F489568

General Info

Members Datasets Scaffolds Average Seq Length
1075 379 1055 351

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_000517|Ga0495687_000517_43977_45200
Length 407
Sequence MSDLDQLKSDLLAAIGSADLAGLEDIRVSALGKSGSVTGLLKTLGGMSPEERQTTGPRIHALREAVSEALTARKTGLEREALNARLAGETLDMTLPADVPAAGTVHPVSQVMDELAEIFADLGFAVATGPEIEDDWHNFTALNIPESHPARAMHDTFYMSPSPHWGEGRXXXXSRATPLGAAPLPDQHRVDRAPRDQGHAGGMADPMLPGGEREQKRMLLRTHTSPVQIRTMVAQKPPIRIIAPGRTYRSDSDATHTPMFHQVEGLVIDKGITLGHLKWTLETFLKAYFERDDIVLRLRPSYFPFTEPSAEVDVGYTIQNGKRVIGGSDHWMEVLGSGMVHPKVIAACGLDPDEWQGFAFGCGIDRLAMLKYGMDDLRAFFDGDIRWLKHYGFAALDVPTLSGGVGA

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
8 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
9 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
10 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
11 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
12 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
13 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
14 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
15 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
16 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
17 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
18 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
19 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
20 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
21 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
22 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
27 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
30 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
31 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
32 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
33 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
34 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
139 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
235 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
236 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
239 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
254 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
255 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
259 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
260 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
261 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
316 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
317 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
331 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
332 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
333 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
334 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
335 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
336 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
337 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
341 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
342 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
343 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
367 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
368 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
374 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
375 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0.09
Isolates 1.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 4.47
Nodule 0
Rhizoplane 3.07
Rhizosphere 87.35
Stem 0
Stem Tuber 0.09
Unclassified 4.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000036 3300001904 Bacteria 22294
2 JGI24736J21556_1000435 3300001904 Bacteria 7880
3 JGI24736J21556_1000841 3300001904 Bacteria 5661
4 JGI24736J21556_1004342 3300001904 Bacteria 2425
5 JGI24752J21851_1000209 3300001976 Bacteria 8171
6 JGI24752J21851_1000362 3300001976 Bacteria 6344
7 JGI24740J21852_10000820 3300001979 Bacteria 13657
8 JGI24740J21852_10046622 3300001979 Bacteria 1271
9 JGI24739J22299_10000237 3300001989 Bacteria 18648
10 JGI24739J22299_10007848 3300001989 Bacteria 3992
11 JGI24737J22298_10000061 3300001990 Bacteria 32526
12 JGI24737J22298_10014465 3300001990 Bacteria 2562
13 JGI24737J22298_10016354 3300001990 Bacteria 2395
14 JGI24750J21931_1000040 3300002070 Bacteria 17215
15 JGI24748J21848_1000053 3300002074 Bacteria 50665
16 JGI24738J21930_10000766 3300002075 Bacteria 9206
17 JGI24738J21930_10001175 3300002075 Bacteria 7369
18 JGI24749J21850_1000019 3300002076 Bacteria 32251
19 JGI24749J21850_1004036 3300002076 Bacteria 2049
20 JGI24749J21850_1009649 3300002076 Bacteria 1349
21 JGI24035J26624_1001486 3300002126 Bacteria 2212
22 JGI24033J26618_1003599 3300002155 Bacteria 1640
23 JGI24034J26672_10000036 3300002239 Bacteria 84333
24 JGI24742J22300_10004660 3300002244 Bacteria 2250
25 JGI24751J29686_10000519 3300002459 Bacteria 11120
26 JGI24751J29686_10007551 3300002459 Bacteria 2222
27 JGI25165J46597_1000010 3300003214 Bacteria 442113
28 JGI25153J46596_10000417 3300003215 Bacteria 27933
29 Ga0055537_1003859 3300003773 Bacteria 4479
30 Ga0055524_1000154 3300003775 Bacteria 80540
31 Ga0065704_10003962 3300005289 Bacteria 4806
32 Ga0065704_10075440 3300005289 Bacteria 5588
33 Ga0065712_10088801 3300005290 Bacteria 2480
34 Ga0065712_10157228 3300005290 Bacteria 1325
35 Ga0065707_10081963 3300005295 Bacteria 27052
36 Ga0065707_10084228 3300005295 Bacteria 7485
37 Ga0065707_10090430 3300005295 Bacteria 4137
38 Ga0065707_10112939 3300005295 Bacteria 2344
39 Ga0070658_10000003 3300005327 Bacteria 465963
40 Ga0070658_10001555 3300005327 Bacteria 19441
41 Ga0070658_10001818 3300005327 Bacteria 17955
42 Ga0070658_10005891 3300005327 Bacteria 9941
43 Ga0070658_10037354 3300005327 Bacteria 3915
44 Ga0070658_10041579 3300005327 Bacteria 3709
45 Ga0070658_10083347 3300005327 Bacteria 2628
46 Ga0070658_10258356 3300005327 Bacteria 1479
47 Ga0070676_10000367 3300005328 Bacteria 20719
48 Ga0070676_10003382 3300005328 Bacteria 8305
49 Ga0070676_10009609 3300005328 Bacteria 5226
50 Ga0070683_100006609 3300005329 Bacteria 9739
51 Ga0070683_100117064 3300005329 Bacteria 2516
52 Ga0070690_100000093 3300005330 Bacteria 44990
53 Ga0070670_100000060 3300005331 Bacteria 113477
54 Ga0070670_100000202 3300005331 Bacteria 55420
55 Ga0070670_100000657 3300005331 Bacteria 26873
56 Ga0070670_100020267 3300005331 Bacteria 5713
57 Ga0070670_100031324 3300005331 Bacteria 4579
58 Ga0070670_100094950 3300005331 Bacteria 2565
59 Ga0070670_100122039 3300005331 Bacteria 2248
60 Ga0070670_100171019 3300005331 Bacteria 1884
61 Ga0070677_10010369 3300005333 Bacteria 3187
62 Ga0068869_100000493 3300005334 Bacteria 21956
63 Ga0068869_100000552 3300005334 Bacteria 20946
64 Ga0068869_100028462 3300005334 Bacteria 3905
65 Ga0070666_10000009 3300005335 Bacteria 279209
66 Ga0070680_100000105 3300005336 Bacteria 48515
67 Ga0070680_100024107 3300005336 Bacteria 4855
68 Ga0070682_100013327 3300005337 Bacteria 4727
69 Ga0068868_100000057 3300005338 Bacteria 62946
70 Ga0068868_100022988 3300005338 Bacteria 4714
71 Ga0070660_100000511 3300005339 Bacteria 25935
72 Ga0070660_100001813 3300005339 Bacteria 14658
73 Ga0070660_100059267 3300005339 Bacteria 2968
74 Ga0070660_100086867 3300005339 Bacteria 2461
75 Ga0070660_100177987 3300005339 Bacteria 1720
76 Ga0070660_100244616 3300005339 Bacteria 1462
77 Ga0070689_100152187 3300005340 Bacteria 1866
78 Ga0070691_10004772 3300005341 Bacteria 6168
79 Ga0070661_100027477 3300005344 Bacteria 4098
80 Ga0070692_10000469 3300005345 Bacteria 12367
81 Ga0070692_10001745 3300005345 Bacteria 8106
82 Ga0070668_100000050 3300005347 Bacteria 73885
83 Ga0070668_100000245 3300005347 Bacteria 35846
84 Ga0070668_100153205 3300005347 Bacteria 1866
85 Ga0070668_100221644 3300005347 Bacteria 1560
86 Ga0070669_100000053 3300005353 Bacteria 113601
87 Ga0070669_100000103 3300005353 Bacteria 81387
88 Ga0070669_100000532 3300005353 Bacteria 28333
89 Ga0070669_100005571 3300005353 Bacteria 9097
90 Ga0070669_100028765 3300005353 Bacteria 4003
91 Ga0070669_100064293 3300005353 Bacteria 2702
92 Ga0070669_100083318 3300005353 Bacteria 2384
93 Ga0070669_100187623 3300005353 Bacteria 1621
94 Ga0070675_100008142 3300005354 Bacteria 8125
95 Ga0070675_100095684 3300005354 Bacteria 2494
96 Ga0070671_100000620 3300005355 Bacteria 25349
97 Ga0070671_100002015 3300005355 Bacteria 15619
98 Ga0070671_100024436 3300005355 Bacteria 4946
99 Ga0070674_100016920 3300005356 Bacteria 4576
100 Ga0070674_100056431 3300005356 Bacteria 2723
101 Ga0070673_100000005 3300005364 Bacteria 193513
102 Ga0070673_100000058 3300005364 Bacteria 45772
103 Ga0070673_100006165 3300005364 Bacteria 7771
104 Ga0070673_100084491 3300005364 Bacteria 2582
105 Ga0070673_100132181 3300005364 Bacteria 2096
106 Ga0070673_100297556 3300005364 Bacteria 1420
107 Ga0070688_100016969 3300005365 Bacteria 4172
108 Ga0070659_100000005 3300005366 Bacteria 259902
109 Ga0070659_100003757 3300005366 Bacteria 10832
110 Ga0070659_100004495 3300005366 Bacteria 9962
111 Ga0070659_100006101 3300005366 Bacteria 8698
112 Ga0070659_100022244 3300005366 Bacteria 4838
113 Ga0070659_100026584 3300005366 Bacteria 4454
114 Ga0070659_100036650 3300005366 Bacteria 3823
115 Ga0070659_100039832 3300005366 Bacteria 3670
116 Ga0070659_100055678 3300005366 Bacteria 3118
117 Ga0070659_100113372 3300005366 Bacteria 2190
118 Ga0070667_100000025 3300005367 Bacteria 190744
119 Ga0070667_100000101 3300005367 Bacteria 108015
120 Ga0070667_100000339 3300005367 Bacteria 52285
121 Ga0070667_100001658 3300005367 Bacteria 19885
122 Ga0070667_100004233 3300005367 Bacteria 12118
123 Ga0070667_100013033 3300005367 Bacteria 6872
124 Ga0070667_100042831 3300005367 Bacteria 3798
125 Ga0070667_100147964 3300005367 Bacteria 2061
126 Ga0070694_100040643 3300005444 Bacteria 3100
127 Ga0070663_100002096 3300005455 Bacteria 11158
128 Ga0070663_100024870 3300005455 Bacteria 4036
129 Ga0070663_100098573 3300005455 Bacteria 2178
130 Ga0070663_100170137 3300005455 Bacteria 1683
131 Ga0070678_100192392 3300005456 Bacteria 1678
132 Ga0070662_100002227 3300005457 Bacteria 11895
133 Ga0070662_100006902 3300005457 Bacteria 7350
134 Ga0070662_100013733 3300005457 Bacteria 5394
135 Ga0070662_100034379 3300005457 Bacteria 3574
136 Ga0070662_100084612 3300005457 Bacteria 2369
137 Ga0070662_100233670 3300005457 Bacteria 1472
138 Ga0070681_10056174 3300005458 Bacteria 3919
139 Ga0070681_10135359 3300005458 Bacteria 2395
140 Ga0068867_100000071 3300005459 Bacteria 61808
141 Ga0068867_100001818 3300005459 Bacteria 14861
142 Ga0068867_100090015 3300005459 Bacteria 2327
143 Ga0070685_10000076 3300005466 Bacteria 59090
144 Ga0070679_100000125 3300005530 Bacteria 61348
145 Ga0070679_100008091 3300005530 Bacteria 9881
146 Ga0070679_100193348 3300005530 Bacteria 2003
147 Ga0068853_100000783 3300005539 Bacteria 22097
148 Ga0068853_100005580 3300005539 Bacteria 9880
149 Ga0068853_100020734 3300005539 Bacteria 5466
150 Ga0070672_100000716 3300005543 Bacteria 19668
151 Ga0070672_100013878 3300005543 Bacteria 5699
152 Ga0070672_100124888 3300005543 Bacteria 2110
153 Ga0070686_100000018 3300005544 Bacteria 140685
154 Ga0070695_100002848 3300005545 Bacteria 10058
155 Ga0070696_100003697 3300005546 Bacteria 10202
156 Ga0070696_100037829 3300005546 Bacteria 3328
157 Ga0070693_100007429 3300005547 Bacteria 5358
158 Ga0070665_100000071 3300005548 Bacteria 200675
159 Ga0070665_100001540 3300005548 Bacteria 26631
160 Ga0070665_100058303 3300005548 Bacteria 3871
161 Ga0070665_100187057 3300005548 Bacteria 2072
162 Ga0068855_100000380 3300005563 Bacteria 54664
163 Ga0068855_100001416 3300005563 Bacteria 29777
164 Ga0068855_100007934 3300005563 Bacteria 12829
165 Ga0068855_100008046 3300005563 Bacteria 12739
166 Ga0068855_100011666 3300005563 Bacteria 10621
167 Ga0068855_100022265 3300005563 Bacteria 7593
168 Ga0068855_100296707 3300005563 Bacteria 1791
169 Ga0068855_100381109 3300005563 Bacteria 1548
170 Ga0070664_100003017 3300005564 Bacteria 13609
171 Ga0070664_100021584 3300005564 Bacteria 5310
172 Ga0070664_100049081 3300005564 Bacteria 3569
173 Ga0070664_100084855 3300005564 Bacteria 2734
174 Ga0070664_100110229 3300005564 Bacteria 2401
175 Ga0070664_100116006 3300005564 Bacteria 2341
176 Ga0070664_100130374 3300005564 Bacteria 2208
177 Ga0070664_100172029 3300005564 Bacteria 1922
178 Ga0070664_100365893 3300005564 Bacteria 1314
179 Ga0068857_100004724 3300005577 Bacteria 11541
180 Ga0068857_100092128 3300005577 Bacteria 2713
181 Ga0068857_100108161 3300005577 Bacteria 2498
182 Ga0068857_100114134 3300005577 Bacteria 2429
183 Ga0068857_100150099 3300005577 Bacteria 2111
184 Ga0068857_100242743 3300005577 Bacteria 1650
185 Ga0068854_100001025 3300005578 Bacteria 16746
186 Ga0068854_100006061 3300005578 Bacteria 7667
187 Ga0068854_100012217 3300005578 Bacteria 5619
188 Ga0068854_100021404 3300005578 Bacteria 4388
189 Ga0068854_100035059 3300005578 Bacteria 3510
190 Ga0068854_100062705 3300005578 Bacteria 2696
191 Ga0068854_100103485 3300005578 Bacteria 2137
192 Ga0068856_100001220 3300005614 Bacteria 26928
193 Ga0068856_100002574 3300005614 Bacteria 18686
194 Ga0068856_100049902 3300005614 Bacteria 4125
195 Ga0068856_100105955 3300005614 Bacteria 2806
196 Ga0068856_100108554 3300005614 Bacteria 2771
197 Ga0070702_100058941 3300005615 Bacteria 2226
198 Ga0068852_100002771 3300005616 Bacteria 12138
199 Ga0068852_100059481 3300005616 Bacteria 3314
200 Ga0068852_100110699 3300005616 Bacteria 2496
201 Ga0068852_100208572 3300005616 Bacteria 1852
202 Ga0068852_100334449 3300005616 Bacteria 1474
203 Ga0068859_100000136 3300005617 Bacteria 68907
204 Ga0068859_100000623 3300005617 Bacteria 35426
205 Ga0068859_100006620 3300005617 Bacteria 11765
206 Ga0068859_100007966 3300005617 Bacteria 10750
207 Ga0068859_100031499 3300005617 Bacteria 5325
208 Ga0068859_100049550 3300005617 Bacteria 4218
209 Ga0068859_100231493 3300005617 Bacteria 1936
210 Ga0068864_100000069 3300005618 Bacteria 114134
211 Ga0068864_100000194 3300005618 Bacteria 55652
212 Ga0068864_100000235 3300005618 Bacteria 49611
213 Ga0068864_100000711 3300005618 Bacteria 27933
214 Ga0068864_100006624 3300005618 Bacteria 9479
215 Ga0068864_100159474 3300005618 Bacteria 2050
216 Ga0068864_100230836 3300005618 Bacteria 1711
217 Ga0068861_100000004 3300005719 Bacteria 105907
218 Ga0068861_100004343 3300005719 Bacteria 9511
219 Ga0068861_100007263 3300005719 Bacteria 7592
220 Ga0068861_100008680 3300005719 Bacteria 6991
221 Ga0068863_100000103 3300005841 Bacteria 91380
222 Ga0068863_100000140 3300005841 Bacteria 76175
223 Ga0068863_100000187 3300005841 Bacteria 65873
224 Ga0068863_100000258 3300005841 Bacteria 55428
225 Ga0068863_100002289 3300005841 Bacteria 19027
226 Ga0068863_100003456 3300005841 Bacteria 15582
227 Ga0068863_100004622 3300005841 Bacteria 13561
228 Ga0068863_100004697 3300005841 Bacteria 13461
229 Ga0068863_100016390 3300005841 Bacteria 7108
230 Ga0068863_100029062 3300005841 Bacteria 5280
231 Ga0068863_100109995 3300005841 Bacteria 2624
232 Ga0068858_100000514 3300005842 Bacteria 40588
233 Ga0068858_100000695 3300005842 Bacteria 35157
234 Ga0068858_100001621 3300005842 Bacteria 22962
235 Ga0068858_100002738 3300005842 Bacteria 17727
236 Ga0068858_100069876 3300005842 Bacteria 3255
237 Ga0068860_100000022 3300005843 Bacteria 279209
238 Ga0068860_100000442 3300005843 Bacteria 52295
239 Ga0068860_100001488 3300005843 Bacteria 25286
240 Ga0068860_100004667 3300005843 Bacteria 13989
241 Ga0068860_100018036 3300005843 Bacteria 6872
242 Ga0068860_100076957 3300005843 Bacteria 3173
243 Ga0068862_100000014 3300005844 Bacteria 251552
244 Ga0068862_100000070 3300005844 Bacteria 122289
245 Ga0068862_100000082 3300005844 Bacteria 113125
246 Ga0068862_100000289 3300005844 Bacteria 55428
247 Ga0068862_100002718 3300005844 Bacteria 15522
248 Ga0068862_100016013 3300005844 Bacteria 6235
249 Ga0068862_100182504 3300005844 Bacteria 1884
250 Ga0081455_10000029 3300005937 Bacteria 155672
251 Ga0081455_10000392 3300005937 Bacteria 57696
252 Ga0081540_1000048 3300005983 Bacteria 127924
253 Ga0081539_10014655 3300005985 Bacteria 5772
254 Ga0075368_10008487 3300006042 Bacteria 3661
255 Ga0075364_10008502 3300006051 Bacteria 6139
256 Ga0075367_10017386 3300006178 Bacteria 3947
257 Ga0075367_10116249 3300006178 Bacteria 1645
258 Ga0075366_10000241 3300006195 Bacteria 24314
259 Ga0068871_100053035 3300006358 Bacteria 3286
260 Ga0075428_100084896 3300006844 Bacteria 3454
261 Ga0075428_100119007 3300006844 Bacteria 2876
262 Ga0075428_100268097 3300006844 Bacteria 1837
263 Ga0075430_100022172 3300006846 Bacteria 5399
264 Ga0075430_100039288 3300006846 Bacteria 4007
265 Ga0075431_100009478 3300006847 Bacteria 9776
266 Ga0075431_100019995 3300006847 Bacteria 6836
267 Ga0075431_100272780 3300006847 Bacteria 1714
268 Ga0075433_10005933 3300006852 Bacteria 9619
269 Ga0075434_100003078 3300006871 Bacteria 14838
270 Ga0075434_100006345 3300006871 Bacteria 10841
271 Ga0075429_100172609 3300006880 Bacteria 1894
272 Ga0068865_100000032 3300006881 Bacteria 88205
273 Ga0068865_100012549 3300006881 Bacteria 5337
274 Ga0097620_100000136 3300006931 Bacteria 68907
275 Ga0097620_100000623 3300006931 Bacteria 35426
276 Ga0097620_100006621 3300006931 Bacteria 11765
277 Ga0097620_100007966 3300006931 Bacteria 10750
278 Ga0097620_100031502 3300006931 Bacteria 5325
279 Ga0097620_100049551 3300006931 Bacteria 4218
280 Ga0097620_100231486 3300006931 Bacteria 1936
281 Ga0105251_10000815 3300009011 Bacteria 28051
282 Ga0105251_10031794 3300009011 Bacteria 2637
283 Ga0105240_10011600 3300009093 Bacteria 12261
284 Ga0105240_10095948 3300009093 Bacteria 3615
285 Ga0105240_10179509 3300009093 Bacteria 2500
286 Ga0111539_10067078 3300009094 Bacteria 4238
287 Ga0111539_10114699 3300009094 Bacteria 3160
288 Ga0111539_10223978 3300009094 Bacteria 2191
289 Ga0111539_10231512 3300009094 Bacteria 2151
290 Ga0111539_10235181 3300009094 Bacteria 2133
291 Ga0111539_10323458 3300009094 Bacteria 1795
292 Ga0105245_10000170 3300009098 Bacteria 61721
293 Ga0105245_10001290 3300009098 Bacteria 22584
294 Ga0105245_10182092 3300009098 Bacteria 2008
295 Ga0105247_10000483 3300009101 Bacteria 33208
296 Ga0105247_10103828 3300009101 Bacteria 1820
297 Ga0105243_10000933 3300009148 Bacteria 27415
298 Ga0105243_10081629 3300009148 Bacteria 2640
299 Ga0105243_10207048 3300009148 Bacteria 1724
300 Ga0105241_10018566 3300009174 Bacteria 5117
301 Ga0105241_10170578 3300009174 Bacteria 1797
302 Ga0105242_10007089 3300009176 Bacteria 8658
303 Ga0105248_10000012 3300009177 Bacteria 333963
304 Ga0105248_10000101 3300009177 Bacteria 95328
305 Ga0105248_10000184 3300009177 Bacteria 72728
306 Ga0105248_10001646 3300009177 Bacteria 24849
307 Ga0105248_10002069 3300009177 Bacteria 22227
308 Ga0105248_10004489 3300009177 Bacteria 15445
309 Ga0105248_10040085 3300009177 Bacteria 5249
310 Ga0105248_10058095 3300009177 Bacteria 4343
311 Ga0105248_10084464 3300009177 Bacteria 3571
312 Ga0105248_10665958 3300009177 Bacteria 1174
313 Ga0105237_10024781 3300009545 Bacteria 6138
314 Ga0105237_10065812 3300009545 Bacteria 3619
315 Ga0105238_10019570 3300009551 Bacteria 6894
316 Ga0105238_10069194 3300009551 Bacteria 3530
317 Ga0105238_10105601 3300009551 Bacteria 2798
318 Ga0105238_10187714 3300009551 Bacteria 2043
319 Ga0105238_10273984 3300009551 Bacteria 1668
320 Ga0105249_10000002 3300009553 Bacteria 376207
321 Ga0105249_10000014 3300009553 Bacteria 283274
322 Ga0105249_10000099 3300009553 Bacteria 119885
323 Ga0105249_10009606 3300009553 Bacteria 8476
324 Ga0105249_10019397 3300009553 Bacteria 6067
325 Ga0105246_10031393 3300011119 Bacteria 3515
326 Ga0105246_10034472 3300011119 Bacteria 3374
327 Ga0105246_10065734 3300011119 Bacteria 2536
328 Ga0157373_10115137 3300013100 Bacteria 1890
329 Ga0157373_10201695 3300013100 Bacteria 1402
330 Ga0157373_10248426 3300013100 Bacteria 1258
331 Ga0157373_10302024 3300013100 Bacteria 1136
332 Ga0157371_10000443 3300013102 Bacteria 50736
333 Ga0157371_10002185 3300013102 Bacteria 18986
334 Ga0157371_10036317 3300013102 Bacteria 3529
335 Ga0157371_10101373 3300013102 Bacteria 2042
336 Ga0157371_10138748 3300013102 Bacteria 1732
337 Ga0157370_10005863 3300013104 Bacteria 13714
338 Ga0157370_10010104 3300013104 Bacteria 9968
339 Ga0157370_10125144 3300013104 Bacteria 2400
340 Ga0157370_10151588 3300013104 Bacteria 2157
341 Ga0157369_10000043 3300013105 Bacteria 180713
342 Ga0157369_10014002 3300013105 Bacteria 9061
343 Ga0157369_10021037 3300013105 Bacteria 7293
344 Ga0157369_10047977 3300013105 Bacteria 4635
345 Ga0157369_10099382 3300013105 Bacteria 3102
346 Ga0157369_10159054 3300013105 Bacteria 2385
347 Ga0157374_10001444 3300013296 Bacteria 20100
348 Ga0157374_10008229 3300013296 Bacteria 8910
349 Ga0157378_10000312 3300013297 Bacteria 47527
350 Ga0157378_10001339 3300013297 Bacteria 22132
351 Ga0157378_10093283 3300013297 Bacteria 2740
352 Ga0157378_10196811 3300013297 Bacteria 1904
353 Ga0157378_10323661 3300013297 Bacteria 1498
354 Ga0163162_10004881 3300013306 Bacteria 12932
355 Ga0163162_10050805 3300013306 Bacteria 4158
356 Ga0163162_10164709 3300013306 Bacteria 2340
357 Ga0157372_10141581 3300013307 Bacteria 2771
358 Ga0157372_10208642 3300013307 Bacteria 2263
359 Ga0157372_10403546 3300013307 Bacteria 1593
360 Ga0157372_10559854 3300013307 Bacteria 1333
361 Ga0157375_10006351 3300013308 Bacteria 10301
362 Ga0157375_10014738 3300013308 Bacteria 6987
363 Ga0157375_10389614 3300013308 Bacteria 1560
364 Ga0163163_10000131 3300014325 Bacteria 76809
365 Ga0163163_10112163 3300014325 Bacteria 2756
366 Ga0157380_10000681 3300014326 Bacteria 21070
367 Ga0157380_10000793 3300014326 Bacteria 19836
368 Ga0157380_10020827 3300014326 Bacteria 4909
369 Ga0157380_10060921 3300014326 Bacteria 3018
370 Ga0157380_10157232 3300014326 Bacteria 1971
371 Ga0157379_10009221 3300014968 Bacteria 8594
372 Ga0157379_10011780 3300014968 Bacteria 7637
373 Ga0157379_10028865 3300014968 Bacteria 4934
374 Ga0157379_10041621 3300014968 Bacteria 4102
375 Ga0157376_10000678 3300014969 Bacteria 22046
376 Ga0183363_1010 3300015690 Bacteria 108191
377 Ga0183361_10895 3300016635 Bacteria 1437
378 Ga0163161_10000186 3300017792 Bacteria 57200
379 Ga0163161_10102018 3300017792 Bacteria 2137
380 Ga0206353_12009786 3300020082 Bacteria 8481
381 Ga0213876_10000371 3300021384 Bacteria 38154
382 Ga0213876_10022864 3300021384 Bacteria 3303
383 Ga0213876_10038133 3300021384 Bacteria 2535
384 Ga0213875_10005028 3300021388 Bacteria 7167
385 Ga0213875_10005786 3300021388 Bacteria 6580
386 Ga0207672_1000691 3300025223 Bacteria 3886
387 Ga0209233_1000044 3300025261 Bacteria 489783
388 Ga0209233_1021520 3300025261 Bacteria 1667
389 Ga0209565_1000007 3300025263 Bacteria 784361
390 Ga0209673_1003983 3300025273 Bacteria 8216
391 Ga0209675_1009823 3300025291 Bacteria 3337
392 Ga0209564_1016878 3300025295 Bacteria 2879
393 Ga0209758_1000007 3300025297 Bacteria 1270410
394 Ga0209050_1003356 3300025298 Bacteria 11930
395 Ga0209256_1000008 3300025299 Bacteria 975723
396 Ga0209257_1002535 3300025304 Bacteria 17892
397 Ga0209257_1008172 3300025304 Bacteria 6056
398 Ga0207697_10000063 3300025315 Bacteria 45019
399 Ga0207697_10028821 3300025315 Bacteria 2271
400 Ga0207713_1006255 3300025735 Bacteria 7287
401 Ga0207713_1027808 3300025735 Bacteria 2561
402 Ga0207682_10005874 3300025893 Bacteria 4976
403 Ga0207682_10029749 3300025893 Bacteria 2185
404 Ga0207710_10001070 3300025900 Bacteria 14117
405 Ga0207710_10055700 3300025900 Bacteria 1782
406 Ga0207688_10000106 3300025901 Bacteria 33178
407 Ga0207680_10000007 3300025903 Bacteria 623574
408 Ga0207680_10008448 3300025903 Bacteria 5055
409 Ga0207647_10000246 3300025904 Bacteria 44259
410 Ga0207647_10000331 3300025904 Bacteria 38861
411 Ga0207647_10009560 3300025904 Bacteria 6881
412 Ga0207647_10020217 3300025904 Bacteria 4466
413 Ga0207647_10054146 3300025904 Bacteria 2469
414 Ga0207645_10010447 3300025907 Bacteria 6372
415 Ga0207645_10051608 3300025907 Bacteria 2628
416 Ga0207643_10033521 3300025908 Bacteria 2873
417 Ga0207705_10000005 3300025909 Bacteria 673478
418 Ga0207705_10000033 3300025909 Bacteria 223997
419 Ga0207705_10000037 3300025909 Bacteria 197951
420 Ga0207705_10000067 3300025909 Bacteria 136004
421 Ga0207705_10000809 3300025909 Bacteria 25712
422 Ga0207705_10000978 3300025909 Bacteria 23330
423 Ga0207705_10004300 3300025909 Bacteria 10784
424 Ga0207705_10015141 3300025909 Bacteria 5544
425 Ga0207705_10017324 3300025909 Bacteria 5158
426 Ga0207705_10039863 3300025909 Bacteria 3367
427 Ga0207705_10188112 3300025909 Bacteria 1560
428 Ga0207705_10247395 3300025909 Bacteria 1359
429 Ga0207654_10004414 3300025911 Bacteria 7097
430 Ga0207707_10093083 3300025912 Bacteria 2633
431 Ga0207707_10095823 3300025912 Bacteria 2593
432 Ga0207707_10148459 3300025912 Bacteria 2050
433 Ga0207695_10001498 3300025913 Bacteria 38870
434 Ga0207695_10003382 3300025913 Bacteria 22540
435 Ga0207695_10051931 3300025913 Bacteria 4300
436 Ga0207695_10063442 3300025913 Bacteria 3809
437 Ga0207695_10177724 3300025913 Bacteria 2050
438 Ga0207695_10222370 3300025913 Bacteria 1795
439 Ga0207671_10000350 3300025914 Bacteria 66648
440 Ga0207671_10014386 3300025914 Bacteria 6257
441 Ga0207660_10000024 3300025917 Bacteria 71220
442 Ga0207660_10000379 3300025917 Bacteria 29073
443 Ga0207660_10038338 3300025917 Bacteria 3344
444 Ga0207662_10157465 3300025918 Bacteria 1449
445 Ga0207657_10002106 3300025919 Bacteria 21522
446 Ga0207657_10003198 3300025919 Bacteria 17527
447 Ga0207657_10006174 3300025919 Bacteria 12455
448 Ga0207657_10013805 3300025919 Bacteria 7906
449 Ga0207657_10028113 3300025919 Bacteria 5137
450 Ga0207657_10070581 3300025919 Bacteria 2960
451 Ga0207657_10080802 3300025919 Bacteria 2732
452 Ga0207657_10172193 3300025919 Bacteria 1753
453 Ga0207649_10002320 3300025920 Bacteria 10689
454 Ga0207649_10020713 3300025920 Bacteria 3774
455 Ga0207649_10046858 3300025920 Bacteria 2658
456 Ga0207649_10106389 3300025920 Bacteria 1866
457 Ga0207649_10111966 3300025920 Bacteria 1825
458 Ga0207652_10000058 3300025921 Bacteria 113620
459 Ga0207652_10118010 3300025921 Bacteria 2358
460 Ga0207652_10239491 3300025921 Bacteria 1635
461 Ga0207652_10326415 3300025921 Bacteria 1385
462 Ga0207681_10000003 3300025923 Bacteria 713245
463 Ga0207681_10000074 3300025923 Bacteria 89861
464 Ga0207681_10006262 3300025923 Bacteria 7302
465 Ga0207681_10019791 3300025923 Bacteria 4259
466 Ga0207681_10020235 3300025923 Bacteria 4214
467 Ga0207681_10057287 3300025923 Bacteria 2662
468 Ga0207681_10066779 3300025923 Bacteria 2490
469 Ga0207681_10117248 3300025923 Bacteria 1947
470 Ga0207694_10000447 3300025924 Bacteria 38252
471 Ga0207694_10032047 3300025924 Bacteria 4021
472 Ga0207694_10096889 3300025924 Bacteria 2333
473 Ga0207650_10000148 3300025925 Bacteria 85425
474 Ga0207650_10000881 3300025925 Bacteria 22724
475 Ga0207650_10002874 3300025925 Bacteria 11892
476 Ga0207650_10002923 3300025925 Bacteria 11787
477 Ga0207650_10010288 3300025925 Bacteria 6413
478 Ga0207650_10010656 3300025925 Bacteria 6313
479 Ga0207650_10101664 3300025925 Bacteria 2214
480 Ga0207659_10006612 3300025926 Bacteria 7119
481 Ga0207659_10008219 3300025926 Bacteria 6467
482 Ga0207687_10004280 3300025927 Bacteria 9538
483 Ga0207700_10028022 3300025928 Bacteria 3952
484 Ga0207644_10001029 3300025931 Bacteria 17849
485 Ga0207644_10002933 3300025931 Bacteria 10986
486 Ga0207644_10157182 3300025931 Bacteria 1764
487 Ga0207690_10000002 3300025932 Bacteria 807473
488 Ga0207690_10005149 3300025932 Bacteria 7716
489 Ga0207690_10005477 3300025932 Bacteria 7487
490 Ga0207690_10014175 3300025932 Bacteria 4809
491 Ga0207690_10031844 3300025932 Bacteria 3379
492 Ga0207690_10032243 3300025932 Bacteria 3360
493 Ga0207690_10036018 3300025932 Bacteria 3202
494 Ga0207690_10061849 3300025932 Bacteria 2547
495 Ga0207690_10072352 3300025932 Bacteria 2381
496 Ga0207690_10139457 3300025932 Bacteria 1785
497 Ga0207706_10000224 3300025933 Bacteria 62043
498 Ga0207706_10004809 3300025933 Bacteria 12649
499 Ga0207706_10005888 3300025933 Bacteria 11401
500 Ga0207706_10005974 3300025933 Bacteria 11322
501 Ga0207706_10020915 3300025933 Bacteria 5875
502 Ga0207686_10015896 3300025934 Bacteria 4216
503 Ga0207709_10000276 3300025935 Bacteria 59937
504 Ga0207670_10026322 3300025936 Bacteria 3664
505 Ga0207669_10009446 3300025937 Bacteria 4645
506 Ga0207704_10000034 3300025938 Bacteria 98810
507 Ga0207691_10000750 3300025940 Bacteria 32085
508 Ga0207691_10007047 3300025940 Bacteria 10845
509 Ga0207691_10136897 3300025940 Bacteria 2159
510 Ga0207711_10000004 3300025941 Bacteria 870636
511 Ga0207711_10000105 3300025941 Bacteria 90036
512 Ga0207711_10000917 3300025941 Bacteria 28411
513 Ga0207711_10005144 3300025941 Bacteria 11089
514 Ga0207711_10013512 3300025941 Bacteria 6779
515 Ga0207711_10013792 3300025941 Bacteria 6710
516 Ga0207711_10150956 3300025941 Bacteria 2096
517 Ga0207689_10000051 3300025942 Bacteria 88480
518 Ga0207689_10001065 3300025942 Bacteria 26408
519 Ga0207689_10093018 3300025942 Bacteria 2477
520 Ga0207661_10014353 3300025944 Bacteria 5804
521 Ga0207679_10008122 3300025945 Bacteria 6678
522 Ga0207679_10033900 3300025945 Bacteria 3597
523 Ga0207679_10095984 3300025945 Bacteria 2306
524 Ga0207679_10108531 3300025945 Bacteria 2185
525 Ga0207679_10143950 3300025945 Bacteria 1930
526 Ga0207667_10000013 3300025949 Bacteria 435875
527 Ga0207667_10000314 3300025949 Bacteria 67212
528 Ga0207667_10000828 3300025949 Bacteria 39983
529 Ga0207667_10006507 3300025949 Bacteria 14135
530 Ga0207667_10007100 3300025949 Bacteria 13519
531 Ga0207667_10007493 3300025949 Bacteria 13099
532 Ga0207667_10028577 3300025949 Bacteria 6055
533 Ga0207667_10064744 3300025949 Bacteria 3815
534 Ga0207667_10133914 3300025949 Bacteria 2552
535 Ga0207667_10255812 3300025949 Bacteria 1791
536 Ga0207667_10282364 3300025949 Bacteria 1696
537 Ga0207667_10348085 3300025949 Bacteria 1511
538 Ga0207667_10405370 3300025949 Bacteria 1388
539 Ga0207651_10000010 3300025960 Bacteria 193754
540 Ga0207651_10000232 3300025960 Bacteria 24043
541 Ga0207651_10218034 3300025960 Bacteria 1540
542 Ga0207712_10000002 3300025961 Bacteria 706628
543 Ga0207712_10000004 3300025961 Bacteria 614655
544 Ga0207712_10000161 3300025961 Bacteria 69260
545 Ga0207712_10014190 3300025961 Bacteria 5117
546 Ga0207712_10025579 3300025961 Bacteria 3923
547 Ga0207668_10000094 3300025972 Bacteria 63810
548 Ga0207668_10000416 3300025972 Bacteria 26868
549 Ga0207668_10004688 3300025972 Bacteria 8043
550 Ga0207668_10031542 3300025972 Bacteria 3492
551 Ga0207668_10066395 3300025972 Bacteria 2557
552 Ga0207668_10069875 3300025972 Bacteria 2502
553 Ga0207668_10107533 3300025972 Bacteria 2086
554 Ga0207668_10146770 3300025972 Bacteria 1821
555 Ga0207640_10002534 3300025981 Bacteria 9792
556 Ga0207640_10003179 3300025981 Bacteria 8837
557 Ga0207640_10004079 3300025981 Bacteria 7893
558 Ga0207640_10099354 3300025981 Bacteria 2037
559 Ga0207640_10175318 3300025981 Bacteria 1602
560 Ga0207658_10000023 3300025986 Bacteria 190806
561 Ga0207658_10000077 3300025986 Bacteria 108352
562 Ga0207658_10000232 3300025986 Bacteria 58908
563 Ga0207658_10000260 3300025986 Bacteria 55292
564 Ga0207658_10000492 3300025986 Bacteria 36290
565 Ga0207658_10001737 3300025986 Bacteria 16425
566 Ga0207658_10001956 3300025986 Bacteria 15383
567 Ga0207677_10000021 3300026023 Bacteria 131828
568 Ga0207677_10000100 3300026023 Bacteria 70908
569 Ga0207703_10001299 3300026035 Bacteria 23105
570 Ga0207703_10001367 3300026035 Bacteria 22279
571 Ga0207703_10002288 3300026035 Bacteria 16700
572 Ga0207703_10003246 3300026035 Bacteria 13663
573 Ga0207639_10002776 3300026041 Bacteria 11763
574 Ga0207639_10006433 3300026041 Bacteria 7987
575 Ga0207639_10030466 3300026041 Bacteria 3957
576 Ga0207639_10032279 3300026041 Bacteria 3854
577 Ga0207639_10065494 3300026041 Bacteria 2821
578 Ga0207639_10086092 3300026041 Bacteria 2501
579 Ga0207678_10001937 3300026067 Bacteria 18896
580 Ga0207678_10002816 3300026067 Bacteria 15773
581 Ga0207678_10008447 3300026067 Bacteria 9082
582 Ga0207678_10019305 3300026067 Bacteria 5988
583 Ga0207678_10037617 3300026067 Bacteria 4208
584 Ga0207678_10091269 3300026067 Bacteria 2603
585 Ga0207678_10123604 3300026067 Bacteria 2208
586 Ga0207702_10000566 3300026078 Bacteria 41185
587 Ga0207702_10001153 3300026078 Bacteria 27012
588 Ga0207702_10005396 3300026078 Bacteria 11197
589 Ga0207702_10033715 3300026078 Bacteria 4278
590 Ga0207702_10056561 3300026078 Bacteria 3331
591 Ga0207702_10058096 3300026078 Bacteria 3291
592 Ga0207702_10073246 3300026078 Bacteria 2953
593 Ga0207702_10257847 3300026078 Bacteria 1640
594 Ga0207702_10430719 3300026078 Bacteria 1277
595 Ga0207641_10000010 3300026088 Bacteria 402193
596 Ga0207641_10000113 3300026088 Bacteria 119188
597 Ga0207641_10000172 3300026088 Bacteria 90549
598 Ga0207641_10000192 3300026088 Bacteria 83746
599 Ga0207641_10000243 3300026088 Bacteria 70600
600 Ga0207641_10000269 3300026088 Bacteria 66008
601 Ga0207641_10003354 3300026088 Bacteria 14239
602 Ga0207641_10003551 3300026088 Bacteria 13782
603 Ga0207641_10004624 3300026088 Bacteria 11886
604 Ga0207641_10007289 3300026088 Bacteria 9215
605 Ga0207641_10371123 3300026088 Bacteria 1368
606 Ga0207648_10000219 3300026089 Bacteria 61792
607 Ga0207648_10000221 3300026089 Bacteria 61280
608 Ga0207648_10022651 3300026089 Bacteria 5639
609 Ga0207676_10000009 3300026095 Bacteria 545256
610 Ga0207676_10000046 3300026095 Bacteria 149037
611 Ga0207676_10000300 3300026095 Bacteria 42535
612 Ga0207676_10000709 3300026095 Bacteria 26254
613 Ga0207676_10032624 3300026095 Bacteria 3926
614 Ga0207676_10048363 3300026095 Bacteria 3301
615 Ga0207676_10066411 3300026095 Bacteria 2877
616 Ga0207674_10002274 3300026116 Bacteria 24350
617 Ga0207674_10009750 3300026116 Bacteria 10940
618 Ga0207674_10026673 3300026116 Bacteria 6129
619 Ga0207674_10132360 3300026116 Bacteria 2456
620 Ga0207674_10155587 3300026116 Bacteria 2241
621 Ga0207674_10162057 3300026116 Bacteria 2191
622 Ga0207674_10185975 3300026116 Bacteria 2028
623 Ga0207674_10218544 3300026116 Bacteria 1854
624 Ga0207675_100000032 3300026118 Bacteria 108677
625 Ga0207675_100000370 3300026118 Bacteria 43070
626 Ga0207675_100001422 3300026118 Bacteria 23981
627 Ga0207675_100032035 3300026118 Bacteria 4897
628 Ga0207683_10087090 3300026121 Bacteria 2777
629 Ga0207683_10185608 3300026121 Bacteria 1887
630 Ga0207698_10002929 3300026142 Bacteria 10207
631 Ga0207698_10016134 3300026142 Bacteria 5025
632 Ga0207698_10032606 3300026142 Bacteria 3776
633 Ga0207698_10042867 3300026142 Bacteria 3385
634 Ga0207698_10132459 3300026142 Bacteria 2133
635 Ga0209813_10006694 3300027866 Bacteria 2854
636 Ga0209974_10006485 3300027876 Bacteria 4083
637 Ga0268266_10000040 3300028379 Bacteria 323843
638 Ga0268266_10000200 3300028379 Bacteria 104456
639 Ga0268266_10035494 3300028379 Bacteria 4241
640 Ga0268266_10169509 3300028379 Bacteria 1981
641 Ga0268266_10246760 3300028379 Bacteria 1650
642 Ga0268265_10000026 3300028380 Bacteria 246653
643 Ga0268265_10000030 3300028380 Bacteria 228157
644 Ga0268265_10000176 3300028380 Bacteria 76619
645 Ga0268265_10000334 3300028380 Bacteria 51202
646 Ga0268265_10000808 3300028380 Bacteria 29755
647 Ga0268265_10068743 3300028380 Bacteria 2748
648 Ga0268265_10092209 3300028380 Bacteria 2424
649 Ga0268265_10142110 3300028380 Bacteria 2011
650 Ga0268264_10000003 3300028381 Bacteria 1141976
651 Ga0268264_10000214 3300028381 Bacteria 114177
652 Ga0268264_10000491 3300028381 Bacteria 52312
653 Ga0268264_10000548 3300028381 Bacteria 47198
654 Ga0268264_10008037 3300028381 Bacteria 8772
655 Ga0268264_10013846 3300028381 Bacteria 6633
656 Ga0268264_10056951 3300028381 Bacteria 3268
657 Ga0268264_10197413 3300028381 Bacteria 1838
658 Ga0307517_10025548 3300028786 Bacteria 7216
659 Ga0265330_10002833 3300031235 Bacteria 9286
660 Ga0265340_10000018 3300031247 Bacteria 90851
661 Ga0265340_10040091 3300031247 Bacteria 2307
662 Ga0265316_10005193 3300031344 Bacteria 12739
663 Ga0307513_10018836 3300031456 Bacteria 8237
664 Ga0307408_100004543 3300031548 Bacteria 9400
665 Ga0307408_100008196 3300031548 Bacteria 6903
666 Ga0307408_100039656 3300031548 Bacteria 3331
667 Ga0307408_100070852 3300031548 Bacteria 2575
668 Ga0307408_100133248 3300031548 Bacteria 1941
669 Ga0307408_100145470 3300031548 Bacteria 1865
670 Ga0307408_100209744 3300031548 Bacteria 1582
671 Ga0307408_100303929 3300031548 Bacteria 1337
672 Ga0265313_10055027 3300031595 Bacteria 1886
673 Ga0265342_10024398 3300031712 Bacteria 3817
674 Ga0307405_10000196 3300031731 Bacteria 22239
675 Ga0307405_10010011 3300031731 Bacteria 4889
676 Ga0307405_10020967 3300031731 Bacteria 3664
677 Ga0307405_10033892 3300031731 Bacteria 3034
678 Ga0307405_10127120 3300031731 Bacteria 1754
679 Ga0307405_10186398 3300031731 Bacteria 1494
680 Ga0307405_10305661 3300031731 Bacteria 1208
681 Ga0307413_10000695 3300031824 Bacteria 11515
682 Ga0307413_10006405 3300031824 Bacteria 5370
683 Ga0307413_10025856 3300031824 Bacteria 3226
684 Ga0307413_10031748 3300031824 Bacteria 2984
685 Ga0307413_10049490 3300031824 Bacteria 2519
686 Ga0307413_10076582 3300031824 Bacteria 2126
687 Ga0307413_10080372 3300031824 Bacteria 2087
688 Ga0307410_10000465 3300031852 Bacteria 16378
689 Ga0307410_10012804 3300031852 Bacteria 4868
690 Ga0307410_10014819 3300031852 Bacteria 4602
691 Ga0307410_10018653 3300031852 Bacteria 4197
692 Ga0307410_10020233 3300031852 Bacteria 4066
693 Ga0307410_10025056 3300031852 Bacteria 3736
694 Ga0307410_10027323 3300031852 Bacteria 3605
695 Ga0307410_10082987 3300031852 Bacteria 2255
696 Ga0307410_10087127 3300031852 Bacteria 2207
697 Ga0307410_10091953 3300031852 Bacteria 2155
698 Ga0307410_10092942 3300031852 Bacteria 2145
699 Ga0307410_10146797 3300031852 Bacteria 1751
700 Ga0307410_10149917 3300031852 Bacteria 1735
701 Ga0307410_10151460 3300031852 Bacteria 1727
702 Ga0307406_10003621 3300031901 Bacteria 8414
703 Ga0307406_10014836 3300031901 Bacteria 4491
704 Ga0307406_10025324 3300031901 Bacteria 3551
705 Ga0307406_10048602 3300031901 Bacteria 2681
706 Ga0307406_10050582 3300031901 Bacteria 2635
707 Ga0307406_10063689 3300031901 Bacteria 2389
708 Ga0307406_10077269 3300031901 Bacteria 2202
709 Ga0307406_10145119 3300031901 Bacteria 1685
710 Ga0307406_10170992 3300031901 Bacteria 1572
711 Ga0307406_10244896 3300031901 Bacteria 1347
712 Ga0307407_10006235 3300031903 Bacteria 5271
713 Ga0307407_10016129 3300031903 Bacteria 3712
714 Ga0307407_10034934 3300031903 Bacteria 2757
715 Ga0307407_10064472 3300031903 Bacteria 2153
716 Ga0307407_10086314 3300031903 Bacteria 1912
717 Ga0307412_10000104 3300031911 Bacteria 67823
718 Ga0307412_10007957 3300031911 Bacteria 6041
719 Ga0307412_10011087 3300031911 Bacteria 5211
720 Ga0307412_10042034 3300031911 Bacteria 2966
721 Ga0307412_10058277 3300031911 Bacteria 2582
722 Ga0307412_10074378 3300031911 Bacteria 2327
723 Ga0307412_10076904 3300031911 Bacteria 2294
724 Ga0307412_10080888 3300031911 Bacteria 2245
725 Ga0307412_10136904 3300031911 Bacteria 1788
726 Ga0307412_10142850 3300031911 Bacteria 1755
727 Ga0307409_100002678 3300031995 Bacteria 9377
728 Ga0307409_100005317 3300031995 Bacteria 7392
729 Ga0307409_100011157 3300031995 Bacteria 5643
730 Ga0307409_100045058 3300031995 Bacteria 3327
731 Ga0307409_100074227 3300031995 Bacteria 2717
732 Ga0307409_100080295 3300031995 Bacteria 2631
733 Ga0307409_100089477 3300031995 Bacteria 2517
734 Ga0307409_100118569 3300031995 Bacteria 2235
735 Ga0307409_100119967 3300031995 Bacteria 2225
736 Ga0307409_100318463 3300031995 Bacteria 1454
737 Ga0307416_100011423 3300032002 Bacteria 5922
738 Ga0307416_100022527 3300032002 Bacteria 4550
739 Ga0307416_100023804 3300032002 Bacteria 4454
740 Ga0307416_100025969 3300032002 Bacteria 4307
741 Ga0307416_100036396 3300032002 Bacteria 3774
742 Ga0307416_100076022 3300032002 Bacteria 2813
743 Ga0307416_100079397 3300032002 Bacteria 2765
744 Ga0307414_10000371 3300032004 Bacteria 24637
745 Ga0307414_10004392 3300032004 Bacteria 7655
746 Ga0307414_10004937 3300032004 Bacteria 7287
747 Ga0307414_10009432 3300032004 Bacteria 5607
748 Ga0307414_10011366 3300032004 Bacteria 5217
749 Ga0307414_10037398 3300032004 Bacteria 3250
750 Ga0307414_10041933 3300032004 Bacteria 3105
751 Ga0307414_10042294 3300032004 Bacteria 3094
752 Ga0307414_10055198 3300032004 Bacteria 2780
753 Ga0307414_10058269 3300032004 Bacteria 2720
754 Ga0307414_10078957 3300032004 Bacteria 2401
755 Ga0307414_10119758 3300032004 Bacteria 2021
756 Ga0307414_10135177 3300032004 Bacteria 1921
757 Ga0307414_10180923 3300032004 Bacteria 1695
758 Ga0307411_10001823 3300032005 Bacteria 9039
759 Ga0307411_10003306 3300032005 Bacteria 7453
760 Ga0307411_10009223 3300032005 Bacteria 5172
761 Ga0307411_10020964 3300032005 Bacteria 3813
762 Ga0307411_10024440 3300032005 Bacteria 3602
763 Ga0307411_10028219 3300032005 Bacteria 3409
764 Ga0307411_10039534 3300032005 Bacteria 2984
765 Ga0307411_10045853 3300032005 Bacteria 2814
766 Ga0307411_10107857 3300032005 Bacteria 1985
767 Ga0307411_10327735 3300032005 Bacteria 1239
768 Ga0307415_100002323 3300032126 Bacteria 9447
769 Ga0307415_100006910 3300032126 Bacteria 6162
770 Ga0307415_100016016 3300032126 Bacteria 4455
771 Ga0307415_100021970 3300032126 Bacteria 3931
772 Ga0307415_100048271 3300032126 Bacteria 2872
773 Ga0307415_100082652 3300032126 Bacteria 2298
774 Ga0307415_100132670 3300032126 Bacteria 1888
775 Ga0307415_100242397 3300032126 Bacteria 1459
776 Ga0307415_100332275 3300032126 Bacteria 1272
777 Ga0373930_0017365 3300034816 Bacteria 1371
778 Ga0373959_0004347 3300034820 Bacteria 2280
779 Ga0373940_0026616 3300035088 Bacteria 1514
780 Ga0373949_0011675 3300035090 Bacteria 1937
781 Ga0373932_0048726 3300035112 Bacteria 1249
782 Ga0373941_0008874 3300035115 Bacteria 2516
783 Ga0373956_0017500 3300035119 Bacteria 3023
784 Ga0373942_0011599 3300035207 Bacteria 2092
785 Ga0373961_0001549 3300035241 Bacteria 6599
786 Ga0373962_0001250 3300035242 Bacteria 5964
787 Ga0373931_0000143 3300035691 Bacteria 31467
788 Ga0373931_0006522 3300035691 Bacteria 5455
789 Ga0373931_0099584 3300035691 Bacteria 1633
790 Ga0373935_0219522 3300035692 Bacteria 1320
791 Ga0373927_0080693 3300035695 Bacteria 2108
792 Ga0395899_0000129 3300037312 Bacteria 118043
793 Ga0395899_0009175 3300037312 Bacteria 7595
794 Ga0395899_0027364 3300037312 Bacteria 4300
795 Ga0395899_0031414 3300037312 Bacteria 3991
796 Ga0395899_0062686 3300037312 Bacteria 2737
797 Ga0395899_0084827 3300037312 Bacteria 2302
798 Ga0395899_0090625 3300037312 Bacteria 2216
799 Ga0395899_0169837 3300037312 Bacteria 1536
800 Ga0395900_0002105 3300037418 Bacteria 22295
801 Ga0395900_0003168 3300037418 Bacteria 17835
802 Ga0395900_0004480 3300037418 Bacteria 14789
803 Ga0395900_0038265 3300037418 Bacteria 4944
804 Ga0395900_0045525 3300037418 Bacteria 4519
805 Ga0395900_0117775 3300037418 Bacteria 2725
806 Ga0395900_0141635 3300037418 Bacteria 2462
807 Ga0395900_0161135 3300037418 Bacteria 2288
808 Ga0395900_0168212 3300037418 Bacteria 2233
809 Ga0395900_0191910 3300037418 Bacteria 2071
810 Ga0395900_0205317 3300037418 Bacteria 1991
811 Ga0395900_0214746 3300037418 Bacteria 1941
812 Ga0395900_0232961 3300037418 Bacteria 1851
813 Ga0395898_0030471 3300037466 Bacteria 5398
814 Ga0395898_0055723 3300037466 Bacteria 3856
815 Ga0395898_0064148 3300037466 Bacteria 3563
816 Ga0395898_0067120 3300037466 Bacteria 3473
817 Ga0395898_0098687 3300037466 Bacteria 2804
818 Ga0395898_0162916 3300037466 Bacteria 2133
819 Ga0395898_0164232 3300037466 Bacteria 2124
820 Ga0395898_0180383 3300037466 Bacteria 2018
821 Ga0395898_0183234 3300037466 Bacteria 2001
822 Ga0395898_0241432 3300037466 Bacteria 1723
823 Ga0395898_0362930 3300037466 Bacteria 1381
824 Ga0395905_0000232 3300037471 Bacteria 84233
825 Ga0395905_0010696 3300037471 Bacteria 8898
826 Ga0395905_0020610 3300037471 Bacteria 6242
827 Ga0395905_0038255 3300037471 Bacteria 4501
828 Ga0395905_0056198 3300037471 Bacteria 3682
829 Ga0395905_0068245 3300037471 Bacteria 3331
830 Ga0395905_0091212 3300037471 Bacteria 2857
831 Ga0395905_0093123 3300037471 Bacteria 2826
832 Ga0395905_0136804 3300037471 Bacteria 2305
833 Ga0395905_0399462 3300037471 Bacteria 1269
834 Ga0436364_0411459 3300037853 Bacteria 10009
835 Ga0436364_0689048 3300037853 Bacteria 11902
836 Ga0395901_0000031 3300038443 Bacteria 241733
837 Ga0395901_0000131 3300038443 Bacteria 96504
838 Ga0395901_0011353 3300038443 Bacteria 9026
839 Ga0395901_0019979 3300038443 Bacteria 6854
840 Ga0395901_0058196 3300038443 Bacteria 4020
841 Ga0395901_0066872 3300038443 Bacteria 3743
842 Ga0395901_0070084 3300038443 Bacteria 3652
843 Ga0395901_0085045 3300038443 Bacteria 3306
844 Ga0395901_0094403 3300038443 Bacteria 3133
845 Ga0395901_0131281 3300038443 Bacteria 2632
846 Ga0395901_0530036 3300038443 Bacteria 1196
847 Ga0395901_0561501 3300038443 Bacteria 1156
848 Ga0237819_00270 3300038705 Bacteria 18995
849 Ga0400486_21858 3300038742 Bacteria 1879
850 Ga0400483_026085 3300039062 Bacteria 1747
851 Ga0436365_0083543 3300039437 Bacteria 85224
852 Ga0436365_0922968 3300039437 Bacteria 9993
853 Ga0436365_0935722 3300039437 Bacteria 2018
854 Ga0436365_1110654 3300039437 Bacteria 2490
855 Ga0436363_0310243 3300039450 Bacteria 3465
856 Ga0436363_0946284 3300039450 Bacteria 1473
857 Ga0436363_1058292 3300039450 Bacteria 2564
858 Ga0439445_0020665 3300042004 Bacteria 1649
859 Ga0439448_0001832 3300042005 Bacteria 5628
860 Ga0439448_0020533 3300042005 Bacteria 2044
861 Ga0439449_0002667 3300042007 Bacteria 6948
862 Ga0450917_003182 3300042120 Bacteria 1184
863 Ga0466969_0010778 3300044656 Bacteria 4842
864 Ga0466966_0000021 3300044684 Bacteria 116714
865 Ga0466966_0001996 3300044684 Bacteria 13224
866 Ga0466961_0008264 3300044693 Bacteria 6630
867 Ga0466961_0045825 3300044693 Bacteria 2797
868 Ga0466963_0016990 3300044694 Bacteria 4532
869 Ga0466963_0032406 3300044694 Bacteria 3384
870 Ga0453684_0038771 3300044712 Bacteria 6504
871 Ga0453684_0369532 3300044712 Bacteria 1613
872 Ga0466971_0000846 3300044719 Bacteria 12460
873 Ga0466957_0002162 3300044842 Bacteria 10524
874 Ga0466959_0006500 3300045049 Bacteria 8102
875 Ga0466959_0038377 3300045049 Bacteria 3539
876 Ga0451576_0000024 3300045051 Bacteria 470499
877 Ga0451576_0014154 3300045051 Bacteria 8889
878 Ga0451576_0068605 3300045051 Bacteria 3690
879 Ga0466958_0009405 3300045836 Bacteria 5446
880 Ga0466958_0074986 3300045836 Bacteria 2074
881 Ga0466958_0102598 3300045836 Bacteria 1780
882 Ga0495638_0000068 3300046460 Bacteria 167596
883 Ga0495638_0000207 3300046460 Bacteria 83805
884 Ga0495580_0226880 3300046472 Bacteria 1283
885 Ga0495585_0003769 3300046492 Bacteria 10119
886 Ga0495596_0044318 3300046500 Bacteria 1751
887 Ga0495607_0009022 3300046501 Bacteria 6780
888 Ga0495607_0056998 3300046501 Bacteria 2241
889 Ga0495583_0051417 3300046506 Bacteria 1879
890 Ga0495606_0000470 3300046507 Bacteria 66278
891 Ga0495616_0000010 3300046513 Bacteria 224378
892 Ga0495616_0011390 3300046513 Bacteria 5100
893 Ga0495616_0039134 3300046513 Bacteria 2430
894 Ga0495648_0059764 3300046524 Bacteria 2272
895 Ga0495663_0001729 3300046525 Bacteria 6781
896 Ga0495621_0000875 3300046539 Bacteria 7690
897 Ga0495633_0015032 3300046558 Bacteria 4024
898 Ga0495668_0008332 3300046616 Bacteria 6490
899 Ga0495669_0001501 3300046684 Bacteria 9626
900 Ga0495669_0002438 3300046684 Bacteria 7603
901 Ga0495670_0002065 3300046691 Bacteria 9907
902 Ga0495687_000517 3300047443 Bacteria 46300
903 Ga0495686_0000273 3300047472 Bacteria 91936
904 Ga0495686_0000916 3300047472 Bacteria 36998
905 Ga0495686_0006459 3300047472 Bacteria 8969
906 Ga0495686_0017144 3300047472 Bacteria 4889
907 Ga0495615_0000114 3300048090 Bacteria 20560
908 Ga0496100_0043927 3300048903 Bacteria 2860
909 Ga0496100_0142523 3300048903 Bacteria 1700
910 Ga0496101_0065998 3300048904 Bacteria 2639
911 Ga0496102_0000049 3300048905 Bacteria 179480
912 Ga0496102_0012793 3300048905 Bacteria 7264
913 Ga0496102_0030551 3300048905 Bacteria 4823
914 Ga0496102_0038529 3300048905 Bacteria 4314
915 Ga0496102_0110297 3300048905 Bacteria 2565
916 Ga0496102_0157832 3300048905 Bacteria 2133
917 Ga0496103_0000037 3300048906 Bacteria 179474
918 Ga0496103_0001324 3300048906 Bacteria 16800
919 Ga0496104_0052893 3300048907 Bacteria 3836
920 Ga0496104_0264349 3300048907 Bacteria 1633
921 Ga0496105_0000224 3300048908 Bacteria 38048
922 Ga0496105_0045068 3300048908 Bacteria 3639
923 Ga0496106_0015255 3300048909 Bacteria 5685
924 Ga0496106_0263598 3300048909 Bacteria 1379
925 Ga0496107_0051593 3300048910 Bacteria 2967
926 Ga0496108_0121555 3300048911 Bacteria 2240
927 Ga0496109_0018512 3300048912 Bacteria 6117
928 Ga0496109_0063831 3300048912 Bacteria 3369
929 Ga0496109_0247692 3300048912 Bacteria 1678
930 Ga0496110_0005561 3300048913 Bacteria 9892
931 Ga0496110_0029322 3300048913 Bacteria 4734
932 Ga0496111_0011559 3300048914 Bacteria 5954
933 Ga0496111_0032922 3300048914 Bacteria 3696
934 Ga0496111_0084793 3300048914 Bacteria 2316
935 Ga0496112_0138104 3300048915 Bacteria 2407
936 Ga0496112_0185924 3300048915 Bacteria 2041
937 Ga0496114_0065139 3300048917 Bacteria 3053
938 Ga0496115_0000325 3300048918 Bacteria 40655
939 Ga0496115_0165412 3300048918 Bacteria 1829
940 Ga0496116_0000664 3300048919 Bacteria 44805
941 Ga0496116_0012690 3300048919 Bacteria 6856
942 Ga0496117_0000115 3300048920 Bacteria 179488
943 Ga0496118_0000086 3300048921 Bacteria 179488
944 Ga0496118_0001765 3300048921 Bacteria 31299
945 Ga0496118_0053610 3300048921 Bacteria 3063
946 Ga0496120_0037633 3300048923 Bacteria 2869
947 Ga0496120_0086404 3300048923 Bacteria 1686
948 Ga0496121_0000017 3300048924 Bacteria 546415
949 Ga0496121_0009718 3300048924 Bacteria 11005
950 Ga0496121_0012133 3300048924 Bacteria 9459
951 Ga0496122_0010014 3300048925 Bacteria 9863
952 Ga0496122_0011314 3300048925 Bacteria 9058
953 Ga0496122_0012455 3300048925 Bacteria 8464
954 Ga0496123_0002815 3300048926 Bacteria 20643
955 Ga0496123_0010116 3300048926 Bacteria 8386
956 Ga0496124_0000102 3300048927 Bacteria 179488
957 Ga0496124_0002035 3300048927 Bacteria 27471
958 Ga0496124_0006985 3300048927 Bacteria 12109
959 Ga0496124_0019874 3300048927 Bacteria 6231
960 Ga0496125_0024159 3300048928 Bacteria 5593
961 Ga0496125_0104914 3300048928 Bacteria 2068
962 Ga0496126_0174418 3300048929 Bacteria 1830
963 Ga0501290_000064 3300049513 Bacteria 14897
964 Ga0501292_000022 3300049515 Bacteria 47432
965 Ga0501294_002490 3300049517 Bacteria 1743
966 Ga0501032_0013776 3300049569 Bacteria 5737
967 Ga0501034_0000068 3300049571 Bacteria 182904
968 Ga0501034_0006843 3300049571 Bacteria 12198
969 Ga0501037_0008627 3300049573 Bacteria 7473
970 Ga0501038_0080357 3300049574 Bacteria 2748
971 Ga0501039_0000205 3300049575 Bacteria 43025
972 Ga0501043_0074585 3300049579 Bacteria 2665
973 Ga0501046_0000058 3300049580 Bacteria 127462
974 Ga0501046_0007334 3300049580 Bacteria 9701
975 Ga0501046_0030319 3300049580 Bacteria 4390
976 Ga0501047_0000152 3300049581 Bacteria 84703
977 Ga0501047_0088462 3300049581 Bacteria 2974
978 Ga0501047_0138116 3300049581 Bacteria 2317
979 Ga0501048_0002175 3300049582 Bacteria 14919
980 Ga0501067_0018422 3300049583 Bacteria 3868
981 Ga0501067_0020300 3300049583 Bacteria 3677
982 Ga0501069_0011632 3300049585 Bacteria 4666
983 Ga0501070_0035400 3300049586 Bacteria 4172
984 Ga0501206_001253 3300049653 Bacteria 3180
985 Ga0501222_000369 3300049662 Bacteria 6926
986 Ga0501223_000171 3300049663 Bacteria 16960
987 Ga0501224_000028 3300049664 Bacteria 53596
988 Ga0501224_003103 3300049664 Bacteria 2301
989 Ga0501233_000230 3300049668 Bacteria 8380
990 Ga0501235_000282 3300049669 Bacteria 9520
991 Ga0501235_005237 3300049669 Bacteria 2821
992 Ga0501249_000063 3300049679 Bacteria 38978
993 Ga0501261_000144 3300049690 Bacteria 10348
994 Ga0501225_0000317 3300049705 Bacteria 15084
995 Ga0501225_0010379 3300049705 Bacteria 2638
996 Ga0501225_0010787 3300049705 Bacteria 2581
997 Ga0501080_0000001 3300049742 Bacteria 241365
998 Ga0501279_000012 3300049775 Bacteria 80359
999 Ga0501280_000005 3300049776 Bacteria 85174
1000 Ga0501281_00328 3300049777 Bacteria 4877
1001 Ga0501282_000707 3300049778 Bacteria 3828
1002 Ga0501035_0000015 3300049822 Bacteria 246493
1003 Ga0501035_0091158 3300049822 Bacteria 2683
1004 Ga0501035_0273131 3300049822 Bacteria 1430
1005 Ga0501044_0000390 3300049823 Bacteria 54419
1006 Ga0501044_0000572 3300049823 Bacteria 44721
1007 Ga0501044_0027379 3300049823 Bacteria 6026
1008 Ga0501045_0079987 3300049824 Bacteria 2410
1009 Ga0501045_0142665 3300049824 Bacteria 1781
1010 Ga0501226_000115 3300049853 Bacteria 17816
1011 nmdc:mga03683_11464_c1 3300050489 Bacteria 1718
1012 nmdc:mga0yw44_19458_c1 3300050492 Bacteria 3745
1013 nmdc:mga06z11_3726_c1 3300050494 Bacteria 5921
1014 nmdc:mga06z11_38986_c1 3300050494 Bacteria 2363
1015 nmdc:mga05p37_125491_c1 3300050507 Bacteria 3152
1016 nmdc:mga05p37_507715_c1 3300050507 Bacteria 1382
1017 nmdc:mga09592_112735_c1 3300050508 Bacteria 2333
1018 nmdc:mga09592_84040_c1 3300050508 Bacteria 2714
1019 nmdc:mga0qj67_347153_c1 3300050509 Bacteria 1200
1020 nmdc:mga0qj67_69878_c1 3300050509 Bacteria 2801
1021 nmdc:mga06r32_1441_c1 3300050510 Bacteria 21480
1022 nmdc:mga06r32_56755_c1 3300050510 Bacteria 3759
1023 nmdc:mga06r32_8364_c1 3300050510 Bacteria 9317
1024 nmdc:mga06r32_94296_c1 3300050510 Bacteria 2929
1025 nmdc:mga08y16_117003_c1 3300050511 Bacteria 2775
1026 nmdc:mga0n895_2524_c1 3300050512 Bacteria 14345
1027 nmdc:mga0n895_6781_c1 3300050512 Bacteria 9771
1028 nmdc:mga0rr50_47105_c1 3300050513 Bacteria 3178
1029 Ga0500643_000134 3300053087 Bacteria 75321
1030 Ga0500643_000235 3300053087 Bacteria 51395
1031 Ga0500643_005223 3300053087 Bacteria 5649
1032 Ga0500651_0008965 3300053093 Bacteria 5918
1033 Ga0500566_0000436 3300053094 Bacteria 23297
1034 Ga0500641_0006777 3300053096 Bacteria 4075
1035 Ga0500641_0051800 3300053096 Bacteria 1690
1036 Ga0500556_0001468 3300053104 Bacteria 9867
1037 Ga0500562_012400 3300053108 Bacteria 2168
1038 Ga0500592_000314 3300053116 Bacteria 8300
1039 Ga0500595_014502 3300053119 Bacteria 2989
1040 Ga0500655_000244 3300053133 Bacteria 12709
1041 Ga0500658_0055351 3300053134 Bacteria 1633
1042 Ga0500573_0000010 3300053140 Bacteria 210704
1043 Ga0500573_0114034 3300053140 Bacteria 1510
1044 Ga0500577_0107520 3300053142 Bacteria 1147
1045 Ga0500590_000141 3300053148 Bacteria 20020
1046 Ga0500616_0005539 3300053153 Bacteria 8555
1047 Ga0500616_0007417 3300053153 Bacteria 6978
1048 Ga0500622_0028152 3300053156 Bacteria 2959
1049 Ga0500624_000003 3300053157 Bacteria 253364
1050 Ga0500637_0000024 3300053178 Bacteria 59926
1051 Ga0500570_003712 3300053724 Bacteria 7919
1052 Ga0501084_0182434 3300054114 Bacteria 1772
1053 Ga0501082_0022902 3300060353 Bacteria 5382
1054 Ga0466962_0002938 3300061719 Bacteria 8127
1055 Ga0530510_0136306 3300061734 Bacteria 1807

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0946284 Ga0436363_0946284_547_1461 292
2 3300048912 Ga0496109_0247692 Ga0496109_0247692_715_1653 298
3 3300025923 Ga0207681_10117248 Ga0207681_101172482 305
4 3300034816 Ga0373930_0017365 Ga0373930_0017365_124_1197 305
5 3300034820 Ga0373959_0004347 Ga0373959_0004347_549_1622 305
6 3300035090 Ga0373949_0011675 Ga0373949_0011675_27_1100 305
7 3300035115 Ga0373941_0008874 Ga0373941_0008874_743_1816 305
8 3300035691 Ga0373931_0000143 Ga0373931_0000143_9862_10935 305
9 3300006852 Ga0075433_10005933 Ga0075433_100059332 308
10 3300006871 Ga0075434_100006345 Ga0075434_1000063453 308
11 3300009094 Ga0111539_10114699 Ga0111539_101146992 308
12 3300050512 nmdc:mga0n895_2524_c1 nmdc:mga0n895_2524_c1_6199_7272 308
13 3300053142 Ga0500577_0107520 Ga0500577_0107520_187_1128 311
14 3300038443 Ga0395901_0530036 Ga0395901_0530036_31_975 313
15 3300048914 Ga0496111_0011559 Ga0496111_0011559_2494_3570 315
16 3300048925 Ga0496122_0010014 Ga0496122_0010014_2484_3560 315
17 3300048927 Ga0496124_0002035 Ga0496124_0002035_25112_26188 315
18 3300053156 Ga0500622_0028152 Ga0500622_0028152_1990_2940 315
19 3300005341 Ga0070691_10004772 Ga0070691_100047726 318
20 3300005347 Ga0070668_100221644 Ga0070668_1002216442 318
21 3300005545 Ga0070695_100002848 Ga0070695_1000028486 318
22 3300005719 Ga0068861_100007263 Ga0068861_1000072633 318
23 3300025972 Ga0207668_10146770 Ga0207668_101467702 318
24 3300026118 Ga0207675_100032035 Ga0207675_1000320352 318
25 3300053108 Ga0500562_012400 Ga0500562_012400_668_1750 318
26 3300031852 Ga0307410_10082987 Ga0307410_100829872 323
27 3300032004 Ga0307414_10037398 Ga0307414_100373982 323
28 3300032005 Ga0307411_10045853 Ga0307411_100458531 323
29 3300037471 Ga0395905_0093123 Ga0395905_0093123_1416_2492 323
30 3300031548 Ga0307408_100070852 Ga0307408_1000708522 325
31 3300031731 Ga0307405_10127120 Ga0307405_101271202 325
32 3300031852 Ga0307410_10012804 Ga0307410_100128044 325
33 3300031901 Ga0307406_10025324 Ga0307406_100253242 325
34 3300031903 Ga0307407_10064472 Ga0307407_100644722 325
35 3300031995 Ga0307409_100005317 Ga0307409_1000053172 325
36 3300032002 Ga0307416_100025969 Ga0307416_1000259694 325
37 3300032004 Ga0307414_10055198 Ga0307414_100551982 325
38 3300032005 Ga0307411_10009223 Ga0307411_100092232 325
39 3300032126 Ga0307415_100006910 Ga0307415_1000069105 325
40 3300005353 Ga0070669_100064293 Ga0070669_1000642932 326
41 3300009148 Ga0105243_10081629 Ga0105243_100816292 326
42 3300025972 Ga0207668_10069875 Ga0207668_100698752 326
43 3300031824 Ga0307413_10031748 Ga0307413_100317483 326
44 3300031852 Ga0307410_10018653 Ga0307410_100186532 326
45 3300031901 Ga0307406_10014836 Ga0307406_100148362 326
46 3300031901 Ga0307406_10077269 Ga0307406_100772692 326
47 3300031903 Ga0307407_10034934 Ga0307407_100349343 326
48 3300031995 Ga0307409_100080295 Ga0307409_1000802952 326
49 3300032004 Ga0307414_10119758 Ga0307414_101197582 326
50 3300032005 Ga0307411_10039534 Ga0307411_100395343 326
51 3300049585 Ga0501069_0011632 Ga0501069_0011632_1341_2423 326
52 3300005548 Ga0070665_100001540 Ga0070665_10000154024 327
53 3300009545 Ga0105237_10024781 Ga0105237_100247813 327
54 3300028379 Ga0268266_10000200 Ga0268266_1000020029 327
55 3300032126 Ga0307415_100242397 Ga0307415_1002423971 327
56 3300035691 Ga0373931_0099584 Ga0373931_0099584_429_1541 327
57 3300037471 Ga0395905_0399462 Ga0395905_0399462_35_1096 327
58 3300001904 JGI24736J21556_1004342 JGI24736J21556_10043422 328
59 3300001979 JGI24740J21852_10046622 JGI24740J21852_100466221 328
60 3300001989 JGI24739J22299_10000237 JGI24739J22299_1000023710 328
61 3300001990 JGI24737J22298_10000061 JGI24737J22298_1000006131 328
62 3300001990 JGI24737J22298_10014465 JGI24737J22298_100144653 328
63 3300002075 JGI24738J21930_10000766 JGI24738J21930_100007664 328
64 3300002076 JGI24749J21850_1009649 JGI24749J21850_10096491 328
65 3300002126 JGI24035J26624_1001486 JGI24035J26624_10014862 328
66 3300005328 Ga0070676_10003382 Ga0070676_1000338210 328
67 3300005328 Ga0070676_10009609 Ga0070676_100096092 328
68 3300005331 Ga0070670_100020267 Ga0070670_1000202672 328
69 3300005331 Ga0070670_100122039 Ga0070670_1001220392 328
70 3300005334 Ga0068869_100000493 Ga0068869_10000049318 328
71 3300005334 Ga0068869_100028462 Ga0068869_1000284623 328
72 3300005338 Ga0068868_100022988 Ga0068868_1000229881 328
73 3300005339 Ga0070660_100086867 Ga0070660_1000868672 328
74 3300005353 Ga0070669_100000532 Ga0070669_1000005322 328
75 3300005364 Ga0070673_100000058 Ga0070673_10000005829 328
76 3300005366 Ga0070659_100006101 Ga0070659_1000061012 328
77 3300005367 Ga0070667_100004233 Ga0070667_1000042332 328
78 3300005459 Ga0068867_100001818 Ga0068867_10000181814 328
79 3300005459 Ga0068867_100090015 Ga0068867_1000900152 328
80 3300005539 Ga0068853_100000783 Ga0068853_10000078320 328
81 3300005543 Ga0070672_100000716 Ga0070672_10000071615 328
82 3300005563 Ga0068855_100001416 Ga0068855_10000141629 328
83 3300005564 Ga0070664_100130374 Ga0070664_1001303742 328
84 3300005577 Ga0068857_100004724 Ga0068857_1000047244 328
85 3300005578 Ga0068854_100001025 Ga0068854_10000102513 328
86 3300005616 Ga0068852_100059481 Ga0068852_1000594815 328
87 3300005617 Ga0068859_100007966 Ga0068859_10000796613 328
88 3300005618 Ga0068864_100000235 Ga0068864_10000023535 328
89 3300005618 Ga0068864_100159474 Ga0068864_1001594742 328
90 3300005841 Ga0068863_100002289 Ga0068863_10000228910 328
91 3300005842 Ga0068858_100000514 Ga0068858_10000051435 328
92 3300005844 Ga0068862_100182504 Ga0068862_1001825042 328
93 3300006358 Ga0068871_100053035 Ga0068871_1000530352 328
94 3300006881 Ga0068865_100012549 Ga0068865_1000125492 328
95 3300006931 Ga0097620_100007966 Ga0097620_1000079662 328
96 3300009098 Ga0105245_10000170 Ga0105245_1000017033 328
97 3300009098 Ga0105245_10182092 Ga0105245_101820921 328
98 3300009148 Ga0105243_10207048 Ga0105243_102070482 328
99 3300009177 Ga0105248_10004489 Ga0105248_1000448914 328
100 3300011119 Ga0105246_10034472 Ga0105246_100344725 328
101 3300013102 Ga0157371_10000443 Ga0157371_1000044330 328
102 3300013297 Ga0157378_10000312 Ga0157378_1000031243 328
103 3300013297 Ga0157378_10093283 Ga0157378_100932832 328
104 3300013307 Ga0157372_10403546 Ga0157372_104035462 328
105 3300013308 Ga0157375_10389614 Ga0157375_103896141 328
106 3300025315 Ga0207697_10000063 Ga0207697_100000638 328
107 3300025315 Ga0207697_10028821 Ga0207697_100288212 328
108 3300025901 Ga0207688_10000106 Ga0207688_1000010620 328
109 3300025904 Ga0207647_10000246 Ga0207647_1000024631 328
110 3300025907 Ga0207645_10010447 Ga0207645_100104472 328
111 3300025908 Ga0207643_10033521 Ga0207643_100335215 328
112 3300025919 Ga0207657_10002106 Ga0207657_100021068 328
113 3300025920 Ga0207649_10046858 Ga0207649_100468582 328
114 3300025923 Ga0207681_10066779 Ga0207681_100667792 328
115 3300025925 Ga0207650_10010656 Ga0207650_100106563 328
116 3300025932 Ga0207690_10005149 Ga0207690_100051492 328
117 3300025933 Ga0207706_10000224 Ga0207706_1000022447 328
118 3300025937 Ga0207669_10009446 Ga0207669_100094462 328
119 3300025940 Ga0207691_10000750 Ga0207691_1000075018 328
120 3300025942 Ga0207689_10000051 Ga0207689_1000005155 328
121 3300025945 Ga0207679_10008122 Ga0207679_100081224 328
122 3300025945 Ga0207679_10095984 Ga0207679_100959842 328
123 3300025949 Ga0207667_10006507 Ga0207667_100065076 328
124 3300025960 Ga0207651_10000232 Ga0207651_100002329 328
125 3300025960 Ga0207651_10218034 Ga0207651_102180342 328
126 3300025981 Ga0207640_10003179 Ga0207640_1000317910 328
127 3300026035 Ga0207703_10003246 Ga0207703_100032469 328
128 3300026041 Ga0207639_10002776 Ga0207639_1000277614 328
129 3300026067 Ga0207678_10091269 Ga0207678_100912692 328
130 3300026088 Ga0207641_10007289 Ga0207641_100072899 328
131 3300026088 Ga0207641_10371123 Ga0207641_103711232 328
132 3300026089 Ga0207648_10000221 Ga0207648_1000022155 328
133 3300026089 Ga0207648_10022651 Ga0207648_100226516 328
134 3300026095 Ga0207676_10066411 Ga0207676_100664112 328
135 3300026116 Ga0207674_10002274 Ga0207674_1000227418 328
136 3300026142 Ga0207698_10002929 Ga0207698_100029294 328
137 3300028380 Ga0268265_10092209 Ga0268265_100922092 328
138 3300028381 Ga0268264_10013846 Ga0268264_100138462 328
139 3300042005 Ga0439448_0020533 Ga0439448_0020533_945_2021 328
140 3300048915 Ga0496112_0185924 Ga0496112_0185924_641_1708 328
141 3300049581 Ga0501047_0138116 Ga0501047_0138116_390_1466 328
142 3300009094 Ga0111539_10323458 Ga0111539_103234582 329
143 3300025928 Ga0207700_10028022 Ga0207700_100280223 329
144 3300031731 Ga0307405_10033892 Ga0307405_100338923 329
145 3300031824 Ga0307413_10000695 Ga0307413_100006956 329
146 3300031852 Ga0307410_10025056 Ga0307410_100250563 329
147 3300031852 Ga0307410_10027323 Ga0307410_100273232 329
148 3300032002 Ga0307416_100011423 Ga0307416_1000114232 329
149 3300032004 Ga0307414_10058269 Ga0307414_100582693 329
150 3300032005 Ga0307411_10020964 Ga0307411_100209643 329
151 3300032126 Ga0307415_100002323 Ga0307415_1000023231 329
152 3300032126 Ga0307415_100048271 Ga0307415_1000482712 329
153 3300050489 nmdc:mga03683_11464_c1 nmdc:mga03683_11464_c1_221_1282 329
154 3300005457 Ga0070662_100013733 Ga0070662_1000137332 330
155 3300005546 Ga0070696_100003697 Ga0070696_1000036977 330
156 3300005578 Ga0068854_100021404 Ga0068854_1000214042 330
157 3300005937 Ga0081455_10000029 Ga0081455_10000029121 330
158 3300009094 Ga0111539_10223978 Ga0111539_102239782 330
159 3300031548 Ga0307408_100133248 Ga0307408_1001332482 330
160 3300031824 Ga0307413_10076582 Ga0307413_100765822 330
161 3300031901 Ga0307406_10170992 Ga0307406_101709921 330
162 3300032005 Ga0307411_10327735 Ga0307411_103277351 330
163 3300044712 Ga0453684_0038771 Ga0453684_0038771_5119_6195 330
164 3300048905 Ga0496102_0000049 Ga0496102_0000049_139080_140156 330
165 3300048906 Ga0496103_0000037 Ga0496103_0000037_39319_40395 330
166 3300048919 Ga0496116_0000664 Ga0496116_0000664_39020_40096 330
167 3300048920 Ga0496117_0000115 Ga0496117_0000115_139080_140156 330
168 3300048921 Ga0496118_0000086 Ga0496118_0000086_39333_40409 330
169 3300048921 Ga0496118_0053610 Ga0496118_0053610_1149_2168 330
170 3300048923 Ga0496120_0086404 Ga0496120_0086404_215_1291 330
171 3300048924 Ga0496121_0012133 Ga0496121_0012133_3362_4381 330
172 3300048925 Ga0496122_0011314 Ga0496122_0011314_5709_6728 330
173 3300048927 Ga0496124_0000102 Ga0496124_0000102_39333_40409 330
174 3300005339 Ga0070660_100000511 Ga0070660_10000051124 331
175 3300005366 Ga0070659_100000005 Ga0070659_100000005159 331
176 3300005539 Ga0068853_100005580 Ga0068853_10000558010 331
177 3300005614 Ga0068856_100105955 Ga0068856_1001059552 331
178 3300005616 Ga0068852_100002771 Ga0068852_1000027712 331
179 3300009551 Ga0105238_10019570 Ga0105238_100195706 331
180 3300013100 Ga0157373_10248426 Ga0157373_102484261 331
181 3300013104 Ga0157370_10125144 Ga0157370_101251442 331
182 3300013105 Ga0157369_10014002 Ga0157369_100140029 331
183 3300013307 Ga0157372_10208642 Ga0157372_102086422 331
184 3300025909 Ga0207705_10017324 Ga0207705_100173242 331
185 3300025914 Ga0207671_10014386 Ga0207671_100143863 331
186 3300025932 Ga0207690_10000002 Ga0207690_10000002804 331
187 3300026023 Ga0207677_10000100 Ga0207677_100001005 331
188 3300026041 Ga0207639_10030466 Ga0207639_100304662 331
189 3300026078 Ga0207702_10073246 Ga0207702_100732462 331
190 3300026116 Ga0207674_10132360 Ga0207674_101323602 331
191 3300026142 Ga0207698_10032606 Ga0207698_100326061 331
192 3300037418 Ga0395900_0232961 Ga0395900_0232961_786_1841 331
193 3300042005 Ga0439448_0001832 Ga0439448_0001832_1081_2190 331
194 3300050507 nmdc:mga05p37_125491_c1 nmdc:mga05p37_125491_c1_1854_2927 331
195 3300001979 JGI24740J21852_10000820 JGI24740J21852_100008206 332
196 3300005329 Ga0070683_100006609 Ga0070683_10000660910 332
197 3300005336 Ga0070680_100000105 Ga0070680_1000001057 332
198 3300005455 Ga0070663_100002096 Ga0070663_1000020965 332
199 3300005457 Ga0070662_100084612 Ga0070662_1000846121 332
200 3300005530 Ga0070679_100000125 Ga0070679_10000012556 332
201 3300005577 Ga0068857_100108161 Ga0068857_1001081611 332
202 3300005578 Ga0068854_100103485 Ga0068854_1001034852 332
203 3300005614 Ga0068856_100001220 Ga0068856_10000122030 332
204 3300005616 Ga0068852_100110699 Ga0068852_1001106992 332
205 3300013104 Ga0157370_10010104 Ga0157370_100101043 332
206 3300025904 Ga0207647_10020217 Ga0207647_100202172 332
207 3300025909 Ga0207705_10000067 Ga0207705_1000006713 332
208 3300025909 Ga0207705_10188112 Ga0207705_101881121 332
209 3300025917 Ga0207660_10000379 Ga0207660_1000037930 332
210 3300025921 Ga0207652_10000058 Ga0207652_1000005855 332
211 3300025944 Ga0207661_10014353 Ga0207661_100143532 332
212 3300025949 Ga0207667_10000828 Ga0207667_1000082813 332
213 3300026041 Ga0207639_10065494 Ga0207639_100654942 332
214 3300026067 Ga0207678_10002816 Ga0207678_100028169 332
215 3300026078 Ga0207702_10001153 Ga0207702_100011533 332
216 3300026116 Ga0207674_10155587 Ga0207674_101555872 332
217 3300026142 Ga0207698_10132459 Ga0207698_101324592 332
218 3300031903 Ga0307407_10086314 Ga0307407_100863142 332
219 3300035088 Ga0373940_0026616 Ga0373940_0026616_179_1252 332
220 3300035112 Ga0373932_0048726 Ga0373932_0048726_143_1216 332
221 3300035207 Ga0373942_0011599 Ga0373942_0011599_409_1482 332
222 3300035241 Ga0373961_0001549 Ga0373961_0001549_1500_2573 332
223 3300035242 Ga0373962_0001250 Ga0373962_0001250_4035_5108 332
224 3300035691 Ga0373931_0006522 Ga0373931_0006522_2690_3763 332
225 3300061734 Ga0530510_0136306 Ga0530510_0136306_305_1378 332
226 3300005354 Ga0070675_100095684 Ga0070675_1000956842 333
227 3300005364 Ga0070673_100132181 Ga0070673_1001321812 333
228 3300025919 Ga0207657_10028113 Ga0207657_100281132 333
229 3300026067 Ga0207678_10037617 Ga0207678_100376174 333
230 3300031548 Ga0307408_100039656 Ga0307408_1000396562 333
231 3300032004 Ga0307414_10009432 Ga0307414_100094324 333
232 3300032005 Ga0307411_10024440 Ga0307411_100244401 333
233 3300037312 Ga0395899_0062686 Ga0395899_0062686_164_1231 333
234 3300037466 Ga0395898_0098687 Ga0395898_0098687_231_1298 333
235 3300037471 Ga0395905_0056198 Ga0395905_0056198_1109_2176 333
236 3300038443 Ga0395901_0011353 Ga0395901_0011353_1441_2508 333
237 3300005353 Ga0070669_100187623 Ga0070669_1001876232 334
238 3300005364 Ga0070673_100084491 Ga0070673_1000844912 334
239 3300005367 Ga0070667_100013033 Ga0070667_1000130336 334
240 3300005457 Ga0070662_100002227 Ga0070662_1000022277 334
241 3300005564 Ga0070664_100110229 Ga0070664_1001102293 334
242 3300005577 Ga0068857_100114134 Ga0068857_1001141343 334
243 3300005617 Ga0068859_100000136 Ga0068859_10000013669 334
244 3300005618 Ga0068864_100000711 Ga0068864_10000071125 334
245 3300005841 Ga0068863_100000140 Ga0068863_10000014071 334
246 3300005841 Ga0068863_100029062 Ga0068863_1000290626 334
247 3300005842 Ga0068858_100000695 Ga0068858_1000006958 334
248 3300006844 Ga0075428_100119007 Ga0075428_1001190072 334
249 3300006846 Ga0075430_100039288 Ga0075430_1000392883 334
250 3300006931 Ga0097620_100000136 Ga0097620_10000013669 334
251 3300009177 Ga0105248_10000184 Ga0105248_1000018450 334
252 3300009553 Ga0105249_10019397 Ga0105249_100193973 334
253 3300013306 Ga0163162_10050805 Ga0163162_100508052 334
254 3300014325 Ga0163163_10000131 Ga0163163_1000013142 334
255 3300014968 Ga0157379_10011780 Ga0157379_100117802 334
256 3300025921 Ga0207652_10239491 Ga0207652_102394912 334
257 3300025933 Ga0207706_10005974 Ga0207706_100059748 334
258 3300025941 Ga0207711_10000105 Ga0207711_1000010563 334
259 3300025942 Ga0207689_10093018 Ga0207689_100930182 334
260 3300025961 Ga0207712_10014190 Ga0207712_100141905 334
261 3300025986 Ga0207658_10001956 Ga0207658_1000195613 334
262 3300026035 Ga0207703_10002288 Ga0207703_100022888 334
263 3300026067 Ga0207678_10019305 Ga0207678_100193056 334
264 3300026088 Ga0207641_10000172 Ga0207641_1000017232 334
265 3300026095 Ga0207676_10000300 Ga0207676_1000030030 334
266 3300026095 Ga0207676_10032624 Ga0207676_100326242 334
267 3300026116 Ga0207674_10026673 Ga0207674_100266731 334
268 3300028381 Ga0268264_10008037 Ga0268264_100080376 334
269 3300031852 Ga0307410_10087127 Ga0307410_100871272 334
270 3300031995 Ga0307409_100045058 Ga0307409_1000450582 334
271 3300031995 Ga0307409_100318463 Ga0307409_1003184631 334
272 3300037312 Ga0395899_0031414 Ga0395899_0031414_2402_3463 334
273 3300037418 Ga0395900_0205317 Ga0395900_0205317_643_1704 334
274 3300037466 Ga0395898_0055723 Ga0395898_0055723_691_1752 334
275 3300037471 Ga0395905_0020610 Ga0395905_0020610_336_1397 334
276 3300038443 Ga0395901_0085045 Ga0395901_0085045_1837_2898 334
277 3300050509 nmdc:mga0qj67_69878_c1 nmdc:mga0qj67_69878_c1_1362_2447 334
278 3300050510 nmdc:mga06r32_94296_c1 nmdc:mga06r32_94296_c1_880_1965 334
279 3300005366 Ga0070659_100113372 Ga0070659_1001133722 335
280 3300005577 Ga0068857_100150099 Ga0068857_1001500992 335
281 3300013296 Ga0157374_10008229 Ga0157374_100082296 335
282 3300025932 Ga0207690_10072352 Ga0207690_100723522 335
283 3300026078 Ga0207702_10430719 Ga0207702_104307192 335
284 3300026116 Ga0207674_10162057 Ga0207674_101620572 335
285 3300045051 Ga0451576_0000024 Ga0451576_0000024_320408_321508 335
286 3300046524 Ga0495648_0059764 Ga0495648_0059764_640_1722 335
287 3300005578 Ga0068854_100012217 Ga0068854_1000122175 336
288 3300031852 Ga0307410_10151460 Ga0307410_101514602 336
289 3300031901 Ga0307406_10003621 Ga0307406_100036216 336
290 3300031901 Ga0307406_10244896 Ga0307406_102448961 336
291 3300031911 Ga0307412_10000104 Ga0307412_1000010416 336
292 3300031911 Ga0307412_10058277 Ga0307412_100582772 336
293 3300031995 Ga0307409_100118569 Ga0307409_1001185692 336
294 3300032002 Ga0307416_100022527 Ga0307416_1000225273 336
295 3300032126 Ga0307415_100132670 Ga0307415_1001326701 336
296 3300037312 Ga0395899_0027364 Ga0395899_0027364_2466_3527 336
297 3300037418 Ga0395900_0003168 Ga0395900_0003168_11220_12281 336
298 3300038443 Ga0395901_0000131 Ga0395901_0000131_19862_20923 336
299 3300045049 Ga0466959_0038377 Ga0466959_0038377_659_1732 336
300 3300045836 Ga0466958_0074986 Ga0466958_0074986_111_1184 336
301 3300048923 Ga0496120_0037633 Ga0496120_0037633_1166_2257 336
302 3300005290 Ga0065712_10157228 Ga0065712_101572282 337
303 3300005331 Ga0070670_100171019 Ga0070670_1001710192 337
304 3300005333 Ga0070677_10010369 Ga0070677_100103693 337
305 3300005564 Ga0070664_100084855 Ga0070664_1000848552 337
306 3300005719 Ga0068861_100000004 Ga0068861_10000000445 337
307 3300025893 Ga0207682_10005874 Ga0207682_100058742 337
308 3300025917 Ga0207660_10000024 Ga0207660_1000002451 337
309 3300025941 Ga0207711_10000917 Ga0207711_1000091719 337
310 3300025945 Ga0207679_10108531 Ga0207679_101085311 337
311 3300025972 Ga0207668_10107533 Ga0207668_101075332 337
312 3300026116 Ga0207674_10185975 Ga0207674_101859751 337
313 3300026118 Ga0207675_100000032 Ga0207675_10000003239 337
314 3300032002 Ga0307416_100079397 Ga0307416_1000793972 337
315 3300037471 Ga0395905_0091212 Ga0395905_0091212_92_1159 337
316 3300044693 Ga0466961_0045825 Ga0466961_0045825_1358_2431 337
317 3300044712 Ga0453684_0369532 Ga0453684_0369532_450_1517 337
318 3300048911 Ga0496108_0121555 Ga0496108_0121555_249_1316 337
319 3300048912 Ga0496109_0063831 Ga0496109_0063831_484_1551 337
320 3300048928 Ga0496125_0024159 Ga0496125_0024159_181_1272 337
321 3300025931 Ga0207644_10157182 Ga0207644_101571822 338
322 3300031731 Ga0307405_10186398 Ga0307405_101863982 338
323 3300031852 Ga0307410_10000465 Ga0307410_100004657 338
324 3300031901 Ga0307406_10048602 Ga0307406_100486022 338
325 3300031903 Ga0307407_10016129 Ga0307407_100161292 338
326 3300031995 Ga0307409_100002678 Ga0307409_1000026788 338
327 3300032004 Ga0307414_10004937 Ga0307414_100049372 338
328 3300032005 Ga0307411_10028219 Ga0307411_100282192 338
329 3300053140 Ga0500573_0114034 Ga0500573_0114034_237_1322 338
330 3300005530 Ga0070679_100193348 Ga0070679_1001933482 339
331 3300005563 Ga0068855_100381109 Ga0068855_1003811092 339
332 3300005614 Ga0068856_100108554 Ga0068856_1001085542 339
333 3300009177 Ga0105248_10665958 Ga0105248_106659581 339
334 3300025913 Ga0207695_10222370 Ga0207695_102223702 339
335 3300025917 Ga0207660_10038338 Ga0207660_100383382 339
336 3300025921 Ga0207652_10326415 Ga0207652_103264152 339
337 3300027876 Ga0209974_10006485 Ga0209974_100064852 339
338 3300028380 Ga0268265_10142110 Ga0268265_101421102 339
339 3300032004 Ga0307414_10078957 Ga0307414_100789572 339
340 3300037466 Ga0395898_0241432 Ga0395898_0241432_243_1304 339
341 3300037471 Ga0395905_0000232 Ga0395905_0000232_6192_7253 339
342 3300044694 Ga0466963_0032406 Ga0466963_0032406_116_1183 339
343 3300005843 Ga0068860_100018036 Ga0068860_1000180366 340
344 3300013102 Ga0157371_10138748 Ga0157371_101387482 340
345 3300025972 Ga0207668_10031542 Ga0207668_100315422 340
346 3300028381 Ga0268264_10197413 Ga0268264_101974132 340
347 3300031995 Ga0307409_100089477 Ga0307409_1000894772 340
348 3300035119 Ga0373956_0017500 Ga0373956_0017500_735_1886 340
349 3300037466 Ga0395898_0164232 Ga0395898_0164232_810_1877 340
350 3300038443 Ga0395901_0066872 Ga0395901_0066872_2113_3180 340
351 3300045836 Ga0466958_0102598 Ga0466958_0102598_651_1718 340
352 3300046616 Ga0495668_0008332 Ga0495668_0008332_1974_3041 340
353 3300046684 Ga0495669_0002438 Ga0495669_0002438_1380_2447 340
354 3300005290 Ga0065712_10088801 Ga0065712_100888012 341
355 3300005331 Ga0070670_100000657 Ga0070670_1000006572 341
356 3300005344 Ga0070661_100027477 Ga0070661_1000274773 341
357 3300005355 Ga0070671_100000620 Ga0070671_10000062027 341
358 3300005364 Ga0070673_100006165 Ga0070673_1000061652 341
359 3300005366 Ga0070659_100055678 Ga0070659_1000556783 341
360 3300005457 Ga0070662_100034379 Ga0070662_1000343792 341
361 3300005543 Ga0070672_100013878 Ga0070672_1000138783 341
362 3300005564 Ga0070664_100003017 Ga0070664_10000301710 341
363 3300005578 Ga0068854_100006061 Ga0068854_1000060616 341
364 3300005618 Ga0068864_100230836 Ga0068864_1002308362 341
365 3300005841 Ga0068863_100000103 Ga0068863_1000001036 341
366 3300005844 Ga0068862_100016013 Ga0068862_1000160134 341
367 3300009177 Ga0105248_10002069 Ga0105248_1000206918 341
368 3300009177 Ga0105248_10040085 Ga0105248_100400854 341
369 3300013100 Ga0157373_10201695 Ga0157373_102016952 341
370 3300013105 Ga0157369_10021037 Ga0157369_100210374 341
371 3300013308 Ga0157375_10006351 Ga0157375_100063516 341
372 3300025920 Ga0207649_10020713 Ga0207649_100207132 341
373 3300025925 Ga0207650_10002874 Ga0207650_100028743 341
374 3300025926 Ga0207659_10008219 Ga0207659_100082193 341
375 3300025933 Ga0207706_10004809 Ga0207706_100048098 341
376 3300025940 Ga0207691_10007047 Ga0207691_100070474 341
377 3300025941 Ga0207711_10150956 Ga0207711_101509562 341
378 3300025945 Ga0207679_10033900 Ga0207679_100339001 341
379 3300025949 Ga0207667_10405370 Ga0207667_104053702 341
380 3300025981 Ga0207640_10175318 Ga0207640_101753182 341
381 3300026088 Ga0207641_10000113 Ga0207641_100001136 341
382 3300026116 Ga0207674_10218544 Ga0207674_102185442 341
383 3300028379 Ga0268266_10246760 Ga0268266_102467602 341
384 3300028380 Ga0268265_10068743 Ga0268265_100687432 341
385 3300031995 Ga0307409_100074227 Ga0307409_1000742272 341
386 3300046506 Ga0495583_0051417 Ga0495583_0051417_587_1723 341
387 3300046513 Ga0495616_0039134 Ga0495616_0039134_1163_2299 341
388 3300046684 Ga0495669_0001501 Ga0495669_0001501_601_1668 341
389 3300048090 Ga0495615_0000114 Ga0495615_0000114_14546_15682 341
390 3300048913 Ga0496110_0005561 Ga0496110_0005561_1049_2116 341
391 3300048914 Ga0496111_0032922 Ga0496111_0032922_2607_3674 341
392 3300048917 Ga0496114_0065139 Ga0496114_0065139_881_1948 341
393 3300048925 Ga0496122_0012455 Ga0496122_0012455_4831_5943 341
394 3300048926 Ga0496123_0002815 Ga0496123_0002815_4884_5996 341
395 3300048927 Ga0496124_0019874 Ga0496124_0019874_4795_5907 341
396 3300002155 JGI24033J26618_1003599 JGI24033J26618_10035991 342
397 3300005327 Ga0070658_10041579 Ga0070658_100415792 342
398 3300005331 Ga0070670_100094950 Ga0070670_1000949502 342
399 3300005339 Ga0070660_100059267 Ga0070660_1000592672 342
400 3300005353 Ga0070669_100028765 Ga0070669_1000287653 342
401 3300005354 Ga0070675_100008142 Ga0070675_1000081423 342
402 3300005356 Ga0070674_100016920 Ga0070674_1000169202 342
403 3300005366 Ga0070659_100022244 Ga0070659_1000222442 342
404 3300005455 Ga0070663_100098573 Ga0070663_1000985732 342
405 3300005456 Ga0070678_100192392 Ga0070678_1001923922 342
406 3300005457 Ga0070662_100233670 Ga0070662_1002336702 342
407 3300005564 Ga0070664_100021584 Ga0070664_1000215842 342
408 3300014326 Ga0157380_10060921 Ga0157380_100609212 342
409 3300025893 Ga0207682_10029749 Ga0207682_100297492 342
410 3300025907 Ga0207645_10051608 Ga0207645_100516082 342
411 3300025909 Ga0207705_10039863 Ga0207705_100398632 342
412 3300025919 Ga0207657_10006174 Ga0207657_100061749 342
413 3300025920 Ga0207649_10106389 Ga0207649_101063892 342
414 3300025923 Ga0207681_10019791 Ga0207681_100197912 342
415 3300025925 Ga0207650_10010288 Ga0207650_100102882 342
416 3300025926 Ga0207659_10006612 Ga0207659_100066123 342
417 3300025932 Ga0207690_10014175 Ga0207690_100141753 342
418 3300025933 Ga0207706_10020915 Ga0207706_100209152 342
419 3300025949 Ga0207667_10282364 Ga0207667_102823642 342
420 3300026121 Ga0207683_10185608 Ga0207683_101856082 342
421 3300031731 Ga0307405_10000196 Ga0307405_1000019612 342
422 3300037312 Ga0395899_0084827 Ga0395899_0084827_630_1691 342
423 3300037418 Ga0395900_0004480 Ga0395900_0004480_6030_7091 342
424 3300037471 Ga0395905_0010696 Ga0395905_0010696_652_1713 342
425 3300038443 Ga0395901_0019979 Ga0395901_0019979_4084_5145 342
426 3300049583 Ga0501067_0020300 Ga0501067_0020300_2131_3204 342
427 3300005366 Ga0070659_100039832 Ga0070659_1000398322 343
428 3300005564 Ga0070664_100172029 Ga0070664_1001720292 343
429 3300005617 Ga0068859_100000623 Ga0068859_10000062325 343
430 3300006871 Ga0075434_100003078 Ga0075434_1000030788 343
431 3300006931 Ga0097620_100000623 Ga0097620_10000062325 343
432 3300009177 Ga0105248_10001646 Ga0105248_100016463 343
433 3300014325 Ga0163163_10112163 Ga0163163_101121632 343
434 3300014968 Ga0157379_10041621 Ga0157379_100416215 343
435 3300025919 Ga0207657_10172193 Ga0207657_101721932 343
436 3300025932 Ga0207690_10031844 Ga0207690_100318442 343
437 3300025941 Ga0207711_10013792 Ga0207711_100137923 343
438 3300025945 Ga0207679_10143950 Ga0207679_101439502 343
439 3300042007 Ga0439449_0002667 Ga0439449_0002667_2861_3928 343
440 3300048903 Ga0496100_0043927 Ga0496100_0043927_1274_2359 343
441 3300048905 Ga0496102_0038529 Ga0496102_0038529_1273_2331 343
442 3300048908 Ga0496105_0045068 Ga0496105_0045068_814_1899 343
443 3300048909 Ga0496106_0263598 Ga0496106_0263598_100_1158 343
444 3300048913 Ga0496110_0029322 Ga0496110_0029322_1693_2751 343
445 3300048914 Ga0496111_0084793 Ga0496111_0084793_920_2005 343
446 3300048915 Ga0496112_0138104 Ga0496112_0138104_651_1736 343
447 3300048918 Ga0496115_0165412 Ga0496115_0165412_229_1314 343
448 3300050512 nmdc:mga0n895_6781_c1 nmdc:mga0n895_6781_c1_2570_3667 343
449 3300050513 nmdc:mga0rr50_47105_c1 nmdc:mga0rr50_47105_c1_1086_2183 343
450 3300053134 Ga0500658_0055351 Ga0500658_0055351_221_1318 343
451 3300053157 Ga0500624_000003 Ga0500624_000003_130377_131447 343
452 3300053178 Ga0500637_0000024 Ga0500637_0000024_38622_39692 343
453 iso_pu_bacteria 2895880812 2895881214 343
454 3300005329 Ga0070683_100117064 Ga0070683_1001170641 344
455 3300005455 Ga0070663_100024870 Ga0070663_1000248703 344
456 3300026067 Ga0207678_10008447 Ga0207678_100084473 344
457 3300026121 Ga0207683_10087090 Ga0207683_100870904 344
458 3300031548 Ga0307408_100004543 Ga0307408_1000045436 344
459 3300031824 Ga0307413_10049490 Ga0307413_100494903 344
460 3300037312 Ga0395899_0090625 Ga0395899_0090625_519_1589 344
461 3300037418 Ga0395900_0214746 Ga0395900_0214746_154_1224 344
462 3300037466 Ga0395898_0180383 Ga0395898_0180383_290_1360 344
463 3300038443 Ga0395901_0094403 Ga0395901_0094403_1847_2917 344
464 3300048927 Ga0496124_0006985 Ga0496124_0006985_3160_4251 344
465 3300005548 Ga0070665_100058303 Ga0070665_1000583032 345
466 3300021388 Ga0213875_10005028 Ga0213875_100050282 345
467 3300026067 Ga0207678_10123604 Ga0207678_101236042 345
468 3300028379 Ga0268266_10035494 Ga0268266_100354945 345
469 3300037853 Ga0436364_0411459 Ga0436364_0411459_4088_5233 345
470 3300053096 Ga0500641_0006777 Ga0500641_0006777_1536_2678 345
471 3300005985 Ga0081539_10014655 Ga0081539_100146556 346
472 3300021384 Ga0213876_10000371 Ga0213876_1000037135 346
473 3300031852 Ga0307410_10149917 Ga0307410_101499172 346
474 3300046460 Ga0495638_0000207 Ga0495638_0000207_22736_23890 346
475 3300039437 Ga0436365_1110654 Ga0436365_1110654_57_1151 347
476 3300049824 Ga0501045_0079987 Ga0501045_0079987_1064_2134 347
477 3300053116 Ga0500592_000314 Ga0500592_000314_4069_5118 347
478 3300005616 Ga0068852_100208572 Ga0068852_1002085722 348
479 3300005336 Ga0070680_100024107 Ga0070680_1000241071 349
480 3300005337 Ga0070682_100013327 Ga0070682_1000133273 349
481 3300005366 Ga0070659_100036650 Ga0070659_1000366502 349
482 3300005530 Ga0070679_100008091 Ga0070679_10000809114 349
483 3300005546 Ga0070696_100037829 Ga0070696_1000378294 349
484 3300005547 Ga0070693_100007429 Ga0070693_1000074298 349
485 3300005564 Ga0070664_100049081 Ga0070664_1000490812 349
486 3300005615 Ga0070702_100058941 Ga0070702_1000589411 349
487 3300005983 Ga0081540_1000048 Ga0081540_100004881 349
488 3300006042 Ga0075368_10008487 Ga0075368_100084871 349
489 3300006051 Ga0075364_10008502 Ga0075364_100085028 349
490 3300006178 Ga0075367_10017386 Ga0075367_100173862 349
491 3300006178 Ga0075367_10116249 Ga0075367_101162492 349
492 3300006844 Ga0075428_100084896 Ga0075428_1000848962 349
493 3300006847 Ga0075431_100019995 Ga0075431_1000199952 349
494 3300006880 Ga0075429_100172609 Ga0075429_1001726091 349
495 3300009094 Ga0111539_10067078 Ga0111539_100670785 349
496 3300009174 Ga0105241_10018566 Ga0105241_100185664 349
497 3300009545 Ga0105237_10065812 Ga0105237_100658125 349
498 3300009551 Ga0105238_10105601 Ga0105238_101056014 349
499 3300011119 Ga0105246_10031393 Ga0105246_100313932 349
500 3300013297 Ga0157378_10323661 Ga0157378_103236611 349
501 3300014326 Ga0157380_10157232 Ga0157380_101572322 349
502 3300025912 Ga0207707_10148459 Ga0207707_101484591 349
503 3300025919 Ga0207657_10080802 Ga0207657_100808023 349
504 3300025921 Ga0207652_10118010 Ga0207652_101180102 349
505 3300025932 Ga0207690_10061849 Ga0207690_100618492 349
506 3300026067 Ga0207678_10001937 Ga0207678_1000193723 349
507 3300027866 Ga0209813_10006694 Ga0209813_100066941 349
508 3300032004 Ga0307414_10000371 Ga0307414_100003717 349
509 3300035692 Ga0373935_0219522 Ga0373935_0219522_68_1144 349
510 3300037418 Ga0395900_0168212 Ga0395900_0168212_488_1555 349
511 3300038742 Ga0400486_21858 Ga0400486_21858_685_1773 349
512 3300046513 Ga0495616_0011390 Ga0495616_0011390_559_1728 349
513 3300048903 Ga0496100_0142523 Ga0496100_0142523_174_1250 349
514 3300048905 Ga0496102_0157832 Ga0496102_0157832_845_1921 349
515 3300048907 Ga0496104_0052893 Ga0496104_0052893_2318_3394 349
516 3300048909 Ga0496106_0015255 Ga0496106_0015255_552_1628 349
517 3300049569 Ga0501032_0013776 Ga0501032_0013776_4119_5186 349
518 3300049571 Ga0501034_0000068 Ga0501034_0000068_6891_7958 349
519 3300049571 Ga0501034_0006843 Ga0501034_0006843_5397_6464 349
520 3300049573 Ga0501037_0008627 Ga0501037_0008627_5361_6428 349
521 3300049574 Ga0501038_0080357 Ga0501038_0080357_841_1908 349
522 3300049575 Ga0501039_0000205 Ga0501039_0000205_16965_18032 349
523 3300049579 Ga0501043_0074585 Ga0501043_0074585_507_1574 349
524 3300049580 Ga0501046_0000058 Ga0501046_0000058_80411_81484 349
525 3300049580 Ga0501046_0007334 Ga0501046_0007334_7410_8477 349
526 3300049580 Ga0501046_0030319 Ga0501046_0030319_765_1832 349
527 3300049581 Ga0501047_0000152 Ga0501047_0000152_20123_21190 349
528 3300049581 Ga0501047_0088462 Ga0501047_0088462_1798_2865 349
529 3300049582 Ga0501048_0002175 Ga0501048_0002175_13566_14642 349
530 3300049583 Ga0501067_0018422 Ga0501067_0018422_563_1630 349
531 3300049586 Ga0501070_0035400 Ga0501070_0035400_1774_2841 349
532 3300049742 Ga0501080_0000001 Ga0501080_0000001_105660_106727 349
533 3300049822 Ga0501035_0000015 Ga0501035_0000015_185214_186281 349
534 3300049822 Ga0501035_0091158 Ga0501035_0091158_477_1544 349
535 3300049823 Ga0501044_0000390 Ga0501044_0000390_24124_25191 349
536 3300049824 Ga0501045_0142665 Ga0501045_0142665_673_1740 349
537 3300050492 nmdc:mga0yw44_19458_c1 nmdc:mga0yw44_19458_c1_1431_2504 349
538 3300050494 nmdc:mga06z11_3726_c1 nmdc:mga06z11_3726_c1_1140_2213 349
539 3300050494 nmdc:mga06z11_38986_c1 nmdc:mga06z11_38986_c1_533_1606 349
540 3300050507 nmdc:mga05p37_507715_c1 nmdc:mga05p37_507715_c1_101_1174 349
541 3300050508 nmdc:mga09592_112735_c1 nmdc:mga09592_112735_c1_1236_2318 349
542 3300050508 nmdc:mga09592_84040_c1 nmdc:mga09592_84040_c1_1009_2082 349
543 3300050509 nmdc:mga0qj67_347153_c1 nmdc:mga0qj67_347153_c1_54_1127 349
544 3300050510 nmdc:mga06r32_8364_c1 nmdc:mga06r32_8364_c1_6864_7937 349
545 3300053104 Ga0500556_0001468 Ga0500556_0001468_3850_4932 349
546 3300053119 Ga0500595_014502 Ga0500595_014502_748_1815 349
547 3300053153 Ga0500616_0005539 Ga0500616_0005539_6457_7539 349
548 3300053153 Ga0500616_0007417 Ga0500616_0007417_4527_5603 349
549 3300054114 Ga0501084_0182434 Ga0501084_0182434_596_1678 349
550 3300060353 Ga0501082_0022902 Ga0501082_0022902_4141_5208 349
551 iso_pu_bacteria 2599185359 2600228368 349
552 iso_pu_bacteria 2879163058 2879163951 349
553 3300005563 Ga0068855_100011666 Ga0068855_1000116662 350
554 3300009093 Ga0105240_10179509 Ga0105240_101795093 350
555 3300031548 Ga0307408_100145470 Ga0307408_1001454702 350
556 iso_pu_bacteria 2885427238 2885429324 350
557 3300005339 Ga0070660_100244616 Ga0070660_1002446162 351
558 3300005444 Ga0070694_100040643 Ga0070694_1000406432 351
559 3300005458 Ga0070681_10056174 Ga0070681_100561745 351
560 3300005458 Ga0070681_10135359 Ga0070681_101353592 351
561 3300006844 Ga0075428_100268097 Ga0075428_1002680972 351
562 3300006847 Ga0075431_100272780 Ga0075431_1002727802 351
563 3300009094 Ga0111539_10231512 Ga0111539_102315122 351
564 3300025912 Ga0207707_10093083 Ga0207707_100930832 351
565 3300025912 Ga0207707_10095823 Ga0207707_100958233 351
566 3300025932 Ga0207690_10139457 Ga0207690_101394571 351
567 3300037418 Ga0395900_0141635 Ga0395900_0141635_1078_2286 351
568 3300037466 Ga0395898_0064148 Ga0395898_0064148_987_2195 351
569 3300037471 Ga0395905_0038255 Ga0395905_0038255_1101_2309 351
570 3300038443 Ga0395901_0070084 Ga0395901_0070084_544_1752 351
571 3300038443 Ga0395901_0131281 Ga0395901_0131281_74_1156 351
572 3300042120 Ga0450917_003182 Ga0450917_003182_40_1098 351
573 3300046472 Ga0495580_0226880 Ga0495580_0226880_153_1238 351
574 3300048907 Ga0496104_0264349 Ga0496104_0264349_132_1217 351
575 3300048912 Ga0496109_0018512 Ga0496109_0018512_2601_3689 351
576 3300048926 Ga0496123_0010116 Ga0496123_0010116_1515_2612 351
577 3300050510 nmdc:mga06r32_56755_c1 nmdc:mga06r32_56755_c1_517_1602 351
578 3300050511 nmdc:mga08y16_117003_c1 nmdc:mga08y16_117003_c1_65_1123 351
579 iso_pu_bacteria 2928027323 2928029766 351
580 3300005327 Ga0070658_10000003 Ga0070658_10000003253 352
581 3300005339 Ga0070660_100001813 Ga0070660_1000018139 352
582 3300005366 Ga0070659_100004495 Ga0070659_1000044955 352
583 3300006195 Ga0075366_10000241 Ga0075366_1000024116 352
584 3300009094 Ga0111539_10235181 Ga0111539_102351812 352
585 3300025909 Ga0207705_10000005 Ga0207705_10000005255 352
586 3300025919 Ga0207657_10003198 Ga0207657_100031984 352
587 3300025924 Ga0207694_10096889 Ga0207694_100968893 352
588 3300025932 Ga0207690_10005477 Ga0207690_100054777 352
589 3300028786 Ga0307517_10025548 Ga0307517_100255485 352
590 3300031548 Ga0307408_100209744 Ga0307408_1002097442 352
591 3300031731 Ga0307405_10020967 Ga0307405_100209672 352
592 3300031824 Ga0307413_10006405 Ga0307413_100064053 352
593 3300031824 Ga0307413_10080372 Ga0307413_100803722 352
594 3300031852 Ga0307410_10091953 Ga0307410_100919532 352
595 3300031852 Ga0307410_10092942 Ga0307410_100929422 352
596 3300031852 Ga0307410_10146797 Ga0307410_101467972 352
597 3300031901 Ga0307406_10145119 Ga0307406_101451192 352
598 3300031903 Ga0307407_10006235 Ga0307407_100062353 352
599 3300031911 Ga0307412_10074378 Ga0307412_100743781 352
600 3300031911 Ga0307412_10080888 Ga0307412_100808882 352
601 3300031911 Ga0307412_10142850 Ga0307412_101428502 352
602 3300031995 Ga0307409_100011157 Ga0307409_1000111572 352
603 3300031995 Ga0307409_100119967 Ga0307409_1001199672 352
604 3300032002 Ga0307416_100023804 Ga0307416_1000238046 352
605 3300032004 Ga0307414_10004392 Ga0307414_100043926 352
606 3300032005 Ga0307411_10003306 Ga0307411_100033066 352
607 3300032126 Ga0307415_100016016 Ga0307415_1000160163 352
608 3300035695 Ga0373927_0080693 Ga0373927_0080693_15_1085 352
609 3300039437 Ga0436365_0083543 Ga0436365_0083543_23784_24875 352
610 3300042004 Ga0439445_0020665 Ga0439445_0020665_138_1205 352
611 3300046500 Ga0495596_0044318 Ga0495596_0044318_592_1659 352
612 3300046525 Ga0495663_0001729 Ga0495663_0001729_808_1875 352
613 3300046539 Ga0495621_0000875 Ga0495621_0000875_2096_3163 352
614 3300046558 Ga0495633_0015032 Ga0495633_0015032_583_1650 352
615 3300005366 Ga0070659_100003757 Ga0070659_10000375711 353
616 3300005616 Ga0068852_100334449 Ga0068852_1003344492 353
617 3300009093 Ga0105240_10011600 Ga0105240_1001160011 353
618 3300009551 Ga0105238_10069194 Ga0105238_100691942 353
619 3300025261 Ga0209233_1021520 Ga0209233_10215202 353
620 3300025913 Ga0207695_10063442 Ga0207695_100634425 353
621 3300025924 Ga0207694_10032047 Ga0207694_100320473 353
622 3300025932 Ga0207690_10036018 Ga0207690_100360183 353
623 3300025949 Ga0207667_10133914 Ga0207667_101339143 353
624 3300025981 Ga0207640_10099354 Ga0207640_100993543 353
625 3300026078 Ga0207702_10257847 Ga0207702_102578471 353
626 3300031548 Ga0307408_100008196 Ga0307408_1000081964 353
627 3300031824 Ga0307413_10025856 Ga0307413_100258562 353
628 3300031852 Ga0307410_10014819 Ga0307410_100148193 353
629 3300031852 Ga0307410_10020233 Ga0307410_100202333 353
630 3300031901 Ga0307406_10050582 Ga0307406_100505822 353
631 3300031901 Ga0307406_10063689 Ga0307406_100636892 353
632 3300031911 Ga0307412_10042034 Ga0307412_100420342 353
633 3300032002 Ga0307416_100036396 Ga0307416_1000363962 353
634 3300032004 Ga0307414_10011366 Ga0307414_100113664 353
635 3300032004 Ga0307414_10042294 Ga0307414_100422942 353
636 3300032005 Ga0307411_10001823 Ga0307411_100018234 353
637 3300032005 Ga0307411_10107857 Ga0307411_101078572 353
638 3300032126 Ga0307415_100021970 Ga0307415_1000219702 353
639 3300032126 Ga0307415_100082652 Ga0307415_1000826522 353
640 3300032126 Ga0307415_100332275 Ga0307415_1003322752 353
641 3300039062 Ga0400483_026085 Ga0400483_026085_408_1520 353
642 3300046492 Ga0495585_0003769 Ga0495585_0003769_8128_9264 353
643 3300001904 JGI24736J21556_1000841 JGI24736J21556_10008415 354
644 3300003214 JGI25165J46597_1000010 JGI25165J46597_1000010208 354
645 3300005366 Ga0070659_100026584 Ga0070659_1000265842 354
646 3300005578 Ga0068854_100035059 Ga0068854_1000350592 354
647 3300013102 Ga0157371_10036317 Ga0157371_100363172 354
648 3300013307 Ga0157372_10141581 Ga0157372_101415812 354
649 3300025261 Ga0209233_1000044 Ga0209233_1000044273 354
650 3300025949 Ga0207667_10064744 Ga0207667_100647442 354
651 3300025981 Ga0207640_10004079 Ga0207640_100040793 354
652 3300026078 Ga0207702_10058096 Ga0207702_100580964 354
653 3300031235 Ga0265330_10002833 Ga0265330_100028337 354
654 3300031247 Ga0265340_10000018 Ga0265340_100000183 354
655 3300031247 Ga0265340_10040091 Ga0265340_100400912 354
656 3300031344 Ga0265316_10005193 Ga0265316_100051933 354
657 3300031595 Ga0265313_10055027 Ga0265313_100550271 354
658 3300031712 Ga0265342_10024398 Ga0265342_100243982 354
659 3300037418 Ga0395900_0045525 Ga0395900_0045525_1769_2836 354
660 3300037418 Ga0395900_0117775 Ga0395900_0117775_1214_2281 354
661 3300037466 Ga0395898_0030471 Ga0395898_0030471_2172_3239 354
662 3300037466 Ga0395898_0362930 Ga0395898_0362930_223_1290 354
663 3300046501 Ga0495607_0056998 Ga0495607_0056998_731_1867 354
664 3300053087 Ga0500643_000235 Ga0500643_000235_13127_14209 354
665 iso_pu_bacteria 2818991466 2819715165 354
666 iso_pu_bacteria 2919138771 2919143206 354
667 3300005327 Ga0070658_10001555 Ga0070658_1000155518 355
668 3300005327 Ga0070658_10037354 Ga0070658_100373542 355
669 3300005327 Ga0070658_10083347 Ga0070658_100833472 355
670 3300005339 Ga0070660_100177987 Ga0070660_1001779872 355
671 3300005345 Ga0070692_10001745 Ga0070692_100017452 355
672 3300005563 Ga0068855_100007934 Ga0068855_1000079342 355
673 3300013100 Ga0157373_10115137 Ga0157373_101151372 355
674 3300013102 Ga0157371_10002185 Ga0157371_100021858 355
675 3300013104 Ga0157370_10151588 Ga0157370_101515882 355
676 3300013297 Ga0157378_10196811 Ga0157378_101968111 355
677 3300014326 Ga0157380_10020827 Ga0157380_100208273 355
678 3300025304 Ga0209257_1008172 Ga0209257_10081722 355
679 3300025904 Ga0207647_10009560 Ga0207647_100095603 355
680 3300025909 Ga0207705_10000809 Ga0207705_1000080923 355
681 3300025909 Ga0207705_10004300 Ga0207705_100043003 355
682 3300025909 Ga0207705_10015141 Ga0207705_100151417 355
683 3300025909 Ga0207705_10247395 Ga0207705_102473952 355
684 3300025919 Ga0207657_10013805 Ga0207657_100138058 355
685 3300025932 Ga0207690_10032243 Ga0207690_100322432 355
686 3300025949 Ga0207667_10000314 Ga0207667_100003146 355
687 3300025949 Ga0207667_10348085 Ga0207667_103480852 355
688 3300037312 Ga0395899_0000129 Ga0395899_0000129_40548_41618 355
689 3300037418 Ga0395900_0002105 Ga0395900_0002105_19529_20599 355
690 3300037418 Ga0395900_0191910 Ga0395900_0191910_324_1424 355
691 3300037466 Ga0395898_0162916 Ga0395898_0162916_151_1221 355
692 3300037466 Ga0395898_0183234 Ga0395898_0183234_272_1342 355
693 3300037471 Ga0395905_0136804 Ga0395905_0136804_118_1188 355
694 3300038443 Ga0395901_0000031 Ga0395901_0000031_234462_235532 355
695 3300039450 Ga0436363_0310243 Ga0436363_0310243_2283_3392 355
696 3300048905 Ga0496102_0030551 Ga0496102_0030551_1121_2191 355
697 3300001990 JGI24737J22298_10016354 JGI24737J22298_100163544 356
698 3300005289 Ga0065704_10003962 Ga0065704_100039625 356
699 3300005295 Ga0065707_10081963 Ga0065707_1008196316 356
700 3300005327 Ga0070658_10001818 Ga0070658_100018184 356
701 3300005455 Ga0070663_100170137 Ga0070663_1001701372 356
702 3300005563 Ga0068855_100022265 Ga0068855_1000222656 356
703 3300005564 Ga0070664_100365893 Ga0070664_1003658932 356
704 3300005578 Ga0068854_100062705 Ga0068854_1000627052 356
705 3300005614 Ga0068856_100002574 Ga0068856_1000025746 356
706 3300005843 Ga0068860_100076957 Ga0068860_1000769572 356
707 3300006847 Ga0075431_100009478 Ga0075431_1000094783 356
708 3300013100 Ga0157373_10302024 Ga0157373_103020241 356
709 3300013105 Ga0157369_10000043 Ga0157369_1000004354 356
710 3300013105 Ga0157369_10047977 Ga0157369_100479772 356
711 3300013307 Ga0157372_10559854 Ga0157372_105598542 356
712 3300021384 Ga0213876_10022864 Ga0213876_100228642 356
713 3300025904 Ga0207647_10054146 Ga0207647_100541462 356
714 3300025909 Ga0207705_10000033 Ga0207705_10000033130 356
715 3300025909 Ga0207705_10000037 Ga0207705_10000037147 356
716 3300025913 Ga0207695_10003382 Ga0207695_100033827 356
717 3300025913 Ga0207695_10177724 Ga0207695_101777242 356
718 3300025920 Ga0207649_10002320 Ga0207649_100023207 356
719 3300025923 Ga0207681_10020235 Ga0207681_100202352 356
720 3300025949 Ga0207667_10007100 Ga0207667_100071007 356
721 3300025972 Ga0207668_10004688 Ga0207668_100046885 356
722 3300025981 Ga0207640_10002534 Ga0207640_1000253410 356
723 3300026078 Ga0207702_10033715 Ga0207702_100337152 356
724 3300026142 Ga0207698_10042867 Ga0207698_100428676 356
725 3300028381 Ga0268264_10056951 Ga0268264_100569512 356
726 3300037312 Ga0395899_0009175 Ga0395899_0009175_3940_5013 356
727 3300037312 Ga0395899_0169837 Ga0395899_0169837_427_1500 356
728 3300037418 Ga0395900_0038265 Ga0395900_0038265_947_2020 356
729 3300037418 Ga0395900_0161135 Ga0395900_0161135_467_1540 356
730 3300037466 Ga0395898_0067120 Ga0395898_0067120_1203_2276 356
731 3300037471 Ga0395905_0068245 Ga0395905_0068245_1137_2210 356
732 3300038443 Ga0395901_0058196 Ga0395901_0058196_57_1130 356
733 3300038443 Ga0395901_0561501 Ga0395901_0561501_57_1130 356
734 3300039437 Ga0436365_0922968 Ga0436365_0922968_7095_8210 356
735 3300044656 Ga0466969_0010778 Ga0466969_0010778_2985_4058 356
736 3300044684 Ga0466966_0000021 Ga0466966_0000021_74735_75865 356
737 3300044684 Ga0466966_0001996 Ga0466966_0001996_6619_7692 356
738 3300044693 Ga0466961_0008264 Ga0466961_0008264_2645_3718 356
739 3300044694 Ga0466963_0016990 Ga0466963_0016990_2936_4009 356
740 3300044719 Ga0466971_0000846 Ga0466971_0000846_4223_5296 356
741 3300044842 Ga0466957_0002162 Ga0466957_0002162_658_1731 356
742 3300045049 Ga0466959_0006500 Ga0466959_0006500_2429_3502 356
743 3300045051 Ga0451576_0068605 Ga0451576_0068605_295_1407 356
744 3300045836 Ga0466958_0009405 Ga0466958_0009405_1569_2642 356
745 3300047472 Ga0495686_0017144 Ga0495686_0017144_428_1534 356
746 3300048905 Ga0496102_0110297 Ga0496102_0110297_336_1439 356
747 3300048908 Ga0496105_0000224 Ga0496105_0000224_31176_32279 356
748 3300048924 Ga0496121_0000017 Ga0496121_0000017_370993_372099 356
749 3300049822 Ga0501035_0273131 Ga0501035_0273131_267_1400 356
750 3300049823 Ga0501044_0000572 Ga0501044_0000572_42739_43869 356
751 3300050510 nmdc:mga06r32_1441_c1 nmdc:mga06r32_1441_c1_359_1435 356
752 3300061719 Ga0466962_0002938 Ga0466962_0002938_2664_3737 356
753 3300013102 Ga0157371_10101373 Ga0157371_101013732 357
754 3300021384 Ga0213876_10038133 Ga0213876_100381333 357
755 3300032004 Ga0307414_10041933 Ga0307414_100419332 357
756 3300032004 Ga0307414_10135177 Ga0307414_101351772 357
757 3300039437 Ga0436365_0935722 Ga0436365_0935722_818_1900 357
758 3300046507 Ga0495606_0000470 Ga0495606_0000470_19741_20862 357
759 3300047472 Ga0495686_0000916 Ga0495686_0000916_2712_3794 357
760 3300049515 Ga0501292_000022 Ga0501292_000022_13514_14623 357
761 3300049653 Ga0501206_001253 Ga0501206_001253_1535_2644 357
762 3300049664 Ga0501224_003103 Ga0501224_003103_186_1295 357
763 3300049668 Ga0501233_000230 Ga0501233_000230_1096_2172 357
764 3300049690 Ga0501261_000144 Ga0501261_000144_8663_9772 357
765 3300049775 Ga0501279_000012 Ga0501279_000012_55455_56564 357
766 3300049778 Ga0501282_000707 Ga0501282_000707_2603_3712 357
767 iso_pu_bacteria 2990265787 2990265819 357
768 iso_pu_bacteria 2993693658 2993696390 357
769 3300001904 JGI24736J21556_1000435 JGI24736J21556_10004355 358
770 3300001976 JGI24752J21851_1000209 JGI24752J21851_10002095 358
771 3300001976 JGI24752J21851_1000362 JGI24752J21851_10003622 358
772 3300001989 JGI24739J22299_10007848 JGI24739J22299_100078484 358
773 3300002070 JGI24750J21931_1000040 JGI24750J21931_100004016 358
774 3300002074 JGI24748J21848_1000053 JGI24748J21848_100005328 358
775 3300002075 JGI24738J21930_10001175 JGI24738J21930_100011756 358
776 3300002076 JGI24749J21850_1004036 JGI24749J21850_10040362 358
777 3300002239 JGI24034J26672_10000036 JGI24034J26672_1000003651 358
778 3300002244 JGI24742J22300_10004660 JGI24742J22300_100046603 358
779 3300002459 JGI24751J29686_10007551 JGI24751J29686_100075512 358
780 3300003773 Ga0055537_1003859 Ga0055537_10038592 358
781 3300003775 Ga0055524_1000154 Ga0055524_10001548 358
782 3300005289 Ga0065704_10075440 Ga0065704_100754405 358
783 3300005327 Ga0070658_10258356 Ga0070658_102583561 358
784 3300005330 Ga0070690_100000093 Ga0070690_10000009325 358
785 3300005331 Ga0070670_100000202 Ga0070670_10000020240 358
786 3300005331 Ga0070670_100031324 Ga0070670_1000313245 358
787 3300005335 Ga0070666_10000009 Ga0070666_1000000976 358
788 3300005340 Ga0070689_100152187 Ga0070689_1001521872 358
789 3300005353 Ga0070669_100000103 Ga0070669_10000010320 358
790 3300005355 Ga0070671_100024436 Ga0070671_1000244361 358
791 3300005365 Ga0070688_100016969 Ga0070688_1000169695 358
792 3300005367 Ga0070667_100001658 Ga0070667_1000016584 358
793 3300005367 Ga0070667_100042831 Ga0070667_1000428313 358
794 3300005457 Ga0070662_100006902 Ga0070662_1000069025 358
795 3300005466 Ga0070685_10000076 Ga0070685_1000007634 358
796 3300005539 Ga0068853_100020734 Ga0068853_1000207345 358
797 3300005544 Ga0070686_100000018 Ga0070686_10000001851 358
798 3300005548 Ga0070665_100000071 Ga0070665_100000071114 358
799 3300005548 Ga0070665_100187057 Ga0070665_1001870572 358
800 3300005563 Ga0068855_100296707 Ga0068855_1002967072 358
801 3300005564 Ga0070664_100116006 Ga0070664_1001160062 358
802 3300005577 Ga0068857_100092128 Ga0068857_1000921284 358
803 3300005577 Ga0068857_100242743 Ga0068857_1002427432 358
804 3300005617 Ga0068859_100031499 Ga0068859_1000314994 358
805 3300005618 Ga0068864_100000194 Ga0068864_10000019415 358
806 3300005719 Ga0068861_100008680 Ga0068861_1000086805 358
807 3300005841 Ga0068863_100000258 Ga0068863_10000025815 358
808 3300005841 Ga0068863_100004697 Ga0068863_1000046974 358
809 3300005842 Ga0068858_100002738 Ga0068858_1000027385 358
810 3300005843 Ga0068860_100000022 Ga0068860_10000002277 358
811 3300005844 Ga0068862_100000070 Ga0068862_10000007011 358
812 3300005844 Ga0068862_100000289 Ga0068862_10000028915 358
813 3300005937 Ga0081455_10000392 Ga0081455_1000039226 358
814 3300006846 Ga0075430_100022172 Ga0075430_1000221722 358
815 3300006931 Ga0097620_100031502 Ga0097620_1000315024 358
816 3300009011 Ga0105251_10000815 Ga0105251_100008158 358
817 3300009101 Ga0105247_10103828 Ga0105247_101038282 358
818 3300009177 Ga0105248_10000012 Ga0105248_10000012110 358
819 3300009177 Ga0105248_10058095 Ga0105248_100580952 358
820 3300009177 Ga0105248_10084464 Ga0105248_100844642 358
821 3300009551 Ga0105238_10187714 Ga0105238_101877142 358
822 3300009551 Ga0105238_10273984 Ga0105238_102739842 358
823 3300009553 Ga0105249_10000014 Ga0105249_1000001478 358
824 3300009553 Ga0105249_10000099 Ga0105249_1000009980 358
825 3300013104 Ga0157370_10005863 Ga0157370_100058637 358
826 3300013105 Ga0157369_10099382 Ga0157369_100993822 358
827 3300013306 Ga0163162_10004881 Ga0163162_100048812 358
828 3300013306 Ga0163162_10164709 Ga0163162_101647092 358
829 3300014326 Ga0157380_10000681 Ga0157380_1000068110 358
830 3300014968 Ga0157379_10009221 Ga0157379_100092215 358
831 3300014968 Ga0157379_10028865 Ga0157379_100288652 358
832 3300017792 Ga0163161_10000186 Ga0163161_1000018651 358
833 3300025223 Ga0207672_1000691 Ga0207672_10006913 358
834 3300025263 Ga0209565_1000007 Ga0209565_1000007646 358
835 3300025273 Ga0209673_1003983 Ga0209673_10039831 358
836 3300025291 Ga0209675_1009823 Ga0209675_10098232 358
837 3300025295 Ga0209564_1016878 Ga0209564_10168782 358
838 3300025298 Ga0209050_1003356 Ga0209050_10033563 358
839 3300025299 Ga0209256_1000008 Ga0209256_1000008488 358
840 3300025304 Ga0209257_1002535 Ga0209257_10025359 358
841 3300025735 Ga0207713_1006255 Ga0207713_10062555 358
842 3300025900 Ga0207710_10055700 Ga0207710_100557002 358
843 3300025903 Ga0207680_10000007 Ga0207680_10000007202 358
844 3300025904 Ga0207647_10000331 Ga0207647_1000033126 358
845 3300025911 Ga0207654_10004414 Ga0207654_100044146 358
846 3300025913 Ga0207695_10001498 Ga0207695_1000149829 358
847 3300025914 Ga0207671_10000350 Ga0207671_1000035043 358
848 3300025918 Ga0207662_10157465 Ga0207662_101574652 358
849 3300025919 Ga0207657_10070581 Ga0207657_100705813 358
850 3300025923 Ga0207681_10000074 Ga0207681_1000007483 358
851 3300025924 Ga0207694_10000447 Ga0207694_1000044729 358
852 3300025925 Ga0207650_10000881 Ga0207650_1000088120 358
853 3300025925 Ga0207650_10002923 Ga0207650_100029234 358
854 3300025931 Ga0207644_10001029 Ga0207644_100010296 358
855 3300025933 Ga0207706_10005888 Ga0207706_100058882 358
856 3300025936 Ga0207670_10026322 Ga0207670_100263223 358
857 3300025941 Ga0207711_10000004 Ga0207711_10000004617 358
858 3300025941 Ga0207711_10013512 Ga0207711_100135125 358
859 3300025949 Ga0207667_10007493 Ga0207667_100074932 358
860 3300025949 Ga0207667_10255812 Ga0207667_102558122 358
861 3300025961 Ga0207712_10000004 Ga0207712_10000004190 358
862 3300025961 Ga0207712_10000161 Ga0207712_1000016132 358
863 3300025986 Ga0207658_10000232 Ga0207658_1000023244 358
864 3300025986 Ga0207658_10000260 Ga0207658_1000026020 358
865 3300026035 Ga0207703_10001367 Ga0207703_1000136710 358
866 3300026041 Ga0207639_10006433 Ga0207639_100064335 358
867 3300026041 Ga0207639_10032279 Ga0207639_100322792 358
868 3300026041 Ga0207639_10086092 Ga0207639_100860922 358
869 3300026078 Ga0207702_10000566 Ga0207702_100005669 358
870 3300026088 Ga0207641_10000010 Ga0207641_10000010262 358
871 3300026088 Ga0207641_10000192 Ga0207641_1000019276 358
872 3300026095 Ga0207676_10000046 Ga0207676_10000046105 358
873 3300026095 Ga0207676_10000709 Ga0207676_1000070924 358
874 3300026116 Ga0207674_10009750 Ga0207674_100097502 358
875 3300026118 Ga0207675_100000370 Ga0207675_10000037023 358
876 3300026142 Ga0207698_10016134 Ga0207698_100161343 358
877 3300028379 Ga0268266_10000040 Ga0268266_10000040115 358
878 3300028379 Ga0268266_10169509 Ga0268266_101695091 358
879 3300028380 Ga0268265_10000026 Ga0268265_10000026139 358
880 3300028380 Ga0268265_10000334 Ga0268265_1000033415 358
881 3300028381 Ga0268264_10000003 Ga0268264_10000003204 358
882 3300031548 Ga0307408_100303929 Ga0307408_1003039292 358
883 3300031731 Ga0307405_10305661 Ga0307405_103056611 358
884 3300031911 Ga0307412_10076904 Ga0307412_100769042 358
885 3300032002 Ga0307416_100076022 Ga0307416_1000760222 358
886 3300038705 Ga0237819_00270 Ga0237819_00270_2086_3162 358
887 3300045051 Ga0451576_0014154 Ga0451576_0014154_462_1547 358
888 3300047472 Ga0495686_0000273 Ga0495686_0000273_27842_28945 358
889 3300048904 Ga0496101_0065998 Ga0496101_0065998_332_1414 358
890 3300048905 Ga0496102_0012793 Ga0496102_0012793_1754_2836 358
891 3300048906 Ga0496103_0001324 Ga0496103_0001324_11962_13044 358
892 3300048910 Ga0496107_0051593 Ga0496107_0051593_1614_2696 358
893 3300048919 Ga0496116_0012690 Ga0496116_0012690_5395_6477 358
894 3300048921 Ga0496118_0001765 Ga0496118_0001765_14301_15383 358
895 3300048924 Ga0496121_0009718 Ga0496121_0009718_788_1870 358
896 3300048929 Ga0496126_0174418 Ga0496126_0174418_154_1293 358
897 3300049663 Ga0501223_000171 Ga0501223_000171_8130_9299 358
898 3300049664 Ga0501224_000028 Ga0501224_000028_33586_34755 358
899 3300049705 Ga0501225_0000317 Ga0501225_0000317_7806_8975 358
900 3300049823 Ga0501044_0027379 Ga0501044_0027379_1459_2562 358
901 3300049853 Ga0501226_000115 Ga0501226_000115_8705_9874 358
902 iso_pu_bacteria 2984555340 2984556675 358
903 iso_pu_bacteria 2984564862 2984565152 358
904 iso_pu_bacteria 2993356040 2993356228 358
905 3300003215 JGI25153J46596_10000417 JGI25153J46596_1000041723 359
906 3300005327 Ga0070658_10005891 Ga0070658_100058914 359
907 3300005328 Ga0070676_10000367 Ga0070676_1000036713 359
908 3300005334 Ga0068869_100000552 Ga0068869_10000055215 359
909 3300005338 Ga0068868_100000057 Ga0068868_10000005761 359
910 3300005345 Ga0070692_10000469 Ga0070692_100004698 359
911 3300005356 Ga0070674_100056431 Ga0070674_1000564312 359
912 3300005364 Ga0070673_100000005 Ga0070673_10000000559 359
913 3300005364 Ga0070673_100297556 Ga0070673_1002975562 359
914 3300005459 Ga0068867_100000071 Ga0068867_10000007110 359
915 3300005543 Ga0070672_100124888 Ga0070672_1001248882 359
916 3300005563 Ga0068855_100000380 Ga0068855_10000038015 359
917 3300005841 Ga0068863_100004622 Ga0068863_10000462213 359
918 3300005843 Ga0068860_100004667 Ga0068860_1000046674 359
919 3300005844 Ga0068862_100000014 Ga0068862_10000001460 359
920 3300006881 Ga0068865_100000032 Ga0068865_10000003239 359
921 3300009098 Ga0105245_10001290 Ga0105245_100012908 359
922 3300009101 Ga0105247_10000483 Ga0105247_1000048318 359
923 3300009148 Ga0105243_10000933 Ga0105243_1000093314 359
924 3300009176 Ga0105242_10007089 Ga0105242_100070896 359
925 3300009553 Ga0105249_10000002 Ga0105249_10000002337 359
926 3300009553 Ga0105249_10009606 Ga0105249_100096067 359
927 3300011119 Ga0105246_10065734 Ga0105246_100657342 359
928 3300013296 Ga0157374_10001444 Ga0157374_1000144414 359
929 3300013297 Ga0157378_10001339 Ga0157378_100013397 359
930 3300013308 Ga0157375_10014738 Ga0157375_100147385 359
931 3300014969 Ga0157376_10000678 Ga0157376_1000067810 359
932 3300017792 Ga0163161_10102018 Ga0163161_101020181 359
933 3300020082 Ga0206353_12009786 Ga0206353_120097867 359
934 3300025297 Ga0209758_1000007 Ga0209758_1000007681 359
935 3300025900 Ga0207710_10001070 Ga0207710_100010706 359
936 3300025909 Ga0207705_10000978 Ga0207705_1000097815 359
937 3300025927 Ga0207687_10004280 Ga0207687_100042802 359
938 3300025934 Ga0207686_10015896 Ga0207686_100158962 359
939 3300025935 Ga0207709_10000276 Ga0207709_1000027612 359
940 3300025938 Ga0207704_10000034 Ga0207704_1000003459 359
941 3300025940 Ga0207691_10136897 Ga0207691_101368972 359
942 3300025942 Ga0207689_10001065 Ga0207689_1000106512 359
943 3300025949 Ga0207667_10000013 Ga0207667_10000013195 359
944 3300025960 Ga0207651_10000010 Ga0207651_1000001059 359
945 3300025961 Ga0207712_10000002 Ga0207712_10000002708 359
946 3300025961 Ga0207712_10025579 Ga0207712_100255792 359
947 3300026023 Ga0207677_10000021 Ga0207677_10000021111 359
948 3300026078 Ga0207702_10005396 Ga0207702_1000539610 359
949 3300026088 Ga0207641_10003354 Ga0207641_100033545 359
950 3300026089 Ga0207648_10000219 Ga0207648_1000021910 359
951 3300028380 Ga0268265_10000176 Ga0268265_1000017661 359
952 3300028381 Ga0268264_10000548 Ga0268264_1000054826 359
953 3300031456 Ga0307513_10018836 Ga0307513_100188364 359
954 3300046691 Ga0495670_0002065 Ga0495670_0002065_4753_5838 359
955 3300047443 Ga0495687_000517 Ga0495687_000517_43977_45200 359
956 3300048918 Ga0496115_0000325 Ga0496115_0000325_26977_28077 359
957 3300053094 Ga0500566_0000436 Ga0500566_0000436_18037_19125 359
958 3300053096 Ga0500641_0051800 Ga0500641_0051800_581_1666 359
959 iso_pu_bacteria 2582581305 2585261115 359
960 3300005295 Ga0065707_10090430 Ga0065707_100904302 360
961 3300005347 Ga0070668_100000050 Ga0070668_10000005055 360
962 3300005347 Ga0070668_100000245 Ga0070668_10000024522 360
963 3300005347 Ga0070668_100153205 Ga0070668_1001532052 360
964 3300005353 Ga0070669_100005571 Ga0070669_1000055716 360
965 3300005353 Ga0070669_100083318 Ga0070669_1000833182 360
966 3300005355 Ga0070671_100002015 Ga0070671_1000020155 360
967 3300005367 Ga0070667_100000025 Ga0070667_100000025151 360
968 3300005367 Ga0070667_100000101 Ga0070667_10000010113 360
969 3300005367 Ga0070667_100000339 Ga0070667_1000003395 360
970 3300005563 Ga0068855_100008046 Ga0068855_1000080463 360
971 3300005614 Ga0068856_100049902 Ga0068856_1000499024 360
972 3300005617 Ga0068859_100049550 Ga0068859_1000495503 360
973 3300005617 Ga0068859_100231493 Ga0068859_1002314932 360
974 3300005618 Ga0068864_100006624 Ga0068864_1000066242 360
975 3300005841 Ga0068863_100000187 Ga0068863_10000018731 360
976 3300005841 Ga0068863_100003456 Ga0068863_1000034565 360
977 3300005841 Ga0068863_100016390 Ga0068863_1000163904 360
978 3300005841 Ga0068863_100109995 Ga0068863_1001099952 360
979 3300005842 Ga0068858_100001621 Ga0068858_1000016217 360
980 3300005843 Ga0068860_100000442 Ga0068860_1000004425 360
981 3300005843 Ga0068860_100001488 Ga0068860_10000148818 360
982 3300005844 Ga0068862_100002718 Ga0068862_1000027182 360
983 3300006931 Ga0097620_100049551 Ga0097620_1000495513 360
984 3300006931 Ga0097620_100231486 Ga0097620_1002314862 360
985 3300009093 Ga0105240_10095948 Ga0105240_100959482 360
986 3300009174 Ga0105241_10170578 Ga0105241_101705783 360
987 3300025903 Ga0207680_10008448 Ga0207680_100084483 360
988 3300025913 Ga0207695_10051931 Ga0207695_100519314 360
989 3300025923 Ga0207681_10006262 Ga0207681_100062625 360
990 3300025923 Ga0207681_10057287 Ga0207681_100572872 360
991 3300025925 Ga0207650_10101664 Ga0207650_101016642 360
992 3300025931 Ga0207644_10002933 Ga0207644_100029332 360
993 3300025949 Ga0207667_10028577 Ga0207667_100285773 360
994 3300025972 Ga0207668_10000094 Ga0207668_1000009432 360
995 3300025972 Ga0207668_10000416 Ga0207668_1000041619 360
996 3300025972 Ga0207668_10066395 Ga0207668_100663952 360
997 3300025986 Ga0207658_10000023 Ga0207658_10000023149 360
998 3300025986 Ga0207658_10000077 Ga0207658_1000007713 360
999 3300025986 Ga0207658_10000492 Ga0207658_1000049238 360
1000 3300026035 Ga0207703_10001299 Ga0207703_1000129919 360
1001 3300026078 Ga0207702_10056561 Ga0207702_100565612 360
1002 3300026088 Ga0207641_10000243 Ga0207641_1000024361 360
1003 3300026088 Ga0207641_10000269 Ga0207641_1000026946 360
1004 3300026088 Ga0207641_10003551 Ga0207641_100035516 360
1005 3300026088 Ga0207641_10004624 Ga0207641_100046242 360
1006 3300026095 Ga0207676_10048363 Ga0207676_100483631 360
1007 3300028380 Ga0268265_10000808 Ga0268265_1000080811 360
1008 3300028381 Ga0268264_10000214 Ga0268264_1000021495 360
1009 3300028381 Ga0268264_10000491 Ga0268264_1000049158 360
1010 3300031911 Ga0307412_10007957 Ga0307412_100079572 360
1011 3300031911 Ga0307412_10136904 Ga0307412_101369042 360
1012 3300047472 Ga0495686_0006459 Ga0495686_0006459_1279_2382 360
1013 3300049679 Ga0501249_000063 Ga0501249_000063_25966_27057 360
1014 3300053087 Ga0500643_000134 Ga0500643_000134_12960_14093 360
1015 3300053093 Ga0500651_0008965 Ga0500651_0008965_3908_4993 360
1016 3300053148 Ga0500590_000141 Ga0500590_000141_8420_9505 360
1017 3300053724 Ga0500570_003712 Ga0500570_003712_6525_7610 360
1018 iso_pu_bacteria 2643221541 2643729393 360
1019 iso_pu_bacteria 2643221605 2644038999 360
1020 iso_pu_bacteria 2643221606 2644045869 360
1021 iso_pu_bacteria 2643221671 2644393446 360
1022 3300005295 Ga0065707_10112939 Ga0065707_101129392 361
1023 3300021388 Ga0213875_10005786 Ga0213875_100057864 361
1024 3300032004 Ga0307414_10180923 Ga0307414_101809232 361
1025 3300037853 Ga0436364_0689048 Ga0436364_0689048_830_1939 361
1026 3300053133 Ga0500655_000244 Ga0500655_000244_5959_7050 361
1027 iso_pu_bacteria 2946787523 2946789911 361
1028 3300002076 JGI24749J21850_1000019 JGI24749J21850_100001923 362
1029 3300002459 JGI24751J29686_10000519 JGI24751J29686_1000051913 362
1030 3300005295 Ga0065707_10084228 Ga0065707_100842287 362
1031 3300005331 Ga0070670_100000060 Ga0070670_10000006017 362
1032 3300005353 Ga0070669_100000053 Ga0070669_10000005399 362
1033 3300005367 Ga0070667_100147964 Ga0070667_1001479642 362
1034 3300005617 Ga0068859_100006620 Ga0068859_10000662015 362
1035 3300005618 Ga0068864_100000069 Ga0068864_10000006999 362
1036 3300005719 Ga0068861_100004343 Ga0068861_10000434310 362
1037 3300005844 Ga0068862_100000082 Ga0068862_10000008217 362
1038 3300006931 Ga0097620_100006621 Ga0097620_1000066212 362
1039 3300009177 Ga0105248_10000101 Ga0105248_1000010181 362
1040 3300014326 Ga0157380_10000793 Ga0157380_100007937 362
1041 3300025923 Ga0207681_10000003 Ga0207681_10000003503 362
1042 3300025925 Ga0207650_10000148 Ga0207650_1000014870 362
1043 3300025941 Ga0207711_10005144 Ga0207711_1000514411 362
1044 3300025986 Ga0207658_10001737 Ga0207658_100017375 362
1045 3300026095 Ga0207676_10000009 Ga0207676_10000009505 362
1046 3300026118 Ga0207675_100001422 Ga0207675_10000142217 362
1047 3300028380 Ga0268265_10000030 Ga0268265_10000030105 362
1048 3300039450 Ga0436363_1058292 Ga0436363_1058292_763_1932 362
1049 3300049513 Ga0501290_000064 Ga0501290_000064_5474_6580 362
1050 3300049517 Ga0501294_002490 Ga0501294_002490_10_1134 362
1051 3300049662 Ga0501222_000369 Ga0501222_000369_3512_4618 362
1052 3300049669 Ga0501235_000282 Ga0501235_000282_8349_9473 362
1053 3300049705 Ga0501225_0010379 Ga0501225_0010379_35_1123 362
1054 3300049705 Ga0501225_0010787 Ga0501225_0010787_205_1311 362
1055 3300049776 Ga0501280_000005 Ga0501280_000005_13299_14405 362
1056 3300049777 Ga0501281_00328 Ga0501281_00328_987_2093 362
1057 3300053087 Ga0500643_005223 Ga0500643_005223_663_1760 362
1058 3300053140 Ga0500573_0000010 Ga0500573_0000010_55666_56814 362
1059 3300005842 Ga0068858_100069876 Ga0068858_1000698765 363
1060 3300015690 Ga0183363_1010 Ga0183363_101011 363
1061 3300016635 Ga0183361_10895 Ga0183361_108951 363
1062 3300046513 Ga0495616_0000010 Ga0495616_0000010_129347_130444 363
1063 3300048928 Ga0496125_0104914 Ga0496125_0104914_325_1416 363
1064 3300049669 Ga0501235_005237 Ga0501235_005237_1625_2716 363
1065 iso_pu_bacteria 2830075706 2830075729 363
1066 3300013105 Ga0157369_10159054 Ga0157369_101590542 364
1067 3300046460 Ga0495638_0000068 Ga0495638_0000068_86219_87313 364
1068 3300046501 Ga0495607_0009022 Ga0495607_0009022_2294_3409 364
1069 iso_pu_bacteria 2885429604 2885432170 364
1070 3300001904 JGI24736J21556_1000036 JGI24736J21556_100003610 367
1071 3300009011 Ga0105251_10031794 Ga0105251_100317942 367
1072 3300025735 Ga0207713_1027808 Ga0207713_10278083 367
1073 3300025920 Ga0207649_10111966 Ga0207649_101119662 367
1074 3300031731 Ga0307405_10010011 Ga0307405_100100112 367
1075 3300031911 Ga0307412_10011087 Ga0307412_100110873 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02912

Phe_tRNA-synt_N

Aminoacyl tRNA synthetase class II, N-terminal domain

18

86

0.98

PF01409

tRNA-synt_2d

tRNA synthetases class II core domain (F)

90

391

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.8582 90 351
4p73-assembly1.cif.gz_C phers in complex with compound 1a 0.8533 90 351
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.8512 90 351
6p8t-assembly1.cif.gz_D acinetobacter baumannii trna synthetase in complex with compound 1 0.8442 91 352
4p75-assembly1.cif.gz_D phers in complex with compound 4a 0.841 88 351
ID Description Score Start End Superfamily
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9063 106 351 3.30.930.10
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8985 106 351 3.30.930.10
3vqxB02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8273 106 339 3.30.930.10
af_Q94K73_217_334_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8041 230 352 3.30.930.10
3l4gO01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7911 107 340 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A6D0IN12-F1-model_v4 phenylalanine--tRNA ligase (EC 6.1.1.20) 0.9237 120 337 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0046872
AF-A0A529NSV6-F1-model_v4 phenylalanine--tRNA ligase (EC 6.1.1.20) 0.923 122 336 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0046872
AF-A0A529NSV6-F1-model_v4 phenylalanine--tRNA ligase (EC 6.1.1.20) 0.9187 122 336 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0046872
AF-A0A4Y9J4T2-F1-model_v4 phenylalanine--tRNA ligase (EC 6.1.1.20) 0.9183 190 330 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0016740
AF-A0A6D0IN12-F1-model_v4 phenylalanine--tRNA ligase (EC 6.1.1.20) 0.9145 120 337 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0046872

Feature Viewer

pLDDT pTM Quality
85.36 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map