046513 | Ga0495616_0011390 | Ga0495616_0011390_559_1728 | 349 |
| 513 | 3300048903 | Ga0496100_0142523 | Ga0496100_0142523_174_1250 | 349 |
| 514 | 3300048905 | Ga0496102_0157832 | Ga0496102_0157832_845_1921 | 349 |
| 515 | 3300048907 | Ga0496104_0052893 | Ga0496104_0052893_2318_3394 | 349 |
| 516 | 3300048909 | Ga0496106_0015255 | Ga0496106_0015255_552_1628 | 349 |
| 517 | 3300049569 | Ga0501032_0013776 | Ga0501032_0013776_4119_5186 | 349 |
| 518 | 3300049571 | Ga0501034_0000068 | Ga0501034_0000068_6891_7958 | 349 |
| 519 | 3300049571 | Ga0501034_0006843 | Ga0501034_0006843_5397_6464 | 349 |
| 520 | 3300049573 | Ga0501037_0008627 | Ga0501037_0008627_5361_6428 | 349 |
| 521 | 3300049574 | Ga0501038_0080357 | Ga0501038_0080357_841_1908 | 349 |
| 522 | 3300049575 | Ga0501039_0000205 | Ga0501039_0000205_16965_18032 | 349 |
| 523 | 3300049579 | Ga0501043_0074585 | Ga0501043_0074585_507_1574 | 349 |
| 524 | 3300049580 | Ga0501046_0000058 | Ga0501046_0000058_80411_81484 | 349 |
| 525 | 3300049580 | Ga0501046_0007334 | Ga0501046_0007334_7410_8477 | 349 |
| 526 | 3300049580 | Ga0501046_0030319 | Ga0501046_0030319_765_1832 | 349 |
| 527 | 3300049581 | Ga0501047_0000152 | Ga0501047_0000152_20123_21190 | 349 |
| 528 | 3300049581 | Ga0501047_0088462 | Ga0501047_0088462_1798_2865 | 349 |
| 529 | 3300049582 | Ga0501048_0002175 | Ga0501048_0002175_13566_14642 | 349 |
| 530 | 3300049583 | Ga0501067_0018422 | Ga0501067_0018422_563_1630 | 349 |
| 531 | 3300049586 | Ga0501070_0035400 | Ga0501070_0035400_1774_2841 | 349 |
| 532 | 3300049742 | Ga0501080_0000001 | Ga0501080_0000001_105660_106727 | 349 |
| 533 | 3300049822 | Ga0501035_0000015 | Ga0501035_0000015_185214_186281 | 349 |
| 534 | 3300049822 | Ga0501035_0091158 | Ga0501035_0091158_477_1544 | 349 |
| 535 | 3300049823 | Ga0501044_0000390 | Ga0501044_0000390_24124_25191 | 349 |
| 536 | 3300049824 | Ga0501045_0142665 | Ga0501045_0142665_673_1740 | 349 |
| 537 | 3300050492 | nmdc:mga0yw44_19458_c1 | nmdc:mga0yw44_19458_c1_1431_2504 | 349 |
| 538 | 3300050494 | nmdc:mga06z11_3726_c1 | nmdc:mga06z11_3726_c1_1140_2213 | 349 |
| 539 | 3300050494 | nmdc:mga06z11_38986_c1 | nmdc:mga06z11_38986_c1_533_1606 | 349 |
| 540 | 3300050507 | nmdc:mga05p37_507715_c1 | nmdc:mga05p37_507715_c1_101_1174 | 349 |
| 541 | 3300050508 | nmdc:mga09592_112735_c1 | nmdc:mga09592_112735_c1_1236_2318 | 349 |
| 542 | 3300050508 | nmdc:mga09592_84040_c1 | nmdc:mga09592_84040_c1_1009_2082 | 349 |
| 543 | 3300050509 | nmdc:mga0qj67_347153_c1 | nmdc:mga0qj67_347153_c1_54_1127 | 349 |
| 544 | 3300050510 | nmdc:mga06r32_8364_c1 | nmdc:mga06r32_8364_c1_6864_7937 | 349 |
| 545 | 3300053104 | Ga0500556_0001468 | Ga0500556_0001468_3850_4932 | 349 |
| 546 | 3300053119 | Ga0500595_014502 | Ga0500595_014502_748_1815 | 349 |
| 547 | 3300053153 | Ga0500616_0005539 | Ga0500616_0005539_6457_7539 | 349 |
| 548 | 3300053153 | Ga0500616_0007417 | Ga0500616_0007417_4527_5603 | 349 |
| 549 | 3300054114 | Ga0501084_0182434 | Ga0501084_0182434_596_1678 | 349 |
| 550 | 3300060353 | Ga0501082_0022902 | Ga0501082_0022902_4141_5208 | 349 |
| 551 | iso_pu_bacteria | 2599185359 | 2600228368 | 349 |
| 552 | iso_pu_bacteria | 2879163058 | 2879163951 | 349 |
| 553 | 3300005563 | Ga0068855_100011666 | Ga0068855_1000116662 | 350 |
| 554 | 3300009093 | Ga0105240_10179509 | Ga0105240_101795093 | 350 |
| 555 | 3300031548 | Ga0307408_100145470 | Ga0307408_1001454702 | 350 |
| 556 | iso_pu_bacteria | 2885427238 | 2885429324 | 350 |
| 557 | 3300005339 | Ga0070660_100244616 | Ga0070660_1002446162 | 351 |
| 558 | 3300005444 | Ga0070694_100040643 | Ga0070694_1000406432 | 351 |
| 559 | 3300005458 | Ga0070681_10056174 | Ga0070681_100561745 | 351 |
| 560 | 3300005458 | Ga0070681_10135359 | Ga0070681_101353592 | 351 |
| 561 | 3300006844 | Ga0075428_100268097 | Ga0075428_1002680972 | 351 |
| 562 | 3300006847 | Ga0075431_100272780 | Ga0075431_1002727802 | 351 |
| 563 | 3300009094 | Ga0111539_10231512 | Ga0111539_102315122 | 351 |
| 564 | 3300025912 | Ga0207707_10093083 | Ga0207707_100930832 | 351 |
| 565 | 3300025912 | Ga0207707_10095823 | Ga0207707_100958233 | 351 |
| 566 | 3300025932 | Ga0207690_10139457 | Ga0207690_101394571 | 351 |
| 567 | 3300037418 | Ga0395900_0141635 | Ga0395900_0141635_1078_2286 | 351 |
| 568 | 3300037466 | Ga0395898_0064148 | Ga0395898_0064148_987_2195 | 351 |
| 569 | 3300037471 | Ga0395905_0038255 | Ga0395905_0038255_1101_2309 | 351 |
| 570 | 3300038443 | Ga0395901_0070084 | Ga0395901_0070084_544_1752 | 351 |
| 571 | 3300038443 | Ga0395901_0131281 | Ga0395901_0131281_74_1156 | 351 |
| 572 | 3300042120 | Ga0450917_003182 | Ga0450917_003182_40_1098 | 351 |
| 573 | 3300046472 | Ga0495580_0226880 | Ga0495580_0226880_153_1238 | 351 |
| 574 | 3300048907 | Ga0496104_0264349 | Ga0496104_0264349_132_1217 | 351 |
| 575 | 3300048912 | Ga0496109_0018512 | Ga0496109_0018512_2601_3689 | 351 |
| 576 | 3300048926 | Ga0496123_0010116 | Ga0496123_0010116_1515_2612 | 351 |
| 577 | 3300050510 | nmdc:mga06r32_56755_c1 | nmdc:mga06r32_56755_c1_517_1602 | 351 |
| 578 | 3300050511 | nmdc:mga08y16_117003_c1 | nmdc:mga08y16_117003_c1_65_1123 | 351 |
| 579 | iso_pu_bacteria | 2928027323 | 2928029766 | 351 |
| 580 | 3300005327 | Ga0070658_10000003 | Ga0070658_10000003253 | 352 |
| 581 | 3300005339 | Ga0070660_100001813 | Ga0070660_1000018139 | 352 |
| 582 | 3300005366 | Ga0070659_100004495 | Ga0070659_1000044955 | 352 |
| 583 | 3300006195 | Ga0075366_10000241 | Ga0075366_1000024116 | 352 |
| 584 | 3300009094 | Ga0111539_10235181 | Ga0111539_102351812 | 352 |
| 585 | 3300025909 | Ga0207705_10000005 | Ga0207705_10000005255 | 352 |
| 586 | 3300025919 | Ga0207657_10003198 | Ga0207657_100031984 | 352 |
| 587 | 3300025924 | Ga0207694_10096889 | Ga0207694_100968893 | 352 |
| 588 | 3300025932 | Ga0207690_10005477 | Ga0207690_100054777 | 352 |
| 589 | 3300028786 | Ga0307517_10025548 | Ga0307517_100255485 | 352 |
| 590 | 3300031548 | Ga0307408_100209744 | Ga0307408_1002097442 | 352 |
| 591 | 3300031731 | Ga0307405_10020967 | Ga0307405_100209672 | 352 |
| 592 | 3300031824 | Ga0307413_10006405 | Ga0307413_100064053 | 352 |
| 593 | 3300031824 | Ga0307413_10080372 | Ga0307413_100803722 | 352 |
| 594 | 3300031852 | Ga0307410_10091953 | Ga0307410_100919532 | 352 |
| 595 | 3300031852 | Ga0307410_10092942 | Ga0307410_100929422 | 352 |
| 596 | 3300031852 | Ga0307410_10146797 | Ga0307410_101467972 | 352 |
| 597 | 3300031901 | Ga0307406_10145119 | Ga0307406_101451192 | 352 |
| 598 | 3300031903 | Ga0307407_10006235 | Ga0307407_100062353 | 352 |
| 599 | 3300031911 | Ga0307412_10074378 | Ga0307412_100743781 | 352 |
| 600 | 3300031911 | Ga0307412_10080888 | Ga0307412_100808882 | 352 |
| 601 | 3300031911 | Ga0307412_10142850 | Ga0307412_101428502 | 352 |
| 602 | 3300031995 | Ga0307409_100011157 | Ga0307409_1000111572 | 352 |
| 603 | 3300031995 | Ga0307409_100119967 | Ga0307409_1001199672 | 352 |
| 604 | 3300032002 | Ga0307416_100023804 | Ga0307416_1000238046 | 352 |
| 605 | 3300032004 | Ga0307414_10004392 | Ga0307414_100043926 | 352 |
| 606 | 3300032005 | Ga0307411_10003306 | Ga0307411_100033066 | 352 |
| 607 | 3300032126 | Ga0307415_100016016 | Ga0307415_1000160163 | 352 |
| 608 | 3300035695 | Ga0373927_0080693 | Ga0373927_0080693_15_1085 | 352 |
| 609 | 3300039437 | Ga0436365_0083543 | Ga0436365_0083543_23784_24875 | 352 |
| 610 | 3300042004 | Ga0439445_0020665 | Ga0439445_0020665_138_1205 | 352 |
| 611 | 3300046500 | Ga0495596_0044318 | Ga0495596_0044318_592_1659 | 352 |
| 612 | 3300046525 | Ga0495663_0001729 | Ga0495663_0001729_808_1875 | 352 |
| 613 | 3300046539 | Ga0495621_0000875 | Ga0495621_0000875_2096_3163 | 352 |
| 614 | 3300046558 | Ga0495633_0015032 | Ga0495633_0015032_583_1650 | 352 |
| 615 | 3300005366 | Ga0070659_100003757 | Ga0070659_10000375711 | 353 |
| 616 | 3300005616 | Ga0068852_100334449 | Ga0068852_1003344492 | 353 |
| 617 | 3300009093 | Ga0105240_10011600 | Ga0105240_1001160011 | 353 |
| 618 | 3300009551 | Ga0105238_10069194 | Ga0105238_100691942 | 353 |
| 619 | 3300025261 | Ga0209233_1021520 | Ga0209233_10215202 | 353 |
| 620 | 3300025913 | Ga0207695_10063442 | Ga0207695_100634425 | 353 |
| 621 | 3300025924 | Ga0207694_10032047 | Ga0207694_100320473 | 353 |
| 622 | 3300025932 | Ga0207690_10036018 | Ga0207690_100360183 | 353 |
| 623 | 3300025949 | Ga0207667_10133914 | Ga0207667_101339143 | 353 |
| 624 | 3300025981 | Ga0207640_10099354 | Ga0207640_100993543 | 353 |
| 625 | 3300026078 | Ga0207702_10257847 | Ga0207702_102578471 | 353 |
| 626 | 3300031548 | Ga0307408_100008196 | Ga0307408_1000081964 | 353 |
| 627 | 3300031824 | Ga0307413_10025856 | Ga0307413_100258562 | 353 |
| 628 | 3300031852 | Ga0307410_10014819 | Ga0307410_100148193 | 353 |
| 629 | 3300031852 | Ga0307410_10020233 | Ga0307410_100202333 | 353 |
| 630 | 3300031901 | Ga0307406_10050582 | Ga0307406_100505822 | 353 |
| 631 | 3300031901 | Ga0307406_10063689 | Ga0307406_100636892 | 353 |
| 632 | 3300031911 | Ga0307412_10042034 | Ga0307412_100420342 | 353 |
| 633 | 3300032002 | Ga0307416_100036396 | Ga0307416_1000363962 | 353 |
| 634 | 3300032004 | Ga0307414_10011366 | Ga0307414_100113664 | 353 |
| 635 | 3300032004 | Ga0307414_10042294 | Ga0307414_100422942 | 353 |
| 636 | 3300032005 | Ga0307411_10001823 | Ga0307411_100018234 | 353 |
| 637 | 3300032005 | Ga0307411_10107857 | Ga0307411_101078572 | 353 |
| 638 | 3300032126 | Ga0307415_100021970 | Ga0307415_1000219702 | 353 |
| 639 | 3300032126 | Ga0307415_100082652 | Ga0307415_1000826522 | 353 |
| 640 | 3300032126 | Ga0307415_100332275 | Ga0307415_1003322752 | 353 |
| 641 | 3300039062 | Ga0400483_026085 | Ga0400483_026085_408_1520 | 353 |
| 642 | 3300046492 | Ga0495585_0003769 | Ga0495585_0003769_8128_9264 | 353 |
| 643 | 3300001904 | JGI24736J21556_1000841 | JGI24736J21556_10008415 | 354 |
| 644 | 3300003214 | JGI25165J46597_1000010 | JGI25165J46597_1000010208 | 354 |
| 645 | 3300005366 | Ga0070659_100026584 | Ga0070659_1000265842 | 354 |
| 646 | 3300005578 | Ga0068854_100035059 | Ga0068854_1000350592 | 354 |
| 647 | 3300013102 | Ga0157371_10036317 | Ga0157371_100363172 | 354 |
| 648 | 3300013307 | Ga0157372_10141581 | Ga0157372_101415812 | 354 |
| 649 | 3300025261 | Ga0209233_1000044 | Ga0209233_1000044273 | 354 |
| 650 | 3300025949 | Ga0207667_10064744 | Ga0207667_100647442 | 354 |
| 651 | 3300025981 | Ga0207640_10004079 | Ga0207640_100040793 | 354 |
| 652 | 3300026078 | Ga0207702_10058096 | Ga0207702_100580964 | 354 |
| 653 | 3300031235 | Ga0265330_10002833 | Ga0265330_100028337 | 354 |
| 654 | 3300031247 | Ga0265340_10000018 | Ga0265340_100000183 | 354 |
| 655 | 3300031247 | Ga0265340_10040091 | Ga0265340_100400912 | 354 |
| 656 | 3300031344 | Ga0265316_10005193 | Ga0265316_100051933 | 354 |
| 657 | 3300031595 | Ga0265313_10055027 | Ga0265313_100550271 | 354 |
| 658 | 3300031712 | Ga0265342_10024398 | Ga0265342_100243982 | 354 |
| 659 | 3300037418 | Ga0395900_0045525 | Ga0395900_0045525_1769_2836 | 354 |
| 660 | 3300037418 | Ga0395900_0117775 | Ga0395900_0117775_1214_2281 | 354 |
| 661 | 3300037466 | Ga0395898_0030471 | Ga0395898_0030471_2172_3239 | 354 |
| 662 | 3300037466 | Ga0395898_0362930 | Ga0395898_0362930_223_1290 | 354 |
| 663 | 3300046501 | Ga0495607_0056998 | Ga0495607_0056998_731_1867 | 354 |
| 664 | 3300053087 | Ga0500643_000235 | Ga0500643_000235_13127_14209 | 354 |
| 665 | iso_pu_bacteria | 2818991466 | 2819715165 | 354 |
| 666 | iso_pu_bacteria | 2919138771 | 2919143206 | 354 |
| 667 | 3300005327 | Ga0070658_10001555 | Ga0070658_1000155518 | 355 |
| 668 | 3300005327 | Ga0070658_10037354 | Ga0070658_100373542 | 355 |
| 669 | 3300005327 | Ga0070658_10083347 | Ga0070658_100833472 | 355 |
| 670 | 3300005339 | Ga0070660_100177987 | Ga0070660_1001779872 | 355 |
| 671 | 3300005345 | Ga0070692_10001745 | Ga0070692_100017452 | 355 |
| 672 | 3300005563 | Ga0068855_100007934 | Ga0068855_1000079342 | 355 |
| 673 | 3300013100 | Ga0157373_10115137 | Ga0157373_101151372 | 355 |
| 674 | 3300013102 | Ga0157371_10002185 | Ga0157371_100021858 | 355 |
| 675 | 3300013104 | Ga0157370_10151588 | Ga0157370_101515882 | 355 |
| 676 | 3300013297 | Ga0157378_10196811 | Ga0157378_101968111 | 355 |
| 677 | 3300014326 | Ga0157380_10020827 | Ga0157380_100208273 | 355 |
| 678 | 3300025304 | Ga0209257_1008172 | Ga0209257_10081722 | 355 |
| 679 | 3300025904 | Ga0207647_10009560 | Ga0207647_100095603 | 355 |
| 680 | 3300025909 | Ga0207705_10000809 | Ga0207705_1000080923 | 355 |
| 681 | 3300025909 | Ga0207705_10004300 | Ga0207705_100043003 | 355 |
| 682 | 3300025909 | Ga0207705_10015141 | Ga0207705_100151417 | 355 |
| 683 | 3300025909 | Ga0207705_10247395 | Ga0207705_102473952 | 355 |
| 684 | 3300025919 | Ga0207657_10013805 | Ga0207657_100138058 | 355 |
| 685 | 3300025932 | Ga0207690_10032243 | Ga0207690_100322432 | 355 |
| 686 | 3300025949 | Ga0207667_10000314 | Ga0207667_100003146 | 355 |
| 687 | 3300025949 | Ga0207667_10348085 | Ga0207667_103480852 | 355 |
| 688 | 3300037312 | Ga0395899_0000129 | Ga0395899_0000129_40548_41618 | 355 |
| 689 | 3300037418 | Ga0395900_0002105 | Ga0395900_0002105_19529_20599 | 355 |
| 690 | 3300037418 | Ga0395900_0191910 | Ga0395900_0191910_324_1424 | 355 |
| 691 | 3300037466 | Ga0395898_0162916 | Ga0395898_0162916_151_1221 | 355 |
| 692 | 3300037466 | Ga0395898_0183234 | Ga0395898_0183234_272_1342 | 355 |
| 693 | 3300037471 | Ga0395905_0136804 | Ga0395905_0136804_118_1188 | 355 |
| 694 | 3300038443 | Ga0395901_0000031 | Ga0395901_0000031_234462_235532 | 355 |
| 695 | 3300039450 | Ga0436363_0310243 | Ga0436363_0310243_2283_3392 | 355 |
| 696 | 3300048905 | Ga0496102_0030551 | Ga0496102_0030551_1121_2191 | 355 |
| 697 | 3300001990 | JGI24737J22298_10016354 | JGI24737J22298_100163544 | 356 |
| 698 | 3300005289 | Ga0065704_10003962 | Ga0065704_100039625 | 356 |
| 699 | 3300005295 | Ga0065707_10081963 | Ga0065707_1008196316 | 356 |
| 700 | 3300005327 | Ga0070658_10001818 | Ga0070658_100018184 | 356 |
| 701 | 3300005455 | Ga0070663_100170137 | Ga0070663_1001701372 | 356 |
| 702 | 3300005563 | Ga0068855_100022265 | Ga0068855_1000222656 | 356 |
| 703 | 3300005564 | Ga0070664_100365893 | Ga0070664_1003658932 | 356 |
| 704 | 3300005578 | Ga0068854_100062705 | Ga0068854_1000627052 | 356 |
| 705 | 3300005614 | Ga0068856_100002574 | Ga0068856_1000025746 | 356 |
| 706 | 3300005843 | Ga0068860_100076957 | Ga0068860_1000769572 | 356 |
| 707 | 3300006847 | Ga0075431_100009478 | Ga0075431_1000094783 | 356 |
| 708 | 3300013100 | Ga0157373_10302024 | Ga0157373_103020241 | 356 |
| 709 | 3300013105 | Ga0157369_10000043 | Ga0157369_1000004354 | 356 |
| 710 | 3300013105 | Ga0157369_10047977 | Ga0157369_100479772 | 356 |
| 711 | 3300013307 | Ga0157372_10559854 | Ga0157372_105598542 | 356 |
| 712 | 3300021384 | Ga0213876_10022864 | Ga0213876_100228642 | 356 |
| 713 | 3300025904 | Ga0207647_10054146 | Ga0207647_100541462 | 356 |
| 714 | 3300025909 | Ga0207705_10000033 | Ga0207705_10000033130 | 356 |
| 715 | 3300025909 | Ga0207705_10000037 | Ga0207705_10000037147 | 356 |
| 716 | 3300025913 | Ga0207695_10003382 | Ga0207695_100033827 | 356 |
| 717 | 3300025913 | Ga0207695_10177724 | Ga0207695_101777242 | 356 |
| 718 | 3300025920 | Ga0207649_10002320 | Ga0207649_100023207 | 356 |
| 719 | 3300025923 | Ga0207681_10020235 | Ga0207681_100202352 | 356 |
| 720 | 3300025949 | Ga0207667_10007100 | Ga0207667_100071007 | 356 |
| 721 | 3300025972 | Ga0207668_10004688 | Ga0207668_100046885 | 356 |
| 722 | 3300025981 | Ga0207640_10002534 | Ga0207640_1000253410 | 356 |
| 723 | 3300026078 | Ga0207702_10033715 | Ga0207702_100337152 | 356 |
| 724 | 3300026142 | Ga0207698_10042867 | Ga0207698_100428676 | 356 |
| 725 | 3300028381 | Ga0268264_10056951 | Ga0268264_100569512 | 356 |
| 726 | 3300037312 | Ga0395899_0009175 | Ga0395899_0009175_3940_5013 | 356 |
| 727 | 3300037312 | Ga0395899_0169837 | Ga0395899_0169837_427_1500 | 356 |
| 728 | 3300037418 | Ga0395900_0038265 | Ga0395900_0038265_947_2020 | 356 |
| 729 | 3300037418 | Ga0395900_0161135 | Ga0395900_0161135_467_1540 | 356 |
| 730 | 3300037466 | Ga0395898_0067120 | Ga0395898_0067120_1203_2276 | 356 |
| 731 | 3300037471 | Ga0395905_0068245 | Ga0395905_0068245_1137_2210 | 356 |
| 732 | 3300038443 | Ga0395901_0058196 | Ga0395901_0058196_57_1130 | 356 |
| 733 | 3300038443 | Ga0395901_0561501 | Ga0395901_0561501_57_1130 | 356 |
| 734 | 3300039437 | Ga0436365_0922968 | Ga0436365_0922968_7095_8210 | 356 |
| 735 | 3300044656 | Ga0466969_0010778 | Ga0466969_0010778_2985_4058 | 356 |
| 736 | 3300044684 | Ga0466966_0000021 | Ga0466966_0000021_74735_75865 | 356 |
| 737 | 3300044684 | Ga0466966_0001996 | Ga0466966_0001996_6619_7692 | 356 |
| 738 | 3300044693 | Ga0466961_0008264 | Ga0466961_0008264_2645_3718 | 356 |
| 739 | 3300044694 | Ga0466963_0016990 | Ga0466963_0016990_2936_4009 | 356 |
| 740 | 3300044719 | Ga0466971_0000846 | Ga0466971_0000846_4223_5296 | 356 |
| 741 | 3300044842 | Ga0466957_0002162 | Ga0466957_0002162_658_1731 | 356 |
| 742 | 3300045049 | Ga0466959_0006500 | Ga0466959_0006500_2429_3502 | 356 |
| 743 | 3300045051 | Ga0451576_0068605 | Ga0451576_0068605_295_1407 | 356 |
| 744 | 3300045836 | Ga0466958_0009405 | Ga0466958_0009405_1569_2642 | 356 |
| 745 | 3300047472 | Ga0495686_0017144 | Ga0495686_0017144_428_1534 | 356 |
| 746 | 3300048905 | Ga0496102_0110297 | Ga0496102_0110297_336_1439 | 356 |
| 747 | 3300048908 | Ga0496105_0000224 | Ga0496105_0000224_31176_32279 | 356 |
| 748 | 3300048924 | Ga0496121_0000017 | Ga0496121_0000017_370993_372099 | 356 |
| 749 | 3300049822 | Ga0501035_0273131 | Ga0501035_0273131_267_1400 | 356 |
| 750 | 3300049823 | Ga0501044_0000572 | Ga0501044_0000572_42739_43869 | 356 |
| 751 | 3300050510 | nmdc:mga06r32_1441_c1 | nmdc:mga06r32_1441_c1_359_1435 | 356 |
| 752 | 3300061719 | Ga0466962_0002938 | Ga0466962_0002938_2664_3737 | 356 |
| 753 | 3300013102 | Ga0157371_10101373 | Ga0157371_101013732 | 357 |
| 754 | 3300021384 | Ga0213876_10038133 | Ga0213876_100381333 | 357 |
| 755 | 3300032004 | Ga0307414_10041933 | Ga0307414_100419332 | 357 |
| 756 | 3300032004 | Ga0307414_10135177 | Ga0307414_101351772 | 357 |
| 757 | 3300039437 | Ga0436365_0935722 | Ga0436365_0935722_818_1900 | 357 |
| 758 | 3300046507 | Ga0495606_0000470 | Ga0495606_0000470_19741_20862 | 357 |
| 759 | 3300047472 | Ga0495686_0000916 | Ga0495686_0000916_2712_3794 | 357 |
| 760 | 3300049515 | Ga0501292_000022 | Ga0501292_000022_13514_14623 | 357 |
| 761 | 3300049653 | Ga0501206_001253 | Ga0501206_001253_1535_2644 | 357 |
| 762 | 3300049664 | Ga0501224_003103 | Ga0501224_003103_186_1295 | 357 |
| 763 | 3300049668 | Ga0501233_000230 | Ga0501233_000230_1096_2172 | 357 |
| 764 | 3300049690 | Ga0501261_000144 | Ga0501261_000144_8663_9772 | 357 |
| 765 | 3300049775 | Ga0501279_000012 | Ga0501279_000012_55455_56564 | 357 |
| 766 | 3300049778 | Ga0501282_000707 | Ga0501282_000707_2603_3712 | 357 |
| 767 | iso_pu_bacteria | 2990265787 | 2990265819 | 357 |
| 768 | iso_pu_bacteria | 2993693658 | 2993696390 | 357 |
| 769 | 3300001904 | JGI24736J21556_1000435 | JGI24736J21556_10004355 | 358 |
| 770 | 3300001976 | JGI24752J21851_1000209 | JGI24752J21851_10002095 | 358 |
| 771 | 3300001976 | JGI24752J21851_1000362 | JGI24752J21851_10003622 | 358 |
| 772 | 3300001989 | JGI24739J22299_10007848 | JGI24739J22299_100078484 | 358 |
| 773 | 3300002070 | JGI24750J21931_1000040 | JGI24750J21931_100004016 | 358 |
| 774 | 3300002074 | JGI24748J21848_1000053 | JGI24748J21848_100005328 | 358 |
| 775 | 3300002075 | JGI24738J21930_10001175 | JGI24738J21930_100011756 | 358 |
| 776 | 3300002076 | JGI24749J21850_1004036 | JGI24749J21850_10040362 | 358 |
| 777 | 3300002239 | JGI24034J26672_10000036 | JGI24034J26672_1000003651 | 358 |
| 778 | 3300002244 | JGI24742J22300_10004660 | JGI24742J22300_100046603 | 358 |
| 779 | 3300002459 | JGI24751J29686_10007551 | JGI24751J29686_100075512 | 358 |
| 780 | 3300003773 | Ga0055537_1003859 | Ga0055537_10038592 | 358 |
| 781 | 3300003775 | Ga0055524_1000154 | Ga0055524_10001548 | 358 |
| 782 | 3300005289 | Ga0065704_10075440 | Ga0065704_100754405 | 358 |
| 783 | 3300005327 | Ga0070658_10258356 | Ga0070658_102583561 | 358 |
| 784 | 3300005330 | Ga0070690_100000093 | Ga0070690_10000009325 | 358 |
| 785 | 3300005331 | Ga0070670_100000202 | Ga0070670_10000020240 | 358 |
| 786 | 3300005331 | Ga0070670_100031324 | Ga0070670_1000313245 | 358 |
| 787 | 3300005335 | Ga0070666_10000009 | Ga0070666_1000000976 | 358 |
| 788 | 3300005340 | Ga0070689_100152187 | Ga0070689_1001521872 | 358 |
| 789 | 3300005353 | Ga0070669_100000103 | Ga0070669_10000010320 | 358 |
| 790 | 3300005355 | Ga0070671_100024436 | Ga0070671_1000244361 | 358 |
| 791 | 3300005365 | Ga0070688_100016969 | Ga0070688_1000169695 | 358 |
| 792 | 3300005367 | Ga0070667_100001658 | Ga0070667_1000016584 | 358 |
| 793 | 3300005367 | Ga0070667_100042831 | Ga0070667_1000428313 | 358 |
| 794 | 3300005457 | Ga0070662_100006902 | Ga0070662_1000069025 | 358 |
| 795 | 3300005466 | Ga0070685_10000076 | Ga0070685_1000007634 | 358 |
| 796 | 3300005539 | Ga0068853_100020734 | Ga0068853_1000207345 | 358 |
| 797 | 3300005544 | Ga0070686_100000018 | Ga0070686_10000001851 | 358 |
| 798 | 3300005548 | Ga0070665_100000071 | Ga0070665_100000071114 | 358 |
| 799 | 3300005548 | Ga0070665_100187057 | Ga0070665_1001870572 | 358 |
| 800 | 3300005563 | Ga0068855_100296707 | Ga0068855_1002967072 | 358 |
| 801 | 3300005564 | Ga0070664_100116006 | Ga0070664_1001160062 | 358 |
| 802 | 3300005577 | Ga0068857_100092128 | Ga0068857_1000921284 | 358 |
| 803 | 3300005577 | Ga0068857_100242743 | Ga0068857_1002427432 | 358 |
| 804 | 3300005617 | Ga0068859_100031499 | Ga0068859_1000314994 | 358 |
| 805 | 3300005618 | Ga0068864_100000194 | Ga0068864_10000019415 | 358 |
| 806 | 3300005719 | Ga0068861_100008680 | Ga0068861_1000086805 | 358 |
| 807 | 3300005841 | Ga0068863_100000258 | Ga0068863_10000025815 | 358 |
| 808 | 3300005841 | Ga0068863_100004697 | Ga0068863_1000046974 | 358 |
| 809 | 3300005842 | Ga0068858_100002738 | Ga0068858_1000027385 | 358 |
| 810 | 3300005843 | Ga0068860_100000022 | Ga0068860_10000002277 | 358 |
| 811 | 3300005844 | Ga0068862_100000070 | Ga0068862_10000007011 | 358 |
| 812 | 3300005844 | Ga0068862_100000289 | Ga0068862_10000028915 | 358 |
| 813 | 3300005937 | Ga0081455_10000392 | Ga0081455_1000039226 | 358 |
| 814 | 3300006846 | Ga0075430_100022172 | Ga0075430_1000221722 | 358 |
| 815 | 3300006931 | Ga0097620_100031502 | Ga0097620_1000315024 | 358 |
| 816 | 3300009011 | Ga0105251_10000815 | Ga0105251_100008158 | 358 |
| 817 | 3300009101 | Ga0105247_10103828 | Ga0105247_101038282 | 358 |
| 818 | 3300009177 | Ga0105248_10000012 | Ga0105248_10000012110 | 358 |
| 819 | 3300009177 | Ga0105248_10058095 | Ga0105248_100580952 | 358 |
| 820 | 3300009177 | Ga0105248_10084464 | Ga0105248_100844642 | 358 |
| 821 | 3300009551 | Ga0105238_10187714 | Ga0105238_101877142 | 358 |
| 822 | 3300009551 | Ga0105238_10273984 | Ga0105238_102739842 | 358 |
| 823 | 3300009553 | Ga0105249_10000014 | Ga0105249_1000001478 | 358 |
| 824 | 3300009553 | Ga0105249_10000099 | Ga0105249_1000009980 | 358 |
| 825 | 3300013104 | Ga0157370_10005863 | Ga0157370_100058637 | 358 |
| 826 | 3300013105 | Ga0157369_10099382 | Ga0157369_100993822 | 358 |
| 827 | 3300013306 | Ga0163162_10004881 | Ga0163162_100048812 | 358 |
| 828 | 3300013306 | Ga0163162_10164709 | Ga0163162_101647092 | 358 |
| 829 | 3300014326 | Ga0157380_10000681 | Ga0157380_1000068110 | 358 |
| 830 | 3300014968 | Ga0157379_10009221 | Ga0157379_100092215 | 358 |
| 831 | 3300014968 | Ga0157379_10028865 | Ga0157379_100288652 | 358 |
| 832 | 3300017792 | Ga0163161_10000186 | Ga0163161_1000018651 | 358 |
| 833 | 3300025223 | Ga0207672_1000691 | Ga0207672_10006913 | 358 |
| 834 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007646 | 358 |
| 835 | 3300025273 | Ga0209673_1003983 | Ga0209673_10039831 | 358 |
| 836 | 3300025291 | Ga0209675_1009823 | Ga0209675_10098232 | 358 |
| 837 | 3300025295 | Ga0209564_1016878 | Ga0209564_10168782 | 358 |
| 838 | 3300025298 | Ga0209050_1003356 | Ga0209050_10033563 | 358 |
| 839 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008488 | 358 |
| 840 | 3300025304 | Ga0209257_1002535 | Ga0209257_10025359 | 358 |
| 841 | 3300025735 | Ga0207713_1006255 | Ga0207713_10062555 | 358 |
| 842 | 3300025900 | Ga0207710_10055700 | Ga0207710_100557002 | 358 |
| 843 | 3300025903 | Ga0207680_10000007 | Ga0207680_10000007202 | 358 |
| 844 | 3300025904 | Ga0207647_10000331 | Ga0207647_1000033126 | 358 |
| 845 | 3300025911 | Ga0207654_10004414 | Ga0207654_100044146 | 358 |
| 846 | 3300025913 | Ga0207695_10001498 | Ga0207695_1000149829 | 358 |
| 847 | 3300025914 | Ga0207671_10000350 | Ga0207671_1000035043 | 358 |
| 848 | 3300025918 | Ga0207662_10157465 | Ga0207662_101574652 | 358 |
| 849 | 3300025919 | Ga0207657_10070581 | Ga0207657_100705813 | 358 |
| 850 | 3300025923 | Ga0207681_10000074 | Ga0207681_1000007483 | 358 |
| 851 | 3300025924 | Ga0207694_10000447 | Ga0207694_1000044729 | 358 |
| 852 | 3300025925 | Ga0207650_10000881 | Ga0207650_1000088120 | 358 |
| 853 | 3300025925 | Ga0207650_10002923 | Ga0207650_100029234 | 358 |
| 854 | 3300025931 | Ga0207644_10001029 | Ga0207644_100010296 | 358 |
| 855 | 3300025933 | Ga0207706_10005888 | Ga0207706_100058882 | 358 |
| 856 | 3300025936 | Ga0207670_10026322 | Ga0207670_100263223 | 358 |
| 857 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004617 | 358 |
| 858 | 3300025941 | Ga0207711_10013512 | Ga0207711_100135125 | 358 |
| 859 | 3300025949 | Ga0207667_10007493 | Ga0207667_100074932 | 358 |
| 860 | 3300025949 | Ga0207667_10255812 | Ga0207667_102558122 | 358 |
| 861 | 3300025961 | Ga0207712_10000004 | Ga0207712_10000004190 | 358 |
| 862 | 3300025961 | Ga0207712_10000161 | Ga0207712_1000016132 | 358 |
| 863 | 3300025986 | Ga0207658_10000232 | Ga0207658_1000023244 | 358 |
| 864 | 3300025986 | Ga0207658_10000260 | Ga0207658_1000026020 | 358 |
| 865 | 3300026035 | Ga0207703_10001367 | Ga0207703_1000136710 | 358 |
| 866 | 3300026041 | Ga0207639_10006433 | Ga0207639_100064335 | 358 |
| 867 | 3300026041 | Ga0207639_10032279 | Ga0207639_100322792 | 358 |
| 868 | 3300026041 | Ga0207639_10086092 | Ga0207639_100860922 | 358 |
| 869 | 3300026078 | Ga0207702_10000566 | Ga0207702_100005669 | 358 |
| 870 | 3300026088 | Ga0207641_10000010 | Ga0207641_10000010262 | 358 |
| 871 | 3300026088 | Ga0207641_10000192 | Ga0207641_1000019276 | 358 |
| 872 | 3300026095 | Ga0207676_10000046 | Ga0207676_10000046105 | 358 |
| 873 | 3300026095 | Ga0207676_10000709 | Ga0207676_1000070924 | 358 |
| 874 | 3300026116 | Ga0207674_10009750 | Ga0207674_100097502 | 358 |
| 875 | 3300026118 | Ga0207675_100000370 | Ga0207675_10000037023 | 358 |
| 876 | 3300026142 | Ga0207698_10016134 | Ga0207698_100161343 | 358 |
| 877 | 3300028379 | Ga0268266_10000040 | Ga0268266_10000040115 | 358 |
| 878 | 3300028379 | Ga0268266_10169509 | Ga0268266_101695091 | 358 |
| 879 | 3300028380 | Ga0268265_10000026 | Ga0268265_10000026139 | 358 |
| 880 | 3300028380 | Ga0268265_10000334 | Ga0268265_1000033415 | 358 |
| 881 | 3300028381 | Ga0268264_10000003 | Ga0268264_10000003204 | 358 |
| 882 | 3300031548 | Ga0307408_100303929 | Ga0307408_1003039292 | 358 |
| 883 | 3300031731 | Ga0307405_10305661 | Ga0307405_103056611 | 358 |
| 884 | 3300031911 | Ga0307412_10076904 | Ga0307412_100769042 | 358 |
| 885 | 3300032002 | Ga0307416_100076022 | Ga0307416_1000760222 | 358 |
| 886 | 3300038705 | Ga0237819_00270 | Ga0237819_00270_2086_3162 | 358 |
| 887 | 3300045051 | Ga0451576_0014154 | Ga0451576_0014154_462_1547 | 358 |
| 888 | 3300047472 | Ga0495686_0000273 | Ga0495686_0000273_27842_28945 | 358 |
| 889 | 3300048904 | Ga0496101_0065998 | Ga0496101_0065998_332_1414 | 358 |
| 890 | 3300048905 | Ga0496102_0012793 | Ga0496102_0012793_1754_2836 | 358 |
| 891 | 3300048906 | Ga0496103_0001324 | Ga0496103_0001324_11962_13044 | 358 |
| 892 | 3300048910 | Ga0496107_0051593 | Ga0496107_0051593_1614_2696 | 358 |
| 893 | 3300048919 | Ga0496116_0012690 | Ga0496116_0012690_5395_6477 | 358 |
| 894 | 3300048921 | Ga0496118_0001765 | Ga0496118_0001765_14301_15383 | 358 |
| 895 | 3300048924 | Ga0496121_0009718 | Ga0496121_0009718_788_1870 | 358 |
| 896 | 3300048929 | Ga0496126_0174418 | Ga0496126_0174418_154_1293 | 358 |
| 897 | 3300049663 | Ga0501223_000171 | Ga0501223_000171_8130_9299 | 358 |
| 898 | 3300049664 | Ga0501224_000028 | Ga0501224_000028_33586_34755 | 358 |
| 899 | 3300049705 | Ga0501225_0000317 | Ga0501225_0000317_7806_8975 | 358 |
| 900 | 3300049823 | Ga0501044_0027379 | Ga0501044_0027379_1459_2562 | 358 |
| 901 | 3300049853 | Ga0501226_000115 | Ga0501226_000115_8705_9874 | 358 |
| 902 | iso_pu_bacteria | 2984555340 | 2984556675 | 358 |
| 903 | iso_pu_bacteria | 2984564862 | 2984565152 | 358 |
| 904 | iso_pu_bacteria | 2993356040 | 2993356228 | 358 |
| 905 | 3300003215 | JGI25153J46596_10000417 | JGI25153J46596_1000041723 | 359 |
| 906 | 3300005327 | Ga0070658_10005891 | Ga0070658_100058914 | 359 |
| 907 | 3300005328 | Ga0070676_10000367 | Ga0070676_1000036713 | 359 |
| 908 | 3300005334 | Ga0068869_100000552 | Ga0068869_10000055215 | 359 |
| 909 | 3300005338 | Ga0068868_100000057 | Ga0068868_10000005761 | 359 |
| 910 | 3300005345 | Ga0070692_10000469 | Ga0070692_100004698 | 359 |
| 911 | 3300005356 | Ga0070674_100056431 | Ga0070674_1000564312 | 359 |
| 912 | 3300005364 | Ga0070673_100000005 | Ga0070673_10000000559 | 359 |
| 913 | 3300005364 | Ga0070673_100297556 | Ga0070673_1002975562 | 359 |
| 914 | 3300005459 | Ga0068867_100000071 | Ga0068867_10000007110 | 359 |
| 915 | 3300005543 | Ga0070672_100124888 | Ga0070672_1001248882 | 359 |
| 916 | 3300005563 | Ga0068855_100000380 | Ga0068855_10000038015 | 359 |
| 917 | 3300005841 | Ga0068863_100004622 | Ga0068863_10000462213 | 359 |
| 918 | 3300005843 | Ga0068860_100004667 | Ga0068860_1000046674 | 359 |
| 919 | 3300005844 | Ga0068862_100000014 | Ga0068862_10000001460 | 359 |
| 920 | 3300006881 | Ga0068865_100000032 | Ga0068865_10000003239 | 359 |
| 921 | 3300009098 | Ga0105245_10001290 | Ga0105245_100012908 | 359 |
| 922 | 3300009101 | Ga0105247_10000483 | Ga0105247_1000048318 | 359 |
| 923 | 3300009148 | Ga0105243_10000933 | Ga0105243_1000093314 | 359 |
| 924 | 3300009176 | Ga0105242_10007089 | Ga0105242_100070896 | 359 |
| 925 | 3300009553 | Ga0105249_10000002 | Ga0105249_10000002337 | 359 |
| 926 | 3300009553 | Ga0105249_10009606 | Ga0105249_100096067 | 359 |
| 927 | 3300011119 | Ga0105246_10065734 | Ga0105246_100657342 | 359 |
| 928 | 3300013296 | Ga0157374_10001444 | Ga0157374_1000144414 | 359 |
| 929 | 3300013297 | Ga0157378_10001339 | Ga0157378_100013397 | 359 |
| 930 | 3300013308 | Ga0157375_10014738 | Ga0157375_100147385 | 359 |
| 931 | 3300014969 | Ga0157376_10000678 | Ga0157376_1000067810 | 359 |
| 932 | 3300017792 | Ga0163161_10102018 | Ga0163161_101020181 | 359 |
| 933 | 3300020082 | Ga0206353_12009786 | Ga0206353_120097867 | 359 |
| 934 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007681 | 359 |
| 935 | 3300025900 | Ga0207710_10001070 | Ga0207710_100010706 | 359 |
| 936 | 3300025909 | Ga0207705_10000978 | Ga0207705_1000097815 | 359 |
| 937 | 3300025927 | Ga0207687_10004280 | Ga0207687_100042802 | 359 |
| 938 | 3300025934 | Ga0207686_10015896 | Ga0207686_100158962 | 359 |
| 939 | 3300025935 | Ga0207709_10000276 | Ga0207709_1000027612 | 359 |
| 940 | 3300025938 | Ga0207704_10000034 | Ga0207704_1000003459 | 359 |
| 941 | 3300025940 | Ga0207691_10136897 | Ga0207691_101368972 | 359 |
| 942 | 3300025942 | Ga0207689_10001065 | Ga0207689_1000106512 | 359 |
| 943 | 3300025949 | Ga0207667_10000013 | Ga0207667_10000013195 | 359 |
| 944 | 3300025960 | Ga0207651_10000010 | Ga0207651_1000001059 | 359 |
| 945 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002708 | 359 |
| 946 | 3300025961 | Ga0207712_10025579 | Ga0207712_100255792 | 359 |
| 947 | 3300026023 | Ga0207677_10000021 | Ga0207677_10000021111 | 359 |
| 948 | 3300026078 | Ga0207702_10005396 | Ga0207702_1000539610 | 359 |
| 949 | 3300026088 | Ga0207641_10003354 | Ga0207641_100033545 | 359 |
| 950 | 3300026089 | Ga0207648_10000219 | Ga0207648_1000021910 | 359 |
| 951 | 3300028380 | Ga0268265_10000176 | Ga0268265_1000017661 | 359 |
| 952 | 3300028381 | Ga0268264_10000548 | Ga0268264_1000054826 | 359 |
| 953 | 3300031456 | Ga0307513_10018836 | Ga0307513_100188364 | 359 |
| 954 | 3300046691 | Ga0495670_0002065 | Ga0495670_0002065_4753_5838 | 359 |
| 955 | 3300047443 | Ga0495687_000517 | Ga0495687_000517_43977_45200 | 359 |
| 956 | 3300048918 | Ga0496115_0000325 | Ga0496115_0000325_26977_28077 | 359 |
| 957 | 3300053094 | Ga0500566_0000436 | Ga0500566_0000436_18037_19125 | 359 |
| 958 | 3300053096 | Ga0500641_0051800 | Ga0500641_0051800_581_1666 | 359 |
| 959 | iso_pu_bacteria | 2582581305 | 2585261115 | 359 |
| 960 | 3300005295 | Ga0065707_10090430 | Ga0065707_100904302 | 360 |
| 961 | 3300005347 | Ga0070668_100000050 | Ga0070668_10000005055 | 360 |
| 962 | 3300005347 | Ga0070668_100000245 | Ga0070668_10000024522 | 360 |
| 963 | 3300005347 | Ga0070668_100153205 | Ga0070668_1001532052 | 360 |
| 964 | 3300005353 | Ga0070669_100005571 | Ga0070669_1000055716 | 360 |
| 965 | 3300005353 | Ga0070669_100083318 | Ga0070669_1000833182 | 360 |
| 966 | 3300005355 | Ga0070671_100002015 | Ga0070671_1000020155 | 360 |
| 967 | 3300005367 | Ga0070667_100000025 | Ga0070667_100000025151 | 360 |
| 968 | 3300005367 | Ga0070667_100000101 | Ga0070667_10000010113 | 360 |
| 969 | 3300005367 | Ga0070667_100000339 | Ga0070667_1000003395 | 360 |
| 970 | 3300005563 | Ga0068855_100008046 | Ga0068855_1000080463 | 360 |
| 971 | 3300005614 | Ga0068856_100049902 | Ga0068856_1000499024 | 360 |
| 972 | 3300005617 | Ga0068859_100049550 | Ga0068859_1000495503 | 360 |
| 973 | 3300005617 | Ga0068859_100231493 | Ga0068859_1002314932 | 360 |
| 974 | 3300005618 | Ga0068864_100006624 | Ga0068864_1000066242 | 360 |
| 975 | 3300005841 | Ga0068863_100000187 | Ga0068863_10000018731 | 360 |
| 976 | 3300005841 | Ga0068863_100003456 | Ga0068863_1000034565 | 360 |
| 977 | 3300005841 | Ga0068863_100016390 | Ga0068863_1000163904 | 360 |
| 978 | 3300005841 | Ga0068863_100109995 | Ga0068863_1001099952 | 360 |
| 979 | 3300005842 | Ga0068858_100001621 | Ga0068858_1000016217 | 360 |
| 980 | 3300005843 | Ga0068860_100000442 | Ga0068860_1000004425 | 360 |
| 981 | 3300005843 | Ga0068860_100001488 | Ga0068860_10000148818 | 360 |
| 982 | 3300005844 | Ga0068862_100002718 | Ga0068862_1000027182 | 360 |
| 983 | 3300006931 | Ga0097620_100049551 | Ga0097620_1000495513 | 360 |
| 984 | 3300006931 | Ga0097620_100231486 | Ga0097620_1002314862 | 360 |
| 985 | 3300009093 | Ga0105240_10095948 | Ga0105240_100959482 | 360 |
| 986 | 3300009174 | Ga0105241_10170578 | Ga0105241_101705783 | 360 |
| 987 | 3300025903 | Ga0207680_10008448 | Ga0207680_100084483 | 360 |
| 988 | 3300025913 | Ga0207695_10051931 | Ga0207695_100519314 | 360 |
| 989 | 3300025923 | Ga0207681_10006262 | Ga0207681_100062625 | 360 |
| 990 | 3300025923 | Ga0207681_10057287 | Ga0207681_100572872 | 360 |
| 991 | 3300025925 | Ga0207650_10101664 | Ga0207650_101016642 | 360 |
| 992 | 3300025931 | Ga0207644_10002933 | Ga0207644_100029332 | 360 |
| 993 | 3300025949 | Ga0207667_10028577 | Ga0207667_100285773 | 360 |
| 994 | 3300025972 | Ga0207668_10000094 | Ga0207668_1000009432 | 360 |
| 995 | 3300025972 | Ga0207668_10000416 | Ga0207668_1000041619 | 360 |
| 996 | 3300025972 | Ga0207668_10066395 | Ga0207668_100663952 | 360 |
| 997 | 3300025986 | Ga0207658_10000023 | Ga0207658_10000023149 | 360 |
| 998 | 3300025986 | Ga0207658_10000077 | Ga0207658_1000007713 | 360 |
| 999 | 3300025986 | Ga0207658_10000492 | Ga0207658_1000049238 | 360 |
| 1000 | 3300026035 | Ga0207703_10001299 | Ga0207703_1000129919 | 360 |
| 1001 | 3300026078 | Ga0207702_10056561 | Ga0207702_100565612 | 360 |
| 1002 | 3300026088 | Ga0207641_10000243 | Ga0207641_1000024361 | 360 |
| 1003 | 3300026088 | Ga0207641_10000269 | Ga0207641_1000026946 | 360 |
| 1004 | 3300026088 | Ga0207641_10003551 | Ga0207641_100035516 | 360 |
| 1005 | 3300026088 | Ga0207641_10004624 | Ga0207641_100046242 | 360 |
| 1006 | 3300026095 | Ga0207676_10048363 | Ga0207676_100483631 | 360 |
| 1007 | 3300028380 | Ga0268265_10000808 | Ga0268265_1000080811 | 360 |
| 1008 | 3300028381 | Ga0268264_10000214 | Ga0268264_1000021495 | 360 |
| 1009 | 3300028381 | Ga0268264_10000491 | Ga0268264_1000049158 | 360 |
| 1010 | 3300031911 | Ga0307412_10007957 | Ga0307412_100079572 | 360 |
| 1011 | 3300031911 | Ga0307412_10136904 | Ga0307412_101369042 | 360 |
| 1012 | 3300047472 | Ga0495686_0006459 | Ga0495686_0006459_1279_2382 | 360 |
| 1013 | 3300049679 | Ga0501249_000063 | Ga0501249_000063_25966_27057 | 360 |
| 1014 | 3300053087 | Ga0500643_000134 | Ga0500643_000134_12960_14093 | 360 |
| 1015 | 3300053093 | Ga0500651_0008965 | Ga0500651_0008965_3908_4993 | 360 |
| 1016 | 3300053148 | Ga0500590_000141 | Ga0500590_000141_8420_9505 | 360 |
| 1017 | 3300053724 | Ga0500570_003712 | Ga0500570_003712_6525_7610 | 360 |
| 1018 | iso_pu_bacteria | 2643221541 | 2643729393 | 360 |
| 1019 | iso_pu_bacteria | 2643221605 | 2644038999 | 360 |
| 1020 | iso_pu_bacteria | 2643221606 | 2644045869 | 360 |
| 1021 | iso_pu_bacteria | 2643221671 | 2644393446 | 360 |
| 1022 | 3300005295 | Ga0065707_10112939 | Ga0065707_101129392 | 361 |
| 1023 | 3300021388 | Ga0213875_10005786 | Ga0213875_100057864 | 361 |
| 1024 | 3300032004 | Ga0307414_10180923 | Ga0307414_101809232 | 361 |
| 1025 | 3300037853 | Ga0436364_0689048 | Ga0436364_0689048_830_1939 | 361 |
| 1026 | 3300053133 | Ga0500655_000244 | Ga0500655_000244_5959_7050 | 361 |
| 1027 | iso_pu_bacteria | 2946787523 | 2946789911 | 361 |
| 1028 | 3300002076 | JGI24749J21850_1000019 | JGI24749J21850_100001923 | 362 |
| 1029 | 3300002459 | JGI24751J29686_10000519 | JGI24751J29686_1000051913 | 362 |
| 1030 | 3300005295 | Ga0065707_10084228 | Ga0065707_100842287 | 362 |
| 1031 | 3300005331 | Ga0070670_100000060 | Ga0070670_10000006017 | 362 |
| 1032 | 3300005353 | Ga0070669_100000053 | Ga0070669_10000005399 | 362 |
| 1033 | 3300005367 | Ga0070667_100147964 | Ga0070667_1001479642 | 362 |
| 1034 | 3300005617 | Ga0068859_100006620 | Ga0068859_10000662015 | 362 |
| 1035 | 3300005618 | Ga0068864_100000069 | Ga0068864_10000006999 | 362 |
| 1036 | 3300005719 | Ga0068861_100004343 | Ga0068861_10000434310 | 362 |
| 1037 | 3300005844 | Ga0068862_100000082 | Ga0068862_10000008217 | 362 |
| 1038 | 3300006931 | Ga0097620_100006621 | Ga0097620_1000066212 | 362 |
| 1039 | 3300009177 | Ga0105248_10000101 | Ga0105248_1000010181 | 362 |
| 1040 | 3300014326 | Ga0157380_10000793 | Ga0157380_100007937 | 362 |
| 1041 | 3300025923 | Ga0207681_10000003 | Ga0207681_10000003503 | 362 |
| 1042 | 3300025925 | Ga0207650_10000148 | Ga0207650_1000014870 | 362 |
| 1043 | 3300025941 | Ga0207711_10005144 | Ga0207711_1000514411 | 362 |
| 1044 | 3300025986 | Ga0207658_10001737 | Ga0207658_100017375 | 362 |
| 1045 | 3300026095 | Ga0207676_10000009 | Ga0207676_10000009505 | 362 |
| 1046 | 3300026118 | Ga0207675_100001422 | Ga0207675_10000142217 | 362 |
| 1047 | 3300028380 | Ga0268265_10000030 | Ga0268265_10000030105 | 362 |
| 1048 | 3300039450 | Ga0436363_1058292 | Ga0436363_1058292_763_1932 | 362 |
| 1049 | 3300049513 | Ga0501290_000064 | Ga0501290_000064_5474_6580 | 362 |
| 1050 | 3300049517 | Ga0501294_002490 | Ga0501294_002490_10_1134 | 362 |
| 1051 | 3300049662 | Ga0501222_000369 | Ga0501222_000369_3512_4618 | 362 |
| 1052 | 3300049669 | Ga0501235_000282 | Ga0501235_000282_8349_9473 | 362 |
| 1053 | 3300049705 | Ga0501225_0010379 | Ga0501225_0010379_35_1123 | 362 |
| 1054 | 3300049705 | Ga0501225_0010787 | Ga0501225_0010787_205_1311 | 362 |
| 1055 | 3300049776 | Ga0501280_000005 | Ga0501280_000005_13299_14405 | 362 |
| 1056 | 3300049777 | Ga0501281_00328 | Ga0501281_00328_987_2093 | 362 |
| 1057 | 3300053087 | Ga0500643_005223 | Ga0500643_005223_663_1760 | 362 |
| 1058 | 3300053140 | Ga0500573_0000010 | Ga0500573_0000010_55666_56814 | 362 |
| 1059 | 3300005842 | Ga0068858_100069876 | Ga0068858_1000698765 | 363 |
| 1060 | 3300015690 | Ga0183363_1010 | Ga0183363_101011 | 363 |
| 1061 | 3300016635 | Ga0183361_10895 | Ga0183361_108951 | 363 |
| 1062 | 3300046513 | Ga0495616_0000010 | Ga0495616_0000010_129347_130444 | 363 |
| 1063 | 3300048928 | Ga0496125_0104914 | Ga0496125_0104914_325_1416 | 363 |
| 1064 | 3300049669 | Ga0501235_005237 | Ga0501235_005237_1625_2716 | 363 |
| 1065 | iso_pu_bacteria | 2830075706 | 2830075729 | 363 |
| 1066 | 3300013105 | Ga0157369_10159054 | Ga0157369_101590542 | 364 |
| 1067 | 3300046460 | Ga0495638_0000068 | Ga0495638_0000068_86219_87313 | 364 |
| 1068 | 3300046501 | Ga0495607_0009022 | Ga0495607_0009022_2294_3409 | 364 |
| 1069 | iso_pu_bacteria | 2885429604 | 2885432170 | 364 |
| 1070 | 3300001904 | JGI24736J21556_1000036 | JGI24736J21556_100003610 | 367 |
| 1071 | 3300009011 | Ga0105251_10031794 | Ga0105251_100317942 | 367 |
| 1072 | 3300025735 | Ga0207713_1027808 | Ga0207713_10278083 | 367 |
| 1073 | 3300025920 | Ga0207649_10111966 | Ga0207649_101119662 | 367 |
| 1074 | 3300031731 | Ga0307405_10010011 | Ga0307405_100100112 | 367 |
| 1075 | 3300031911 | Ga0307412_10011087 | Ga0307412_100110873 | 367 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p75-assembly1.cif.gz_C | phers in complex with compound 4a | 0.8582 | 90 | 351 |
| 4p73-assembly1.cif.gz_C | phers in complex with compound 1a | 0.8533 | 90 | 351 |
| 4p75-assembly1.cif.gz_C | phers in complex with compound 4a | 0.8512 | 90 | 351 |
| 6p8t-assembly1.cif.gz_D | acinetobacter baumannii trna synthetase in complex with compound 1 | 0.8442 | 91 | 352 |
| 4p75-assembly1.cif.gz_D | phers in complex with compound 4a | 0.841 | 88 | 351 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p73C01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9063 | 106 | 351 | 3.30.930.10 |
| 4p73C01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8985 | 106 | 351 | 3.30.930.10 |
| 3vqxB02 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8273 | 106 | 339 | 3.30.930.10 |
| af_Q94K73_217_334_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8041 | 230 | 352 | 3.30.930.10 |
| 3l4gO01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.7911 | 107 | 340 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6D0IN12-F1-model_v4 | phenylalanine--tRNA ligase (EC 6.1.1.20) | 0.9237 | 120 | 337 |
GO:0000049
GO:0004826 GO:0005524 GO:0005737 GO:0006432 GO:0046872 |
| AF-A0A529NSV6-F1-model_v4 | phenylalanine--tRNA ligase (EC 6.1.1.20) | 0.923 | 122 | 336 |
GO:0000049
GO:0004826 GO:0005524 GO:0005737 GO:0006432 GO:0046872 |
| AF-A0A529NSV6-F1-model_v4 | phenylalanine--tRNA ligase (EC 6.1.1.20) | 0.9187 | 122 | 336 |
GO:0000049
GO:0004826 GO:0005524 GO:0005737 GO:0006432 GO:0046872 |
| AF-A0A4Y9J4T2-F1-model_v4 | phenylalanine--tRNA ligase (EC 6.1.1.20) | 0.9183 | 190 | 330 |
GO:0000049
GO:0004826 GO:0005524 GO:0005737 GO:0006432 GO:0016740 |
| AF-A0A6D0IN12-F1-model_v4 | phenylalanine--tRNA ligase (EC 6.1.1.20) | 0.9145 | 120 | 337 |
GO:0000049
GO:0004826 GO:0005524 GO:0005737 GO:0006432 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar