F489571

General Info

Members Datasets Scaffolds Average Seq Length
1075 309 2150 151

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_001960|Ga0500643_001960_1199_1741
Length 180
Sequence MAAGSADVGSSSGIRAGPMSEAAEDAVAKPAIGPLDIRRVMAALPHRYPMLLVDRVESIIPDKSIVAIKAVTINEGFFNGHFPGRPIMPGVLIVEALAQAAGVLAVESLGLAGTGKLVYFMAIEEAKFRAPVEPGVLLRLEVEFTQMRSKVCKFSGRALIEDKLAAEASFTAMIADPPAA

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
113 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
114 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
223 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
227 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
245 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
307 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
309 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.19
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0
Rhizoplane 5.21
Rhizosphere 87.72
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_001960 3300053087 Bacteria 11149
2 SwRhRL2b_contig_1151829 2162886007 Bacteria 5435
3 SwRhRL2b_contig_724347 2162886007 Bacteria 4499
4 JGI24736J21556_1000050 3300001904 Bacteria 19452
5 JGI24736J21556_1003007 3300001904 Bacteria 2947
6 JGI24736J21556_1015632 3300001904 Bacteria 1214
7 JGI24741J21665_1009840 3300001915 Bacteria 1737
8 JGI24752J21851_1000419 3300001976 Bacteria 5780
9 JGI24752J21851_1006940 3300001976 Bacteria 1479
10 JGI24740J21852_10005088 3300001979 Bacteria 5584
11 JGI24740J21852_10005255 3300001979 Bacteria 5497
12 JGI24740J21852_10026236 3300001979 Bacteria 1954
13 JGI24739J22299_10007091 3300001989 Bacteria 4219
14 JGI24739J22299_10007201 3300001989 Bacteria 4186
15 JGI24739J22299_10007913 3300001989 Bacteria 3978
16 JGI24739J22299_10014449 3300001989 Bacteria 2872
17 JGI24739J22299_10021332 3300001989 Bacteria 2306
18 JGI24739J22299_10244579 3300001989 Bacteria 525
19 JGI24737J22298_10000263 3300001990 Bacteria 17247
20 JGI24737J22298_10007578 3300001990 Bacteria 3657
21 JGI24737J22298_10010047 3300001990 Bacteria 3133
22 JGI24737J22298_10021562 3300001990 Bacteria 2052
23 JGI24737J22298_10058068 3300001990 Bacteria 1167
24 JGI24743J22301_10071440 3300001991 Bacteria 724
25 JGI24735J21928_10003538 3300002067 Bacteria 5317
26 JGI24735J21928_10007302 3300002067 Bacteria 3607
27 JGI24735J21928_10039163 3300002067 Bacteria 1386
28 JGI24735J21928_10057873 3300002067 Bacteria 1115
29 JGI24750J21931_1000225 3300002070 Bacteria 9622
30 JGI24748J21848_1000088 3300002074 Bacteria 27066
31 JGI24748J21848_1004123 3300002074 Bacteria 1665
32 JGI24738J21930_10000777 3300002075 Bacteria 9121
33 JGI24738J21930_10001723 3300002075 Bacteria 5980
34 JGI24738J21930_10014908 3300002075 Bacteria 1662
35 JGI24738J21930_10017035 3300002075 Bacteria 1530
36 JGI24749J21850_1012028 3300002076 Bacteria 1215
37 JGI24034J26672_10000034 3300002239 Bacteria 85929
38 JGI24034J26672_10091823 3300002239 Bacteria 564
39 JGI24034J26672_10111352 3300002239 Bacteria 523
40 JGI24742J22300_10045354 3300002244 Bacteria 789
41 JGI24751J29686_10066237 3300002459 Bacteria 744
42 Ga0055530_10067205 3300003791 Bacteria 782
43 Ga0055540_1001754 3300003792 Bacteria 12410
44 JGI25405J52794_10083993 3300003911 Bacteria 702
45 Ga0065704_10070220 3300005289 Bacteria 67739
46 Ga0065704_10070273 3300005289 Bacteria 42544
47 Ga0065715_10522699 3300005293 Bacteria 762
48 Ga0065707_10082229 3300005295 Bacteria 18711
49 Ga0065707_10091608 3300005295 Bacteria 3910
50 Ga0070658_10000652 3300005327 Bacteria 29975
51 Ga0070658_10013809 3300005327 Bacteria 6479
52 Ga0070658_10456375 3300005327 Bacteria 1101
53 Ga0070658_10784924 3300005327 Bacteria 827
54 Ga0070658_10846472 3300005327 Bacteria 795
55 Ga0070658_11274673 3300005327 Bacteria 638
56 Ga0070658_11278377 3300005327 Bacteria 637
57 Ga0070676_10008676 3300005328 Bacteria 5484
58 Ga0070676_10014836 3300005328 Bacteria 4288
59 Ga0070676_10719243 3300005328 Bacteria 730
60 Ga0070683_100005348 3300005329 Bacteria 10706
61 Ga0070683_100062337 3300005329 Bacteria 3467
62 Ga0070683_100064333 3300005329 Bacteria 3414
63 Ga0070683_100557222 3300005329 Bacteria 1096
64 Ga0070690_100000334 3300005330 Bacteria 24148
65 Ga0070690_100050676 3300005330 Bacteria 2649
66 Ga0070670_100021878 3300005331 Bacteria 5501
67 Ga0070670_100063472 3300005331 Bacteria 3171
68 Ga0070670_100101721 3300005331 Bacteria 2474
69 Ga0070670_100136701 3300005331 Bacteria 2118
70 Ga0070670_100331434 3300005331 Bacteria 1335
71 Ga0070670_101112809 3300005331 Bacteria 720
72 Ga0070677_10165757 3300005333 Bacteria 1040
73 Ga0070677_10297584 3300005333 Bacteria 819
74 Ga0068869_100001147 3300005334 Bacteria 15456
75 Ga0068869_100092583 3300005334 Bacteria 2275
76 Ga0068869_100532578 3300005334 Bacteria 985
77 Ga0068869_100609696 3300005334 Bacteria 923
78 Ga0068869_100805001 3300005334 Bacteria 808
79 Ga0070666_10000002 3300005335 Bacteria 478684
80 Ga0070666_10002190 3300005335 Bacteria 11860
81 Ga0070666_10026826 3300005335 Bacteria 3767
82 Ga0070666_10054135 3300005335 Bacteria 2707
83 Ga0070666_10062503 3300005335 Bacteria 2523
84 Ga0070666_10182766 3300005335 Bacteria 1471
85 Ga0070666_10250140 3300005335 Bacteria 1255
86 Ga0070666_10352933 3300005335 Bacteria 1053
87 Ga0070680_100016740 3300005336 Bacteria 5770
88 Ga0068868_100039908 3300005338 Bacteria 3650
89 Ga0068868_100071647 3300005338 Bacteria 2764
90 Ga0068868_100168143 3300005338 Bacteria 1814
91 Ga0068868_100190956 3300005338 Bacteria 1703
92 Ga0068868_100244103 3300005338 Bacteria 1510
93 Ga0068868_100405901 3300005338 Bacteria 1177
94 Ga0070660_100004906 3300005339 Bacteria 9252
95 Ga0070660_100012491 3300005339 Bacteria 6066
96 Ga0070660_100017060 3300005339 Bacteria 5286
97 Ga0070660_100214784 3300005339 Bacteria 1562
98 Ga0070660_100227050 3300005339 Bacteria 1519
99 Ga0070660_100264673 3300005339 Bacteria 1404
100 Ga0070660_100955613 3300005339 Bacteria 723
101 Ga0070689_100014956 3300005340 Bacteria 5649
102 Ga0070689_100076938 3300005340 Bacteria 2615
103 Ga0070689_100150929 3300005340 Bacteria 1874
104 Ga0070661_100014084 3300005344 Bacteria 5629
105 Ga0070661_100033923 3300005344 Bacteria 3700
106 Ga0070661_100057871 3300005344 Bacteria 2840
107 Ga0070661_100064931 3300005344 Bacteria 2682
108 Ga0070661_100086907 3300005344 Bacteria 2312
109 Ga0070661_100350033 3300005344 Bacteria 1159
110 Ga0070661_100364314 3300005344 Bacteria 1136
111 Ga0070692_10012871 3300005345 Bacteria 3886
112 Ga0070692_10047487 3300005345 Bacteria 2222
113 Ga0070668_100032336 3300005347 Bacteria 3982
114 Ga0070668_100033446 3300005347 Bacteria 3915
115 Ga0070668_100047447 3300005347 Bacteria 3302
116 Ga0070668_100049960 3300005347 Bacteria 3218
117 Ga0070668_100075984 3300005347 Bacteria 2623
118 Ga0070668_100165212 3300005347 Bacteria 1798
119 Ga0070668_100755790 3300005347 Bacteria 861
120 Ga0070668_101006065 3300005347 Bacteria 749
121 Ga0070669_100000055 3300005353 Bacteria 111488
122 Ga0070669_100002134 3300005353 Bacteria 14303
123 Ga0070669_100009650 3300005353 Bacteria 6875
124 Ga0070669_100012645 3300005353 Bacteria 5990
125 Ga0070669_100024805 3300005353 Bacteria 4303
126 Ga0070669_100248596 3300005353 Bacteria 1415
127 Ga0070669_100375860 3300005353 Bacteria 1158
128 Ga0070675_100006603 3300005354 Bacteria 8915
129 Ga0070675_100020664 3300005354 Bacteria 5255
130 Ga0070675_100030973 3300005354 Bacteria 4321
131 Ga0070675_100179091 3300005354 Bacteria 1832
132 Ga0070675_100789271 3300005354 Bacteria 868
133 Ga0070675_101216467 3300005354 Bacteria 694
134 Ga0070671_100005849 3300005355 Bacteria 9799
135 Ga0070671_100011280 3300005355 Bacteria 7180
136 Ga0070671_100011936 3300005355 Bacteria 6989
137 Ga0070671_100023684 3300005355 Bacteria 5026
138 Ga0070671_100086184 3300005355 Bacteria 2627
139 Ga0070671_100102625 3300005355 Bacteria 2400
140 Ga0070671_100137074 3300005355 Bacteria 2063
141 Ga0070671_100159874 3300005355 Bacteria 1904
142 Ga0070671_100212104 3300005355 Bacteria 1642
143 Ga0070671_100453909 3300005355 Bacteria 1100
144 Ga0070674_100027463 3300005356 Bacteria 3730
145 Ga0070674_100068509 3300005356 Bacteria 2500
146 Ga0070674_100073881 3300005356 Bacteria 2418
147 Ga0070674_100135511 3300005356 Bacteria 1841
148 Ga0070674_100363249 3300005356 Bacteria 1173
149 Ga0070673_100000991 3300005364 Bacteria 16094
150 Ga0070673_100002271 3300005364 Bacteria 11653
151 Ga0070673_100009946 3300005364 Bacteria 6411
152 Ga0070673_100015515 3300005364 Bacteria 5353
153 Ga0070673_100083198 3300005364 Bacteria 2599
154 Ga0070673_100088078 3300005364 Bacteria 2531
155 Ga0070673_100169176 3300005364 Bacteria 1864
156 Ga0070673_100188398 3300005364 Bacteria 1770
157 Ga0070673_100672567 3300005364 Bacteria 949
158 Ga0070673_100901082 3300005364 Bacteria 820
159 Ga0070673_100957516 3300005364 Bacteria 796
160 Ga0070688_100001690 3300005365 Bacteria 11028
161 Ga0070688_100042597 3300005365 Bacteria 2794
162 Ga0070659_100004264 3300005366 Bacteria 10207
163 Ga0070659_100006645 3300005366 Bacteria 8357
164 Ga0070659_100034208 3300005366 Bacteria 3952
165 Ga0070659_100194740 3300005366 Bacteria 1667
166 Ga0070667_100000222 3300005367 Bacteria 65587
167 Ga0070667_100000763 3300005367 Bacteria 30599
168 Ga0070667_100002812 3300005367 Bacteria 15011
169 Ga0070667_100003416 3300005367 Bacteria 13529
170 Ga0070667_100004916 3300005367 Bacteria 11202
171 Ga0070667_100005143 3300005367 Bacteria 10947
172 Ga0070667_100006574 3300005367 Bacteria 9665
173 Ga0070667_100014036 3300005367 Bacteria 6621
174 Ga0070667_100077387 3300005367 Bacteria 2840
175 Ga0070667_100082755 3300005367 Bacteria 2748
176 Ga0070667_100237683 3300005367 Bacteria 1626
177 Ga0070667_101063854 3300005367 Bacteria 756
178 Ga0070709_10052636 3300005434 Bacteria 2560
179 Ga0070714_100172906 3300005435 Bacteria 1961
180 Ga0070713_100247830 3300005436 Bacteria 1624
181 Ga0070705_100189496 3300005440 Bacteria 1400
182 Ga0070694_100005487 3300005444 Bacteria 7681
183 Ga0070663_100029611 3300005455 Bacteria 3744
184 Ga0070663_100063495 3300005455 Bacteria 2667
185 Ga0070663_100064388 3300005455 Bacteria 2650
186 Ga0070663_100068061 3300005455 Bacteria 2584
187 Ga0070663_100121894 3300005455 Bacteria 1970
188 Ga0070678_100005675 3300005456 Bacteria 7248
189 Ga0070678_100014857 3300005456 Bacteria 4927
190 Ga0070678_100021955 3300005456 Bacteria 4219
191 Ga0070678_100052130 3300005456 Bacteria 2969
192 Ga0070678_100357307 3300005456 Bacteria 1258
193 Ga0070678_101678587 3300005456 Bacteria 597
194 Ga0070662_100002019 3300005457 Bacteria 12431
195 Ga0070662_100002085 3300005457 Bacteria 12258
196 Ga0070662_100002761 3300005457 Bacteria 10857
197 Ga0070662_100071930 3300005457 Bacteria 2552
198 Ga0070662_100077680 3300005457 Bacteria 2464
199 Ga0070662_100100359 3300005457 Bacteria 2189
200 Ga0070662_100117063 3300005457 Bacteria 2038
201 Ga0070662_100126832 3300005457 Bacteria 1962
202 Ga0070662_100132032 3300005457 Bacteria 1926
203 Ga0070662_100138244 3300005457 Bacteria 1885
204 Ga0070662_100158586 3300005457 Bacteria 1768
205 Ga0070662_100598754 3300005457 Bacteria 927
206 Ga0070662_100823938 3300005457 Bacteria 789
207 Ga0070681_10073507 3300005458 Bacteria 3380
208 Ga0070681_10100447 3300005458 Bacteria 2839
209 Ga0070681_10217200 3300005458 Bacteria 1828
210 Ga0070681_10233756 3300005458 Bacteria 1752
211 Ga0068867_100004339 3300005459 Bacteria 9983
212 Ga0068867_100024493 3300005459 Bacteria 4324
213 Ga0068867_100025006 3300005459 Bacteria 4282
214 Ga0070679_100094458 3300005530 Bacteria 2977
215 Ga0070679_100544252 3300005530 Bacteria 1104
216 Ga0070679_101501911 3300005530 Bacteria 621
217 Ga0070679_101646574 3300005530 Bacteria 589
218 Ga0070684_100051073 3300005535 Bacteria 3592
219 Ga0070684_100402939 3300005535 Bacteria 1261
220 Ga0068853_100012957 3300005539 Bacteria 6797
221 Ga0068853_100100197 3300005539 Bacteria 2560
222 Ga0068853_100112078 3300005539 Bacteria 2424
223 Ga0068853_100115195 3300005539 Bacteria 2392
224 Ga0068853_100117056 3300005539 Bacteria 2373
225 Ga0068853_100502582 3300005539 Bacteria 1145
226 Ga0068853_100521047 3300005539 Bacteria 1124
227 Ga0068853_100784295 3300005539 Bacteria 912
228 Ga0070672_100002094 3300005543 Bacteria 12579
229 Ga0070672_100009145 3300005543 Bacteria 6817
230 Ga0070672_100045227 3300005543 Bacteria 3404
231 Ga0070672_100081440 3300005543 Bacteria 2595
232 Ga0070672_100162312 3300005543 Bacteria 1855
233 Ga0070672_100384915 3300005543 Bacteria 1200
234 Ga0070672_100492382 3300005543 Bacteria 1060
235 Ga0070686_100000003 3300005544 Bacteria 308397
236 Ga0070696_100017543 3300005546 Bacteria 4833
237 Ga0070693_100057850 3300005547 Bacteria 2242
238 Ga0070693_100495267 3300005547 Bacteria 866
239 Ga0070665_100000036 3300005548 Bacteria 314603
240 Ga0070665_100009237 3300005548 Bacteria 9990
241 Ga0070665_100016369 3300005548 Bacteria 7436
242 Ga0070665_100018770 3300005548 Bacteria 6934
243 Ga0070665_100025030 3300005548 Bacteria 6016
244 Ga0070665_100029159 3300005548 Bacteria 5554
245 Ga0070665_100056611 3300005548 Bacteria 3931
246 Ga0070665_100302964 3300005548 Bacteria 1601
247 Ga0068855_100000416 3300005563 Bacteria 52868
248 Ga0068855_100013061 3300005563 Bacteria 10018
249 Ga0068855_100060574 3300005563 Bacteria 4426
250 Ga0068855_100233435 3300005563 Bacteria 2058
251 Ga0068855_100287476 3300005563 Bacteria 1824
252 Ga0068855_100355347 3300005563 Bacteria 1613
253 Ga0070664_100002143 3300005564 Bacteria 15814
254 Ga0070664_100008627 3300005564 Bacteria 8248
255 Ga0070664_100028885 3300005564 Bacteria 4618
256 Ga0070664_100065520 3300005564 Bacteria 3100
257 Ga0070664_100372129 3300005564 Bacteria 1303
258 Ga0070664_100936308 3300005564 Bacteria 813
259 Ga0068857_100006484 3300005577 Bacteria 10036
260 Ga0068857_100006868 3300005577 Bacteria 9796
261 Ga0068857_100018717 3300005577 Bacteria 6080
262 Ga0068857_100025709 3300005577 Bacteria 5184
263 Ga0068857_100067063 3300005577 Bacteria 3193
264 Ga0068857_100130949 3300005577 Bacteria 2262
265 Ga0068857_100186437 3300005577 Bacteria 1889
266 Ga0068857_100240388 3300005577 Bacteria 1658
267 Ga0068854_100000967 3300005578 Bacteria 17292
268 Ga0068854_100008248 3300005578 Bacteria 6689
269 Ga0068854_100012824 3300005578 Bacteria 5489
270 Ga0068854_100046883 3300005578 Bacteria 3079
271 Ga0068854_100078121 3300005578 Bacteria 2437
272 Ga0068854_100135992 3300005578 Bacteria 1881
273 Ga0068854_100219895 3300005578 Bacteria 1502
274 Ga0068854_100263981 3300005578 Bacteria 1380
275 Ga0068854_100414384 3300005578 Bacteria 1118
276 Ga0068856_100038595 3300005614 Bacteria 4688
277 Ga0068856_100437855 3300005614 Bacteria 1328
278 Ga0068856_100547845 3300005614 Bacteria 1178
279 Ga0068852_100010427 3300005616 Bacteria 6945
280 Ga0068852_100017888 3300005616 Bacteria 5572
281 Ga0068852_100035305 3300005616 Bacteria 4169
282 Ga0068852_100088901 3300005616 Bacteria 2760
283 Ga0068852_100107546 3300005616 Bacteria 2530
284 Ga0068852_100190496 3300005616 Bacteria 1935
285 Ga0068852_100328026 3300005616 Bacteria 1488
286 Ga0068852_100407529 3300005616 Bacteria 1339
287 Ga0068852_101031276 3300005616 Bacteria 842
288 Ga0068852_101050548 3300005616 Bacteria 834
289 Ga0068859_100004454 3300005617 Bacteria 14289
290 Ga0068859_100032582 3300005617 Bacteria 5234
291 Ga0068859_100061715 3300005617 Bacteria 3777
292 Ga0068859_100084481 3300005617 Bacteria 3220
293 Ga0068859_100236618 3300005617 Bacteria 1915
294 Ga0068864_100000004 3300005618 Bacteria 489341
295 Ga0068864_100002759 3300005618 Bacteria 14484
296 Ga0068864_100003689 3300005618 Bacteria 12646
297 Ga0068864_100005457 3300005618 Bacteria 10426
298 Ga0068864_100015275 3300005618 Bacteria 6385
299 Ga0068864_100046298 3300005618 Bacteria 3732
300 Ga0068864_100211912 3300005618 Bacteria 1784
301 Ga0068866_10027636 3300005718 Bacteria 2694
302 Ga0068866_10343035 3300005718 Bacteria 947
303 Ga0068861_100011513 3300005719 Bacteria 6154
304 Ga0068861_100107831 3300005719 Bacteria 2227
305 Ga0068851_10038669 3300005834 Bacteria 2394
306 Ga0068851_10098165 3300005834 Bacteria 1551
307 Ga0068851_10186911 3300005834 Bacteria 1150
308 Ga0068851_10337848 3300005834 Bacteria 874
309 Ga0068870_10375599 3300005840 Bacteria 919
310 Ga0068863_100000002 3300005841 Bacteria 489510
311 Ga0068863_100000034 3300005841 Bacteria 168359
312 Ga0068863_100000058 3300005841 Bacteria 123096
313 Ga0068863_100012807 3300005841 Bacteria 8088
314 Ga0068863_100013229 3300005841 Bacteria 7959
315 Ga0068863_100040903 3300005841 Bacteria 4406
316 Ga0068863_100062881 3300005841 Bacteria 3510
317 Ga0068863_100066632 3300005841 Bacteria 3406
318 Ga0068863_100106796 3300005841 Bacteria 2664
319 Ga0068858_100003215 3300005842 Bacteria 16311
320 Ga0068858_100003738 3300005842 Bacteria 15056
321 Ga0068858_100005852 3300005842 Bacteria 12011
322 Ga0068858_100020726 3300005842 Bacteria 6141
323 Ga0068858_100070857 3300005842 Bacteria 3232
324 Ga0068858_100099066 3300005842 Bacteria 2718
325 Ga0068858_100350577 3300005842 Bacteria 1414
326 Ga0068860_100000001 3300005843 Bacteria 703043
327 Ga0068860_100000057 3300005843 Bacteria 201847
328 Ga0068860_100011114 3300005843 Bacteria 8872
329 Ga0068860_100025331 3300005843 Bacteria 5725
330 Ga0068860_100051397 3300005843 Bacteria 3922
331 Ga0068860_100078845 3300005843 Bacteria 3132
332 Ga0068860_100137842 3300005843 Bacteria 2344
333 Ga0068860_100152316 3300005843 Bacteria 2227
334 Ga0068860_100233646 3300005843 Bacteria 1787
335 Ga0068860_100284840 3300005843 Bacteria 1616
336 Ga0068862_100000002 3300005844 Bacteria 489341
337 Ga0068862_100003077 3300005844 Bacteria 14538
338 Ga0068862_100011549 3300005844 Bacteria 7287
339 Ga0068862_100023350 3300005844 Bacteria 5181
340 Ga0068862_100023655 3300005844 Bacteria 5150
341 Ga0068862_100025436 3300005844 Bacteria 4970
342 Ga0068862_100950462 3300005844 Bacteria 847
343 Ga0081455_10000285 3300005937 Bacteria 66909
344 Ga0081538_10004145 3300005981 Bacteria 13449
345 Ga0081539_10015411 3300005985 Bacteria 5557
346 Ga0075362_10141481 3300006177 Bacteria 1150
347 Ga0075369_10044211 3300006186 Bacteria 1913
348 Ga0075369_10109762 3300006186 Bacteria 1243
349 Ga0075366_10080134 3300006195 Bacteria 1950
350 Ga0097621_100029076 3300006237 Bacteria 4362
351 Ga0097621_100031489 3300006237 Bacteria 4210
352 Ga0097621_100041012 3300006237 Bacteria 3724
353 Ga0097621_100068813 3300006237 Bacteria 2921
354 Ga0097621_100387448 3300006237 Bacteria 1249
355 Ga0075370_10012327 3300006353 Bacteria 4514
356 Ga0075370_10299786 3300006353 Bacteria 956
357 Ga0068871_100032747 3300006358 Bacteria 4109
358 Ga0068871_100061530 3300006358 Bacteria 3066
359 Ga0068871_100069819 3300006358 Bacteria 2886
360 Ga0068871_100281172 3300006358 Bacteria 1456
361 Ga0068871_100571483 3300006358 Bacteria 1026
362 Ga0068871_100757637 3300006358 Bacteria 893
363 Ga0075431_101155980 3300006847 Bacteria 737
364 Ga0075433_10321687 3300006852 Bacteria 1368
365 Ga0075434_100138580 3300006871 Bacteria 2452
366 Ga0068865_100022990 3300006881 Bacteria 4075
367 Ga0075436_100706768 3300006914 Bacteria 747
368 Ga0097620_100004454 3300006931 Bacteria 14289
369 Ga0097620_100032585 3300006931 Bacteria 5234
370 Ga0097620_100061707 3300006931 Bacteria 3777
371 Ga0097620_100084480 3300006931 Bacteria 3220
372 Ga0097620_100236599 3300006931 Bacteria 1915
373 Ga0075435_100362972 3300007076 Bacteria 1242
374 Ga0105251_10000318 3300009011 Bacteria 48256
375 Ga0105251_10000528 3300009011 Bacteria 36047
376 Ga0105251_10280942 3300009011 Bacteria 753
377 Ga0105240_10018614 3300009093 Bacteria 9312
378 Ga0105240_10038887 3300009093 Bacteria 6099
379 Ga0105240_10079593 3300009093 Bacteria 4032
380 Ga0105240_10544104 3300009093 Bacteria 1285
381 Ga0105240_10963601 3300009093 Bacteria 914
382 Ga0111539_10082456 3300009094 Bacteria 3782
383 Ga0105245_10005794 3300009098 Bacteria 10838
384 Ga0105245_10030788 3300009098 Bacteria 4746
385 Ga0105245_10237512 3300009098 Bacteria 1765
386 Ga0105247_10259226 3300009101 Bacteria 1191
387 Ga0105247_10587879 3300009101 Bacteria 824
388 Ga0105243_10014013 3300009148 Bacteria 6067
389 Ga0105241_10049088 3300009174 Bacteria 3213
390 Ga0105241_10135351 3300009174 Bacteria 2000
391 Ga0105241_10183692 3300009174 Bacteria 1736
392 Ga0105241_10278097 3300009174 Bacteria 1428
393 Ga0105241_10499137 3300009174 Bacteria 1085
394 Ga0105242_10053897 3300009176 Bacteria 3286
395 Ga0105248_10002544 3300009177 Bacteria 20305
396 Ga0105248_10004898 3300009177 Bacteria 14796
397 Ga0105248_10024303 3300009177 Bacteria 6738
398 Ga0105248_10029706 3300009177 Bacteria 6099
399 Ga0105248_10049395 3300009177 Bacteria 4718
400 Ga0105248_10054703 3300009177 Bacteria 4476
401 Ga0105248_10067315 3300009177 Bacteria 4021
402 Ga0105248_10074938 3300009177 Bacteria 3803
403 Ga0105248_10155322 3300009177 Bacteria 2582
404 Ga0105248_10232493 3300009177 Bacteria 2075
405 Ga0105248_10251577 3300009177 Bacteria 1989
406 Ga0105248_10995075 3300009177 Bacteria 947
407 Ga0105237_10048374 3300009545 Bacteria 4274
408 Ga0105237_11858343 3300009545 Bacteria 610
409 Ga0105237_12435927 3300009545 Bacteria 534
410 Ga0105238_10166463 3300009551 Bacteria 2180
411 Ga0105238_10176708 3300009551 Bacteria 2112
412 Ga0105238_10196587 3300009551 Bacteria 1992
413 Ga0105238_10706270 3300009551 Bacteria 1020
414 Ga0105249_10000026 3300009553 Bacteria 232053
415 Ga0105249_10000041 3300009553 Bacteria 195999
416 Ga0105249_10087542 3300009553 Bacteria 2906
417 Ga0105249_10250536 3300009553 Bacteria 1756
418 Ga0105249_10447159 3300009553 Bacteria 1330
419 Ga0105032_107290 3300009979 Bacteria 918
420 Ga0105239_10029892 3300010375 Bacteria 5992
421 Ga0105239_10064615 3300010375 Bacteria 4017
422 Ga0105239_10202988 3300010375 Bacteria 2221
423 Ga0105239_11266880 3300010375 Bacteria 850
424 Ga0105246_10015655 3300011119 Bacteria 4792
425 Ga0105246_10066570 3300011119 Bacteria 2522
426 Ga0157325_1003944 3300012485 Bacteria 846
427 Ga0157327_1005599 3300012512 Bacteria 1025
428 Ga0157326_1002093 3300012513 Bacteria 2159
429 Ga0157373_10018417 3300013100 Bacteria 5084
430 Ga0157373_10044638 3300013100 Bacteria 3164
431 Ga0157373_10049774 3300013100 Bacteria 2985
432 Ga0157373_10102886 3300013100 Bacteria 2009
433 Ga0157373_10118059 3300013100 Bacteria 1864
434 Ga0157373_11011791 3300013100 Bacteria 621
435 Ga0157371_10001127 3300013102 Bacteria 28864
436 Ga0157371_10035191 3300013102 Bacteria 3589
437 Ga0157371_10037325 3300013102 Bacteria 3477
438 Ga0157371_10135487 3300013102 Bacteria 1753
439 Ga0157371_10290414 3300013102 Bacteria 1182
440 Ga0157370_10015106 3300013104 Bacteria 7866
441 Ga0157370_10036432 3300013104 Bacteria 4773
442 Ga0157370_10057761 3300013104 Bacteria 3688
443 Ga0157370_10067871 3300013104 Bacteria 3371
444 Ga0157370_10107049 3300013104 Bacteria 2616
445 Ga0157370_10339077 3300013104 Bacteria 1385
446 Ga0157369_10028337 3300013105 Bacteria 6199
447 Ga0157369_10033530 3300013105 Bacteria 5642
448 Ga0157369_10048730 3300013105 Bacteria 4596
449 Ga0157369_10053242 3300013105 Bacteria 4375
450 Ga0157369_10449041 3300013105 Bacteria 1335
451 Ga0157369_11018390 3300013105 Bacteria 848
452 Ga0157374_10014163 3300013296 Bacteria 6972
453 Ga0157374_10055362 3300013296 Bacteria 3702
454 Ga0157374_10422179 3300013296 Bacteria 1332
455 Ga0157374_10733354 3300013296 Bacteria 1002
456 Ga0157378_10012326 3300013297 Bacteria 7485
457 Ga0157378_10094692 3300013297 Bacteria 2719
458 Ga0157378_11271653 3300013297 Bacteria 776
459 Ga0163162_10010333 3300013306 Bacteria 9073
460 Ga0163162_10041158 3300013306 Bacteria 4622
461 Ga0163162_10050732 3300013306 Bacteria 4161
462 Ga0163162_10095745 3300013306 Bacteria 3056
463 Ga0163162_10144998 3300013306 Bacteria 2490
464 Ga0163162_10151769 3300013306 Bacteria 2435
465 Ga0163162_10293544 3300013306 Bacteria 1757
466 Ga0163162_11495294 3300013306 Bacteria 769
467 Ga0157372_10050082 3300013307 Bacteria 4646
468 Ga0157372_10066362 3300013307 Bacteria 4054
469 Ga0157372_10162259 3300013307 Bacteria 2583
470 Ga0157372_10540758 3300013307 Bacteria 1358
471 Ga0157372_10920059 3300013307 Bacteria 1014
472 Ga0157375_10001559 3300013308 Bacteria 19743
473 Ga0157375_10023390 3300013308 Bacteria 5701
474 Ga0157375_10029940 3300013308 Bacteria 5126
475 Ga0157375_10044167 3300013308 Bacteria 4327
476 Ga0157375_10164783 3300013308 Bacteria 2361
477 Ga0157375_10214100 3300013308 Bacteria 2084
478 Ga0163163_10004621 3300014325 Bacteria 11758
479 Ga0163163_10022431 3300014325 Bacteria 5978
480 Ga0163163_10022750 3300014325 Bacteria 5939
481 Ga0163163_10295003 3300014325 Bacteria 1674
482 Ga0163163_11341414 3300014325 Bacteria 777
483 Ga0157380_10004942 3300014326 Bacteria 9293
484 Ga0157380_10006760 3300014326 Bacteria 8105
485 Ga0157380_10185537 3300014326 Bacteria 1831
486 Ga0157380_10999994 3300014326 Bacteria 870
487 Ga0157377_10007543 3300014745 Bacteria 5260
488 Ga0157377_10037098 3300014745 Bacteria 2685
489 Ga0157379_10003023 3300014968 Bacteria 14215
490 Ga0157379_10076998 3300014968 Bacteria 2987
491 Ga0157379_10168565 3300014968 Bacteria 1977
492 Ga0157376_10689635 3300014969 Bacteria 1025
493 Ga0163161_10000008 3300017792 Bacteria 294642
494 Ga0163161_10969811 3300017792 Bacteria 724
495 Ga0206354_11597705 3300020081 Bacteria 762
496 Ga0213875_10000504 3300021388 Bacteria 32687
497 Ga0207672_1001417 3300025223 Bacteria 1870
498 Ga0209674_104386 3300025226 Bacteria 2307
499 Ga0209026_1023632 3300025250 Bacteria 935
500 Ga0209677_106817 3300025253 Bacteria 2600
501 Ga0209050_1000119 3300025298 Bacteria 200661
502 Ga0207697_10000146 3300025315 Bacteria 34541
503 Ga0207697_10008369 3300025315 Bacteria 4530
504 Ga0207697_10042668 3300025315 Bacteria 1864
505 Ga0207656_10019689 3300025321 Bacteria 2672
506 Ga0207656_10046431 3300025321 Bacteria 1863
507 Ga0207656_10058493 3300025321 Bacteria 1684
508 Ga0207656_10178952 3300025321 Bacteria 1017
509 Ga0207696_1008396 3300025711 Bacteria 3956
510 Ga0207713_1001817 3300025735 Bacteria 16293
511 Ga0207713_1007873 3300025735 Bacteria 6211
512 Ga0207713_1018330 3300025735 Bacteria 3470
513 Ga0207682_10003216 3300025893 Bacteria 7145
514 Ga0207642_10038577 3300025899 Bacteria 2068
515 Ga0207642_10290280 3300025899 Bacteria 944
516 Ga0207710_10227695 3300025900 Bacteria 927
517 Ga0207688_10000514 3300025901 Bacteria 18701
518 Ga0207688_10002039 3300025901 Bacteria 10848
519 Ga0207688_10008611 3300025901 Bacteria 5556
520 Ga0207688_10257735 3300025901 Bacteria 1058
521 Ga0207688_10352254 3300025901 Bacteria 907
522 Ga0207680_10000004 3300025903 Bacteria 827324
523 Ga0207680_10010303 3300025903 Bacteria 4671
524 Ga0207680_10013802 3300025903 Bacteria 4161
525 Ga0207680_10027602 3300025903 Bacteria 3164
526 Ga0207680_10064143 3300025903 Bacteria 2251
527 Ga0207680_10150115 3300025903 Bacteria 1553
528 Ga0207680_10171087 3300025903 Bacteria 1463
529 Ga0207647_10006026 3300025904 Bacteria 8837
530 Ga0207647_10015636 3300025904 Bacteria 5195
531 Ga0207647_10023716 3300025904 Bacteria 4053
532 Ga0207647_10028124 3300025904 Bacteria 3656
533 Ga0207647_10077978 3300025904 Bacteria 1991
534 Ga0207645_10008722 3300025907 Bacteria 7060
535 Ga0207645_10008939 3300025907 Bacteria 6957
536 Ga0207645_10099693 3300025907 Bacteria 1873
537 Ga0207645_10289566 3300025907 Bacteria 1089
538 Ga0207645_10331791 3300025907 Bacteria 1016
539 Ga0207643_10208825 3300025908 Bacteria 1191
540 Ga0207705_10000023 3300025909 Bacteria 301755
541 Ga0207705_10003928 3300025909 Bacteria 11299
542 Ga0207705_10003980 3300025909 Bacteria 11236
543 Ga0207705_10061108 3300025909 Bacteria 2722
544 Ga0207705_10700309 3300025909 Bacteria 787
545 Ga0207654_10017454 3300025911 Bacteria 3752
546 Ga0207654_10075657 3300025911 Bacteria 2013
547 Ga0207707_10022822 3300025912 Bacteria 5472
548 Ga0207707_10261522 3300025912 Bacteria 1502
549 Ga0207707_10576637 3300025912 Bacteria 954
550 Ga0207695_10025245 3300025913 Bacteria 6658
551 Ga0207695_10029643 3300025913 Bacteria 6040
552 Ga0207695_10165830 3300025913 Bacteria 2137
553 Ga0207671_10002922 3300025914 Bacteria 17609
554 Ga0207660_10053288 3300025917 Bacteria 2883
555 Ga0207662_10100954 3300025918 Bacteria 1787
556 Ga0207662_10164397 3300025918 Bacteria 1420
557 Ga0207657_10000157 3300025919 Bacteria 69693
558 Ga0207657_10002054 3300025919 Bacteria 21785
559 Ga0207657_10007296 3300025919 Bacteria 11336
560 Ga0207657_10031703 3300025919 Bacteria 4783
561 Ga0207657_10199707 3300025919 Bacteria 1609
562 Ga0207649_10018259 3300025920 Bacteria 3986
563 Ga0207649_10019618 3300025920 Bacteria 3867
564 Ga0207649_10079153 3300025920 Bacteria 2122
565 Ga0207649_10609709 3300025920 Bacteria 840
566 Ga0207652_10005299 3300025921 Bacteria 10463
567 Ga0207652_10047408 3300025921 Bacteria 3670
568 Ga0207652_10251005 3300025921 Bacteria 1595
569 Ga0207652_10549465 3300025921 Bacteria 1038
570 Ga0207681_10000069 3300025923 Bacteria 92959
571 Ga0207681_10000125 3300025923 Bacteria 62866
572 Ga0207681_10000968 3300025923 Bacteria 18725
573 Ga0207681_10004090 3300025923 Bacteria 9036
574 Ga0207681_10167003 3300025923 Bacteria 1664
575 Ga0207681_10410098 3300025923 Bacteria 1096
576 Ga0207681_10601281 3300025923 Bacteria 909
577 Ga0207681_10689530 3300025923 Bacteria 849
578 Ga0207694_10001182 3300025924 Bacteria 22597
579 Ga0207694_10067827 3300025924 Bacteria 2785
580 Ga0207694_10106528 3300025924 Bacteria 2227
581 Ga0207694_10124272 3300025924 Bacteria 2063
582 Ga0207650_10000083 3300025925 Bacteria 127270
583 Ga0207650_10006485 3300025925 Bacteria 7975
584 Ga0207650_10040361 3300025925 Bacteria 3415
585 Ga0207650_10140186 3300025925 Bacteria 1900
586 Ga0207650_10157013 3300025925 Bacteria 1799
587 Ga0207650_10289861 3300025925 Bacteria 1334
588 Ga0207650_10474719 3300025925 Bacteria 1043
589 Ga0207650_10765500 3300025925 Bacteria 817
590 Ga0207659_10002940 3300025926 Bacteria 10145
591 Ga0207659_10020455 3300025926 Bacteria 4376
592 Ga0207659_10029707 3300025926 Bacteria 3728
593 Ga0207659_10117586 3300025926 Bacteria 2032
594 Ga0207659_10736040 3300025926 Bacteria 845
595 Ga0207659_10875309 3300025926 Bacteria 772
596 Ga0207687_10035622 3300025927 Bacteria 3386
597 Ga0207687_10044839 3300025927 Bacteria 3054
598 Ga0207687_10162708 3300025927 Bacteria 1714
599 Ga0207700_11023449 3300025928 Bacteria 739
600 Ga0207664_10008627 3300025929 Bacteria 7123
601 Ga0207644_10000451 3300025931 Bacteria 26541
602 Ga0207644_10000494 3300025931 Bacteria 25330
603 Ga0207644_10000963 3300025931 Bacteria 18367
604 Ga0207644_10011181 3300025931 Bacteria 5931
605 Ga0207644_10013459 3300025931 Bacteria 5454
606 Ga0207644_10015985 3300025931 Bacteria 5045
607 Ga0207644_10026799 3300025931 Bacteria 3976
608 Ga0207644_10053223 3300025931 Bacteria 2913
609 Ga0207644_10086687 3300025931 Bacteria 2325
610 Ga0207644_10214140 3300025931 Bacteria 1524
611 Ga0207690_10001145 3300025932 Bacteria 16858
612 Ga0207690_10051816 3300025932 Bacteria 2746
613 Ga0207690_10060462 3300025932 Bacteria 2571
614 Ga0207706_10000707 3300025933 Bacteria 34824
615 Ga0207706_10001411 3300025933 Bacteria 24041
616 Ga0207706_10022661 3300025933 Bacteria 5637
617 Ga0207706_10049855 3300025933 Bacteria 3700
618 Ga0207706_10088835 3300025933 Bacteria 2716
619 Ga0207706_10116440 3300025933 Bacteria 2351
620 Ga0207706_10117232 3300025933 Bacteria 2342
621 Ga0207706_10228655 3300025933 Bacteria 1628
622 Ga0207706_10284720 3300025933 Bacteria 1441
623 Ga0207706_10558956 3300025933 Bacteria 985
624 Ga0207706_10602172 3300025933 Bacteria 944
625 Ga0207709_10261036 3300025935 Bacteria 1270
626 Ga0207670_10008177 3300025936 Bacteria 5889
627 Ga0207670_10103663 3300025936 Bacteria 2036
628 Ga0207670_10365769 3300025936 Bacteria 1145
629 Ga0207669_10011128 3300025937 Bacteria 4365
630 Ga0207669_10063816 3300025937 Bacteria 2276
631 Ga0207669_10078757 3300025937 Bacteria 2101
632 Ga0207669_10086474 3300025937 Bacteria 2027
633 Ga0207669_10166054 3300025937 Bacteria 1565
634 Ga0207704_10248553 3300025938 Bacteria 1333
635 Ga0207691_10001477 3300025940 Bacteria 23465
636 Ga0207691_10005762 3300025940 Bacteria 11989
637 Ga0207691_10029443 3300025940 Bacteria 5137
638 Ga0207691_10052045 3300025940 Bacteria 3741
639 Ga0207691_10201302 3300025940 Bacteria 1733
640 Ga0207711_10000035 3300025941 Bacteria 177223
641 Ga0207711_10002211 3300025941 Bacteria 17469
642 Ga0207711_10003944 3300025941 Bacteria 12763
643 Ga0207711_10007414 3300025941 Bacteria 9180
644 Ga0207711_10045546 3300025941 Bacteria 3749
645 Ga0207711_10058902 3300025941 Bacteria 3306
646 Ga0207711_10085454 3300025941 Bacteria 2764
647 Ga0207711_10087914 3300025941 Bacteria 2727
648 Ga0207711_10121572 3300025941 Bacteria 2331
649 Ga0207711_10126775 3300025941 Bacteria 2284
650 Ga0207711_10130723 3300025941 Bacteria 2251
651 Ga0207711_10189840 3300025941 Bacteria 1872
652 Ga0207711_10519434 3300025941 Bacteria 1110
653 Ga0207689_10000327 3300025942 Bacteria 44239
654 Ga0207689_10006734 3300025942 Bacteria 10134
655 Ga0207689_10044681 3300025942 Bacteria 3663
656 Ga0207689_10246925 3300025942 Bacteria 1476
657 Ga0207689_10976279 3300025942 Bacteria 715
658 Ga0207661_10096451 3300025944 Bacteria 2474
659 Ga0207661_10462744 3300025944 Bacteria 1156
660 Ga0207661_11318533 3300025944 Bacteria 663
661 Ga0207679_10010734 3300025945 Bacteria 5908
662 Ga0207679_10016172 3300025945 Bacteria 4947
663 Ga0207679_10027185 3300025945 Bacteria 3954
664 Ga0207679_10036633 3300025945 Bacteria 3480
665 Ga0207679_10838319 3300025945 Bacteria 839
666 Ga0207667_10000504 3300025949 Bacteria 51526
667 Ga0207667_10020667 3300025949 Bacteria 7315
668 Ga0207667_10025649 3300025949 Bacteria 6450
669 Ga0207667_10082437 3300025949 Bacteria 3332
670 Ga0207667_10091102 3300025949 Bacteria 3150
671 Ga0207667_10132748 3300025949 Bacteria 2565
672 Ga0207667_10422709 3300025949 Bacteria 1356
673 Ga0207651_10001733 3300025960 Bacteria 10095
674 Ga0207651_10008053 3300025960 Bacteria 5656
675 Ga0207651_10062023 3300025960 Bacteria 2603
676 Ga0207651_10416804 3300025960 Bacteria 1145
677 Ga0207651_10602805 3300025960 Bacteria 960
678 Ga0207651_10901611 3300025960 Bacteria 787
679 Ga0207651_10958312 3300025960 Bacteria 763
680 Ga0207712_10000001 3300025961 Bacteria 750309
681 Ga0207712_10000338 3300025961 Bacteria 42597
682 Ga0207712_10474040 3300025961 Bacteria 1066
683 Ga0207668_10000091 3300025972 Bacteria 66830
684 Ga0207668_10034071 3300025972 Bacteria 3379
685 Ga0207668_10035523 3300025972 Bacteria 3319
686 Ga0207668_10037530 3300025972 Bacteria 3244
687 Ga0207668_10037793 3300025972 Bacteria 3234
688 Ga0207668_10048863 3300025972 Bacteria 2905
689 Ga0207668_10335870 3300025972 Bacteria 1259
690 Ga0207668_10690818 3300025972 Bacteria 896
691 Ga0207640_10000394 3300025981 Bacteria 27805
692 Ga0207640_10048996 3300025981 Bacteria 2734
693 Ga0207640_10060662 3300025981 Bacteria 2501
694 Ga0207640_10074903 3300025981 Bacteria 2292
695 Ga0207640_10147157 3300025981 Bacteria 1725
696 Ga0207640_10263744 3300025981 Bacteria 1344
697 Ga0207640_10269477 3300025981 Bacteria 1331
698 Ga0207658_10000247 3300025986 Bacteria 56367
699 Ga0207658_10000479 3300025986 Bacteria 36981
700 Ga0207658_10000845 3300025986 Bacteria 25594
701 Ga0207658_10007062 3300025986 Bacteria 7646
702 Ga0207658_10009987 3300025986 Bacteria 6451
703 Ga0207658_10010194 3300025986 Bacteria 6385
704 Ga0207658_10023095 3300025986 Bacteria 4337
705 Ga0207658_10036115 3300025986 Bacteria 3542
706 Ga0207658_10042942 3300025986 Bacteria 3283
707 Ga0207658_10085947 3300025986 Bacteria 2424
708 Ga0207658_10101921 3300025986 Bacteria 2250
709 Ga0207658_10229396 3300025986 Bacteria 1566
710 Ga0207658_11538520 3300025986 Bacteria 608
711 Ga0207658_11718549 3300025986 Bacteria 573
712 Ga0207677_10001141 3300026023 Bacteria 14484
713 Ga0207677_10075979 3300026023 Bacteria 2390
714 Ga0207677_10157322 3300026023 Bacteria 1761
715 Ga0207677_10435496 3300026023 Bacteria 1120
716 Ga0207677_10859555 3300026023 Bacteria 816
717 Ga0207703_10001491 3300026035 Bacteria 21348
718 Ga0207703_10012590 3300026035 Bacteria 6594
719 Ga0207703_10030693 3300026035 Bacteria 4247
720 Ga0207703_10054589 3300026035 Bacteria 3250
721 Ga0207639_10011077 3300026041 Bacteria 6255
722 Ga0207639_10024055 3300026041 Bacteria 4403
723 Ga0207639_10039328 3300026041 Bacteria 3523
724 Ga0207639_10064493 3300026041 Bacteria 2840
725 Ga0207639_10267153 3300026041 Bacteria 1499
726 Ga0207639_10498970 3300026041 Bacteria 1112
727 Ga0207639_10708171 3300026041 Bacteria 934
728 Ga0207639_11045651 3300026041 Bacteria 765
729 Ga0207678_10004612 3300026067 Bacteria 12382
730 Ga0207678_10011543 3300026067 Bacteria 7760
731 Ga0207678_10016036 3300026067 Bacteria 6580
732 Ga0207678_10217682 3300026067 Bacteria 1634
733 Ga0207702_10016194 3300026078 Bacteria 6172
734 Ga0207702_10032763 3300026078 Bacteria 4336
735 Ga0207702_10188245 3300026078 Bacteria 1905
736 Ga0207702_10373629 3300026078 Bacteria 1369
737 Ga0207702_10559141 3300026078 Bacteria 1120
738 Ga0207702_10680796 3300026078 Bacteria 1013
739 Ga0207702_12013728 3300026078 Bacteria 568
740 Ga0207641_10000002 3300026088 Bacteria 981004
741 Ga0207641_10000057 3300026088 Bacteria 168603
742 Ga0207641_10000338 3300026088 Bacteria 56937
743 Ga0207641_10002263 3300026088 Bacteria 17943
744 Ga0207641_10017865 3300026088 Bacteria 5809
745 Ga0207641_10020571 3300026088 Bacteria 5421
746 Ga0207641_10030727 3300026088 Bacteria 4450
747 Ga0207641_10247520 3300026088 Bacteria 1663
748 Ga0207641_10268108 3300026088 Bacteria 1601
749 Ga0207648_10002010 3300026089 Bacteria 22197
750 Ga0207648_10005437 3300026089 Bacteria 12837
751 Ga0207648_10008026 3300026089 Bacteria 10287
752 Ga0207648_10060399 3300026089 Bacteria 3306
753 Ga0207648_10098399 3300026089 Bacteria 2561
754 Ga0207648_10560696 3300026089 Bacteria 1050
755 Ga0207676_10000005 3300026095 Bacteria 698744
756 Ga0207676_10005731 3300026095 Bacteria 8789
757 Ga0207676_10006145 3300026095 Bacteria 8477
758 Ga0207676_10010041 3300026095 Bacteria 6735
759 Ga0207676_10011187 3300026095 Bacteria 6406
760 Ga0207676_10067064 3300026095 Bacteria 2865
761 Ga0207676_10132474 3300026095 Bacteria 2122
762 Ga0207676_10201065 3300026095 Bacteria 1761
763 Ga0207674_10008456 3300026116 Bacteria 11886
764 Ga0207674_10008693 3300026116 Bacteria 11690
765 Ga0207674_10024052 3300026116 Bacteria 6515
766 Ga0207674_10089158 3300026116 Bacteria 3077
767 Ga0207674_10239460 3300026116 Bacteria 1761
768 Ga0207674_10391289 3300026116 Bacteria 1344
769 Ga0207674_10403942 3300026116 Bacteria 1320
770 Ga0207674_10439426 3300026116 Bacteria 1261
771 Ga0207675_100000571 3300026118 Bacteria 35943
772 Ga0207675_100093064 3300026118 Bacteria 2835
773 Ga0207675_100292957 3300026118 Bacteria 1583
774 Ga0207683_10014765 3300026121 Bacteria 6648
775 Ga0207683_10034599 3300026121 Bacteria 4391
776 Ga0207683_10036248 3300026121 Bacteria 4294
777 Ga0207683_10043317 3300026121 Bacteria 3934
778 Ga0207683_10531154 3300026121 Bacteria 1087
779 Ga0207698_10000141 3300026142 Bacteria 45510
780 Ga0207698_10027615 3300026142 Bacteria 4032
781 Ga0207698_10033459 3300026142 Bacteria 3736
782 Ga0207698_10036243 3300026142 Bacteria 3618
783 Ga0207698_10060741 3300026142 Bacteria 2941
784 Ga0207698_10061122 3300026142 Bacteria 2934
785 Ga0207698_10240388 3300026142 Bacteria 1650
786 Ga0207698_10494360 3300026142 Bacteria 1189
787 Ga0207698_10520009 3300026142 Bacteria 1161
788 Ga0207698_10933270 3300026142 Bacteria 876
789 Ga0207428_10145098 3300027907 Bacteria 1809
790 Ga0268266_10000042 3300028379 Bacteria 316826
791 Ga0268266_10000888 3300028379 Bacteria 38725
792 Ga0268266_10007115 3300028379 Bacteria 10150
793 Ga0268266_10020750 3300028379 Bacteria 5601
794 Ga0268266_10029863 3300028379 Bacteria 4632
795 Ga0268266_10030450 3300028379 Bacteria 4585
796 Ga0268266_10076745 3300028379 Bacteria 2904
797 Ga0268266_10095458 3300028379 Bacteria 2611
798 Ga0268266_10664875 3300028379 Bacteria 1003
799 Ga0268266_11314491 3300028379 Bacteria 698
800 Ga0268266_11389706 3300028379 Bacteria 678
801 Ga0268265_10000003 3300028380 Bacteria 949201
802 Ga0268265_10000145 3300028380 Bacteria 89267
803 Ga0268265_10002983 3300028380 Bacteria 12369
804 Ga0268265_10017567 3300028380 Bacteria 4940
805 Ga0268265_10024819 3300028380 Bacteria 4247
806 Ga0268265_10033209 3300028380 Bacteria 3749
807 Ga0268265_10244333 3300028380 Bacteria 1586
808 Ga0268265_10992954 3300028380 Bacteria 829
809 Ga0268264_10000006 3300028381 Bacteria 827324
810 Ga0268264_10000078 3300028381 Bacteria 249595
811 Ga0268264_10009040 3300028381 Bacteria 8266
812 Ga0268264_10014901 3300028381 Bacteria 6386
813 Ga0268264_10044922 3300028381 Bacteria 3667
814 Ga0268264_10224856 3300028381 Bacteria 1730
815 Ga0268264_10225661 3300028381 Bacteria 1727
816 Ga0268264_10303919 3300028381 Bacteria 1503
817 Ga0268264_10363018 3300028381 Bacteria 1382
818 Ga0265331_10047984 3300031250 Bacteria 2055
819 Ga0307408_100066956 3300031548 Bacteria 2639
820 Ga0307408_100435032 3300031548 Bacteria 1134
821 Ga0307408_100918759 3300031548 Bacteria 802
822 Ga0307405_10031040 3300031731 Bacteria 3141
823 Ga0307405_10060344 3300031731 Bacteria 2393
824 Ga0307405_10116650 3300031731 Bacteria 1819
825 Ga0307413_10177791 3300031824 Bacteria 1513
826 Ga0307413_11022020 3300031824 Bacteria 710
827 Ga0307413_11110125 3300031824 Bacteria 683
828 Ga0307406_10235791 3300031901 Bacteria 1369
829 Ga0307412_10024118 3300031911 Bacteria 3752
830 Ga0307409_100008388 3300031995 Bacteria 6267
831 Ga0307409_100037682 3300031995 Bacteria 3567
832 Ga0307409_100062813 3300031995 Bacteria 2909
833 Ga0307409_100191452 3300031995 Bacteria 1821
834 Ga0307409_100290036 3300031995 Bacteria 1517
835 Ga0307416_100544926 3300032002 Bacteria 1232
836 Ga0307416_101479626 3300032002 Bacteria 785
837 Ga0307414_10000225 3300032004 Bacteria 37162
838 Ga0307414_10119146 3300032004 Bacteria 2026
839 Ga0307414_10189678 3300032004 Bacteria 1662
840 Ga0307411_10106532 3300032005 Bacteria 1995
841 Ga0307415_100365096 3300032126 Bacteria 1220
842 Ga0307510_10412149 3300033180 Bacteria 794
843 Ga0373929_0069590 3300035085 Bacteria 839
844 Ga0373943_0609029 3300035170 Bacteria 644
845 Ga0373943_0788340 3300035170 Bacteria 565
846 Ga0373935_1029093 3300035692 Bacteria 612
847 Ga0373927_0066214 3300035695 Bacteria 2337
848 Ga0395899_0001370 3300037312 Bacteria 20899
849 Ga0395899_0020561 3300037312 Bacteria 5003
850 Ga0395899_0039456 3300037312 Unclassified 3534
851 Ga0395899_0315234 3300037312 Bacteria 1055
852 Ga0395899_0442121 3300037312 Bacteria 853
853 Ga0395900_0000449 3300037418 Bacteria 58912
854 Ga0395900_0005115 3300037418 Bacteria 13770
855 Ga0395900_0046854 3300037418 Bacteria 4451
856 Ga0395900_0149478 3300037418 Bacteria 2387
857 Ga0395900_0293015 3300037418 Bacteria 1615
858 Ga0395900_0420129 3300037418 Bacteria 1298
859 Ga0395900_0862715 3300037418 Bacteria 830
860 Ga0395900_1176037 3300037418 Bacteria 683
861 Ga0395900_1707199 3300037418 Bacteria 540
862 Ga0395898_0002969 3300037466 Bacteria 19284
863 Ga0395898_0004847 3300037466 Bacteria 14622
864 Ga0395898_0035811 3300037466 Bacteria 4932
865 Ga0395898_0050229 3300037466 Bacteria 4082
866 Ga0395898_0357001 3300037466 Bacteria 1394
867 Ga0395898_0376430 3300037466 Bacteria 1354
868 Ga0395898_0822708 3300037466 Bacteria 868
869 Ga0395905_0000434 3300037471 Bacteria 58335
870 Ga0395905_0002407 3300037471 Bacteria 20791
871 Ga0395905_0003338 3300037471 Bacteria 17223
872 Ga0395905_0003634 3300037471 Bacteria 16385
873 Ga0395905_0005040 3300037471 Bacteria 13603
874 Ga0395905_0005740 3300037471 Bacteria 12621
875 Ga0395905_0018144 3300037471 Bacteria 6678
876 Ga0395905_0028836 3300037471 Bacteria 5231
877 Ga0395905_0073288 3300037471 Bacteria 3209
878 Ga0395905_0103466 3300037471 Bacteria 2673
879 Ga0395905_0281710 3300037471 Bacteria 1548
880 Ga0395905_0360819 3300037471 Bacteria 1346
881 Ga0395905_0495604 3300037471 Bacteria 1121
882 Ga0395905_0518102 3300037471 Bacteria 1093
883 Ga0395905_0657171 3300037471 Bacteria 950
884 Ga0395905_1081782 3300037471 Bacteria 705
885 Ga0395905_1358739 3300037471 Bacteria 614
886 Ga0436364_0139430 3300037853 Bacteria 61613
887 Ga0436364_0533904 3300037853 Bacteria 764
888 Ga0395901_0001276 3300038443 Bacteria 26721
889 Ga0395901_0008989 3300038443 Bacteria 10115
890 Ga0395901_0052068 3300038443 Bacteria 4255
891 Ga0395901_0056699 3300038443 Bacteria 4076
892 Ga0395901_0088296 3300038443 Bacteria 3243
893 Ga0395901_0244789 3300038443 Bacteria 1869
894 Ga0395901_0375842 3300038443 Bacteria 1463
895 Ga0395901_0820496 3300038443 Bacteria 917
896 Ga0395901_0876482 3300038443 Unclassified 881
897 Ga0395901_0974745 3300038443 Bacteria 825
898 Ga0237819_00594 3300038705 Bacteria 12112
899 Ga0237816_01767 3300039145 Bacteria 1727
900 Ga0436365_1287249 3300039437 Bacteria 1227
901 Ga0436365_1582505 3300039437 Bacteria 4913
902 Ga0436363_1327386 3300039450 Bacteria 790
903 Ga0451800_0345223 3300041459 Bacteria 799
904 Ga0451841_0452807 3300041498 Bacteria 656
905 Ga0451853_3072353 3300041512 Bacteria 1041
906 Ga0451853_3355289 3300041512 Bacteria 1061
907 Ga0439448_0242723 3300042005 Bacteria 635
908 Ga0439432_060137 3300042006 Bacteria 1173
909 Ga0439458_0000285 3300042157 Bacteria 12567
910 Ga0466973_0146996 3300044659 Bacteria 1874
911 Ga0466966_0323529 3300044684 Bacteria 926
912 Ga0466963_0041360 3300044694 Bacteria 3023
913 Ga0466963_0060017 3300044694 Bacteria 2539
914 Ga0453684_0642946 3300044712 Bacteria 1158
915 Ga0466957_0065750 3300044842 Bacteria 2234
916 Ga0466957_0615601 3300044842 Bacteria 761
917 Ga0466967_0326948 3300045976 Bacteria 1480
918 Ga0466967_0587467 3300045976 Bacteria 1098
919 Ga0495638_0284459 3300046460 Bacteria 897
920 Ga0495585_0210739 3300046492 Bacteria 985
921 Ga0495596_0001277 3300046500 Bacteria 14545
922 Ga0495607_0030644 3300046501 Bacteria 3301
923 Ga0495607_0109229 3300046501 Bacteria 1469
924 Ga0495583_0069549 3300046506 Bacteria 1550
925 Ga0495610_0000600 3300046512 Bacteria 35676
926 Ga0495631_0009110 3300046518 Bacteria 4970
927 Ga0495631_0153554 3300046518 Bacteria 988
928 Ga0495632_0085336 3300046519 Bacteria 1502
929 Ga0495643_0000351 3300046522 Bacteria 62687
930 Ga0495643_0003604 3300046522 Bacteria 11255
931 Ga0495643_0126412 3300046522 Bacteria 1287
932 Ga0495648_0054512 3300046524 Bacteria 2415
933 Ga0495663_0030303 3300046525 Bacteria 1602
934 Ga0495642_0422670 3300046528 Bacteria 588
935 Ga0495654_0002139 3300046530 Bacteria 12892
936 Ga0495654_0177974 3300046530 Bacteria 923
937 Ga0495598_0055378 3300046537 Bacteria 1207
938 Ga0495609_0014144 3300046538 Bacteria 3757
939 Ga0495621_0000308 3300046539 Bacteria 11830
940 Ga0495633_0002121 3300046558 Bacteria 14234
941 Ga0495633_0036960 3300046558 Bacteria 2338
942 Ga0495668_0001229 3300046616 Bacteria 25821
943 Ga0495668_0043797 3300046616 Bacteria 2488
944 Ga0495625_0023484 3300046660 Bacteria 4710
945 Ga0495661_0267674 3300046665 Bacteria 866
946 Ga0495647_0152673 3300046681 Bacteria 991
947 Ga0495669_0000187 3300046684 Bacteria 38516
948 Ga0495669_0001688 3300046684 Bacteria 9048
949 Ga0495669_0049668 3300046684 Bacteria 1879
950 Ga0495669_0314784 3300046684 Bacteria 755
951 Ga0495669_0571218 3300046684 Bacteria 550
952 Ga0495670_0005983 3300046691 Bacteria 5959
953 Ga0495670_0027439 3300046691 Bacteria 2821
954 Ga0495670_0286529 3300046691 Bacteria 881
955 Ga0495589_0044504 3300046794 Bacteria 2208
956 Ga0495677_0240288 3300047445 Bacteria 707
957 Ga0495681_0155354 3300047470 Bacteria 957
958 Ga0496100_0031059 3300048903 Bacteria 3317
959 Ga0496101_0041860 3300048904 Bacteria 3268
960 Ga0496101_0175594 3300048904 Bacteria 1648
961 Ga0496101_0325996 3300048904 Bacteria 1205
962 Ga0496102_0000106 3300048905 Bacteria 118841
963 Ga0496102_0018284 3300048905 Bacteria 6158
964 Ga0496102_0102114 3300048905 Bacteria 2665
965 Ga0496102_0232962 3300048905 Bacteria 1736
966 Ga0496102_0244239 3300048905 Bacteria 1693
967 Ga0496102_0298997 3300048905 Bacteria 1517
968 Ga0496102_1121703 3300048905 Bacteria 706
969 Ga0496102_1868321 3300048905 Bacteria 517
970 Ga0496103_0000095 3300048906 Bacteria 98260
971 Ga0496103_0003384 3300048906 Bacteria 9746
972 Ga0496103_0015936 3300048906 Bacteria 4482
973 Ga0496103_0041926 3300048906 Bacteria 2815
974 Ga0496103_0046662 3300048906 Bacteria 2676
975 Ga0496103_0158326 3300048906 Bacteria 1452
976 Ga0496103_0222765 3300048906 Bacteria 1213
977 Ga0496104_0000060 3300048907 Bacteria 117966
978 Ga0496104_0037015 3300048907 Bacteria 4563
979 Ga0496104_0370295 3300048907 Bacteria 1345
980 Ga0496104_0993578 3300048907 Bacteria 743
981 Ga0496105_0000122 3300048908 Bacteria 52475
982 Ga0496105_0000751 3300048908 Bacteria 22003
983 Ga0496105_0210965 3300048908 Bacteria 1583
984 Ga0496106_0260157 3300048909 Bacteria 1389
985 Ga0496106_0318907 3300048909 Bacteria 1247
986 Ga0496106_0426356 3300048909 Bacteria 1066
987 Ga0496106_0784872 3300048909 Bacteria 756
988 Ga0496107_0002226 3300048910 Bacteria 12479
989 Ga0496107_0010545 3300048910 Bacteria 6424
990 Ga0496107_0012702 3300048910 Bacteria 5882
991 Ga0496107_0217265 3300048910 Bacteria 1422
992 Ga0496108_0010554 3300048911 Bacteria 7501
993 Ga0496108_0048506 3300048911 Bacteria 3551
994 Ga0496108_0049625 3300048911 Bacteria 3510
995 Ga0496109_0001421 3300048912 Bacteria 19869
996 Ga0496109_0007620 3300048912 Bacteria 9180
997 Ga0496109_1115462 3300048912 Bacteria 726
998 Ga0496110_0025450 3300048913 Bacteria 5057
999 Ga0496110_0244269 3300048913 Bacteria 1634
1000 Ga0496110_0449021 3300048913 Bacteria 1175
1001 Ga0496110_1021164 3300048913 Bacteria 734
1002 Ga0496110_1154249 3300048913 Bacteria 683
1003 Ga0496111_0004971 3300048914 Bacteria 8452
1004 Ga0496111_0035243 3300048914 Bacteria 3575
1005 Ga0496112_0013852 3300048915 Bacteria 7458
1006 Ga0496112_0053584 3300048915 Bacteria 3962
1007 Ga0496112_0119238 3300048915 Bacteria 2608
1008 Ga0496113_0000378 3300048916 Bacteria 21504
1009 Ga0496113_0002130 3300048916 Bacteria 11418
1010 Ga0496113_0002449 3300048916 Bacteria 10803
1011 Ga0496113_0016220 3300048916 Bacteria 5142
1012 Ga0496115_0026203 3300048918 Bacteria 4548
1013 Ga0496116_0000035 3300048919 Bacteria 402424
1014 Ga0496116_0048411 3300048919 Bacteria 2853
1015 Ga0496117_0003116 3300048920 Bacteria 19798
1016 Ga0496117_0013244 3300048920 Bacteria 7209
1017 Ga0496117_0029840 3300048920 Bacteria 4196
1018 Ga0496117_0076107 3300048920 Bacteria 2227
1019 Ga0496118_0000807 3300048921 Bacteria 50003
1020 Ga0496118_0002769 3300048921 Bacteria 22965
1021 Ga0496118_0004532 3300048921 Bacteria 16403
1022 Ga0496118_0026194 3300048921 Bacteria 4974
1023 Ga0496118_0428350 3300048921 Bacteria 678
1024 Ga0496118_0477939 3300048921 Bacteria 625
1025 Ga0496119_0000222 3300048922 Bacteria 79824
1026 Ga0496119_0072452 3300048922 Bacteria 2013
1027 Ga0496119_0220527 3300048922 Bacteria 971
1028 Ga0496120_0001728 3300048923 Bacteria 24842
1029 Ga0496120_0082466 3300048923 Bacteria 1738
1030 Ga0496120_0118114 3300048923 Bacteria 1375
1031 Ga0496121_0002209 3300048924 Bacteria 30388
1032 Ga0496121_0044026 3300048924 Bacteria 3857
1033 Ga0496122_0001902 3300048925 Bacteria 31581
1034 Ga0496122_0008544 3300048925 Bacteria 11013
1035 Ga0496123_0005132 3300048926 Bacteria 13352
1036 Ga0496123_0017737 3300048926 Bacteria 5707
1037 Ga0496123_0134356 3300048926 Bacteria 1364
1038 Ga0496123_0420800 3300048926 Bacteria 602
1039 Ga0496124_0001019 3300048927 Bacteria 44416
1040 Ga0496124_0012893 3300048927 Bacteria 8206
1041 Ga0496124_0213795 3300048927 Bacteria 1456
1042 Ga0496124_0385420 3300048927 Bacteria 978
1043 Ga0496124_0464187 3300048927 Bacteria 859
1044 Ga0496124_0982895 3300048927 Bacteria 504
1045 Ga0496125_0011746 3300048928 Bacteria 8729
1046 Ga0496125_0076035 3300048928 Bacteria 2594
1047 Ga0496125_0229184 3300048928 Bacteria 1189
1048 Ga0496126_0000084 3300048929 Bacteria 217111
1049 Ga0496126_0000294 3300048929 Bacteria 106327
1050 Ga0496126_0016038 3300048929 Bacteria 7514
1051 Ga0496126_0204267 3300048929 Bacteria 1666
1052 Ga0495678_050251 3300049459 Bacteria 1617
1053 Ga0501032_0012532 3300049569 Bacteria 6054
1054 Ga0501037_0820279 3300049573 Bacteria 613
1055 Ga0501042_0975382 3300049578 Bacteria 618
1056 Ga0501043_0007329 3300049579 Bacteria 8758
1057 Ga0501046_0198319 3300049580 Bacteria 1494
1058 Ga0501047_0002674 3300049581 Bacteria 16946
1059 Ga0501249_000314 3300049679 Bacteria 13443
1060 Ga0501249_027565 3300049679 Bacteria 1258
1061 nmdc:mga00v17_506623_c1 3300050491 Bacteria 782
1062 nmdc:mga0k408_307677_c1 3300050493 Bacteria 946
1063 nmdc:mga07m45_101852_c1 3300050496 Bacteria 1649
1064 nmdc:mga07m45_5275_c1 3300050496 Bacteria 6425
1065 nmdc:mga08y16_318898_c1 3300050511 Bacteria 1600
1066 nmdc:mga0rr50_1032255_c1 3300050513 Bacteria 700
1067 Ga0500592_000075 3300053116 Bacteria 24990
1068 Ga0500592_000336 3300053116 Bacteria 7951
1069 Ga0500595_012882 3300053119 Bacteria 3217
1070 Ga0500658_0019313 3300053134 Bacteria 2564
1071 Ga0500627_0000187 3300053158 Bacteria 18164
1072 Ga0500627_0000336 3300053158 Bacteria 12744
1073 Ga0587090_004120 3300059510 Bacteria 1741
1074 2511126152 2510917021 Bacteria 5705459
1075 2819552701 2818991438 Bacteria 5793701
1076 Ga0500643_001960
1077 SwRhRL2b_contig_1151829
1078 SwRhRL2b_contig_724347
1079 JGI24736J21556_1000050
1080 JGI24736J21556_1003007
1081 JGI24736J21556_1015632
1082 JGI24741J21665_1009840
1083 JGI24752J21851_1000419
1084 JGI24752J21851_1006940
1085 JGI24740J21852_10005088
1086 JGI24740J21852_10005255
1087 JGI24740J21852_10026236
1088 JGI24739J22299_10007091
1089 JGI24739J22299_10007201
1090 JGI24739J22299_10007913
1091 JGI24739J22299_10014449
1092 JGI24739J22299_10021332
1093 JGI24739J22299_10244579
1094 JGI24737J22298_10000263
1095 JGI24737J22298_10007578
1096 JGI24737J22298_10010047
1097 JGI24737J22298_10021562
1098 JGI24737J22298_10058068
1099 JGI24743J22301_10071440
1100 JGI24735J21928_10003538
1101 JGI24735J21928_10007302
1102 JGI24735J21928_10039163
1103 JGI24735J21928_10057873
1104 JGI24750J21931_1000225
1105 JGI24748J21848_1000088
1106 JGI24748J21848_1004123
1107 JGI24738J21930_10000777
1108 JGI24738J21930_10001723
1109 JGI24738J21930_10014908
1110 JGI24738J21930_10017035
1111 JGI24749J21850_1012028
1112 JGI24034J26672_10000034
1113 JGI24034J26672_10091823
1114 JGI24034J26672_10111352
1115 JGI24742J22300_10045354
1116 JGI24751J29686_10066237
1117 Ga0055530_10067205
1118 Ga0055540_1001754
1119 JGI25405J52794_10083993
1120 Ga0065704_10070220
1121 Ga0065704_10070273
1122 Ga0065715_10522699
1123 Ga0065707_10082229
1124 Ga0065707_10091608
1125 Ga0070658_10000652
1126 Ga0070658_10013809
1127 Ga0070658_10456375
1128 Ga0070658_10784924
1129 Ga0070658_10846472
1130 Ga0070658_11274673
1131 Ga0070658_11278377
1132 Ga0070676_10008676
1133 Ga0070676_10014836
1134 Ga0070676_10719243
1135 Ga0070683_100005348
1136 Ga0070683_100062337
1137 Ga0070683_100064333
1138 Ga0070683_100557222
1139 Ga0070690_100000334
1140 Ga0070690_100050676
1141 Ga0070670_100021878
1142 Ga0070670_100063472
1143 Ga0070670_100101721
1144 Ga0070670_100136701
1145 Ga0070670_100331434
1146 Ga0070670_101112809
1147 Ga0070677_10165757
1148 Ga0070677_10297584
1149 Ga0068869_100001147
1150 Ga0068869_100092583
1151 Ga0068869_100532578
1152 Ga0068869_100609696
1153 Ga0068869_100805001
1154 Ga0070666_10000002
1155 Ga0070666_10002190
1156 Ga0070666_10026826
1157 Ga0070666_10054135
1158 Ga0070666_10062503
1159 Ga0070666_10182766
1160 Ga0070666_10250140
1161 Ga0070666_10352933
1162 Ga0070680_100016740
1163 Ga0068868_100039908
1164 Ga0068868_100071647
1165 Ga0068868_100168143
1166 Ga0068868_100190956
1167 Ga0068868_100244103
1168 Ga0068868_100405901
1169 Ga0070660_100004906
1170 Ga0070660_100012491
1171 Ga0070660_100017060
1172 Ga0070660_100214784
1173 Ga0070660_100227050
1174 Ga0070660_100264673
1175 Ga0070660_100955613
1176 Ga0070689_100014956
1177 Ga0070689_100076938
1178 Ga0070689_100150929
1179 Ga0070661_100014084
1180 Ga0070661_100033923
1181 Ga0070661_100057871
1182 Ga0070661_100064931
1183 Ga0070661_100086907
1184 Ga0070661_100350033
1185 Ga0070661_100364314
1186 Ga0070692_10012871
1187 Ga0070692_10047487
1188 Ga0070668_100032336
1189 Ga0070668_100033446
1190 Ga0070668_100047447
1191 Ga0070668_100049960
1192 Ga0070668_100075984
1193 Ga0070668_100165212
1194 Ga0070668_100755790
1195 Ga0070668_101006065
1196 Ga0070669_100000055
1197 Ga0070669_100002134
1198 Ga0070669_100009650
1199 Ga0070669_100012645
1200 Ga0070669_100024805
1201 Ga0070669_100248596
1202 Ga0070669_100375860
1203 Ga0070675_100006603
1204 Ga0070675_100020664
1205 Ga0070675_100030973
1206 Ga0070675_100179091
1207 Ga0070675_100789271
1208 Ga0070675_101216467
1209 Ga0070671_100005849
1210 Ga0070671_100011280
1211 Ga0070671_100011936
1212 Ga0070671_100023684
1213 Ga0070671_100086184
1214 Ga0070671_100102625
1215 Ga0070671_100137074
1216 Ga0070671_100159874
1217 Ga0070671_100212104
1218 Ga0070671_100453909
1219 Ga0070674_100027463
1220 Ga0070674_100068509
1221 Ga0070674_100073881
1222 Ga0070674_100135511
1223 Ga0070674_100363249
1224 Ga0070673_100000991
1225 Ga0070673_100002271
1226 Ga0070673_100009946
1227 Ga0070673_100015515
1228 Ga0070673_100083198
1229 Ga0070673_100088078
1230 Ga0070673_100169176
1231 Ga0070673_100188398
1232 Ga0070673_100672567
1233 Ga0070673_100901082
1234 Ga0070673_100957516
1235 Ga0070688_100001690
1236 Ga0070688_100042597
1237 Ga0070659_100004264
1238 Ga0070659_100006645
1239 Ga0070659_100034208
1240 Ga0070659_100194740
1241 Ga0070667_100000222
1242 Ga0070667_100000763
1243 Ga0070667_100002812
1244 Ga0070667_100003416
1245 Ga0070667_100004916
1246 Ga0070667_100005143
1247 Ga0070667_100006574
1248 Ga0070667_100014036
1249 Ga0070667_100077387
1250 Ga0070667_100082755
1251 Ga0070667_100237683
1252 Ga0070667_101063854
1253 Ga0070709_10052636
1254 Ga0070714_100172906
1255 Ga0070713_100247830
1256 Ga0070705_100189496
1257 Ga0070694_100005487
1258 Ga0070663_100029611
1259 Ga0070663_100063495
1260 Ga0070663_100064388
1261 Ga0070663_100068061
1262 Ga0070663_100121894
1263 Ga0070678_100005675
1264 Ga0070678_100014857
1265 Ga0070678_100021955
1266 Ga0070678_100052130
1267 Ga0070678_100357307
1268 Ga0070678_101678587
1269 Ga0070662_100002019
1270 Ga0070662_100002085
1271 Ga0070662_100002761
1272 Ga0070662_100071930
1273 Ga0070662_100077680
1274 Ga0070662_100100359
1275 Ga0070662_100117063
1276 Ga0070662_100126832
1277 Ga0070662_100132032
1278 Ga0070662_100138244
1279 Ga0070662_100158586
1280 Ga0070662_100598754
1281 Ga0070662_100823938
1282 Ga0070681_10073507
1283 Ga0070681_10100447
1284 Ga0070681_10217200
1285 Ga0070681_10233756
1286 Ga0068867_100004339
1287 Ga0068867_100024493
1288 Ga0068867_100025006
1289 Ga0070679_100094458
1290 Ga0070679_100544252
1291 Ga0070679_101501911
1292 Ga0070679_101646574
1293 Ga0070684_100051073
1294 Ga0070684_100402939
1295 Ga0068853_100012957
1296 Ga0068853_100100197
1297 Ga0068853_100112078
1298 Ga0068853_100115195
1299 Ga0068853_100117056
1300 Ga0068853_100502582
1301 Ga0068853_100521047
1302 Ga0068853_100784295
1303 Ga0070672_100002094
1304 Ga0070672_100009145
1305 Ga0070672_100045227
1306 Ga0070672_100081440
1307 Ga0070672_100162312
1308 Ga0070672_100384915
1309 Ga0070672_100492382
1310 Ga0070686_100000003
1311 Ga0070696_100017543
1312 Ga0070693_100057850
1313 Ga0070693_100495267
1314 Ga0070665_100000036
1315 Ga0070665_100009237
1316 Ga0070665_100016369
1317 Ga0070665_100018770
1318 Ga0070665_100025030
1319 Ga0070665_100029159
1320 Ga0070665_100056611
1321 Ga0070665_100302964
1322 Ga0068855_100000416
1323 Ga0068855_100013061
1324 Ga0068855_100060574
1325 Ga0068855_100233435
1326 Ga0068855_100287476
1327 Ga0068855_100355347
1328 Ga0070664_100002143
1329 Ga0070664_100008627
1330 Ga0070664_100028885
1331 Ga0070664_100065520
1332 Ga0070664_100372129
1333 Ga0070664_100936308
1334 Ga0068857_100006484
1335 Ga0068857_100006868
1336 Ga0068857_100018717
1337 Ga0068857_100025709
1338 Ga0068857_100067063
1339 Ga0068857_100130949
1340 Ga0068857_100186437
1341 Ga0068857_100240388
1342 Ga0068854_100000967
1343 Ga0068854_100008248
1344 Ga0068854_100012824
1345 Ga0068854_100046883
1346 Ga0068854_100078121
1347 Ga0068854_100135992
1348 Ga0068854_100219895
1349 Ga0068854_100263981
1350 Ga0068854_100414384
1351 Ga0068856_100038595
1352 Ga0068856_100437855
1353 Ga0068856_100547845
1354 Ga0068852_100010427
1355 Ga0068852_100017888
1356 Ga0068852_100035305
1357 Ga0068852_100088901
1358 Ga0068852_100107546
1359 Ga0068852_100190496
1360 Ga0068852_100328026
1361 Ga0068852_100407529
1362 Ga0068852_101031276
1363 Ga0068852_101050548
1364 Ga0068859_100004454
1365 Ga0068859_100032582
1366 Ga0068859_100061715
1367 Ga0068859_100084481
1368 Ga0068859_100236618
1369 Ga0068864_100000004
1370 Ga0068864_100002759
1371 Ga0068864_100003689
1372 Ga0068864_100005457
1373 Ga0068864_100015275
1374 Ga0068864_100046298
1375 Ga0068864_100211912
1376 Ga0068866_10027636
1377 Ga0068866_10343035
1378 Ga0068861_100011513
1379 Ga0068861_100107831
1380 Ga0068851_10038669
1381 Ga0068851_10098165
1382 Ga0068851_10186911
1383 Ga0068851_10337848
1384 Ga0068870_10375599
1385 Ga0068863_100000002
1386 Ga0068863_100000034
1387 Ga0068863_100000058
1388 Ga0068863_100012807
1389 Ga0068863_100013229
1390 Ga0068863_100040903
1391 Ga0068863_100062881
1392 Ga0068863_100066632
1393 Ga0068863_100106796
1394 Ga0068858_100003215
1395 Ga0068858_100003738
1396 Ga0068858_100005852
1397 Ga0068858_100020726
1398 Ga0068858_100070857
1399 Ga0068858_100099066
1400 Ga0068858_100350577
1401 Ga0068860_100000001
1402 Ga0068860_100000057
1403 Ga0068860_100011114
1404 Ga0068860_100025331
1405 Ga0068860_100051397
1406 Ga0068860_100078845
1407 Ga0068860_100137842
1408 Ga0068860_100152316
1409 Ga0068860_100233646
1410 Ga0068860_100284840
1411 Ga0068862_100000002
1412 Ga0068862_100003077
1413 Ga0068862_100011549
1414 Ga0068862_100023350
1415 Ga0068862_100023655
1416 Ga0068862_100025436
1417 Ga0068862_100950462
1418 Ga0081455_10000285
1419 Ga0081538_10004145
1420 Ga0081539_10015411
1421 Ga0075362_10141481
1422 Ga0075369_10044211
1423 Ga0075369_10109762
1424 Ga0075366_10080134
1425 Ga0097621_100029076
1426 Ga0097621_100031489
1427 Ga0097621_100041012
1428 Ga0097621_100068813
1429 Ga0097621_100387448
1430 Ga0075370_10012327
1431 Ga0075370_10299786
1432 Ga0068871_100032747
1433 Ga0068871_100061530
1434 Ga0068871_100069819
1435 Ga0068871_100281172
1436 Ga0068871_100571483
1437 Ga0068871_100757637
1438 Ga0075431_101155980
1439 Ga0075433_10321687
1440 Ga0075434_100138580
1441 Ga0068865_100022990
1442 Ga0075436_100706768
1443 Ga0097620_100004454
1444 Ga0097620_100032585
1445 Ga0097620_100061707
1446 Ga0097620_100084480
1447 Ga0097620_100236599
1448 Ga0075435_100362972
1449 Ga0105251_10000318
1450 Ga0105251_10000528
1451 Ga0105251_10280942
1452 Ga0105240_10018614
1453 Ga0105240_10038887
1454 Ga0105240_10079593
1455 Ga0105240_10544104
1456 Ga0105240_10963601
1457 Ga0111539_10082456
1458 Ga0105245_10005794
1459 Ga0105245_10030788
1460 Ga0105245_10237512
1461 Ga0105247_10259226
1462 Ga0105247_10587879
1463 Ga0105243_10014013
1464 Ga0105241_10049088
1465 Ga0105241_10135351
1466 Ga0105241_10183692
1467 Ga0105241_10278097
1468 Ga0105241_10499137
1469 Ga0105242_10053897
1470 Ga0105248_10002544
1471 Ga0105248_10004898
1472 Ga0105248_10024303
1473 Ga0105248_10029706
1474 Ga0105248_10049395
1475 Ga0105248_10054703
1476 Ga0105248_10067315
1477 Ga0105248_10074938
1478 Ga0105248_10155322
1479 Ga0105248_10232493
1480 Ga0105248_10251577
1481 Ga0105248_10995075
1482 Ga0105237_10048374
1483 Ga0105237_11858343
1484 Ga0105237_12435927
1485 Ga0105238_10166463
1486 Ga0105238_10176708
1487 Ga0105238_10196587
1488 Ga0105238_10706270
1489 Ga0105249_10000026
1490 Ga0105249_10000041
1491 Ga0105249_10087542
1492 Ga0105249_10250536
1493 Ga0105249_10447159
1494 Ga0105032_107290
1495 Ga0105239_10029892
1496 Ga0105239_10064615
1497 Ga0105239_10202988
1498 Ga0105239_11266880
1499 Ga0105246_10015655
1500 Ga0105246_10066570
1501 Ga0157325_1003944
1502 Ga0157327_1005599
1503 Ga0157326_1002093
1504 Ga0157373_10018417
1505 Ga0157373_10044638
1506 Ga0157373_10049774
1507 Ga0157373_10102886
1508 Ga0157373_10118059
1509 Ga0157373_11011791
1510 Ga0157371_10001127
1511 Ga0157371_10035191
1512 Ga0157371_10037325
1513 Ga0157371_10135487
1514 Ga0157371_10290414
1515 Ga0157370_10015106
1516 Ga0157370_10036432
1517 Ga0157370_10057761
1518 Ga0157370_10067871
1519 Ga0157370_10107049
1520 Ga0157370_10339077
1521 Ga0157369_10028337
1522 Ga0157369_10033530
1523 Ga0157369_10048730
1524 Ga0157369_10053242
1525 Ga0157369_10449041
1526 Ga0157369_11018390
1527 Ga0157374_10014163
1528 Ga0157374_10055362
1529 Ga0157374_10422179
1530 Ga0157374_10733354
1531 Ga0157378_10012326
1532 Ga0157378_10094692
1533 Ga0157378_11271653
1534 Ga0163162_10010333
1535 Ga0163162_10041158
1536 Ga0163162_10050732
1537 Ga0163162_10095745
1538 Ga0163162_10144998
1539 Ga0163162_10151769
1540 Ga0163162_10293544
1541 Ga0163162_11495294
1542 Ga0157372_10050082
1543 Ga0157372_10066362
1544 Ga0157372_10162259
1545 Ga0157372_10540758
1546 Ga0157372_10920059
1547 Ga0157375_10001559
1548 Ga0157375_10023390
1549 Ga0157375_10029940
1550 Ga0157375_10044167
1551 Ga0157375_10164783
1552 Ga0157375_10214100
1553 Ga0163163_10004621
1554 Ga0163163_10022431
1555 Ga0163163_10022750
1556 Ga0163163_10295003
1557 Ga0163163_11341414
1558 Ga0157380_10004942
1559 Ga0157380_10006760
1560 Ga0157380_10185537
1561 Ga0157380_10999994
1562 Ga0157377_10007543
1563 Ga0157377_10037098
1564 Ga0157379_10003023
1565 Ga0157379_10076998
1566 Ga0157379_10168565
1567 Ga0157376_10689635
1568 Ga0163161_10000008
1569 Ga0163161_10969811
1570 Ga0206354_11597705
1571 Ga0213875_10000504
1572 Ga0207672_1001417
1573 Ga0209674_104386
1574 Ga0209026_1023632
1575 Ga0209677_106817
1576 Ga0209050_1000119
1577 Ga0207697_10000146
1578 Ga0207697_10008369
1579 Ga0207697_10042668
1580 Ga0207656_10019689
1581 Ga0207656_10046431
1582 Ga0207656_10058493
1583 Ga0207656_10178952
1584 Ga0207696_1008396
1585 Ga0207713_1001817
1586 Ga0207713_1007873
1587 Ga0207713_1018330
1588 Ga0207682_10003216
1589 Ga0207642_10038577
1590 Ga0207642_10290280
1591 Ga0207710_10227695
1592 Ga0207688_10000514
1593 Ga0207688_10002039
1594 Ga0207688_10008611
1595 Ga0207688_10257735
1596 Ga0207688_10352254
1597 Ga0207680_10000004
1598 Ga0207680_10010303
1599 Ga0207680_10013802
1600 Ga0207680_10027602
1601 Ga0207680_10064143
1602 Ga0207680_10150115
1603 Ga0207680_10171087
1604 Ga0207647_10006026
1605 Ga0207647_10015636
1606 Ga0207647_10023716
1607 Ga0207647_10028124
1608 Ga0207647_10077978
1609 Ga0207645_10008722
1610 Ga0207645_10008939
1611 Ga0207645_10099693
1612 Ga0207645_10289566
1613 Ga0207645_10331791
1614 Ga0207643_10208825
1615 Ga0207705_10000023
1616 Ga0207705_10003928
1617 Ga0207705_10003980
1618 Ga0207705_10061108
1619 Ga0207705_10700309
1620 Ga0207654_10017454
1621 Ga0207654_10075657
1622 Ga0207707_10022822
1623 Ga0207707_10261522
1624 Ga0207707_10576637
1625 Ga0207695_10025245
1626 Ga0207695_10029643
1627 Ga0207695_10165830
1628 Ga0207671_10002922
1629 Ga0207660_10053288
1630 Ga0207662_10100954
1631 Ga0207662_10164397
1632 Ga0207657_10000157
1633 Ga0207657_10002054
1634 Ga0207657_10007296
1635 Ga0207657_10031703
1636 Ga0207657_10199707
1637 Ga0207649_10018259
1638 Ga0207649_10019618
1639 Ga0207649_10079153
1640 Ga0207649_10609709
1641 Ga0207652_10005299
1642 Ga0207652_10047408
1643 Ga0207652_10251005
1644 Ga0207652_10549465
1645 Ga0207681_10000069
1646 Ga0207681_10000125
1647 Ga0207681_10000968
1648 Ga0207681_10004090
1649 Ga0207681_10167003
1650 Ga0207681_10410098
1651 Ga0207681_10601281
1652 Ga0207681_10689530
1653 Ga0207694_10001182
1654 Ga0207694_10067827
1655 Ga0207694_10106528
1656 Ga0207694_10124272
1657 Ga0207650_10000083
1658 Ga0207650_10006485
1659 Ga0207650_10040361
1660 Ga0207650_10140186
1661 Ga0207650_10157013
1662 Ga0207650_10289861
1663 Ga0207650_10474719
1664 Ga0207650_10765500
1665 Ga0207659_10002940
1666 Ga0207659_10020455
1667 Ga0207659_10029707
1668 Ga0207659_10117586
1669 Ga0207659_10736040
1670 Ga0207659_10875309
1671 Ga0207687_10035622
1672 Ga0207687_10044839
1673 Ga0207687_10162708
1674 Ga0207700_11023449
1675 Ga0207664_10008627
1676 Ga0207644_10000451
1677 Ga0207644_10000494
1678 Ga0207644_10000963
1679 Ga0207644_10011181
1680 Ga0207644_10013459
1681 Ga0207644_10015985
1682 Ga0207644_10026799
1683 Ga0207644_10053223
1684 Ga0207644_10086687
1685 Ga0207644_10214140
1686 Ga0207690_10001145
1687 Ga0207690_10051816
1688 Ga0207690_10060462
1689 Ga0207706_10000707
1690 Ga0207706_10001411
1691 Ga0207706_10022661
1692 Ga0207706_10049855
1693 Ga0207706_10088835
1694 Ga0207706_10116440
1695 Ga0207706_10117232
1696 Ga0207706_10228655
1697 Ga0207706_10284720
1698 Ga0207706_10558956
1699 Ga0207706_10602172
1700 Ga0207709_10261036
1701 Ga0207670_10008177
1702 Ga0207670_10103663
1703 Ga0207670_10365769
1704 Ga0207669_10011128
1705 Ga0207669_10063816
1706 Ga0207669_10078757
1707 Ga0207669_10086474
1708 Ga0207669_10166054
1709 Ga0207704_10248553
1710 Ga0207691_10001477
1711 Ga0207691_10005762
1712 Ga0207691_10029443
1713 Ga0207691_10052045
1714 Ga0207691_10201302
1715 Ga0207711_10000035
1716 Ga0207711_10002211
1717 Ga0207711_10003944
1718 Ga0207711_10007414
1719 Ga0207711_10045546
1720 Ga0207711_10058902
1721 Ga0207711_10085454
1722 Ga0207711_10087914
1723 Ga0207711_10121572
1724 Ga0207711_10126775
1725 Ga0207711_10130723
1726 Ga0207711_10189840
1727 Ga0207711_10519434
1728 Ga0207689_10000327
1729 Ga0207689_10006734
1730 Ga0207689_10044681
1731 Ga0207689_10246925
1732 Ga0207689_10976279
1733 Ga0207661_10096451
1734 Ga0207661_10462744
1735 Ga0207661_11318533
1736 Ga0207679_10010734
1737 Ga0207679_10016172
1738 Ga0207679_10027185
1739 Ga0207679_10036633
1740 Ga0207679_10838319
1741 Ga0207667_10000504
1742 Ga0207667_10020667
1743 Ga0207667_10025649
1744 Ga0207667_10082437
1745 Ga0207667_10091102
1746 Ga0207667_10132748
1747 Ga0207667_10422709
1748 Ga0207651_10001733
1749 Ga0207651_10008053
1750 Ga0207651_10062023
1751 Ga0207651_10416804
1752 Ga0207651_10602805
1753 Ga0207651_10901611
1754 Ga0207651_10958312
1755 Ga0207712_10000001
1756 Ga0207712_10000338
1757 Ga0207712_10474040
1758 Ga0207668_10000091
1759 Ga0207668_10034071
1760 Ga0207668_10035523
1761 Ga0207668_10037530
1762 Ga0207668_10037793
1763 Ga0207668_10048863
1764 Ga0207668_10335870
1765 Ga0207668_10690818
1766 Ga0207640_10000394
1767 Ga0207640_10048996
1768 Ga0207640_10060662
1769 Ga0207640_10074903
1770 Ga0207640_10147157
1771 Ga0207640_10263744
1772 Ga0207640_10269477
1773 Ga0207658_10000247
1774 Ga0207658_10000479
1775 Ga0207658_10000845
1776 Ga0207658_10007062
1777 Ga0207658_10009987
1778 Ga0207658_10010194
1779 Ga0207658_10023095
1780 Ga0207658_10036115
1781 Ga0207658_10042942
1782 Ga0207658_10085947
1783 Ga0207658_10101921
1784 Ga0207658_10229396
1785 Ga0207658_11538520
1786 Ga0207658_11718549
1787 Ga0207677_10001141
1788 Ga0207677_10075979
1789 Ga0207677_10157322
1790 Ga0207677_10435496
1791 Ga0207677_10859555
1792 Ga0207703_10001491
1793 Ga0207703_10012590
1794 Ga0207703_10030693
1795 Ga0207703_10054589
1796 Ga0207639_10011077
1797 Ga0207639_10024055
1798 Ga0207639_10039328
1799 Ga0207639_10064493
1800 Ga0207639_10267153
1801 Ga0207639_10498970
1802 Ga0207639_10708171
1803 Ga0207639_11045651
1804 Ga0207678_10004612
1805 Ga0207678_10011543
1806 Ga0207678_10016036
1807 Ga0207678_10217682
1808 Ga0207702_10016194
1809 Ga0207702_10032763
1810 Ga0207702_10188245
1811 Ga0207702_10373629
1812 Ga0207702_10559141
1813 Ga0207702_10680796
1814 Ga0207702_12013728
1815 Ga0207641_10000002
1816 Ga0207641_10000057
1817 Ga0207641_10000338
1818 Ga0207641_10002263
1819 Ga0207641_10017865
1820 Ga0207641_10020571
1821 Ga0207641_10030727
1822 Ga0207641_10247520
1823 Ga0207641_10268108
1824 Ga0207648_10002010
1825 Ga0207648_10005437
1826 Ga0207648_10008026
1827 Ga0207648_10060399
1828 Ga0207648_10098399
1829 Ga0207648_10560696
1830 Ga0207676_10000005
1831 Ga0207676_10005731
1832 Ga0207676_10006145
1833 Ga0207676_10010041
1834 Ga0207676_10011187
1835 Ga0207676_10067064
1836 Ga0207676_10132474
1837 Ga0207676_10201065
1838 Ga0207674_10008456
1839 Ga0207674_10008693
1840 Ga0207674_10024052
1841 Ga0207674_10089158
1842 Ga0207674_10239460
1843 Ga0207674_10391289
1844 Ga0207674_10403942
1845 Ga0207674_10439426
1846 Ga0207675_100000571
1847 Ga0207675_100093064
1848 Ga0207675_100292957
1849 Ga0207683_10014765
1850 Ga0207683_10034599
1851 Ga0207683_10036248
1852 Ga0207683_10043317
1853 Ga0207683_10531154
1854 Ga0207698_10000141
1855 Ga0207698_10027615
1856 Ga0207698_10033459
1857 Ga0207698_10036243
1858 Ga0207698_10060741
1859 Ga0207698_10061122
1860 Ga0207698_10240388
1861 Ga0207698_10494360
1862 Ga0207698_10520009
1863 Ga0207698_10933270
1864 Ga0207428_10145098
1865 Ga0268266_10000042
1866 Ga0268266_10000888
1867 Ga0268266_10007115
1868 Ga0268266_10020750
1869 Ga0268266_10029863
1870 Ga0268266_10030450
1871 Ga0268266_10076745
1872 Ga0268266_10095458
1873 Ga0268266_10664875
1874 Ga0268266_11314491
1875 Ga0268266_11389706
1876 Ga0268265_10000003
1877 Ga0268265_10000145
1878 Ga0268265_10002983
1879 Ga0268265_10017567
1880 Ga0268265_10024819
1881 Ga0268265_10033209
1882 Ga0268265_10244333
1883 Ga0268265_10992954
1884 Ga0268264_10000006
1885 Ga0268264_10000078
1886 Ga0268264_10009040
1887 Ga0268264_10014901
1888 Ga0268264_10044922
1889 Ga0268264_10224856
1890 Ga0268264_10225661
1891 Ga0268264_10303919
1892 Ga0268264_10363018
1893 Ga0265331_10047984
1894 Ga0307408_100066956
1895 Ga0307408_100435032
1896 Ga0307408_100918759
1897 Ga0307405_10031040
1898 Ga0307405_10060344
1899 Ga0307405_10116650
1900 Ga0307413_10177791
1901 Ga0307413_11022020
1902 Ga0307413_11110125
1903 Ga0307406_10235791
1904 Ga0307412_10024118
1905 Ga0307409_100008388
1906 Ga0307409_100037682
1907 Ga0307409_100062813
1908 Ga0307409_100191452
1909 Ga0307409_100290036
1910 Ga0307416_100544926
1911 Ga0307416_101479626
1912 Ga0307414_10000225
1913 Ga0307414_10119146
1914 Ga0307414_10189678
1915 Ga0307411_10106532
1916 Ga0307415_100365096
1917 Ga0307510_10412149
1918 Ga0373929_0069590
1919 Ga0373943_0609029
1920 Ga0373943_0788340
1921 Ga0373935_1029093
1922 Ga0373927_0066214
1923 Ga0395899_0001370
1924 Ga0395899_0020561
1925 Ga0395899_0039456
1926 Ga0395899_0315234
1927 Ga0395899_0442121
1928 Ga0395900_0000449
1929 Ga0395900_0005115
1930 Ga0395900_0046854
1931 Ga0395900_0149478
1932 Ga0395900_0293015
1933 Ga0395900_0420129
1934 Ga0395900_0862715
1935 Ga0395900_1176037
1936 Ga0395900_1707199
1937 Ga0395898_0002969
1938 Ga0395898_0004847
1939 Ga0395898_0035811
1940 Ga0395898_0050229
1941 Ga0395898_0357001
1942 Ga0395898_0376430
1943 Ga0395898_0822708
1944 Ga0395905_0000434
1945 Ga0395905_0002407
1946 Ga0395905_0003338
1947 Ga0395905_0003634
1948 Ga0395905_0005040
1949 Ga0395905_0005740
1950 Ga0395905_0018144
1951 Ga0395905_0028836
1952 Ga0395905_0073288
1953 Ga0395905_0103466
1954 Ga0395905_0281710
1955 Ga0395905_0360819
1956 Ga0395905_0495604
1957 Ga0395905_0518102
1958 Ga0395905_0657171
1959 Ga0395905_1081782
1960 Ga0395905_1358739
1961 Ga0436364_0139430
1962 Ga0436364_0533904
1963 Ga0395901_0001276
1964 Ga0395901_0008989
1965 Ga0395901_0052068
1966 Ga0395901_0056699
1967 Ga0395901_0088296
1968 Ga0395901_0244789
1969 Ga0395901_0375842
1970 Ga0395901_0820496
1971 Ga0395901_0876482
1972 Ga0395901_0974745
1973 Ga0237819_00594
1974 Ga0237816_01767
1975 Ga0436365_1287249
1976 Ga0436365_1582505
1977 Ga0436363_1327386
1978 Ga0451800_0345223
1979 Ga0451841_0452807
1980 Ga0451853_3072353
1981 Ga0451853_3355289
1982 Ga0439448_0242723
1983 Ga0439432_060137
1984 Ga0439458_0000285
1985 Ga0466973_0146996
1986 Ga0466966_0323529
1987 Ga0466963_0041360
1988 Ga0466963_0060017
1989 Ga0453684_0642946
1990 Ga0466957_0065750
1991 Ga0466957_0615601
1992 Ga0466967_0326948
1993 Ga0466967_0587467
1994 Ga0495638_0284459
1995 Ga0495585_0210739
1996 Ga0495596_0001277
1997 Ga0495607_0030644
1998 Ga0495607_0109229
1999 Ga0495583_0069549
2000 Ga0495610_0000600
2001 Ga0495631_0009110
2002 Ga0495631_0153554
2003 Ga0495632_0085336
2004 Ga0495643_0000351
2005 Ga0495643_0003604
2006 Ga0495643_0126412
2007 Ga0495648_0054512
2008 Ga0495663_0030303
2009 Ga0495642_0422670
2010 Ga0495654_0002139
2011 Ga0495654_0177974
2012 Ga0495598_0055378
2013 Ga0495609_0014144
2014 Ga0495621_0000308
2015 Ga0495633_0002121
2016 Ga0495633_0036960
2017 Ga0495668_0001229
2018 Ga0495668_0043797
2019 Ga0495625_0023484
2020 Ga0495661_0267674
2021 Ga0495647_0152673
2022 Ga0495669_0000187
2023 Ga0495669_0001688
2024 Ga0495669_0049668
2025 Ga0495669_0314784
2026 Ga0495669_0571218
2027 Ga0495670_0005983
2028 Ga0495670_0027439
2029 Ga0495670_0286529
2030 Ga0495589_0044504
2031 Ga0495677_0240288
2032 Ga0495681_0155354
2033 Ga0496100_0031059
2034 Ga0496101_0041860
2035 Ga0496101_0175594
2036 Ga0496101_0325996
2037 Ga0496102_0000106
2038 Ga0496102_0018284
2039 Ga0496102_0102114
2040 Ga0496102_0232962
2041 Ga0496102_0244239
2042 Ga0496102_0298997
2043 Ga0496102_1121703
2044 Ga0496102_1868321
2045 Ga0496103_0000095
2046 Ga0496103_0003384
2047 Ga0496103_0015936
2048 Ga0496103_0041926
2049 Ga0496103_0046662
2050 Ga0496103_0158326
2051 Ga0496103_0222765
2052 Ga0496104_0000060
2053 Ga0496104_0037015
2054 Ga0496104_0370295
2055 Ga0496104_0993578
2056 Ga0496105_0000122
2057 Ga0496105_0000751
2058 Ga0496105_0210965
2059 Ga0496106_0260157
2060 Ga0496106_0318907
2061 Ga0496106_0426356
2062 Ga0496106_0784872
2063 Ga0496107_0002226
2064 Ga0496107_0010545
2065 Ga0496107_0012702
2066 Ga0496107_0217265
2067 Ga0496108_0010554
2068 Ga0496108_0048506
2069 Ga0496108_0049625
2070 Ga0496109_0001421
2071 Ga0496109_0007620
2072 Ga0496109_1115462
2073 Ga0496110_0025450
2074 Ga0496110_0244269
2075 Ga0496110_0449021
2076 Ga0496110_1021164
2077 Ga0496110_1154249
2078 Ga0496111_0004971
2079 Ga0496111_0035243
2080 Ga0496112_0013852
2081 Ga0496112_0053584
2082 Ga0496112_0119238
2083 Ga0496113_0000378
2084 Ga0496113_0002130
2085 Ga0496113_0002449
2086 Ga0496113_0016220
2087 Ga0496115_0026203
2088 Ga0496116_0000035
2089 Ga0496116_0048411
2090 Ga0496117_0003116
2091 Ga0496117_0013244
2092 Ga0496117_0029840
2093 Ga0496117_0076107
2094 Ga0496118_0000807
2095 Ga0496118_0002769
2096 Ga0496118_0004532
2097 Ga0496118_0026194
2098 Ga0496118_0428350
2099 Ga0496118_0477939
2100 Ga0496119_0000222
2101 Ga0496119_0072452
2102 Ga0496119_0220527
2103 Ga0496120_0001728
2104 Ga0496120_0082466
2105 Ga0496120_0118114
2106 Ga0496121_0002209
2107 Ga0496121_0044026
2108 Ga0496122_0001902
2109 Ga0496122_0008544
2110 Ga0496123_0005132
2111 Ga0496123_0017737
2112 Ga0496123_0134356
2113 Ga0496123_0420800
2114 Ga0496124_0001019
2115 Ga0496124_0012893
2116 Ga0496124_0213795
2117 Ga0496124_0385420
2118 Ga0496124_0464187
2119 Ga0496124_0982895
2120 Ga0496125_0011746
2121 Ga0496125_0076035
2122 Ga0496125_0229184
2123 Ga0496126_0000084
2124 Ga0496126_0000294
2125 Ga0496126_0016038
2126 Ga0496126_0204267
2127 Ga0495678_050251
2128 Ga0501032_0012532
2129 Ga0501037_0820279
2130 Ga0501042_0975382
2131 Ga0501043_0007329
2132 Ga0501046_0198319
2133 Ga0501047_0002674
2134 Ga0501249_000314
2135 Ga0501249_027565
2136 nmdc:mga00v17_506623_c1
2137 nmdc:mga0k408_307677_c1
2138 nmdc:mga07m45_101852_c1
2139 nmdc:mga07m45_5275_c1
2140 nmdc:mga08y16_318898_c1
2141 nmdc:mga0rr50_1032255_c1
2142 Ga0500592_000075
2143 Ga0500592_000336
2144 Ga0500595_012882
2145 Ga0500658_0019313
2146 Ga0500627_0000187
2147 Ga0500627_0000336
2148 Ga0587090_004120
2149 2511126152
2150 2819552701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

44

169

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xmg-assembly1.cif.gz_A crystal structure of nitrophorin 7 from rhodnius prolixus at ph 7.8 complexed with imidazole 0.8953 111 146
5m6k-assembly1.cif.gz_A crystal structure of nitrophorin 7 e27v mutant from rhodnius prolixus with imidazole 0.893 111 146
6n3p-assembly1.cif.gz_A crosslinked acpp=fabz complex from e. coli type ii fas 0.8708 8 148
7qv0-assembly1.cif.gz_C-2 covalent complex between scalindua brodae amxfabz and amxacp 0.8706 12 149
4i83-assembly1.cif.gz_F crystal structure of (3r)-hydroxymyristoyl-acp dehydratase from neisseria meningitidis fam18 0.8701 7 146
ID Description Score Start End Superfamily
4xmhA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8896 111 146 2.40.128.20
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8694 9 150 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8652 9 148 3.10.129.10
af_A0A0R0JUA4_1_78_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8637 68 143 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8614 8 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A4Q3A892-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9781 66 150 GO:0016829
AF-A0A537M7B8-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9615 61 150 GO:0016829
AF-A0A4Q3A892-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9246 66 150 GO:0016829
AF-A0A537M7B8-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9217 61 150 GO:0016829
AF-A0A523E9X7-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9015 6 147 GO:0016829

Map