F489574
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1075 | 439 | 2150 | 364 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2842805378|2842809663 |
| Length | 347 |
| Sequence | LLLLLEGGVLLAGLLLAFFVWQQNSALKQTLNVPAGYVMEVPAGATPGGVLNRLESEGVLNGAFWLRIYWRFNLSGQALHSGEYQLNPGATAKDLLTLWQRGDVVQYSLTLVEGWNFRQVRAALAKQIKLEQTITELTDAQVMERIGQRGVFPEGRFFPDTYRYVRGMSDTDLLKQAFARLAAVLDEEWKQRDASADLPYKDAYDALIMASMIEKETGVPQERGQIAGVFVRRLQQGMQLQTDPTVIYGLGERYTGKLTRAHLREATPYNTYMIAGMPPTPIAMVGREAIHAALHPVDGKSLYFVARGDGSHVFSDDLDNHNRAVREFQLKRRADYRSSPAPAPAVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 2 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 30 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 31 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 32 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 41 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 49 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 86 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 87 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 91 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 92 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 93 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 94 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 95 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 96 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 97 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 98 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 99 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 100 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 101 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 102 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 103 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 104 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 105 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 106 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 107 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 108 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 109 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 110 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 111 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 112 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 113 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 114 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 115 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 116 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 117 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 118 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 119 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 120 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 121 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 122 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 123 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 124 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 125 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 126 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 127 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 203 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 207 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 210 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 213 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 214 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 215 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 216 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 217 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 223 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 224 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 225 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 226 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 227 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 228 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 229 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 230 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 231 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 232 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 233 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 234 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 235 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 236 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 237 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 238 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 239 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 240 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 241 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 242 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 243 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 244 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 245 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 246 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 247 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 248 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 249 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 250 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 251 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 252 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 253 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 254 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 255 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 256 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 257 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 258 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 259 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 260 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 261 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 262 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 263 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 264 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 265 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 266 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 267 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 268 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 269 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 270 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 271 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 272 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 273 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 274 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 275 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 276 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 277 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 278 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 279 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 280 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 281 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 282 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 283 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 284 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 285 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 286 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 287 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 288 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 289 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 290 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 291 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 292 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 293 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 294 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 295 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 296 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 297 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 298 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 299 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 300 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 301 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 302 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 303 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 304 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 305 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 306 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 307 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 308 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 309 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 310 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 311 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 312 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 313 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 314 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 315 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 316 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 317 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 318 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 319 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 320 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 321 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 322 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 323 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 324 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 325 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 326 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 327 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 328 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 329 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 330 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 331 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 332 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 333 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 334 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 335 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 336 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 337 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 338 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 339 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 340 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 341 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 342 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 343 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 344 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 345 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 346 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 347 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 348 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 349 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 350 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 351 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 352 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 353 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 354 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 355 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 356 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 357 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 358 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 359 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 360 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 361 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 362 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 363 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 364 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 365 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 366 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 367 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 368 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 369 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 370 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 371 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 372 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 373 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 374 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 375 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 376 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 377 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 378 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 379 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 380 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 381 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 382 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 383 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 384 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 385 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 386 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 387 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 388 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 389 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 390 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 391 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 392 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 393 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 394 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 395 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 396 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 397 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 398 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 399 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 400 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 401 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 402 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 403 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 404 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 405 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 406 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 407 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 408 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 409 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 410 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 411 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 412 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 413 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 414 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 415 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 416 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 417 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 418 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 419 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 420 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 421 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 422 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 423 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 424 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 425 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 426 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 427 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 428 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 429 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 430 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 431 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 432 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 433 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 434 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 435 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 436 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 437 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 438 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 439 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.09 |
| Metatranscriptomes | 0 |
| Isolates | 19.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.95 |
| Nodule | 1.95 |
| Rhizoplane | 6.79 |
| Rhizosphere | 73.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000421 | 3300002737 | Bacteria | 34311 |
| 2 | JGI25162J39368_1000838 | 3300002737 | Bacteria | 20276 |
| 3 | JGI25163J39215_1000824 | 3300002771 | Bacteria | 7443 |
| 4 | JGI25163J39215_1000932 | 3300002771 | Bacteria | 6678 |
| 5 | JGI25164J39214_1000296 | 3300002772 | Bacteria | 34311 |
| 6 | JGI25164J39214_1000469 | 3300002772 | Bacteria | 20276 |
| 7 | JGI25165J46597_1000528 | 3300003214 | Bacteria | 35737 |
| 8 | JGI25165J46597_1000864 | 3300003214 | Bacteria | 21703 |
| 9 | Ga0055538_1000132 | 3300003751 | Bacteria | 54508 |
| 10 | Ga0055539_1000177 | 3300003752 | Bacteria | 54508 |
| 11 | Ga0055533_1000179 | 3300003756 | Bacteria | 54508 |
| 12 | Ga0055532_1000179 | 3300003758 | Bacteria | 54508 |
| 13 | Ga0055525_1000408 | 3300003759 | Bacteria | 26491 |
| 14 | Ga0055525_1002782 | 3300003759 | Bacteria | 1672 |
| 15 | Ga0055535_1008840 | 3300003761 | Bacteria | 1781 |
| 16 | Ga0055536_1000436 | 3300003781 | Bacteria | 29486 |
| 17 | Ga0055536_1003265 | 3300003781 | Bacteria | 8790 |
| 18 | Ga0055536_1003284 | 3300003781 | Bacteria | 8749 |
| 19 | Ga0055530_10000240 | 3300003791 | Bacteria | 49322 |
| 20 | Ga0055530_10000671 | 3300003791 | Bacteria | 29135 |
| 21 | Ga0055530_10004397 | 3300003791 | Bacteria | 7269 |
| 22 | Ga0055540_1000248 | 3300003792 | Bacteria | 49322 |
| 23 | Ga0055540_1000400 | 3300003792 | Bacteria | 35238 |
| 24 | Ga0055540_1004414 | 3300003792 | Bacteria | 6358 |
| 25 | Ga0055531_10000202 | 3300003794 | Bacteria | 65776 |
| 26 | Ga0055541_1000118 | 3300003841 | Bacteria | 54508 |
| 27 | Ga0065714_10000004 | 3300005288 | Bacteria | 24654 |
| 28 | Ga0065714_10005054 | 3300005288 | Bacteria | 4202 |
| 29 | Ga0065714_10008187 | 3300005288 | Bacteria | 5174 |
| 30 | Ga0065714_10010654 | 3300005288 | Bacteria | 3220 |
| 31 | Ga0065714_10015583 | 3300005288 | Bacteria | 3679 |
| 32 | Ga0065714_10065886 | 3300005288 | Bacteria | 8197 |
| 33 | Ga0065714_10076538 | 3300005288 | Bacteria | 2779 |
| 34 | Ga0065714_10077353 | 3300005288 | Bacteria | 2698 |
| 35 | Ga0065704_10073559 | 3300005289 | Bacteria | 7017 |
| 36 | Ga0065704_10073698 | 3300005289 | Bacteria | 6873 |
| 37 | Ga0065704_10110882 | 3300005289 | Bacteria | 1966 |
| 38 | Ga0065712_10077948 | 3300005290 | Bacteria | 3421 |
| 39 | Ga0070670_100010753 | 3300005331 | Bacteria | 7818 |
| 40 | Ga0070670_100154186 | 3300005331 | Bacteria | 1989 |
| 41 | Ga0070661_100000284 | 3300005344 | Bacteria | 41018 |
| 42 | Ga0070669_100001202 | 3300005353 | Bacteria | 18859 |
| 43 | Ga0070662_100000804 | 3300005457 | Bacteria | 19304 |
| 44 | Ga0070662_100072526 | 3300005457 | Bacteria | 2542 |
| 45 | Ga0068853_100003812 | 3300005539 | Bacteria | 11552 |
| 46 | Ga0070665_100013903 | 3300005548 | Bacteria | 8097 |
| 47 | Ga0070665_100175995 | 3300005548 | Bacteria | 2140 |
| 48 | Ga0070664_100000681 | 3300005564 | Bacteria | 25939 |
| 49 | Ga0070664_100127710 | 3300005564 | Bacteria | 2232 |
| 50 | Ga0068854_100023043 | 3300005578 | Bacteria | 4250 |
| 51 | Ga0068851_10000011 | 3300005834 | Bacteria | 178585 |
| 52 | Ga0075364_10067732 | 3300006051 | Bacteria | 2347 |
| 53 | Ga0075432_10003878 | 3300006058 | Bacteria | 5095 |
| 54 | Ga0075432_10004638 | 3300006058 | Bacteria | 4681 |
| 55 | Ga0075432_10008264 | 3300006058 | Bacteria | 3547 |
| 56 | Ga0075432_10034471 | 3300006058 | Bacteria | 1758 |
| 57 | Ga0099823_1021985 | 3300006944 | Bacteria | 5927 |
| 58 | Ga0079104_1000094 | 3300006946 | Bacteria | 130202 |
| 59 | Ga0079104_1000668 | 3300006946 | Bacteria | 32257 |
| 60 | Ga0105251_10000971 | 3300009011 | Bacteria | 25452 |
| 61 | Ga0105251_10007772 | 3300009011 | Bacteria | 6536 |
| 62 | Ga0105251_10008998 | 3300009011 | Bacteria | 5954 |
| 63 | Ga0105251_10017930 | 3300009011 | Bacteria | 3780 |
| 64 | Ga0105251_10032103 | 3300009011 | Bacteria | 2620 |
| 65 | Ga0105251_10039370 | 3300009011 | Bacteria | 2311 |
| 66 | Ga0105251_10065585 | 3300009011 | Bacteria | 1699 |
| 67 | Ga0105244_10000709 | 3300009036 | Bacteria | 28850 |
| 68 | Ga0105244_10004356 | 3300009036 | Bacteria | 9764 |
| 69 | Ga0105244_10006626 | 3300009036 | Bacteria | 7460 |
| 70 | Ga0105244_10008269 | 3300009036 | Bacteria | 6512 |
| 71 | Ga0105244_10009510 | 3300009036 | Bacteria | 5971 |
| 72 | Ga0105244_10012167 | 3300009036 | Bacteria | 5107 |
| 73 | Ga0105244_10013981 | 3300009036 | Bacteria | 4661 |
| 74 | Ga0105244_10022306 | 3300009036 | Bacteria | 3486 |
| 75 | Ga0105244_10022410 | 3300009036 | Bacteria | 3476 |
| 76 | Ga0105244_10022998 | 3300009036 | Bacteria | 3425 |
| 77 | Ga0105244_10026665 | 3300009036 | Bacteria | 3123 |
| 78 | Ga0105244_10036096 | 3300009036 | Bacteria | 2592 |
| 79 | Ga0105244_10051317 | 3300009036 | Bacteria | 2102 |
| 80 | Ga0105244_10064503 | 3300009036 | Bacteria | 1837 |
| 81 | Ga0105244_10111724 | 3300009036 | Bacteria | 1329 |
| 82 | Ga0105250_10000735 | 3300009092 | Bacteria | 19966 |
| 83 | Ga0105250_10004551 | 3300009092 | Bacteria | 6358 |
| 84 | Ga0105250_10005278 | 3300009092 | Bacteria | 5804 |
| 85 | Ga0105250_10076085 | 3300009092 | Bacteria | 1358 |
| 86 | Ga0105243_10012583 | 3300009148 | Bacteria | 6396 |
| 87 | Ga0105243_10029559 | 3300009148 | Bacteria | 4214 |
| 88 | Ga0105243_10031266 | 3300009148 | Bacteria | 4104 |
| 89 | Ga0105243_10036090 | 3300009148 | Bacteria | 3834 |
| 90 | Ga0105243_10042285 | 3300009148 | Bacteria | 3567 |
| 91 | Ga0105242_10000626 | 3300009176 | Bacteria | 27761 |
| 92 | Ga0105248_10011709 | 3300009177 | Bacteria | 9671 |
| 93 | Ga0105237_10001599 | 3300009545 | Bacteria | 29440 |
| 94 | Ga0105246_10000824 | 3300011119 | Bacteria | 17639 |
| 95 | Ga0105246_10010995 | 3300011119 | Bacteria | 5610 |
| 96 | Ga0105246_10027429 | 3300011119 | Bacteria | 3731 |
| 97 | Ga0157345_1000647 | 3300012498 | Bacteria | 2893 |
| 98 | Ga0157373_10003636 | 3300013100 | Bacteria | 11647 |
| 99 | Ga0157373_10012012 | 3300013100 | Bacteria | 6365 |
| 100 | Ga0157373_10015562 | 3300013100 | Bacteria | 5560 |
| 101 | Ga0157373_10017236 | 3300013100 | Bacteria | 5260 |
| 102 | Ga0157373_10020104 | 3300013100 | Bacteria | 4857 |
| 103 | Ga0157373_10022847 | 3300013100 | Bacteria | 4535 |
| 104 | Ga0157373_10055876 | 3300013100 | Bacteria | 2804 |
| 105 | Ga0157371_10000406 | 3300013102 | Bacteria | 53786 |
| 106 | Ga0157371_10013522 | 3300013102 | Bacteria | 6195 |
| 107 | Ga0157371_10023347 | 3300013102 | Bacteria | 4523 |
| 108 | Ga0157371_10040966 | 3300013102 | Bacteria | 3307 |
| 109 | Ga0157370_10003491 | 3300013104 | Bacteria | 18436 |
| 110 | Ga0157370_10036318 | 3300013104 | Bacteria | 4783 |
| 111 | Ga0157370_10115524 | 3300013104 | Bacteria | 2507 |
| 112 | Ga0157370_10166034 | 3300013104 | Bacteria | 2053 |
| 113 | Ga0157370_10247865 | 3300013104 | Bacteria | 1648 |
| 114 | Ga0157370_10332055 | 3300013104 | Bacteria | 1402 |
| 115 | Ga0157369_10027825 | 3300013105 | Bacteria | 6263 |
| 116 | Ga0157369_10028899 | 3300013105 | Bacteria | 6133 |
| 117 | Ga0163162_10000495 | 3300013306 | Bacteria | 36598 |
| 118 | Ga0163162_10081968 | 3300013306 | Bacteria | 3297 |
| 119 | Ga0157372_10006569 | 3300013307 | Bacteria | 12375 |
| 120 | Ga0157372_10038617 | 3300013307 | Bacteria | 5268 |
| 121 | Ga0157375_10021676 | 3300013308 | Bacteria | 5898 |
| 122 | Ga0157375_10027977 | 3300013308 | Bacteria | 5277 |
| 123 | Ga0157375_10171941 | 3300013308 | Bacteria | 2314 |
| 124 | Ga0157375_10299655 | 3300013308 | Bacteria | 1771 |
| 125 | Ga0182008_10001674 | 3300014497 | Bacteria | 14583 |
| 126 | Ga0182008_10008849 | 3300014497 | Bacteria | 5464 |
| 127 | Ga0182008_10009722 | 3300014497 | Bacteria | 5179 |
| 128 | Ga0182008_10009866 | 3300014497 | Bacteria | 5133 |
| 129 | Ga0182008_10010494 | 3300014497 | Bacteria | 4955 |
| 130 | Ga0182008_10012345 | 3300014497 | Bacteria | 4510 |
| 131 | Ga0182008_10016508 | 3300014497 | Bacteria | 3837 |
| 132 | Ga0182008_10017589 | 3300014497 | Bacteria | 3707 |
| 133 | Ga0182008_10018048 | 3300014497 | Bacteria | 3655 |
| 134 | Ga0182006_1004541 | 3300015261 | Bacteria | 6831 |
| 135 | Ga0182006_1004981 | 3300015261 | Bacteria | 6400 |
| 136 | Ga0182006_1006695 | 3300015261 | Bacteria | 5331 |
| 137 | Ga0182006_1013745 | 3300015261 | Bacteria | 3502 |
| 138 | Ga0182006_1024345 | 3300015261 | Bacteria | 2497 |
| 139 | Ga0182006_1024946 | 3300015261 | Bacteria | 2461 |
| 140 | Ga0182006_1031414 | 3300015261 | Bacteria | 2140 |
| 141 | Ga0182007_10004029 | 3300015262 | Bacteria | 6776 |
| 142 | Ga0182005_1002599 | 3300015265 | Bacteria | 6381 |
| 143 | Ga0182005_1002754 | 3300015265 | Bacteria | 6133 |
| 144 | Ga0163161_10006646 | 3300017792 | Bacteria | 8004 |
| 145 | Ga0163161_10010440 | 3300017792 | Bacteria | 6430 |
| 146 | Ga0163161_10011813 | 3300017792 | Bacteria | 6056 |
| 147 | Ga0163161_10012997 | 3300017792 | Bacteria | 5785 |
| 148 | Ga0163161_10069277 | 3300017792 | Bacteria | 2578 |
| 149 | Ga0163161_10238054 | 3300017792 | Bacteria | 1415 |
| 150 | Ga0209435_100479 | 3300025206 | Bacteria | 7904 |
| 151 | Ga0209760_100114 | 3300025207 | Bacteria | 57573 |
| 152 | Ga0209760_100337 | 3300025207 | Bacteria | 13875 |
| 153 | Ga0209784_100173 | 3300025224 | Bacteria | 55534 |
| 154 | Ga0209566_100226 | 3300025225 | Bacteria | 55534 |
| 155 | Ga0209674_100216 | 3300025226 | Bacteria | 55534 |
| 156 | Ga0209147_100229 | 3300025229 | Bacteria | 55534 |
| 157 | Ga0209563_100224 | 3300025230 | Bacteria | 28175 |
| 158 | Ga0209563_100338 | 3300025230 | Bacteria | 17932 |
| 159 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 160 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 161 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 162 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 163 | Ga0209258_100386 | 3300025242 | Bacteria | 56316 |
| 164 | Ga0209646_1000387 | 3300025246 | Bacteria | 28229 |
| 165 | Ga0209677_100171 | 3300025253 | Bacteria | 55534 |
| 166 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 167 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 168 | Ga0209675_1001650 | 3300025291 | Bacteria | 12430 |
| 169 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 170 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 171 | Ga0209676_1000345 | 3300025292 | Bacteria | 88051 |
| 172 | Ga0209676_1001157 | 3300025292 | Bacteria | 28735 |
| 173 | Ga0209676_1005862 | 3300025292 | Bacteria | 6255 |
| 174 | Ga0209676_1015165 | 3300025292 | Bacteria | 2852 |
| 175 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 176 | Ga0209050_1000162 | 3300025298 | Bacteria | 155309 |
| 177 | Ga0209050_1000227 | 3300025298 | Bacteria | 123743 |
| 178 | Ga0209050_1002674 | 3300025298 | Bacteria | 14539 |
| 179 | Ga0209051_1000104 | 3300025303 | Bacteria | 161001 |
| 180 | Ga0209051_1000164 | 3300025303 | Bacteria | 124186 |
| 181 | Ga0209051_1020234 | 3300025303 | Bacteria | 2873 |
| 182 | Ga0209051_1023109 | 3300025303 | Bacteria | 2595 |
| 183 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 184 | Ga0207656_10000013 | 3300025321 | Bacteria | 160490 |
| 185 | Ga0207696_1000019 | 3300025711 | Bacteria | 476309 |
| 186 | Ga0207696_1000097 | 3300025711 | Bacteria | 175696 |
| 187 | Ga0207696_1000819 | 3300025711 | Bacteria | 20011 |
| 188 | Ga0207696_1002467 | 3300025711 | Bacteria | 9046 |
| 189 | Ga0207696_1010023 | 3300025711 | Bacteria | 3497 |
| 190 | Ga0207696_1013261 | 3300025711 | Bacteria | 2881 |
| 191 | Ga0207696_1014766 | 3300025711 | Bacteria | 2668 |
| 192 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 193 | Ga0207655_1000142 | 3300025728 | Bacteria | 137562 |
| 194 | Ga0207655_1001255 | 3300025728 | Bacteria | 24204 |
| 195 | Ga0207655_1002823 | 3300025728 | Bacteria | 13462 |
| 196 | Ga0207655_1008691 | 3300025728 | Bacteria | 6409 |
| 197 | Ga0207655_1009298 | 3300025728 | Bacteria | 6120 |
| 198 | Ga0207655_1009950 | 3300025728 | Bacteria | 5838 |
| 199 | Ga0207655_1011990 | 3300025728 | Bacteria | 5108 |
| 200 | Ga0207655_1016994 | 3300025728 | Bacteria | 3947 |
| 201 | Ga0207655_1017006 | 3300025728 | Bacteria | 3945 |
| 202 | Ga0207655_1017633 | 3300025728 | Bacteria | 3840 |
| 203 | Ga0207655_1019796 | 3300025728 | Bacteria | 3496 |
| 204 | Ga0207655_1024112 | 3300025728 | Bacteria | 2991 |
| 205 | Ga0207655_1024459 | 3300025728 | Bacteria | 2959 |
| 206 | Ga0207655_1028445 | 3300025728 | Bacteria | 2637 |
| 207 | Ga0207655_1055669 | 3300025728 | Bacteria | 1564 |
| 208 | Ga0207655_1056174 | 3300025728 | Bacteria | 1554 |
| 209 | Ga0207713_1000681 | 3300025735 | Bacteria | 31842 |
| 210 | Ga0207713_1001006 | 3300025735 | Bacteria | 24570 |
| 211 | Ga0207713_1001791 | 3300025735 | Bacteria | 16439 |
| 212 | Ga0207713_1002600 | 3300025735 | Bacteria | 13023 |
| 213 | Ga0207713_1004032 | 3300025735 | Bacteria | 9706 |
| 214 | Ga0207713_1010546 | 3300025735 | Bacteria | 5108 |
| 215 | Ga0207713_1012121 | 3300025735 | Bacteria | 4634 |
| 216 | Ga0207713_1021322 | 3300025735 | Bacteria | 3109 |
| 217 | Ga0207713_1048189 | 3300025735 | Bacteria | 1718 |
| 218 | Ga0207713_1058126 | 3300025735 | Bacteria | 1491 |
| 219 | Ga0207671_10000165 | 3300025914 | Bacteria | 103178 |
| 220 | Ga0207649_10000013 | 3300025920 | Bacteria | 255009 |
| 221 | Ga0207681_10001353 | 3300025923 | Bacteria | 15834 |
| 222 | Ga0207681_10131781 | 3300025923 | Bacteria | 1849 |
| 223 | Ga0207650_10000077 | 3300025925 | Bacteria | 132010 |
| 224 | Ga0207650_10000457 | 3300025925 | Bacteria | 34586 |
| 225 | Ga0207706_10002991 | 3300025933 | Bacteria | 16297 |
| 226 | Ga0207706_10013867 | 3300025933 | Bacteria | 7310 |
| 227 | Ga0207686_10019202 | 3300025934 | Bacteria | 3883 |
| 228 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 229 | Ga0207709_10005497 | 3300025935 | Bacteria | 7192 |
| 230 | Ga0207709_10017514 | 3300025935 | Bacteria | 3999 |
| 231 | Ga0207709_10031319 | 3300025935 | Bacteria | 3105 |
| 232 | Ga0207679_10000005 | 3300025945 | Bacteria | 525011 |
| 233 | Ga0207679_10236834 | 3300025945 | Bacteria | 1544 |
| 234 | Ga0207640_10142299 | 3300025981 | Bacteria | 1750 |
| 235 | Ga0207639_10002794 | 3300026041 | Bacteria | 11720 |
| 236 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 237 | Ga0209281_1000212 | 3300027111 | Bacteria | 130216 |
| 238 | Ga0209281_1002389 | 3300027111 | Bacteria | 7645 |
| 239 | Ga0209389_1000037 | 3300027296 | Bacteria | 125897 |
| 240 | Ga0209371_1000198 | 3300027312 | Bacteria | 87565 |
| 241 | Ga0209371_1000359 | 3300027312 | Bacteria | 49211 |
| 242 | Ga0207428_10036878 | 3300027907 | Bacteria | 3983 |
| 243 | Ga0207428_10085243 | 3300027907 | Bacteria | 2461 |
| 244 | Ga0207428_10087582 | 3300027907 | Bacteria | 2423 |
| 245 | Ga0207428_10220691 | 3300027907 | Bacteria | 1421 |
| 246 | Ga0268266_10020349 | 3300028379 | Bacteria | 5657 |
| 247 | Ga0268266_10226830 | 3300028379 | Bacteria | 1719 |
| 248 | Ga0268256_1000159 | 3300030500 | Bacteria | 87145 |
| 249 | Ga0268256_1000305 | 3300030500 | Bacteria | 49210 |
| 250 | Ga0314311_1228399 | 3300030733 | Bacteria | 3978 |
| 251 | Ga0316181_1100804 | 3300030744 | Bacteria | 4760 |
| 252 | Ga0265340_10067283 | 3300031247 | Bacteria | 1703 |
| 253 | Ga0307408_100000027 | 3300031548 | Bacteria | 261506 |
| 254 | Ga0307408_100013344 | 3300031548 | Bacteria | 5452 |
| 255 | Ga0307408_100022832 | 3300031548 | Bacteria | 4255 |
| 256 | Ga0307405_10005852 | 3300031731 | Bacteria | 5987 |
| 257 | Ga0307413_10033417 | 3300031824 | Bacteria | 2928 |
| 258 | Ga0307412_10011186 | 3300031911 | Bacteria | 5193 |
| 259 | Ga0307412_10017850 | 3300031911 | Bacteria | 4254 |
| 260 | Ga0307412_10035447 | 3300031911 | Bacteria | 3188 |
| 261 | Ga0307412_10058519 | 3300031911 | Bacteria | 2578 |
| 262 | Ga0307414_10220637 | 3300032004 | Bacteria | 1556 |
| 263 | Ga0307510_10030497 | 3300033180 | Bacteria | 6112 |
| 264 | Ga0439438_000807 | 3300041405 | Bacteria | 14011 |
| 265 | Ga0439438_003655 | 3300041405 | Bacteria | 6144 |
| 266 | Ga0439438_003712 | 3300041405 | Bacteria | 6070 |
| 267 | Ga0439438_004132 | 3300041405 | Bacteria | 5668 |
| 268 | Ga0439438_004492 | 3300041405 | Bacteria | 5334 |
| 269 | Ga0439438_004546 | 3300041405 | Bacteria | 5289 |
| 270 | Ga0439438_004833 | 3300041405 | Bacteria | 5076 |
| 271 | Ga0439438_009790 | 3300041405 | Bacteria | 3080 |
| 272 | Ga0439438_014232 | 3300041405 | Bacteria | 2372 |
| 273 | Ga0439438_039167 | 3300041405 | Bacteria | 1235 |
| 274 | Ga0439447_002684 | 3300041407 | Bacteria | 6443 |
| 275 | Ga0439447_003481 | 3300041407 | Bacteria | 5593 |
| 276 | Ga0439447_003500 | 3300041407 | Bacteria | 5572 |
| 277 | Ga0439447_004605 | 3300041407 | Bacteria | 4703 |
| 278 | Ga0439447_012937 | 3300041407 | Bacteria | 2381 |
| 279 | Ga0439466_0002247 | 3300041411 | Bacteria | 7566 |
| 280 | Ga0439466_0004509 | 3300041411 | Bacteria | 5353 |
| 281 | Ga0439466_0004750 | 3300041411 | Bacteria | 5218 |
| 282 | Ga0439466_0005809 | 3300041411 | Bacteria | 4701 |
| 283 | Ga0439466_0012788 | 3300041411 | Bacteria | 3082 |
| 284 | Ga0439466_0014661 | 3300041411 | Bacteria | 2851 |
| 285 | Ga0439466_0017892 | 3300041411 | Bacteria | 2548 |
| 286 | Ga0439466_0020077 | 3300041411 | Bacteria | 2386 |
| 287 | Ga0439465_0003421 | 3300041413 | Bacteria | 5176 |
| 288 | Ga0439431_0004399 | 3300041997 | Bacteria | 3097 |
| 289 | Ga0439432_003190 | 3300042006 | Bacteria | 6103 |
| 290 | Ga0439432_004434 | 3300042006 | Bacteria | 5129 |
| 291 | Ga0439432_016417 | 3300042006 | Bacteria | 2491 |
| 292 | Ga0439432_018797 | 3300042006 | Bacteria | 2305 |
| 293 | Ga0439432_022847 | 3300042006 | Bacteria | 2064 |
| 294 | Ga0439451_002492 | 3300042009 | Bacteria | 3732 |
| 295 | Ga0439451_006952 | 3300042009 | Bacteria | 2314 |
| 296 | Ga0439451_009467 | 3300042009 | Bacteria | 1971 |
| 297 | Ga0439452_000281 | 3300042010 | Bacteria | 33473 |
| 298 | Ga0439452_002545 | 3300042010 | Bacteria | 6713 |
| 299 | Ga0439452_003098 | 3300042010 | Bacteria | 5895 |
| 300 | Ga0439452_004023 | 3300042010 | Bacteria | 5013 |
| 301 | Ga0439452_005077 | 3300042010 | Bacteria | 4296 |
| 302 | Ga0439452_006591 | 3300042010 | Bacteria | 3627 |
| 303 | Ga0439452_009916 | 3300042010 | Bacteria | 2791 |
| 304 | Ga0439456_000264 | 3300042013 | Bacteria | 13028 |
| 305 | Ga0439456_001502 | 3300042013 | Bacteria | 4701 |
| 306 | Ga0439456_013625 | 3300042013 | Bacteria | 1693 |
| 307 | Ga0439463_001607 | 3300042016 | Bacteria | 5950 |
| 308 | Ga0439463_001951 | 3300042016 | Bacteria | 5365 |
| 309 | Ga0439463_013291 | 3300042016 | Bacteria | 2026 |
| 310 | Ga0439463_029775 | 3300042016 | Bacteria | 1376 |
| 311 | Ga0450911_002967 | 3300042115 | Bacteria | 3130 |
| 312 | Ga0450911_003200 | 3300042115 | Bacteria | 2950 |
| 313 | Ga0450919_000544 | 3300042121 | Bacteria | 4739 |
| 314 | Ga0450890_000530 | 3300042127 | Bacteria | 5625 |
| 315 | Ga0450902_000722 | 3300042137 | Bacteria | 4224 |
| 316 | Ga0450902_001237 | 3300042137 | Bacteria | 3438 |
| 317 | Ga0450903_004755 | 3300042138 | Bacteria | 2300 |
| 318 | Ga0450905_001013 | 3300042142 | Bacteria | 3527 |
| 319 | Ga0450905_004406 | 3300042142 | Bacteria | 1868 |
| 320 | Ga0450906_002265 | 3300042145 | Bacteria | 4217 |
| 321 | Ga0450907_001033 | 3300042146 | Bacteria | 6517 |
| 322 | Ga0450910_000567 | 3300042147 | Bacteria | 4394 |
| 323 | Ga0450908_003567 | 3300042184 | Bacteria | 3030 |
| 324 | Ga0450909_000392 | 3300042185 | Bacteria | 5578 |
| 325 | Ga0439434_0001710 | 3300042435 | Bacteria | 6369 |
| 326 | Ga0439464_0004415 | 3300042439 | Bacteria | 3597 |
| 327 | Ga0439460_0002183 | 3300042461 | Bacteria | 4696 |
| 328 | Ga0439460_0002977 | 3300042461 | Bacteria | 4085 |
| 329 | Ga0450893_0003284 | 3300042532 | Bacteria | 2545 |
| 330 | Ga0450901_000122 | 3300042533 | Bacteria | 8475 |
| 331 | Ga0450901_001148 | 3300042533 | Bacteria | 3070 |
| 332 | Ga0439440_0010287 | 3300042993 | Bacteria | 1952 |
| 333 | Ga0495617_000225 | 3300046452 | Bacteria | 34294 |
| 334 | Ga0495617_003852 | 3300046452 | Bacteria | 5530 |
| 335 | Ga0495617_004477 | 3300046452 | Bacteria | 5082 |
| 336 | Ga0495627_000257 | 3300046453 | Bacteria | 54471 |
| 337 | Ga0495627_000451 | 3300046453 | Bacteria | 35736 |
| 338 | Ga0495627_000569 | 3300046453 | Bacteria | 29766 |
| 339 | Ga0495627_004752 | 3300046453 | Bacteria | 5615 |
| 340 | Ga0495627_006643 | 3300046453 | Bacteria | 4511 |
| 341 | Ga0495627_008286 | 3300046453 | Bacteria | 3911 |
| 342 | Ga0495627_018439 | 3300046453 | Bacteria | 2353 |
| 343 | Ga0495603_0002381 | 3300046455 | Bacteria | 11047 |
| 344 | Ga0495603_0021821 | 3300046455 | Bacteria | 3877 |
| 345 | Ga0495590_0004245 | 3300046457 | Bacteria | 5791 |
| 346 | Ga0495590_0004738 | 3300046457 | Bacteria | 5454 |
| 347 | Ga0495591_000822 | 3300046458 | Bacteria | 21997 |
| 348 | Ga0495591_001100 | 3300046458 | Bacteria | 17997 |
| 349 | Ga0495591_004826 | 3300046458 | Bacteria | 6429 |
| 350 | Ga0495591_005086 | 3300046458 | Bacteria | 6175 |
| 351 | Ga0495591_006137 | 3300046458 | Bacteria | 5384 |
| 352 | Ga0495591_006343 | 3300046458 | Bacteria | 5248 |
| 353 | Ga0495591_006511 | 3300046458 | Bacteria | 5150 |
| 354 | Ga0495591_017012 | 3300046458 | Bacteria | 2510 |
| 355 | Ga0495638_0018185 | 3300046460 | Bacteria | 4671 |
| 356 | Ga0495638_0020515 | 3300046460 | Bacteria | 4365 |
| 357 | Ga0495638_0022371 | 3300046460 | Bacteria | 4151 |
| 358 | Ga0495638_0024256 | 3300046460 | Bacteria | 3957 |
| 359 | Ga0495638_0035890 | 3300046460 | Bacteria | 3158 |
| 360 | Ga0495638_0037932 | 3300046460 | Bacteria | 3064 |
| 361 | Ga0495638_0117666 | 3300046460 | Bacteria | 1572 |
| 362 | Ga0495638_0120723 | 3300046460 | Bacteria | 1549 |
| 363 | Ga0495653_0014639 | 3300046463 | Bacteria | 6399 |
| 364 | Ga0495653_0014669 | 3300046463 | Bacteria | 6393 |
| 365 | Ga0495653_0052181 | 3300046463 | Bacteria | 3135 |
| 366 | Ga0495653_0061222 | 3300046463 | Bacteria | 2848 |
| 367 | Ga0495650_0000853 | 3300046471 | Bacteria | 36611 |
| 368 | Ga0495650_0001128 | 3300046471 | Bacteria | 29020 |
| 369 | Ga0495650_0003282 | 3300046471 | Bacteria | 11964 |
| 370 | Ga0495650_0009821 | 3300046471 | Bacteria | 5404 |
| 371 | Ga0495650_0023701 | 3300046471 | Bacteria | 2916 |
| 372 | Ga0495650_0028569 | 3300046471 | Bacteria | 2557 |
| 373 | Ga0495582_0020275 | 3300046473 | Bacteria | 3638 |
| 374 | Ga0495605_0000336 | 3300046474 | Bacteria | 46876 |
| 375 | Ga0495605_0000831 | 3300046474 | Bacteria | 21800 |
| 376 | Ga0495605_0000880 | 3300046474 | Bacteria | 20790 |
| 377 | Ga0495605_0000903 | 3300046474 | Bacteria | 20403 |
| 378 | Ga0495605_0006152 | 3300046474 | Bacteria | 6919 |
| 379 | Ga0495605_0010787 | 3300046474 | Bacteria | 5106 |
| 380 | Ga0495605_0010841 | 3300046474 | Bacteria | 5090 |
| 381 | Ga0495605_0011420 | 3300046474 | Bacteria | 4949 |
| 382 | Ga0495605_0012571 | 3300046474 | Bacteria | 4689 |
| 383 | Ga0495605_0021270 | 3300046474 | Bacteria | 3439 |
| 384 | Ga0495605_0025150 | 3300046474 | Bacteria | 3104 |
| 385 | Ga0495605_0035188 | 3300046474 | Bacteria | 2532 |
| 386 | Ga0495605_0055282 | 3300046474 | Bacteria | 1918 |
| 387 | Ga0495605_0063797 | 3300046474 | Bacteria | 1756 |
| 388 | Ga0495639_0000158 | 3300046475 | Bacteria | 34960 |
| 389 | Ga0495639_0006561 | 3300046475 | Bacteria | 5004 |
| 390 | Ga0495584_0006126 | 3300046491 | Bacteria | 6323 |
| 391 | Ga0495584_0007034 | 3300046491 | Bacteria | 5877 |
| 392 | Ga0495584_0008147 | 3300046491 | Bacteria | 5443 |
| 393 | Ga0495584_0011158 | 3300046491 | Bacteria | 4605 |
| 394 | Ga0495584_0028398 | 3300046491 | Bacteria | 2834 |
| 395 | Ga0495584_0029006 | 3300046491 | Bacteria | 2804 |
| 396 | Ga0495584_0035434 | 3300046491 | Bacteria | 2522 |
| 397 | Ga0495584_0067679 | 3300046491 | Bacteria | 1794 |
| 398 | Ga0495585_0008120 | 3300046492 | Bacteria | 6378 |
| 399 | Ga0495585_0009359 | 3300046492 | Bacteria | 5879 |
| 400 | Ga0495585_0010239 | 3300046492 | Bacteria | 5595 |
| 401 | Ga0495585_0014589 | 3300046492 | Bacteria | 4572 |
| 402 | Ga0495585_0014716 | 3300046492 | Bacteria | 4551 |
| 403 | Ga0495585_0022053 | 3300046492 | Bacteria | 3655 |
| 404 | Ga0495585_0075837 | 3300046492 | Bacteria | 1827 |
| 405 | Ga0495594_0010942 | 3300046499 | Bacteria | 4707 |
| 406 | Ga0495594_0011583 | 3300046499 | Bacteria | 4585 |
| 407 | Ga0495596_0004892 | 3300046500 | Bacteria | 6425 |
| 408 | Ga0495596_0026184 | 3300046500 | Bacteria | 2351 |
| 409 | Ga0495607_0000869 | 3300046501 | Bacteria | 28344 |
| 410 | Ga0495607_0001347 | 3300046501 | Bacteria | 21894 |
| 411 | Ga0495607_0001613 | 3300046501 | Bacteria | 19606 |
| 412 | Ga0495607_0001842 | 3300046501 | Bacteria | 18063 |
| 413 | Ga0495607_0006360 | 3300046501 | Bacteria | 8317 |
| 414 | Ga0495607_0007341 | 3300046501 | Bacteria | 7637 |
| 415 | Ga0495607_0007352 | 3300046501 | Bacteria | 7629 |
| 416 | Ga0495607_0009030 | 3300046501 | Bacteria | 6778 |
| 417 | Ga0495607_0012101 | 3300046501 | Bacteria | 5708 |
| 418 | Ga0495607_0014781 | 3300046501 | Bacteria | 5074 |
| 419 | Ga0495607_0016892 | 3300046501 | Bacteria | 4698 |
| 420 | Ga0495607_0025554 | 3300046501 | Bacteria | 3671 |
| 421 | Ga0495607_0031783 | 3300046501 | Bacteria | 3229 |
| 422 | Ga0495607_0033106 | 3300046501 | Bacteria | 3147 |
| 423 | Ga0495607_0033463 | 3300046501 | Bacteria | 3127 |
| 424 | Ga0495607_0037857 | 3300046501 | Bacteria | 2893 |
| 425 | Ga0495607_0048152 | 3300046501 | Bacteria | 2493 |
| 426 | Ga0495607_0059837 | 3300046501 | Bacteria | 2170 |
| 427 | Ga0495607_0077111 | 3300046501 | Bacteria | 1841 |
| 428 | Ga0495607_0079061 | 3300046501 | Bacteria | 1812 |
| 429 | Ga0495607_0095791 | 3300046501 | Bacteria | 1599 |
| 430 | Ga0495607_0097438 | 3300046501 | Bacteria | 1581 |
| 431 | Ga0495583_0001354 | 3300046506 | Bacteria | 25389 |
| 432 | Ga0495583_0001828 | 3300046506 | Bacteria | 19872 |
| 433 | Ga0495583_0002363 | 3300046506 | Bacteria | 16292 |
| 434 | Ga0495583_0006262 | 3300046506 | Bacteria | 7826 |
| 435 | Ga0495583_0008207 | 3300046506 | Bacteria | 6414 |
| 436 | Ga0495583_0009383 | 3300046506 | Bacteria | 5853 |
| 437 | Ga0495583_0013893 | 3300046506 | Bacteria | 4463 |
| 438 | Ga0495583_0017192 | 3300046506 | Bacteria | 3852 |
| 439 | Ga0495583_0018242 | 3300046506 | Bacteria | 3697 |
| 440 | Ga0495583_0023594 | 3300046506 | Bacteria | 3109 |
| 441 | Ga0495606_0001384 | 3300046507 | Bacteria | 32777 |
| 442 | Ga0495606_0001423 | 3300046507 | Bacteria | 32125 |
| 443 | Ga0495606_0005372 | 3300046507 | Bacteria | 12289 |
| 444 | Ga0495606_0014967 | 3300046507 | Bacteria | 6015 |
| 445 | Ga0495606_0015945 | 3300046507 | Bacteria | 5759 |
| 446 | Ga0495606_0017185 | 3300046507 | Bacteria | 5480 |
| 447 | Ga0495606_0020027 | 3300046507 | Bacteria | 4950 |
| 448 | Ga0495606_0021665 | 3300046507 | Bacteria | 4701 |
| 449 | Ga0495606_0021913 | 3300046507 | Bacteria | 4672 |
| 450 | Ga0495606_0047957 | 3300046507 | Bacteria | 2813 |
| 451 | Ga0495606_0052557 | 3300046507 | Bacteria | 2649 |
| 452 | Ga0495606_0096119 | 3300046507 | Bacteria | 1812 |
| 453 | Ga0495610_0009001 | 3300046512 | Bacteria | 6375 |
| 454 | Ga0495610_0009088 | 3300046512 | Bacteria | 6330 |
| 455 | Ga0495610_0009663 | 3300046512 | Bacteria | 6072 |
| 456 | Ga0495610_0010838 | 3300046512 | Bacteria | 5628 |
| 457 | Ga0495610_0010961 | 3300046512 | Bacteria | 5583 |
| 458 | Ga0495610_0011192 | 3300046512 | Bacteria | 5502 |
| 459 | Ga0495610_0016561 | 3300046512 | Bacteria | 4236 |
| 460 | Ga0495610_0022453 | 3300046512 | Bacteria | 3451 |
| 461 | Ga0495610_0039138 | 3300046512 | Bacteria | 2400 |
| 462 | Ga0495616_0006907 | 3300046513 | Bacteria | 6835 |
| 463 | Ga0495616_0007521 | 3300046513 | Bacteria | 6520 |
| 464 | Ga0495616_0016626 | 3300046513 | Bacteria | 4068 |
| 465 | Ga0495616_0055025 | 3300046513 | Bacteria | 1971 |
| 466 | Ga0495616_0094693 | 3300046513 | Bacteria | 1409 |
| 467 | Ga0495620_0000054 | 3300046515 | Bacteria | 100835 |
| 468 | Ga0495620_0001742 | 3300046515 | Bacteria | 12840 |
| 469 | Ga0495620_0002259 | 3300046515 | Bacteria | 11147 |
| 470 | Ga0495620_0007056 | 3300046515 | Bacteria | 6128 |
| 471 | Ga0495620_0010613 | 3300046515 | Bacteria | 4851 |
| 472 | Ga0495620_0017624 | 3300046515 | Bacteria | 3553 |
| 473 | Ga0495620_0017763 | 3300046515 | Bacteria | 3538 |
| 474 | Ga0495620_0020290 | 3300046515 | Bacteria | 3248 |
| 475 | Ga0495620_0044710 | 3300046515 | Bacteria | 1922 |
| 476 | Ga0495620_0045077 | 3300046515 | Bacteria | 1912 |
| 477 | Ga0495630_0016649 | 3300046517 | Bacteria | 5376 |
| 478 | Ga0495630_0018980 | 3300046517 | Bacteria | 5053 |
| 479 | Ga0495631_0000478 | 3300046518 | Bacteria | 26772 |
| 480 | Ga0495631_0001335 | 3300046518 | Bacteria | 15074 |
| 481 | Ga0495631_0005026 | 3300046518 | Bacteria | 6963 |
| 482 | Ga0495631_0013312 | 3300046518 | Bacteria | 3995 |
| 483 | Ga0495631_0015511 | 3300046518 | Bacteria | 3648 |
| 484 | Ga0495631_0015929 | 3300046518 | Bacteria | 3592 |
| 485 | Ga0495631_0036200 | 3300046518 | Bacteria | 2205 |
| 486 | Ga0495632_0001147 | 3300046519 | Bacteria | 22609 |
| 487 | Ga0495632_0001888 | 3300046519 | Bacteria | 16800 |
| 488 | Ga0495632_0008307 | 3300046519 | Bacteria | 6392 |
| 489 | Ga0495632_0008784 | 3300046519 | Bacteria | 6155 |
| 490 | Ga0495632_0009540 | 3300046519 | Bacteria | 5838 |
| 491 | Ga0495632_0011026 | 3300046519 | Bacteria | 5296 |
| 492 | Ga0495632_0011532 | 3300046519 | Bacteria | 5151 |
| 493 | Ga0495632_0012646 | 3300046519 | Bacteria | 4857 |
| 494 | Ga0495632_0021411 | 3300046519 | Bacteria | 3483 |
| 495 | Ga0495632_0034893 | 3300046519 | Bacteria | 2571 |
| 496 | Ga0495632_0045190 | 3300046519 | Bacteria | 2195 |
| 497 | Ga0495632_0060467 | 3300046519 | Bacteria | 1841 |
| 498 | Ga0495632_0086213 | 3300046519 | Bacteria | 1493 |
| 499 | Ga0495632_0102320 | 3300046519 | Bacteria | 1349 |
| 500 | Ga0495637_0003252 | 3300046520 | Bacteria | 8655 |
| 501 | Ga0495637_0006397 | 3300046520 | Bacteria | 5916 |
| 502 | Ga0495637_0006846 | 3300046520 | Bacteria | 5697 |
| 503 | Ga0495637_0007578 | 3300046520 | Bacteria | 5370 |
| 504 | Ga0495637_0008319 | 3300046520 | Bacteria | 5101 |
| 505 | Ga0495637_0010254 | 3300046520 | Bacteria | 4537 |
| 506 | Ga0495637_0012231 | 3300046520 | Bacteria | 4107 |
| 507 | Ga0495637_0013088 | 3300046520 | Bacteria | 3947 |
| 508 | Ga0495637_0013389 | 3300046520 | Bacteria | 3892 |
| 509 | Ga0495637_0017016 | 3300046520 | Bacteria | 3394 |
| 510 | Ga0495637_0021167 | 3300046520 | Bacteria | 2983 |
| 511 | Ga0495637_0024487 | 3300046520 | Bacteria | 2731 |
| 512 | Ga0495637_0028419 | 3300046520 | Bacteria | 2498 |
| 513 | Ga0495637_0031069 | 3300046520 | Bacteria | 2364 |
| 514 | Ga0495637_0035031 | 3300046520 | Bacteria | 2194 |
| 515 | Ga0495637_0056489 | 3300046520 | Bacteria | 1624 |
| 516 | Ga0495637_0076083 | 3300046520 | Bacteria | 1345 |
| 517 | Ga0495643_0000909 | 3300046522 | Bacteria | 31205 |
| 518 | Ga0495643_0004499 | 3300046522 | Bacteria | 9717 |
| 519 | Ga0495643_0004605 | 3300046522 | Bacteria | 9598 |
| 520 | Ga0495643_0009458 | 3300046522 | Bacteria | 6057 |
| 521 | Ga0495643_0019568 | 3300046522 | Bacteria | 3914 |
| 522 | Ga0495643_0030091 | 3300046522 | Bacteria | 3034 |
| 523 | Ga0495643_0035228 | 3300046522 | Bacteria | 2757 |
| 524 | Ga0495643_0052738 | 3300046522 | Bacteria | 2182 |
| 525 | Ga0495644_0000496 | 3300046523 | Bacteria | 16789 |
| 526 | Ga0495644_0002396 | 3300046523 | Bacteria | 7480 |
| 527 | Ga0495644_0003999 | 3300046523 | Bacteria | 5797 |
| 528 | Ga0495644_0014807 | 3300046523 | Bacteria | 2986 |
| 529 | Ga0495644_0017355 | 3300046523 | Bacteria | 2752 |
| 530 | Ga0495648_0001608 | 3300046524 | Bacteria | 21988 |
| 531 | Ga0495648_0003220 | 3300046524 | Bacteria | 14476 |
| 532 | Ga0495648_0011986 | 3300046524 | Bacteria | 6497 |
| 533 | Ga0495648_0012916 | 3300046524 | Bacteria | 6201 |
| 534 | Ga0495648_0014011 | 3300046524 | Bacteria | 5897 |
| 535 | Ga0495648_0016867 | 3300046524 | Bacteria | 5248 |
| 536 | Ga0495648_0017468 | 3300046524 | Bacteria | 5125 |
| 537 | Ga0495648_0023252 | 3300046524 | Bacteria | 4249 |
| 538 | Ga0495648_0023803 | 3300046524 | Bacteria | 4184 |
| 539 | Ga0495648_0025421 | 3300046524 | Bacteria | 4009 |
| 540 | Ga0495648_0053759 | 3300046524 | Bacteria | 2437 |
| 541 | Ga0495648_0054300 | 3300046524 | Bacteria | 2421 |
| 542 | Ga0495666_0017315 | 3300046526 | Bacteria | 3589 |
| 543 | Ga0495666_0020490 | 3300046526 | Bacteria | 3275 |
| 544 | Ga0495642_0003041 | 3300046528 | Bacteria | 6680 |
| 545 | Ga0495642_0003357 | 3300046528 | Bacteria | 6326 |
| 546 | Ga0495642_0004114 | 3300046528 | Bacteria | 5674 |
| 547 | Ga0495654_0000672 | 3300046530 | Bacteria | 26959 |
| 548 | Ga0495654_0006669 | 3300046530 | Bacteria | 6535 |
| 549 | Ga0495654_0006958 | 3300046530 | Bacteria | 6373 |
| 550 | Ga0495654_0007483 | 3300046530 | Bacteria | 6097 |
| 551 | Ga0495654_0007930 | 3300046530 | Bacteria | 5899 |
| 552 | Ga0495654_0007957 | 3300046530 | Bacteria | 5888 |
| 553 | Ga0495654_0012419 | 3300046530 | Bacteria | 4574 |
| 554 | Ga0495654_0016001 | 3300046530 | Bacteria | 3973 |
| 555 | Ga0495654_0017519 | 3300046530 | Bacteria | 3765 |
| 556 | Ga0495654_0019596 | 3300046530 | Bacteria | 3538 |
| 557 | Ga0495654_0022619 | 3300046530 | Bacteria | 3261 |
| 558 | Ga0495654_0025971 | 3300046530 | Bacteria | 3015 |
| 559 | Ga0495654_0026914 | 3300046530 | Bacteria | 2952 |
| 560 | Ga0495654_0052925 | 3300046530 | Bacteria | 1975 |
| 561 | Ga0495654_0077302 | 3300046530 | Bacteria | 1566 |
| 562 | Ga0495587_0018557 | 3300046536 | Bacteria | 4313 |
| 563 | Ga0495609_0000011 | 3300046538 | Bacteria | 334377 |
| 564 | Ga0495609_0000784 | 3300046538 | Bacteria | 23757 |
| 565 | Ga0495609_0005802 | 3300046538 | Bacteria | 6409 |
| 566 | Ga0495609_0008532 | 3300046538 | Bacteria | 5014 |
| 567 | Ga0495609_0009845 | 3300046538 | Bacteria | 4608 |
| 568 | Ga0495609_0021143 | 3300046538 | Bacteria | 3001 |
| 569 | Ga0495609_0021476 | 3300046538 | Bacteria | 2978 |
| 570 | Ga0495597_0000221 | 3300046542 | Bacteria | 52360 |
| 571 | Ga0495597_0008152 | 3300046542 | Bacteria | 5268 |
| 572 | Ga0495597_0009966 | 3300046542 | Bacteria | 4667 |
| 573 | Ga0495597_0034302 | 3300046542 | Bacteria | 2293 |
| 574 | Ga0495597_0050274 | 3300046542 | Bacteria | 1840 |
| 575 | Ga0495597_0063118 | 3300046542 | Bacteria | 1610 |
| 576 | Ga0495645_0051545 | 3300046543 | Bacteria | 2994 |
| 577 | Ga0495622_0004041 | 3300046557 | Bacteria | 6846 |
| 578 | Ga0495622_0004514 | 3300046557 | Bacteria | 6442 |
| 579 | Ga0495622_0004608 | 3300046557 | Bacteria | 6385 |
| 580 | Ga0495622_0014806 | 3300046557 | Bacteria | 3625 |
| 581 | Ga0495622_0015519 | 3300046557 | Bacteria | 3541 |
| 582 | Ga0495633_0019202 | 3300046558 | Bacteria | 3457 |
| 583 | Ga0495668_0008686 | 3300046616 | Bacteria | 6314 |
| 584 | Ga0495668_0010764 | 3300046616 | Bacteria | 5523 |
| 585 | Ga0495668_0039894 | 3300046616 | Bacteria | 2620 |
| 586 | Ga0495668_0044485 | 3300046616 | Bacteria | 2468 |
| 587 | Ga0495668_0078419 | 3300046616 | Bacteria | 1814 |
| 588 | Ga0495634_0012371 | 3300046642 | Bacteria | 6179 |
| 589 | Ga0495611_0000679 | 3300046648 | Bacteria | 19413 |
| 590 | Ga0495611_0005044 | 3300046648 | Bacteria | 5659 |
| 591 | Ga0495611_0007983 | 3300046648 | Bacteria | 4496 |
| 592 | Ga0495611_0010339 | 3300046648 | Bacteria | 3948 |
| 593 | Ga0495611_0017803 | 3300046648 | Bacteria | 3043 |
| 594 | Ga0495625_0000187 | 3300046660 | Bacteria | 97797 |
| 595 | Ga0495625_0002270 | 3300046660 | Bacteria | 21124 |
| 596 | Ga0495625_0014956 | 3300046660 | Bacteria | 6166 |
| 597 | Ga0495625_0018168 | 3300046660 | Bacteria | 5496 |
| 598 | Ga0495625_0051669 | 3300046660 | Bacteria | 2946 |
| 599 | Ga0495625_0055293 | 3300046660 | Bacteria | 2831 |
| 600 | Ga0495625_0066427 | 3300046660 | Bacteria | 2540 |
| 601 | Ga0495625_0148111 | 3300046660 | Bacteria | 1579 |
| 602 | Ga0495635_0011871 | 3300046663 | Bacteria | 6105 |
| 603 | Ga0495659_0002188 | 3300046664 | Bacteria | 6375 |
| 604 | Ga0495659_0017081 | 3300046664 | Bacteria | 2400 |
| 605 | Ga0495661_0000477 | 3300046665 | Bacteria | 42410 |
| 606 | Ga0495661_0001003 | 3300046665 | Bacteria | 25378 |
| 607 | Ga0495661_0011555 | 3300046665 | Bacteria | 5987 |
| 608 | Ga0495661_0021018 | 3300046665 | Bacteria | 4258 |
| 609 | Ga0495661_0023404 | 3300046665 | Bacteria | 4011 |
| 610 | Ga0495661_0032749 | 3300046665 | Bacteria | 3283 |
| 611 | Ga0495661_0086413 | 3300046665 | Bacteria | 1795 |
| 612 | Ga0495661_0098839 | 3300046665 | Bacteria | 1646 |
| 613 | Ga0495661_0107323 | 3300046665 | Bacteria | 1561 |
| 614 | Ga0495588_0034828 | 3300046674 | Bacteria | 2548 |
| 615 | Ga0495588_0046567 | 3300046674 | Bacteria | 2224 |
| 616 | Ga0495623_0011027 | 3300046679 | Bacteria | 5847 |
| 617 | Ga0495646_0034820 | 3300046680 | Bacteria | 3125 |
| 618 | Ga0495646_0068240 | 3300046680 | Bacteria | 2099 |
| 619 | Ga0495669_0036086 | 3300046684 | Bacteria | 2184 |
| 620 | Ga0495613_0028914 | 3300046689 | Bacteria | 4122 |
| 621 | Ga0495613_0035907 | 3300046689 | Bacteria | 3676 |
| 622 | Ga0495624_0010386 | 3300046690 | Bacteria | 6418 |
| 623 | Ga0495670_0005708 | 3300046691 | Bacteria | 6104 |
| 624 | Ga0495670_0007057 | 3300046691 | Bacteria | 5531 |
| 625 | Ga0495670_0010097 | 3300046691 | Bacteria | 4643 |
| 626 | Ga0495670_0054500 | 3300046691 | Bacteria | 2003 |
| 627 | Ga0495670_0072675 | 3300046691 | Bacteria | 1742 |
| 628 | Ga0495671_0001180 | 3300046692 | Bacteria | 17885 |
| 629 | Ga0495671_0002553 | 3300046692 | Bacteria | 11447 |
| 630 | Ga0495671_0007066 | 3300046692 | Bacteria | 6428 |
| 631 | Ga0495671_0011460 | 3300046692 | Bacteria | 4875 |
| 632 | Ga0495671_0013002 | 3300046692 | Bacteria | 4527 |
| 633 | Ga0495671_0015788 | 3300046692 | Bacteria | 4041 |
| 634 | Ga0495671_0016740 | 3300046692 | Bacteria | 3908 |
| 635 | Ga0495671_0018162 | 3300046692 | Bacteria | 3734 |
| 636 | Ga0495671_0021717 | 3300046692 | Bacteria | 3367 |
| 637 | Ga0495671_0022238 | 3300046692 | Bacteria | 3323 |
| 638 | Ga0495671_0032131 | 3300046692 | Bacteria | 2680 |
| 639 | Ga0495671_0044886 | 3300046692 | Bacteria | 2214 |
| 640 | Ga0495671_0046155 | 3300046692 | Bacteria | 2178 |
| 641 | Ga0495649_0003758 | 3300046694 | Bacteria | 10081 |
| 642 | Ga0495649_0007939 | 3300046694 | Bacteria | 6419 |
| 643 | Ga0495649_0013301 | 3300046694 | Bacteria | 4752 |
| 644 | Ga0495649_0016828 | 3300046694 | Bacteria | 4139 |
| 645 | Ga0495649_0021385 | 3300046694 | Bacteria | 3624 |
| 646 | Ga0495649_0027148 | 3300046694 | Bacteria | 3177 |
| 647 | Ga0495649_0029908 | 3300046694 | Bacteria | 3009 |
| 648 | Ga0495649_0048660 | 3300046694 | Bacteria | 2304 |
| 649 | Ga0495649_0090715 | 3300046694 | Bacteria | 1629 |
| 650 | Ga0495649_0115516 | 3300046694 | Bacteria | 1421 |
| 651 | Ga0495589_0006835 | 3300046794 | Bacteria | 6001 |
| 652 | Ga0495589_0007574 | 3300046794 | Bacteria | 5688 |
| 653 | Ga0495589_0009516 | 3300046794 | Bacteria | 5050 |
| 654 | Ga0495589_0012887 | 3300046794 | Bacteria | 4320 |
| 655 | Ga0495589_0014210 | 3300046794 | Bacteria | 4103 |
| 656 | Ga0495589_0018694 | 3300046794 | Bacteria | 3552 |
| 657 | Ga0495589_0018838 | 3300046794 | Bacteria | 3539 |
| 658 | Ga0495589_0021020 | 3300046794 | Bacteria | 3335 |
| 659 | Ga0495600_0087578 | 3300046809 | Bacteria | 2031 |
| 660 | Ga0495600_0089008 | 3300046809 | Bacteria | 2014 |
| 661 | Ga0495600_0095479 | 3300046809 | Bacteria | 1938 |
| 662 | Ga0495660_0000407 | 3300046810 | Bacteria | 36758 |
| 663 | Ga0495660_0000888 | 3300046810 | Bacteria | 22116 |
| 664 | Ga0495660_0005255 | 3300046810 | Bacteria | 7766 |
| 665 | Ga0495660_0014627 | 3300046810 | Bacteria | 4538 |
| 666 | Ga0495660_0016041 | 3300046810 | Bacteria | 4320 |
| 667 | Ga0495660_0039523 | 3300046810 | Bacteria | 2620 |
| 668 | Ga0495660_0041576 | 3300046810 | Bacteria | 2543 |
| 669 | Ga0495660_0052020 | 3300046810 | Bacteria | 2227 |
| 670 | Ga0495660_0057568 | 3300046810 | Bacteria | 2096 |
| 671 | Ga0495660_0060872 | 3300046810 | Bacteria | 2026 |
| 672 | Ga0495660_0075330 | 3300046810 | Bacteria | 1780 |
| 673 | Ga0495581_0020117 | 3300047315 | Bacteria | 3875 |
| 674 | Ga0495604_0014492 | 3300047317 | Bacteria | 6287 |
| 675 | Ga0495604_0019863 | 3300047317 | Bacteria | 5375 |
| 676 | Ga0495604_0080550 | 3300047317 | Bacteria | 2439 |
| 677 | Ga0495674_0022886 | 3300047319 | Bacteria | 5758 |
| 678 | Ga0495672_0001999 | 3300047320 | Bacteria | 19270 |
| 679 | Ga0495672_0004119 | 3300047320 | Bacteria | 12105 |
| 680 | Ga0495672_0010951 | 3300047320 | Bacteria | 6430 |
| 681 | Ga0495672_0010991 | 3300047320 | Bacteria | 6414 |
| 682 | Ga0495672_0011802 | 3300047320 | Bacteria | 6137 |
| 683 | Ga0495672_0012897 | 3300047320 | Bacteria | 5795 |
| 684 | Ga0495672_0025964 | 3300047320 | Bacteria | 3744 |
| 685 | Ga0495672_0027595 | 3300047320 | Bacteria | 3605 |
| 686 | Ga0495672_0037594 | 3300047320 | Bacteria | 2960 |
| 687 | Ga0495672_0096243 | 3300047320 | Bacteria | 1614 |
| 688 | Ga0495676_0000508 | 3300047321 | Bacteria | 31862 |
| 689 | Ga0495676_0044259 | 3300047321 | Bacteria | 3634 |
| 690 | Ga0495680_0016282 | 3300047322 | Bacteria | 6394 |
| 691 | Ga0495680_0020043 | 3300047322 | Bacteria | 5635 |
| 692 | Ga0495680_0020798 | 3300047322 | Bacteria | 5509 |
| 693 | Ga0495680_0022963 | 3300047322 | Bacteria | 5192 |
| 694 | Ga0495680_0061528 | 3300047322 | Bacteria | 2888 |
| 695 | Ga0495683_0000176 | 3300047323 | Bacteria | 62784 |
| 696 | Ga0495683_0000216 | 3300047323 | Bacteria | 54311 |
| 697 | Ga0495683_0006693 | 3300047323 | Bacteria | 6277 |
| 698 | Ga0495683_0014143 | 3300047323 | Bacteria | 4157 |
| 699 | Ga0495683_0019039 | 3300047323 | Bacteria | 3543 |
| 700 | Ga0495683_0027993 | 3300047323 | Bacteria | 2881 |
| 701 | Ga0495683_0032221 | 3300047323 | Bacteria | 2670 |
| 702 | Ga0495683_0038880 | 3300047323 | Bacteria | 2407 |
| 703 | Ga0495683_0040353 | 3300047323 | Bacteria | 2358 |
| 704 | Ga0495683_0080345 | 3300047323 | Bacteria | 1591 |
| 705 | Ga0495683_0100220 | 3300047323 | Bacteria | 1393 |
| 706 | Ga0495687_000676 | 3300047443 | Bacteria | 38731 |
| 707 | Ga0495687_008412 | 3300047443 | Bacteria | 5909 |
| 708 | Ga0495687_011711 | 3300047443 | Bacteria | 4692 |
| 709 | Ga0495687_016205 | 3300047443 | Bacteria | 3754 |
| 710 | Ga0495675_0043355 | 3300047444 | Bacteria | 2866 |
| 711 | Ga0495675_0061883 | 3300047444 | Bacteria | 2370 |
| 712 | Ga0495677_0004418 | 3300047445 | Bacteria | 5399 |
| 713 | Ga0495679_005086 | 3300047446 | Bacteria | 5901 |
| 714 | Ga0495679_006422 | 3300047446 | Bacteria | 5061 |
| 715 | Ga0495679_007665 | 3300047446 | Bacteria | 4476 |
| 716 | Ga0495679_013289 | 3300047446 | Bacteria | 3099 |
| 717 | Ga0495679_015209 | 3300047446 | Bacteria | 2821 |
| 718 | Ga0495685_006994 | 3300047447 | Bacteria | 3713 |
| 719 | Ga0495673_0000938 | 3300047469 | Bacteria | 26443 |
| 720 | Ga0495673_0001468 | 3300047469 | Bacteria | 18689 |
| 721 | Ga0495673_0001495 | 3300047469 | Bacteria | 18488 |
| 722 | Ga0495673_0006807 | 3300047469 | Bacteria | 6676 |
| 723 | Ga0495673_0007204 | 3300047469 | Bacteria | 6428 |
| 724 | Ga0495673_0007237 | 3300047469 | Bacteria | 6413 |
| 725 | Ga0495673_0008958 | 3300047469 | Bacteria | 5574 |
| 726 | Ga0495673_0009407 | 3300047469 | Bacteria | 5409 |
| 727 | Ga0495673_0012088 | 3300047469 | Bacteria | 4598 |
| 728 | Ga0495673_0015257 | 3300047469 | Bacteria | 3962 |
| 729 | Ga0495673_0019347 | 3300047469 | Bacteria | 3413 |
| 730 | Ga0495673_0019537 | 3300047469 | Bacteria | 3392 |
| 731 | Ga0495673_0020580 | 3300047469 | Bacteria | 3282 |
| 732 | Ga0495673_0026104 | 3300047469 | Bacteria | 2797 |
| 733 | Ga0495673_0036542 | 3300047469 | Bacteria | 2252 |
| 734 | Ga0495673_0039272 | 3300047469 | Bacteria | 2148 |
| 735 | Ga0495673_0039704 | 3300047469 | Bacteria | 2133 |
| 736 | Ga0495673_0070476 | 3300047469 | Bacteria | 1472 |
| 737 | Ga0495681_0000588 | 3300047470 | Bacteria | 27772 |
| 738 | Ga0495681_0005805 | 3300047470 | Bacteria | 8201 |
| 739 | Ga0495681_0006397 | 3300047470 | Bacteria | 7752 |
| 740 | Ga0495681_0009539 | 3300047470 | Bacteria | 5964 |
| 741 | Ga0495681_0009601 | 3300047470 | Bacteria | 5943 |
| 742 | Ga0495681_0010451 | 3300047470 | Bacteria | 5617 |
| 743 | Ga0495681_0010626 | 3300047470 | Bacteria | 5561 |
| 744 | Ga0495681_0010743 | 3300047470 | Bacteria | 5516 |
| 745 | Ga0495681_0012384 | 3300047470 | Bacteria | 5015 |
| 746 | Ga0495681_0023530 | 3300047470 | Bacteria | 3270 |
| 747 | Ga0495681_0029275 | 3300047470 | Bacteria | 2820 |
| 748 | Ga0495681_0035413 | 3300047470 | Bacteria | 2479 |
| 749 | Ga0495681_0041589 | 3300047470 | Bacteria | 2230 |
| 750 | Ga0495681_0046452 | 3300047470 | Bacteria | 2070 |
| 751 | Ga0495681_0054716 | 3300047470 | Bacteria | 1863 |
| 752 | Ga0495686_0018147 | 3300047472 | Bacteria | 4726 |
| 753 | Ga0495686_0021228 | 3300047472 | Bacteria | 4318 |
| 754 | Ga0495686_0023740 | 3300047472 | Bacteria | 4038 |
| 755 | Ga0495686_0039147 | 3300047472 | Bacteria | 3029 |
| 756 | Ga0495593_0015342 | 3300047673 | Bacteria | 4342 |
| 757 | Ga0495626_0000250 | 3300048091 | Bacteria | 62295 |
| 758 | Ga0495626_0000721 | 3300048091 | Bacteria | 30932 |
| 759 | Ga0495626_0002158 | 3300048091 | Bacteria | 14181 |
| 760 | Ga0495626_0007151 | 3300048091 | Bacteria | 6241 |
| 761 | Ga0495626_0007269 | 3300048091 | Bacteria | 6177 |
| 762 | Ga0495626_0008235 | 3300048091 | Bacteria | 5736 |
| 763 | Ga0495626_0009970 | 3300048091 | Bacteria | 5102 |
| 764 | Ga0495626_0010027 | 3300048091 | Bacteria | 5082 |
| 765 | Ga0495626_0031440 | 3300048091 | Bacteria | 2554 |
| 766 | Ga0496102_0017499 | 3300048905 | Bacteria | 6277 |
| 767 | Ga0496103_0008923 | 3300048906 | Bacteria | 5944 |
| 768 | Ga0496110_0010564 | 3300048913 | Bacteria | 7518 |
| 769 | Ga0496110_0370153 | 3300048913 | Bacteria | 1306 |
| 770 | Ga0496111_0094149 | 3300048914 | Bacteria | 2197 |
| 771 | Ga0496112_0160691 | 3300048915 | Bacteria | 2213 |
| 772 | Ga0496114_0003285 | 3300048917 | Bacteria | 12412 |
| 773 | Ga0496114_0019724 | 3300048917 | Bacteria | 5465 |
| 774 | Ga0496116_0001102 | 3300048919 | Bacteria | 32408 |
| 775 | Ga0496116_0001892 | 3300048919 | Bacteria | 22607 |
| 776 | Ga0496116_0013194 | 3300048919 | Bacteria | 6683 |
| 777 | Ga0496116_0028107 | 3300048919 | Bacteria | 4080 |
| 778 | Ga0496116_0036122 | 3300048919 | Bacteria | 3462 |
| 779 | Ga0496116_0066709 | 3300048919 | Bacteria | 2302 |
| 780 | Ga0496117_0002125 | 3300048920 | Bacteria | 25937 |
| 781 | Ga0496117_0002831 | 3300048920 | Bacteria | 21115 |
| 782 | Ga0496117_0003138 | 3300048920 | Bacteria | 19704 |
| 783 | Ga0496117_0006628 | 3300048920 | Bacteria | 11620 |
| 784 | Ga0496117_0008859 | 3300048920 | Bacteria | 9494 |
| 785 | Ga0496117_0021272 | 3300048920 | Bacteria | 5255 |
| 786 | Ga0496117_0049167 | 3300048920 | Bacteria | 3003 |
| 787 | Ga0496117_0052054 | 3300048920 | Bacteria | 2887 |
| 788 | Ga0496117_0054878 | 3300048920 | Bacteria | 2788 |
| 789 | Ga0496118_0006257 | 3300048921 | Bacteria | 13163 |
| 790 | Ga0496118_0006536 | 3300048921 | Bacteria | 12753 |
| 791 | Ga0496118_0025614 | 3300048921 | Bacteria | 5050 |
| 792 | Ga0496118_0027731 | 3300048921 | Bacteria | 4784 |
| 793 | Ga0496118_0032911 | 3300048921 | Bacteria | 4261 |
| 794 | Ga0496118_0032940 | 3300048921 | Bacteria | 4259 |
| 795 | Ga0496118_0041866 | 3300048921 | Bacteria | 3620 |
| 796 | Ga0496119_0000130 | 3300048922 | Bacteria | 106433 |
| 797 | Ga0496119_0025020 | 3300048922 | Bacteria | 4179 |
| 798 | Ga0496120_0001123 | 3300048923 | Bacteria | 34638 |
| 799 | Ga0496120_0032235 | 3300048923 | Bacteria | 3161 |
| 800 | Ga0496120_0045803 | 3300048923 | Bacteria | 2531 |
| 801 | Ga0496121_0000781 | 3300048924 | Bacteria | 58375 |
| 802 | Ga0496121_0002035 | 3300048924 | Bacteria | 31995 |
| 803 | Ga0496121_0010893 | 3300048924 | Bacteria | 10161 |
| 804 | Ga0496121_0040850 | 3300048924 | Bacteria | 4063 |
| 805 | Ga0496121_0046437 | 3300048924 | Bacteria | 3717 |
| 806 | Ga0496121_0075467 | 3300048924 | Bacteria | 2693 |
| 807 | Ga0496122_0001762 | 3300048925 | Bacteria | 33218 |
| 808 | Ga0496122_0006421 | 3300048925 | Bacteria | 13501 |
| 809 | Ga0496122_0018352 | 3300048925 | Bacteria | 6472 |
| 810 | Ga0496122_0018887 | 3300048925 | Bacteria | 6333 |
| 811 | Ga0496122_0021949 | 3300048925 | Bacteria | 5691 |
| 812 | Ga0496122_0029502 | 3300048925 | Bacteria | 4625 |
| 813 | Ga0496122_0040241 | 3300048925 | Bacteria | 3718 |
| 814 | Ga0496122_0124302 | 3300048925 | Bacteria | 1655 |
| 815 | Ga0496122_0158864 | 3300048925 | Bacteria | 1382 |
| 816 | Ga0496122_0178245 | 3300048925 | Bacteria | 1271 |
| 817 | Ga0496123_0001295 | 3300048926 | Bacteria | 35624 |
| 818 | Ga0496123_0005038 | 3300048926 | Bacteria | 13515 |
| 819 | Ga0496123_0010414 | 3300048926 | Bacteria | 8221 |
| 820 | Ga0496123_0014533 | 3300048926 | Bacteria | 6518 |
| 821 | Ga0496123_0028125 | 3300048926 | Bacteria | 4169 |
| 822 | Ga0496123_0087768 | 3300048926 | Bacteria | 1859 |
| 823 | Ga0496124_0000382 | 3300048927 | Bacteria | 80986 |
| 824 | Ga0496124_0002323 | 3300048927 | Bacteria | 25088 |
| 825 | Ga0496124_0010744 | 3300048927 | Bacteria | 9230 |
| 826 | Ga0496124_0026032 | 3300048927 | Bacteria | 5282 |
| 827 | Ga0496124_0029001 | 3300048927 | Bacteria | 4939 |
| 828 | Ga0496124_0031178 | 3300048927 | Bacteria | 4722 |
| 829 | Ga0496124_0036947 | 3300048927 | Bacteria | 4253 |
| 830 | Ga0496124_0043400 | 3300048927 | Bacteria | 3866 |
| 831 | Ga0496124_0058258 | 3300048927 | Bacteria | 3250 |
| 832 | Ga0496124_0100434 | 3300048927 | Bacteria | 2345 |
| 833 | Ga0496124_0122764 | 3300048927 | Bacteria | 2073 |
| 834 | Ga0496124_0169951 | 3300048927 | Bacteria | 1690 |
| 835 | Ga0496125_0002291 | 3300048928 | Bacteria | 25314 |
| 836 | Ga0496125_0006854 | 3300048928 | Bacteria | 12216 |
| 837 | Ga0496125_0019099 | 3300048928 | Bacteria | 6479 |
| 838 | Ga0496125_0021660 | 3300048928 | Bacteria | 5988 |
| 839 | Ga0496125_0025862 | 3300048928 | Bacteria | 5364 |
| 840 | Ga0496125_0054616 | 3300048928 | Bacteria | 3262 |
| 841 | Ga0496125_0100107 | 3300048928 | Bacteria | 2138 |
| 842 | Ga0496126_0022741 | 3300048929 | Bacteria | 6090 |
| 843 | Ga0496126_0049246 | 3300048929 | Bacteria | 3847 |
| 844 | Ga0495678_000688 | 3300049459 | Bacteria | 31040 |
| 845 | Ga0495678_007338 | 3300049459 | Bacteria | 5724 |
| 846 | Ga0495678_007420 | 3300049459 | Bacteria | 5681 |
| 847 | Ga0495678_010370 | 3300049459 | Bacteria | 4535 |
| 848 | Ga0495678_010418 | 3300049459 | Bacteria | 4521 |
| 849 | Ga0495678_017505 | 3300049459 | Bacteria | 3246 |
| 850 | Ga0495678_020346 | 3300049459 | Bacteria | 2941 |
| 851 | Ga0495678_060946 | 3300049459 | Bacteria | 1417 |
| 852 | Ga0495682_0001672 | 3300049460 | Bacteria | 11334 |
| 853 | Ga0495682_0007675 | 3300049460 | Bacteria | 4279 |
| 854 | Ga0495682_0016549 | 3300049460 | Bacteria | 2790 |
| 855 | Ga0501034_0000325 | 3300049571 | Bacteria | 83662 |
| 856 | Ga0501039_0063602 | 3300049575 | Bacteria | 2859 |
| 857 | nmdc:mga0sz30_22593_c1 | 3300050516 | Bacteria | 2554 |
| 858 | Ga0500659_0013100 | 3300053135 | Bacteria | 4521 |
| 859 | Ga0500573_0031135 | 3300053140 | Bacteria | 3078 |
| 860 | Ga0500577_0026732 | 3300053142 | Bacteria | 1968 |
| 861 | Ga0500634_0011370 | 3300053161 | Bacteria | 4591 |
| 862 | 2842809663 | 2842805378 | Bacteria | 5385175 |
| 863 | 2511256778 | 2511231004 | Bacteria | 6669789 |
| 864 | 2511266739 | 2511231006 | Bacteria | 6794709 |
| 865 | 2511274727 | 2511231007 | Bacteria | 6306603 |
| 866 | 2511303140 | 2511231012 | Bacteria | 6738011 |
| 867 | 2511314149 | 2511231014 | Bacteria | 6462302 |
| 868 | 2511319696 | 2511231015 | Bacteria | 6598026 |
| 869 | 2511329035 | 2511231016 | Bacteria | 6704427 |
| 870 | 2511330502 | 2511231017 | Bacteria | 6503007 |
| 871 | 2511344980 | 2511231019 | Bacteria | 6520662 |
| 872 | 2511360102 | 2511231021 | Bacteria | 7302637 |
| 873 | 2511360767 | 2511231022 | Bacteria | 6719296 |
| 874 | 2511371461 | 2511231023 | Bacteria | 6808468 |
| 875 | 2511376236 | 2511231024 | Bacteria | 5835885 |
| 876 | 2511826134 | 2511231156 | Bacteria | 6845832 |
| 877 | 2512324762 | 2512047018 | Bacteria | 6663241 |
| 878 | 2555248684 | 2554235231 | Bacteria | 5215788 |
| 879 | 2583793842 | 2582580891 | Bacteria | 6800976 |
| 880 | 2597856970 | 2597489887 | Bacteria | 6666321 |
| 881 | 2597862607 | 2597489888 | Bacteria | 6179543 |
| 882 | 2597871258 | 2597489889 | Bacteria | 6297495 |
| 883 | 2599328632 | 2599185155 | Bacteria | 5827168 |
| 884 | 2599357154 | 2599185160 | Bacteria | 6844013 |
| 885 | 2599362059 | 2599185161 | Bacteria | 6960462 |
| 886 | 2599368379 | 2599185162 | Bacteria | 6957254 |
| 887 | 2599375168 | 2599185163 | Bacteria | 6995158 |
| 888 | 2599382259 | 2599185164 | Bacteria | 6841688 |
| 889 | 2599388706 | 2599185165 | Bacteria | 6843250 |
| 890 | 2599394026 | 2599185166 | Bacteria | 6959206 |
| 891 | 2599402026 | 2599185167 | Bacteria | 6353609 |
| 892 | 2599405791 | 2599185168 | Bacteria | 6997636 |
| 893 | 2599464345 | 2599185181 | Bacteria | 6844519 |
| 894 | 2599468665 | 2599185182 | Bacteria | 6883168 |
| 895 | 2599483994 | 2599185185 | Bacteria | 6652270 |
| 896 | 2599493364 | 2599185186 | Bacteria | 6831633 |
| 897 | 2599504317 | 2599185188 | Bacteria | 6164180 |
| 898 | 2599510652 | 2599185189 | Bacteria | 5862825 |
| 899 | 2599512322 | 2599185190 | Bacteria | 6285678 |
| 900 | 2599520479 | 2599185191 | Bacteria | 6297582 |
| 901 | 2599613607 | 2599185212 | Bacteria | 6765997 |
| 902 | 2599772523 | 2599185248 | Bacteria | 6696816 |
| 903 | 2599801645 | 2599185257 | Bacteria | 6492581 |
| 904 | 2599883655 | 2599185288 | Bacteria | 6666191 |
| 905 | 2599888755 | 2599185289 | Bacteria | 6778765 |
| 906 | 2599890998 | 2599185290 | Bacteria | 6289611 |
| 907 | 2599900385 | 2599185291 | Bacteria | 6775623 |
| 908 | 2599933422 | 2599185300 | Bacteria | 6062622 |
| 909 | 2599944125 | 2599185302 | Bacteria | 5954930 |
| 910 | 2599952017 | 2599185303 | Bacteria | 6512725 |
| 911 | 2599956343 | 2599185304 | Bacteria | 5951361 |
| 912 | 2599961280 | 2599185305 | Bacteria | 6748700 |
| 913 | 2599968405 | 2599185306 | Bacteria | 6637356 |
| 914 | 2599979704 | 2599185308 | Bacteria | 6621546 |
| 915 | 2599985037 | 2599185309 | Bacteria | 5969593 |
| 916 | 2599989337 | 2599185310 | Bacteria | 6014457 |
| 917 | 2599994250 | 2599185311 | Bacteria | 6354990 |
| 918 | 2600000267 | 2599185312 | Bacteria | 5912071 |
| 919 | 2600008763 | 2599185313 | Bacteria | 6658188 |
| 920 | 2600013529 | 2599185314 | Bacteria | 6621749 |
| 921 | 2600020982 | 2599185315 | Bacteria | 6771107 |
| 922 | 2600023545 | 2599185316 | Bacteria | 6320029 |
| 923 | 2600030653 | 2599185317 | Bacteria | 6435722 |
| 924 | 2600037010 | 2599185318 | Bacteria | 6961590 |
| 925 | 2600042433 | 2599185319 | Bacteria | 6637840 |
| 926 | 2600049571 | 2599185320 | Bacteria | 5963263 |
| 927 | 2600055920 | 2599185321 | Bacteria | 6764560 |
| 928 | 2600060496 | 2599185322 | Bacteria | 6763055 |
| 929 | 2600065595 | 2599185323 | Bacteria | 6688755 |
| 930 | 2600070754 | 2599185324 | Bacteria | 6590677 |
| 931 | 2600078279 | 2599185325 | Bacteria | 6324919 |
| 932 | 2600216622 | 2599185356 | Bacteria | 6843884 |
| 933 | 2600360460 | 2600254930 | Bacteria | 6431253 |
| 934 | 2600365933 | 2600254931 | Bacteria | 6734225 |
| 935 | 2600442311 | 2600254954 | Bacteria | 5100516 |
| 936 | 2601689289 | 2600255296 | Bacteria | 5784754 |
| 937 | 2601776785 | 2600255313 | Bacteria | 6842543 |
| 938 | 2601796408 | 2600255318 | Bacteria | 6383414 |
| 939 | 2602009724 | 2600255389 | Bacteria | 5275336 |
| 940 | 2606073558 | 2603880185 | Bacteria | 6379190 |
| 941 | 2606126798 | 2603880199 | Bacteria | 6377649 |
| 942 | 2621298058 | 2619619299 | Bacteria | 6649820 |
| 943 | 2624482056 | 2623620443 | Bacteria | 6427864 |
| 944 | 2624490859 | 2623620446 | Bacteria | 6500345 |
| 945 | 2643845096 | 2643221565 | Bacteria | 6216018 |
| 946 | 2643871788 | 2643221571 | Bacteria | 6228673 |
| 947 | 2643956622 | 2643221589 | Bacteria | 6250934 |
| 948 | 2644025335 | 2643221602 | Bacteria | 6249926 |
| 949 | 2644286231 | 2643221650 | Bacteria | 7029547 |
| 950 | 2644624289 | 2643221713 | Bacteria | 6554480 |
| 951 | 2652546047 | 2651869719 | Bacteria | 6047974 |
| 952 | 2671093045 | 2667528170 | Bacteria | 6786960 |
| 953 | 2671098698 | 2667528171 | Bacteria | 6900659 |
| 954 | 2671129072 | 2667528176 | Bacteria | 6724917 |
| 955 | 2671768594 | 2671180172 | Bacteria | 6495783 |
| 956 | 2677900198 | 2675903420 | Bacteria | 6247433 |
| 957 | 2678264470 | 2675903515 | Bacteria | 6580491 |
| 958 | 2715751366 | 2713897148 | Bacteria | 5883533 |
| 959 | 2715758357 | 2713897149 | Bacteria | 6506249 |
| 960 | 2718635298 | 2718217725 | Bacteria | 5758958 |
| 961 | 2723250165 | 2721755607 | Bacteria | 5841722 |
| 962 | 2738675188 | 2738541265 | Bacteria | 6594665 |
| 963 | 2738753592 | 2738541282 | Bacteria | 6593925 |
| 964 | 2738812075 | 2738541294 | Bacteria | 6925949 |
| 965 | 2738862581 | 2738541303 | Bacteria | 6591772 |
| 966 | 2738899435 | 2738541309 | Bacteria | 6926455 |
| 967 | 2739197041 | 2738543004 | Bacteria | 6381073 |
| 968 | 2739259110 | 2738543015 | Bacteria | 6750701 |
| 969 | 2739264380 | 2738543016 | Bacteria | 5657564 |
| 970 | 2739293502 | 2738543021 | Bacteria | 5718241 |
| 971 | 2743736395 | 2740892503 | Bacteria | 6855563 |
| 972 | 2745004924 | 2744054620 | Bacteria | 6551379 |
| 973 | 2774132994 | 2773857673 | Bacteria | 6513460 |
| 974 | 2784317933 | 2784132072 | Bacteria | 6596533 |
| 975 | 2794595941 | 2791355520 | Bacteria | 5948615 |
| 976 | 2807455696 | 2806310745 | Bacteria | 5742165 |
| 977 | 2808924240 | 2808606376 | Bacteria | 6248667 |
| 978 | 2808929852 | 2808606377 | Bacteria | 6646337 |
| 979 | 2808936997 | 2808606378 | Bacteria | 6177535 |
| 980 | 2808946375 | 2808606380 | Bacteria | 6248705 |
| 981 | 2808952073 | 2808606381 | Bacteria | 6646461 |
| 982 | 2808957202 | 2808606382 | Bacteria | 6841132 |
| 983 | 2808965307 | 2808606383 | Bacteria | 6138645 |
| 984 | 2808980764 | 2808606385 | Bacteria | 6711065 |
| 985 | 2808996437 | 2808606388 | Bacteria | 6706662 |
| 986 | 2809000205 | 2808606389 | Bacteria | 6138126 |
| 987 | 2809218980 | 2808606445 | Bacteria | 6057339 |
| 988 | 2812371315 | 2811994881 | Bacteria | 6298475 |
| 989 | 2817492802 | 2816332298 | Bacteria | 6852809 |
| 990 | 2819655794 | 2818991456 | Bacteria | 6123676 |
| 991 | 2819703819 | 2818991464 | Bacteria | 6907494 |
| 992 | 2823424427 | 2823421272 | Bacteria | 5372474 |
| 993 | 2825656587 | 2825651385 | Bacteria | 6715909 |
| 994 | 2826583630 | 2826581358 | Bacteria | 5963467 |
| 995 | 2834031593 | 2834028612 | Bacteria | 6354979 |
| 996 | 2842818126 | 2842815866 | Bacteria | 5947510 |
| 997 | 2842827386 | 2842826826 | Bacteria | 5974129 |
| 998 | 2842836658 | 2842832357 | Bacteria | 5959113 |
| 999 | 2842843065 | 2842837860 | Bacteria | 6066181 |
| 1000 | 2842844774 | 2842843487 | Bacteria | 6004777 |
| 1001 | 2842849239 | 2842849001 | Bacteria | 5924277 |
| 1002 | 2842859279 | 2842854478 | Bacteria | 6143501 |
| 1003 | 2844669281 | 2844665904 | Bacteria | 6817974 |
| 1004 | 2852612828 | 2852612431 | Bacteria | 6885235 |
| 1005 | 2852661384 | 2852657418 | Bacteria | 6472974 |
| 1006 | 2852669437 | 2852667396 | Bacteria | 6885555 |
| 1007 | 2860871891 | 2860867994 | Bacteria | 5645326 |
| 1008 | 2878034037 | 2878029506 | Bacteria | 6418441 |
| 1009 | 2880234662 | 2880230671 | Bacteria | 6140320 |
| 1010 | 2904521204 | 2904518522 | Bacteria | 6068986 |
| 1011 | 2904555233 | 2904550169 | Bacteria | 6221258 |
| 1012 | 2908451341 | 2908446538 | Bacteria | 6829095 |
| 1013 | 2912967519 | 2912963787 | Bacteria | 5646108 |
| 1014 | 2913040948 | 2913036834 | Bacteria | 6704877 |
| 1015 | 2917072555 | 2917070673 | Bacteria | 6868303 |
| 1016 | 2919069341 | 2919063839 | Bacteria | 6302690 |
| 1017 | 2919157354 | 2919155634 | Bacteria | 4860545 |
| 1018 | 2919388137 | 2919385768 | Bacteria | 5897293 |
| 1019 | 2919486295 | 2919481497 | Bacteria | 6907839 |
| 1020 | 2919489676 | 2919487758 | Bacteria | 5929766 |
| 1021 | 2919504154 | 2919501602 | Bacteria | 5286340 |
| 1022 | 2919703285 | 2919697872 | Bacteria | 6553725 |
| 1023 | 2923155409 | 2923153595 | Bacteria | 6870622 |
| 1024 | 2923525428 | 2923519811 | Bacteria | 6298479 |
| 1025 | 2923589984 | 2923586266 | Bacteria | 6565975 |
| 1026 | 2926065273 | 2926063275 | Bacteria | 5285848 |
| 1027 | 2929148446 | 2929144301 | Bacteria | 6622272 |
| 1028 | 2929193970 | 2929189879 | Bacteria | 5930554 |
| 1029 | 2931374138 | 2931369376 | Bacteria | 6847892 |
| 1030 | 2931395262 | 2931390751 | Bacteria | 6273349 |
| 1031 | 2931396700 | 2931396565 | Bacteria | 7251677 |
| 1032 | 2935354719 | 2935353572 | Unclassified | 6955622 |
| 1033 | 2939637499 | 2939636861 | Bacteria | 6297853 |
| 1034 | 2939653029 | 2939651529 | Bacteria | 5895393 |
| 1035 | 2945932058 | 2945928738 | Bacteria | 6053221 |
| 1036 | 2946008172 | 2946006987 | Bacteria | 6705746 |
| 1037 | 2946032464 | 2946027586 | Bacteria | 6049274 |
| 1038 | 2947239273 | 2947233263 | Bacteria | 6439278 |
| 1039 | 2969308817 | 2969304461 | Bacteria | 6601805 |
| 1040 | 2974289806 | 2974289157 | Bacteria | 6080362 |
| 1041 | 2988730047 | 2988728565 | Bacteria | 6124362 |
| 1042 | 2998144120 | 2998139840 | Bacteria | 6073514 |
| 1043 | 3007253136 | 3007252601 | Bacteria | 4559114 |
| 1044 | 3007424367 | 3007419365 | Bacteria | 7026924 |
| 1045 | 3007619614 | 3007614139 | Bacteria | 6053559 |
| 1046 | 3007719045 | 3007718800 | Bacteria | 5971527 |
| 1047 | 3007858897 | 3007855910 | Bacteria | 5637581 |
| 1048 | 3007865550 | 3007861166 | Bacteria | 6045338 |
| 1049 | 637319139 | 637000220 | Bacteria | 7074893 |
| 1050 | 8011355530 | 8011350971 | Bacteria | 6158957 |
| 1051 | 8015689630 | 8015687852 | Bacteria | 6613826 |
| 1052 | 8019772724 | 8019769354 | Bacteria | 6924660 |
| 1053 | 8019779414 | 8019775933 | Bacteria | 6858656 |
| 1054 | 8029996761 | 8029995093 | Bacteria | 5990776 |
| 1055 | 8034967022 | 8034962539 | Bacteria | 4884839 |
| 1056 | 8054289522 | 8054285046 | Bacteria | 6919322 |
| 1057 | 8054349105 | 8054347763 | Bacteria | 5901107 |
| 1058 | 8054507765 | 8054503363 | Bacteria | 6101651 |
| 1059 | 8054931083 | 8054929484 | Bacteria | 5599761 |
| 1060 | 8055772766 | 8055770955 | Bacteria | 6827675 |
| 1061 | 8055822702 | 8055817908 | Bacteria | 6609162 |
| 1062 | 8056117829 | 8056115690 | Bacteria | 5527654 |
| 1063 | 8056124490 | 8056120720 | Bacteria | 5758328 |
| 1064 | 8056130391 | 8056125926 | Bacteria | 6228218 |
| 1065 | 8056136153 | 8056131705 | Bacteria | 6107031 |
| 1066 | 8056139032 | 8056137416 | Bacteria | 6147080 |
| 1067 | 8056144925 | 8056143049 | Bacteria | 6307666 |
| 1068 | 8056150031 | 8056148874 | Bacteria | 6479865 |
| 1069 | 8056155167 | 8056155041 | Bacteria | 6486948 |
| 1070 | 8056162410 | 8056161164 | Bacteria | 6106669 |
| 1071 | 8056167164 | 8056166840 | Bacteria | 5820959 |
| 1072 | 8056173133 | 8056172158 | Bacteria | 6133900 |
| 1073 | 8056180119 | 8056177738 | Bacteria | 6748268 |
| 1074 | 8056572858 | 8056569372 | Bacteria | 5997322 |
| 1075 | 8057799187 | 8057798959 | Bacteria | 6713499 |
| 1076 | JGI25162J39368_1000421 | |||
| 1077 | JGI25162J39368_1000838 | |||
| 1078 | JGI25163J39215_1000824 | |||
| 1079 | JGI25163J39215_1000932 | |||
| 1080 | JGI25164J39214_1000296 | |||
| 1081 | JGI25164J39214_1000469 | |||
| 1082 | JGI25165J46597_1000528 | |||
| 1083 | JGI25165J46597_1000864 | |||
| 1084 | Ga0055538_1000132 | |||
| 1085 | Ga0055539_1000177 | |||
| 1086 | Ga0055533_1000179 | |||
| 1087 | Ga0055532_1000179 | |||
| 1088 | Ga0055525_1000408 | |||
| 1089 | Ga0055525_1002782 | |||
| 1090 | Ga0055535_1008840 | |||
| 1091 | Ga0055536_1000436 | |||
| 1092 | Ga0055536_1003265 | |||
| 1093 | Ga0055536_1003284 | |||
| 1094 | Ga0055530_10000240 | |||
| 1095 | Ga0055530_10000671 | |||
| 1096 | Ga0055530_10004397 | |||
| 1097 | Ga0055540_1000248 | |||
| 1098 | Ga0055540_1000400 | |||
| 1099 | Ga0055540_1004414 | |||
| 1100 | Ga0055531_10000202 | |||
| 1101 | Ga0055541_1000118 | |||
| 1102 | Ga0065714_10000004 | |||
| 1103 | Ga0065714_10005054 | |||
| 1104 | Ga0065714_10008187 | |||
| 1105 | Ga0065714_10010654 | |||
| 1106 | Ga0065714_10015583 | |||
| 1107 | Ga0065714_10065886 | |||
| 1108 | Ga0065714_10076538 | |||
| 1109 | Ga0065714_10077353 | |||
| 1110 | Ga0065704_10073559 | |||
| 1111 | Ga0065704_10073698 | |||
| 1112 | Ga0065704_10110882 | |||
| 1113 | Ga0065712_10077948 | |||
| 1114 | Ga0070670_100010753 | |||
| 1115 | Ga0070670_100154186 | |||
| 1116 | Ga0070661_100000284 | |||
| 1117 | Ga0070669_100001202 | |||
| 1118 | Ga0070662_100000804 | |||
| 1119 | Ga0070662_100072526 | |||
| 1120 | Ga0068853_100003812 | |||
| 1121 | Ga0070665_100013903 | |||
| 1122 | Ga0070665_100175995 | |||
| 1123 | Ga0070664_100000681 | |||
| 1124 | Ga0070664_100127710 | |||
| 1125 | Ga0068854_100023043 | |||
| 1126 | Ga0068851_10000011 | |||
| 1127 | Ga0075364_10067732 | |||
| 1128 | Ga0075432_10003878 | |||
| 1129 | Ga0075432_10004638 | |||
| 1130 | Ga0075432_10008264 | |||
| 1131 | Ga0075432_10034471 | |||
| 1132 | Ga0099823_1021985 | |||
| 1133 | Ga0079104_1000094 | |||
| 1134 | Ga0079104_1000668 | |||
| 1135 | Ga0105251_10000971 | |||
| 1136 | Ga0105251_10007772 | |||
| 1137 | Ga0105251_10008998 | |||
| 1138 | Ga0105251_10017930 | |||
| 1139 | Ga0105251_10032103 | |||
| 1140 | Ga0105251_10039370 | |||
| 1141 | Ga0105251_10065585 | |||
| 1142 | Ga0105244_10000709 | |||
| 1143 | Ga0105244_10004356 | |||
| 1144 | Ga0105244_10006626 | |||
| 1145 | Ga0105244_10008269 | |||
| 1146 | Ga0105244_10009510 | |||
| 1147 | Ga0105244_10012167 | |||
| 1148 | Ga0105244_10013981 | |||
| 1149 | Ga0105244_10022306 | |||
| 1150 | Ga0105244_10022410 | |||
| 1151 | Ga0105244_10022998 | |||
| 1152 | Ga0105244_10026665 | |||
| 1153 | Ga0105244_10036096 | |||
| 1154 | Ga0105244_10051317 | |||
| 1155 | Ga0105244_10064503 | |||
| 1156 | Ga0105244_10111724 | |||
| 1157 | Ga0105250_10000735 | |||
| 1158 | Ga0105250_10004551 | |||
| 1159 | Ga0105250_10005278 | |||
| 1160 | Ga0105250_10076085 | |||
| 1161 | Ga0105243_10012583 | |||
| 1162 | Ga0105243_10029559 | |||
| 1163 | Ga0105243_10031266 | |||
| 1164 | Ga0105243_10036090 | |||
| 1165 | Ga0105243_10042285 | |||
| 1166 | Ga0105242_10000626 | |||
| 1167 | Ga0105248_10011709 | |||
| 1168 | Ga0105237_10001599 | |||
| 1169 | Ga0105246_10000824 | |||
| 1170 | Ga0105246_10010995 | |||
| 1171 | Ga0105246_10027429 | |||
| 1172 | Ga0157345_1000647 | |||
| 1173 | Ga0157373_10003636 | |||
| 1174 | Ga0157373_10012012 | |||
| 1175 | Ga0157373_10015562 | |||
| 1176 | Ga0157373_10017236 | |||
| 1177 | Ga0157373_10020104 | |||
| 1178 | Ga0157373_10022847 | |||
| 1179 | Ga0157373_10055876 | |||
| 1180 | Ga0157371_10000406 | |||
| 1181 | Ga0157371_10013522 | |||
| 1182 | Ga0157371_10023347 | |||
| 1183 | Ga0157371_10040966 | |||
| 1184 | Ga0157370_10003491 | |||
| 1185 | Ga0157370_10036318 | |||
| 1186 | Ga0157370_10115524 | |||
| 1187 | Ga0157370_10166034 | |||
| 1188 | Ga0157370_10247865 | |||
| 1189 | Ga0157370_10332055 | |||
| 1190 | Ga0157369_10027825 | |||
| 1191 | Ga0157369_10028899 | |||
| 1192 | Ga0163162_10000495 | |||
| 1193 | Ga0163162_10081968 | |||
| 1194 | Ga0157372_10006569 | |||
| 1195 | Ga0157372_10038617 | |||
| 1196 | Ga0157375_10021676 | |||
| 1197 | Ga0157375_10027977 | |||
| 1198 | Ga0157375_10171941 | |||
| 1199 | Ga0157375_10299655 | |||
| 1200 | Ga0182008_10001674 | |||
| 1201 | Ga0182008_10008849 | |||
| 1202 | Ga0182008_10009722 | |||
| 1203 | Ga0182008_10009866 | |||
| 1204 | Ga0182008_10010494 | |||
| 1205 | Ga0182008_10012345 | |||
| 1206 | Ga0182008_10016508 | |||
| 1207 | Ga0182008_10017589 | |||
| 1208 | Ga0182008_10018048 | |||
| 1209 | Ga0182006_1004541 | |||
| 1210 | Ga0182006_1004981 | |||
| 1211 | Ga0182006_1006695 | |||
| 1212 | Ga0182006_1013745 | |||
| 1213 | Ga0182006_1024345 | |||
| 1214 | Ga0182006_1024946 | |||
| 1215 | Ga0182006_1031414 | |||
| 1216 | Ga0182007_10004029 | |||
| 1217 | Ga0182005_1002599 | |||
| 1218 | Ga0182005_1002754 | |||
| 1219 | Ga0163161_10006646 | |||
| 1220 | Ga0163161_10010440 | |||
| 1221 | Ga0163161_10011813 | |||
| 1222 | Ga0163161_10012997 | |||
| 1223 | Ga0163161_10069277 | |||
| 1224 | Ga0163161_10238054 | |||
| 1225 | Ga0209435_100479 | |||
| 1226 | Ga0209760_100114 | |||
| 1227 | Ga0209760_100337 | |||
| 1228 | Ga0209784_100173 | |||
| 1229 | Ga0209566_100226 | |||
| 1230 | Ga0209674_100216 | |||
| 1231 | Ga0209147_100229 | |||
| 1232 | Ga0209563_100224 | |||
| 1233 | Ga0209563_100338 | |||
| 1234 | Ga0207427_100001 | |||
| 1235 | Ga0207427_100008 | |||
| 1236 | Ga0209437_100003 | |||
| 1237 | Ga0209437_100014 | |||
| 1238 | Ga0209258_100386 | |||
| 1239 | Ga0209646_1000387 | |||
| 1240 | Ga0209677_100171 | |||
| 1241 | Ga0209233_1000007 | |||
| 1242 | Ga0209233_1000008 | |||
| 1243 | Ga0209675_1001650 | |||
| 1244 | Ga0209676_1000010 | |||
| 1245 | Ga0209676_1000021 | |||
| 1246 | Ga0209676_1000345 | |||
| 1247 | Ga0209676_1001157 | |||
| 1248 | Ga0209676_1005862 | |||
| 1249 | Ga0209676_1015165 | |||
| 1250 | Ga0209050_1000081 | |||
| 1251 | Ga0209050_1000162 | |||
| 1252 | Ga0209050_1000227 | |||
| 1253 | Ga0209050_1002674 | |||
| 1254 | Ga0209051_1000104 | |||
| 1255 | Ga0209051_1000164 | |||
| 1256 | Ga0209051_1020234 | |||
| 1257 | Ga0209051_1023109 | |||
| 1258 | Ga0209257_1000040 | |||
| 1259 | Ga0207656_10000013 | |||
| 1260 | Ga0207696_1000019 | |||
| 1261 | Ga0207696_1000097 | |||
| 1262 | Ga0207696_1000819 | |||
| 1263 | Ga0207696_1002467 | |||
| 1264 | Ga0207696_1010023 | |||
| 1265 | Ga0207696_1013261 | |||
| 1266 | Ga0207696_1014766 | |||
| 1267 | Ga0207655_1000005 | |||
| 1268 | Ga0207655_1000142 | |||
| 1269 | Ga0207655_1001255 | |||
| 1270 | Ga0207655_1002823 | |||
| 1271 | Ga0207655_1008691 | |||
| 1272 | Ga0207655_1009298 | |||
| 1273 | Ga0207655_1009950 | |||
| 1274 | Ga0207655_1011990 | |||
| 1275 | Ga0207655_1016994 | |||
| 1276 | Ga0207655_1017006 | |||
| 1277 | Ga0207655_1017633 | |||
| 1278 | Ga0207655_1019796 | |||
| 1279 | Ga0207655_1024112 | |||
| 1280 | Ga0207655_1024459 | |||
| 1281 | Ga0207655_1028445 | |||
| 1282 | Ga0207655_1055669 | |||
| 1283 | Ga0207655_1056174 | |||
| 1284 | Ga0207713_1000681 | |||
| 1285 | Ga0207713_1001006 | |||
| 1286 | Ga0207713_1001791 | |||
| 1287 | Ga0207713_1002600 | |||
| 1288 | Ga0207713_1004032 | |||
| 1289 | Ga0207713_1010546 | |||
| 1290 | Ga0207713_1012121 | |||
| 1291 | Ga0207713_1021322 | |||
| 1292 | Ga0207713_1048189 | |||
| 1293 | Ga0207713_1058126 | |||
| 1294 | Ga0207671_10000165 | |||
| 1295 | Ga0207649_10000013 | |||
| 1296 | Ga0207681_10001353 | |||
| 1297 | Ga0207681_10131781 | |||
| 1298 | Ga0207650_10000077 | |||
| 1299 | Ga0207650_10000457 | |||
| 1300 | Ga0207706_10002991 | |||
| 1301 | Ga0207706_10013867 | |||
| 1302 | Ga0207686_10019202 | |||
| 1303 | Ga0207709_10000035 | |||
| 1304 | Ga0207709_10005497 | |||
| 1305 | Ga0207709_10017514 | |||
| 1306 | Ga0207709_10031319 | |||
| 1307 | Ga0207679_10000005 | |||
| 1308 | Ga0207679_10236834 | |||
| 1309 | Ga0207640_10142299 | |||
| 1310 | Ga0207639_10002794 | |||
| 1311 | Ga0209281_1000077 | |||
| 1312 | Ga0209281_1000212 | |||
| 1313 | Ga0209281_1002389 | |||
| 1314 | Ga0209389_1000037 | |||
| 1315 | Ga0209371_1000198 | |||
| 1316 | Ga0209371_1000359 | |||
| 1317 | Ga0207428_10036878 | |||
| 1318 | Ga0207428_10085243 | |||
| 1319 | Ga0207428_10087582 | |||
| 1320 | Ga0207428_10220691 | |||
| 1321 | Ga0268266_10020349 | |||
| 1322 | Ga0268266_10226830 | |||
| 1323 | Ga0268256_1000159 | |||
| 1324 | Ga0268256_1000305 | |||
| 1325 | Ga0314311_1228399 | |||
| 1326 | Ga0316181_1100804 | |||
| 1327 | Ga0265340_10067283 | |||
| 1328 | Ga0307408_100000027 | |||
| 1329 | Ga0307408_100013344 | |||
| 1330 | Ga0307408_100022832 | |||
| 1331 | Ga0307405_10005852 | |||
| 1332 | Ga0307413_10033417 | |||
| 1333 | Ga0307412_10011186 | |||
| 1334 | Ga0307412_10017850 | |||
| 1335 | Ga0307412_10035447 | |||
| 1336 | Ga0307412_10058519 | |||
| 1337 | Ga0307414_10220637 | |||
| 1338 | Ga0307510_10030497 | |||
| 1339 | Ga0439438_000807 | |||
| 1340 | Ga0439438_003655 | |||
| 1341 | Ga0439438_003712 | |||
| 1342 | Ga0439438_004132 | |||
| 1343 | Ga0439438_004492 | |||
| 1344 | Ga0439438_004546 | |||
| 1345 | Ga0439438_004833 | |||
| 1346 | Ga0439438_009790 | |||
| 1347 | Ga0439438_014232 | |||
| 1348 | Ga0439438_039167 | |||
| 1349 | Ga0439447_002684 | |||
| 1350 | Ga0439447_003481 | |||
| 1351 | Ga0439447_003500 | |||
| 1352 | Ga0439447_004605 | |||
| 1353 | Ga0439447_012937 | |||
| 1354 | Ga0439466_0002247 | |||
| 1355 | Ga0439466_0004509 | |||
| 1356 | Ga0439466_0004750 | |||
| 1357 | Ga0439466_0005809 | |||
| 1358 | Ga0439466_0012788 | |||
| 1359 | Ga0439466_0014661 | |||
| 1360 | Ga0439466_0017892 | |||
| 1361 | Ga0439466_0020077 | |||
| 1362 | Ga0439465_0003421 | |||
| 1363 | Ga0439431_0004399 | |||
| 1364 | Ga0439432_003190 | |||
| 1365 | Ga0439432_004434 | |||
| 1366 | Ga0439432_016417 | |||
| 1367 | Ga0439432_018797 | |||
| 1368 | Ga0439432_022847 | |||
| 1369 | Ga0439451_002492 | |||
| 1370 | Ga0439451_006952 | |||
| 1371 | Ga0439451_009467 | |||
| 1372 | Ga0439452_000281 | |||
| 1373 | Ga0439452_002545 | |||
| 1374 | Ga0439452_003098 | |||
| 1375 | Ga0439452_004023 | |||
| 1376 | Ga0439452_005077 | |||
| 1377 | Ga0439452_006591 | |||
| 1378 | Ga0439452_009916 | |||
| 1379 | Ga0439456_000264 | |||
| 1380 | Ga0439456_001502 | |||
| 1381 | Ga0439456_013625 | |||
| 1382 | Ga0439463_001607 | |||
| 1383 | Ga0439463_001951 | |||
| 1384 | Ga0439463_013291 | |||
| 1385 | Ga0439463_029775 | |||
| 1386 | Ga0450911_002967 | |||
| 1387 | Ga0450911_003200 | |||
| 1388 | Ga0450919_000544 | |||
| 1389 | Ga0450890_000530 | |||
| 1390 | Ga0450902_000722 | |||
| 1391 | Ga0450902_001237 | |||
| 1392 | Ga0450903_004755 | |||
| 1393 | Ga0450905_001013 | |||
| 1394 | Ga0450905_004406 | |||
| 1395 | Ga0450906_002265 | |||
| 1396 | Ga0450907_001033 | |||
| 1397 | Ga0450910_000567 | |||
| 1398 | Ga0450908_003567 | |||
| 1399 | Ga0450909_000392 | |||
| 1400 | Ga0439434_0001710 | |||
| 1401 | Ga0439464_0004415 | |||
| 1402 | Ga0439460_0002183 | |||
| 1403 | Ga0439460_0002977 | |||
| 1404 | Ga0450893_0003284 | |||
| 1405 | Ga0450901_000122 | |||
| 1406 | Ga0450901_001148 | |||
| 1407 | Ga0439440_0010287 | |||
| 1408 | Ga0495617_000225 | |||
| 1409 | Ga0495617_003852 | |||
| 1410 | Ga0495617_004477 | |||
| 1411 | Ga0495627_000257 | |||
| 1412 | Ga0495627_000451 | |||
| 1413 | Ga0495627_000569 | |||
| 1414 | Ga0495627_004752 | |||
| 1415 | Ga0495627_006643 | |||
| 1416 | Ga0495627_008286 | |||
| 1417 | Ga0495627_018439 | |||
| 1418 | Ga0495603_0002381 | |||
| 1419 | Ga0495603_0021821 | |||
| 1420 | Ga0495590_0004245 | |||
| 1421 | Ga0495590_0004738 | |||
| 1422 | Ga0495591_000822 | |||
| 1423 | Ga0495591_001100 | |||
| 1424 | Ga0495591_004826 | |||
| 1425 | Ga0495591_005086 | |||
| 1426 | Ga0495591_006137 | |||
| 1427 | Ga0495591_006343 | |||
| 1428 | Ga0495591_006511 | |||
| 1429 | Ga0495591_017012 | |||
| 1430 | Ga0495638_0018185 | |||
| 1431 | Ga0495638_0020515 | |||
| 1432 | Ga0495638_0022371 | |||
| 1433 | Ga0495638_0024256 | |||
| 1434 | Ga0495638_0035890 | |||
| 1435 | Ga0495638_0037932 | |||
| 1436 | Ga0495638_0117666 | |||
| 1437 | Ga0495638_0120723 | |||
| 1438 | Ga0495653_0014639 | |||
| 1439 | Ga0495653_0014669 | |||
| 1440 | Ga0495653_0052181 | |||
| 1441 | Ga0495653_0061222 | |||
| 1442 | Ga0495650_0000853 | |||
| 1443 | Ga0495650_0001128 | |||
| 1444 | Ga0495650_0003282 | |||
| 1445 | Ga0495650_0009821 | |||
| 1446 | Ga0495650_0023701 | |||
| 1447 | Ga0495650_0028569 | |||
| 1448 | Ga0495582_0020275 | |||
| 1449 | Ga0495605_0000336 | |||
| 1450 | Ga0495605_0000831 | |||
| 1451 | Ga0495605_0000880 | |||
| 1452 | Ga0495605_0000903 | |||
| 1453 | Ga0495605_0006152 | |||
| 1454 | Ga0495605_0010787 | |||
| 1455 | Ga0495605_0010841 | |||
| 1456 | Ga0495605_0011420 | |||
| 1457 | Ga0495605_0012571 | |||
| 1458 | Ga0495605_0021270 | |||
| 1459 | Ga0495605_0025150 | |||
| 1460 | Ga0495605_0035188 | |||
| 1461 | Ga0495605_0055282 | |||
| 1462 | Ga0495605_0063797 | |||
| 1463 | Ga0495639_0000158 | |||
| 1464 | Ga0495639_0006561 | |||
| 1465 | Ga0495584_0006126 | |||
| 1466 | Ga0495584_0007034 | |||
| 1467 | Ga0495584_0008147 | |||
| 1468 | Ga0495584_0011158 | |||
| 1469 | Ga0495584_0028398 | |||
| 1470 | Ga0495584_0029006 | |||
| 1471 | Ga0495584_0035434 | |||
| 1472 | Ga0495584_0067679 | |||
| 1473 | Ga0495585_0008120 | |||
| 1474 | Ga0495585_0009359 | |||
| 1475 | Ga0495585_0010239 | |||
| 1476 | Ga0495585_0014589 | |||
| 1477 | Ga0495585_0014716 | |||
| 1478 | Ga0495585_0022053 | |||
| 1479 | Ga0495585_0075837 | |||
| 1480 | Ga0495594_0010942 | |||
| 1481 | Ga0495594_0011583 | |||
| 1482 | Ga0495596_0004892 | |||
| 1483 | Ga0495596_0026184 | |||
| 1484 | Ga0495607_0000869 | |||
| 1485 | Ga0495607_0001347 | |||
| 1486 | Ga0495607_0001613 | |||
| 1487 | Ga0495607_0001842 | |||
| 1488 | Ga0495607_0006360 | |||
| 1489 | Ga0495607_0007341 | |||
| 1490 | Ga0495607_0007352 | |||
| 1491 | Ga0495607_0009030 | |||
| 1492 | Ga0495607_0012101 | |||
| 1493 | Ga0495607_0014781 | |||
| 1494 | Ga0495607_0016892 | |||
| 1495 | Ga0495607_0025554 | |||
| 1496 | Ga0495607_0031783 | |||
| 1497 | Ga0495607_0033106 | |||
| 1498 | Ga0495607_0033463 | |||
| 1499 | Ga0495607_0037857 | |||
| 1500 | Ga0495607_0048152 | |||
| 1501 | Ga0495607_0059837 | |||
| 1502 | Ga0495607_0077111 | |||
| 1503 | Ga0495607_0079061 | |||
| 1504 | Ga0495607_0095791 | |||
| 1505 | Ga0495607_0097438 | |||
| 1506 | Ga0495583_0001354 | |||
| 1507 | Ga0495583_0001828 | |||
| 1508 | Ga0495583_0002363 | |||
| 1509 | Ga0495583_0006262 | |||
| 1510 | Ga0495583_0008207 | |||
| 1511 | Ga0495583_0009383 | |||
| 1512 | Ga0495583_0013893 | |||
| 1513 | Ga0495583_0017192 | |||
| 1514 | Ga0495583_0018242 | |||
| 1515 | Ga0495583_0023594 | |||
| 1516 | Ga0495606_0001384 | |||
| 1517 | Ga0495606_0001423 | |||
| 1518 | Ga0495606_0005372 | |||
| 1519 | Ga0495606_0014967 | |||
| 1520 | Ga0495606_0015945 | |||
| 1521 | Ga0495606_0017185 | |||
| 1522 | Ga0495606_0020027 | |||
| 1523 | Ga0495606_0021665 | |||
| 1524 | Ga0495606_0021913 | |||
| 1525 | Ga0495606_0047957 | |||
| 1526 | Ga0495606_0052557 | |||
| 1527 | Ga0495606_0096119 | |||
| 1528 | Ga0495610_0009001 | |||
| 1529 | Ga0495610_0009088 | |||
| 1530 | Ga0495610_0009663 | |||
| 1531 | Ga0495610_0010838 | |||
| 1532 | Ga0495610_0010961 | |||
| 1533 | Ga0495610_0011192 | |||
| 1534 | Ga0495610_0016561 | |||
| 1535 | Ga0495610_0022453 | |||
| 1536 | Ga0495610_0039138 | |||
| 1537 | Ga0495616_0006907 | |||
| 1538 | Ga0495616_0007521 | |||
| 1539 | Ga0495616_0016626 | |||
| 1540 | Ga0495616_0055025 | |||
| 1541 | Ga0495616_0094693 | |||
| 1542 | Ga0495620_0000054 | |||
| 1543 | Ga0495620_0001742 | |||
| 1544 | Ga0495620_0002259 | |||
| 1545 | Ga0495620_0007056 | |||
| 1546 | Ga0495620_0010613 | |||
| 1547 | Ga0495620_0017624 | |||
| 1548 | Ga0495620_0017763 | |||
| 1549 | Ga0495620_0020290 | |||
| 1550 | Ga0495620_0044710 | |||
| 1551 | Ga0495620_0045077 | |||
| 1552 | Ga0495630_0016649 | |||
| 1553 | Ga0495630_0018980 | |||
| 1554 | Ga0495631_0000478 | |||
| 1555 | Ga0495631_0001335 | |||
| 1556 | Ga0495631_0005026 | |||
| 1557 | Ga0495631_0013312 | |||
| 1558 | Ga0495631_0015511 | |||
| 1559 | Ga0495631_0015929 | |||
| 1560 | Ga0495631_0036200 | |||
| 1561 | Ga0495632_0001147 | |||
| 1562 | Ga0495632_0001888 | |||
| 1563 | Ga0495632_0008307 | |||
| 1564 | Ga0495632_0008784 | |||
| 1565 | Ga0495632_0009540 | |||
| 1566 | Ga0495632_0011026 | |||
| 1567 | Ga0495632_0011532 | |||
| 1568 | Ga0495632_0012646 | |||
| 1569 | Ga0495632_0021411 | |||
| 1570 | Ga0495632_0034893 | |||
| 1571 | Ga0495632_0045190 | |||
| 1572 | Ga0495632_0060467 | |||
| 1573 | Ga0495632_0086213 | |||
| 1574 | Ga0495632_0102320 | |||
| 1575 | Ga0495637_0003252 | |||
| 1576 | Ga0495637_0006397 | |||
| 1577 | Ga0495637_0006846 | |||
| 1578 | Ga0495637_0007578 | |||
| 1579 | Ga0495637_0008319 | |||
| 1580 | Ga0495637_0010254 | |||
| 1581 | Ga0495637_0012231 | |||
| 1582 | Ga0495637_0013088 | |||
| 1583 | Ga0495637_0013389 | |||
| 1584 | Ga0495637_0017016 | |||
| 1585 | Ga0495637_0021167 | |||
| 1586 | Ga0495637_0024487 | |||
| 1587 | Ga0495637_0028419 | |||
| 1588 | Ga0495637_0031069 | |||
| 1589 | Ga0495637_0035031 | |||
| 1590 | Ga0495637_0056489 | |||
| 1591 | Ga0495637_0076083 | |||
| 1592 | Ga0495643_0000909 | |||
| 1593 | Ga0495643_0004499 | |||
| 1594 | Ga0495643_0004605 | |||
| 1595 | Ga0495643_0009458 | |||
| 1596 | Ga0495643_0019568 | |||
| 1597 | Ga0495643_0030091 | |||
| 1598 | Ga0495643_0035228 | |||
| 1599 | Ga0495643_0052738 | |||
| 1600 | Ga0495644_0000496 | |||
| 1601 | Ga0495644_0002396 | |||
| 1602 | Ga0495644_0003999 | |||
| 1603 | Ga0495644_0014807 | |||
| 1604 | Ga0495644_0017355 | |||
| 1605 | Ga0495648_0001608 | |||
| 1606 | Ga0495648_0003220 | |||
| 1607 | Ga0495648_0011986 | |||
| 1608 | Ga0495648_0012916 | |||
| 1609 | Ga0495648_0014011 | |||
| 1610 | Ga0495648_0016867 | |||
| 1611 | Ga0495648_0017468 | |||
| 1612 | Ga0495648_0023252 | |||
| 1613 | Ga0495648_0023803 | |||
| 1614 | Ga0495648_0025421 | |||
| 1615 | Ga0495648_0053759 | |||
| 1616 | Ga0495648_0054300 | |||
| 1617 | Ga0495666_0017315 | |||
| 1618 | Ga0495666_0020490 | |||
| 1619 | Ga0495642_0003041 | |||
| 1620 | Ga0495642_0003357 | |||
| 1621 | Ga0495642_0004114 | |||
| 1622 | Ga0495654_0000672 | |||
| 1623 | Ga0495654_0006669 | |||
| 1624 | Ga0495654_0006958 | |||
| 1625 | Ga0495654_0007483 | |||
| 1626 | Ga0495654_0007930 | |||
| 1627 | Ga0495654_0007957 | |||
| 1628 | Ga0495654_0012419 | |||
| 1629 | Ga0495654_0016001 | |||
| 1630 | Ga0495654_0017519 | |||
| 1631 | Ga0495654_0019596 | |||
| 1632 | Ga0495654_0022619 | |||
| 1633 | Ga0495654_0025971 | |||
| 1634 | Ga0495654_0026914 | |||
| 1635 | Ga0495654_0052925 | |||
| 1636 | Ga0495654_0077302 | |||
| 1637 | Ga0495587_0018557 | |||
| 1638 | Ga0495609_0000011 | |||
| 1639 | Ga0495609_0000784 | |||
| 1640 | Ga0495609_0005802 | |||
| 1641 | Ga0495609_0008532 | |||
| 1642 | Ga0495609_0009845 | |||
| 1643 | Ga0495609_0021143 | |||
| 1644 | Ga0495609_0021476 | |||
| 1645 | Ga0495597_0000221 | |||
| 1646 | Ga0495597_0008152 | |||
| 1647 | Ga0495597_0009966 | |||
| 1648 | Ga0495597_0034302 | |||
| 1649 | Ga0495597_0050274 | |||
| 1650 | Ga0495597_0063118 | |||
| 1651 | Ga0495645_0051545 | |||
| 1652 | Ga0495622_0004041 | |||
| 1653 | Ga0495622_0004514 | |||
| 1654 | Ga0495622_0004608 | |||
| 1655 | Ga0495622_0014806 | |||
| 1656 | Ga0495622_0015519 | |||
| 1657 | Ga0495633_0019202 | |||
| 1658 | Ga0495668_0008686 | |||
| 1659 | Ga0495668_0010764 | |||
| 1660 | Ga0495668_0039894 | |||
| 1661 | Ga0495668_0044485 | |||
| 1662 | Ga0495668_0078419 | |||
| 1663 | Ga0495634_0012371 | |||
| 1664 | Ga0495611_0000679 | |||
| 1665 | Ga0495611_0005044 | |||
| 1666 | Ga0495611_0007983 | |||
| 1667 | Ga0495611_0010339 | |||
| 1668 | Ga0495611_0017803 | |||
| 1669 | Ga0495625_0000187 | |||
| 1670 | Ga0495625_0002270 | |||
| 1671 | Ga0495625_0014956 | |||
| 1672 | Ga0495625_0018168 | |||
| 1673 | Ga0495625_0051669 | |||
| 1674 | Ga0495625_0055293 | |||
| 1675 | Ga0495625_0066427 | |||
| 1676 | Ga0495625_0148111 | |||
| 1677 | Ga0495635_0011871 | |||
| 1678 | Ga0495659_0002188 | |||
| 1679 | Ga0495659_0017081 | |||
| 1680 | Ga0495661_0000477 | |||
| 1681 | Ga0495661_0001003 | |||
| 1682 | Ga0495661_0011555 | |||
| 1683 | Ga0495661_0021018 | |||
| 1684 | Ga0495661_0023404 | |||
| 1685 | Ga0495661_0032749 | |||
| 1686 | Ga0495661_0086413 | |||
| 1687 | Ga0495661_0098839 | |||
| 1688 | Ga0495661_0107323 | |||
| 1689 | Ga0495588_0034828 | |||
| 1690 | Ga0495588_0046567 | |||
| 1691 | Ga0495623_0011027 | |||
| 1692 | Ga0495646_0034820 | |||
| 1693 | Ga0495646_0068240 | |||
| 1694 | Ga0495669_0036086 | |||
| 1695 | Ga0495613_0028914 | |||
| 1696 | Ga0495613_0035907 | |||
| 1697 | Ga0495624_0010386 | |||
| 1698 | Ga0495670_0005708 | |||
| 1699 | Ga0495670_0007057 | |||
| 1700 | Ga0495670_0010097 | |||
| 1701 | Ga0495670_0054500 | |||
| 1702 | Ga0495670_0072675 | |||
| 1703 | Ga0495671_0001180 | |||
| 1704 | Ga0495671_0002553 | |||
| 1705 | Ga0495671_0007066 | |||
| 1706 | Ga0495671_0011460 | |||
| 1707 | Ga0495671_0013002 | |||
| 1708 | Ga0495671_0015788 | |||
| 1709 | Ga0495671_0016740 | |||
| 1710 | Ga0495671_0018162 | |||
| 1711 | Ga0495671_0021717 | |||
| 1712 | Ga0495671_0022238 | |||
| 1713 | Ga0495671_0032131 | |||
| 1714 | Ga0495671_0044886 | |||
| 1715 | Ga0495671_0046155 | |||
| 1716 | Ga0495649_0003758 | |||
| 1717 | Ga0495649_0007939 | |||
| 1718 | Ga0495649_0013301 | |||
| 1719 | Ga0495649_0016828 | |||
| 1720 | Ga0495649_0021385 | |||
| 1721 | Ga0495649_0027148 | |||
| 1722 | Ga0495649_0029908 | |||
| 1723 | Ga0495649_0048660 | |||
| 1724 | Ga0495649_0090715 | |||
| 1725 | Ga0495649_0115516 | |||
| 1726 | Ga0495589_0006835 | |||
| 1727 | Ga0495589_0007574 | |||
| 1728 | Ga0495589_0009516 | |||
| 1729 | Ga0495589_0012887 | |||
| 1730 | Ga0495589_0014210 | |||
| 1731 | Ga0495589_0018694 | |||
| 1732 | Ga0495589_0018838 | |||
| 1733 | Ga0495589_0021020 | |||
| 1734 | Ga0495600_0087578 | |||
| 1735 | Ga0495600_0089008 | |||
| 1736 | Ga0495600_0095479 | |||
| 1737 | Ga0495660_0000407 | |||
| 1738 | Ga0495660_0000888 | |||
| 1739 | Ga0495660_0005255 | |||
| 1740 | Ga0495660_0014627 | |||
| 1741 | Ga0495660_0016041 | |||
| 1742 | Ga0495660_0039523 | |||
| 1743 | Ga0495660_0041576 | |||
| 1744 | Ga0495660_0052020 | |||
| 1745 | Ga0495660_0057568 | |||
| 1746 | Ga0495660_0060872 | |||
| 1747 | Ga0495660_0075330 | |||
| 1748 | Ga0495581_0020117 | |||
| 1749 | Ga0495604_0014492 | |||
| 1750 | Ga0495604_0019863 | |||
| 1751 | Ga0495604_0080550 | |||
| 1752 | Ga0495674_0022886 | |||
| 1753 | Ga0495672_0001999 | |||
| 1754 | Ga0495672_0004119 | |||
| 1755 | Ga0495672_0010951 | |||
| 1756 | Ga0495672_0010991 | |||
| 1757 | Ga0495672_0011802 | |||
| 1758 | Ga0495672_0012897 | |||
| 1759 | Ga0495672_0025964 | |||
| 1760 | Ga0495672_0027595 | |||
| 1761 | Ga0495672_0037594 | |||
| 1762 | Ga0495672_0096243 | |||
| 1763 | Ga0495676_0000508 | |||
| 1764 | Ga0495676_0044259 | |||
| 1765 | Ga0495680_0016282 | |||
| 1766 | Ga0495680_0020043 | |||
| 1767 | Ga0495680_0020798 | |||
| 1768 | Ga0495680_0022963 | |||
| 1769 | Ga0495680_0061528 | |||
| 1770 | Ga0495683_0000176 | |||
| 1771 | Ga0495683_0000216 | |||
| 1772 | Ga0495683_0006693 | |||
| 1773 | Ga0495683_0014143 | |||
| 1774 | Ga0495683_0019039 | |||
| 1775 | Ga0495683_0027993 | |||
| 1776 | Ga0495683_0032221 | |||
| 1777 | Ga0495683_0038880 | |||
| 1778 | Ga0495683_0040353 | |||
| 1779 | Ga0495683_0080345 | |||
| 1780 | Ga0495683_0100220 | |||
| 1781 | Ga0495687_000676 | |||
| 1782 | Ga0495687_008412 | |||
| 1783 | Ga0495687_011711 | |||
| 1784 | Ga0495687_016205 | |||
| 1785 | Ga0495675_0043355 | |||
| 1786 | Ga0495675_0061883 | |||
| 1787 | Ga0495677_0004418 | |||
| 1788 | Ga0495679_005086 | |||
| 1789 | Ga0495679_006422 | |||
| 1790 | Ga0495679_007665 | |||
| 1791 | Ga0495679_013289 | |||
| 1792 | Ga0495679_015209 | |||
| 1793 | Ga0495685_006994 | |||
| 1794 | Ga0495673_0000938 | |||
| 1795 | Ga0495673_0001468 | |||
| 1796 | Ga0495673_0001495 | |||
| 1797 | Ga0495673_0006807 | |||
| 1798 | Ga0495673_0007204 | |||
| 1799 | Ga0495673_0007237 | |||
| 1800 | Ga0495673_0008958 | |||
| 1801 | Ga0495673_0009407 | |||
| 1802 | Ga0495673_0012088 | |||
| 1803 | Ga0495673_0015257 | |||
| 1804 | Ga0495673_0019347 | |||
| 1805 | Ga0495673_0019537 | |||
| 1806 | Ga0495673_0020580 | |||
| 1807 | Ga0495673_0026104 | |||
| 1808 | Ga0495673_0036542 | |||
| 1809 | Ga0495673_0039272 | |||
| 1810 | Ga0495673_0039704 | |||
| 1811 | Ga0495673_0070476 | |||
| 1812 | Ga0495681_0000588 | |||
| 1813 | Ga0495681_0005805 | |||
| 1814 | Ga0495681_0006397 | |||
| 1815 | Ga0495681_0009539 | |||
| 1816 | Ga0495681_0009601 | |||
| 1817 | Ga0495681_0010451 | |||
| 1818 | Ga0495681_0010626 | |||
| 1819 | Ga0495681_0010743 | |||
| 1820 | Ga0495681_0012384 | |||
| 1821 | Ga0495681_0023530 | |||
| 1822 | Ga0495681_0029275 | |||
| 1823 | Ga0495681_0035413 | |||
| 1824 | Ga0495681_0041589 | |||
| 1825 | Ga0495681_0046452 | |||
| 1826 | Ga0495681_0054716 | |||
| 1827 | Ga0495686_0018147 | |||
| 1828 | Ga0495686_0021228 | |||
| 1829 | Ga0495686_0023740 | |||
| 1830 | Ga0495686_0039147 | |||
| 1831 | Ga0495593_0015342 | |||
| 1832 | Ga0495626_0000250 | |||
| 1833 | Ga0495626_0000721 | |||
| 1834 | Ga0495626_0002158 | |||
| 1835 | Ga0495626_0007151 | |||
| 1836 | Ga0495626_0007269 | |||
| 1837 | Ga0495626_0008235 | |||
| 1838 | Ga0495626_0009970 | |||
| 1839 | Ga0495626_0010027 | |||
| 1840 | Ga0495626_0031440 | |||
| 1841 | Ga0496102_0017499 | |||
| 1842 | Ga0496103_0008923 | |||
| 1843 | Ga0496110_0010564 | |||
| 1844 | Ga0496110_0370153 | |||
| 1845 | Ga0496111_0094149 | |||
| 1846 | Ga0496112_0160691 | |||
| 1847 | Ga0496114_0003285 | |||
| 1848 | Ga0496114_0019724 | |||
| 1849 | Ga0496116_0001102 | |||
| 1850 | Ga0496116_0001892 | |||
| 1851 | Ga0496116_0013194 | |||
| 1852 | Ga0496116_0028107 | |||
| 1853 | Ga0496116_0036122 | |||
| 1854 | Ga0496116_0066709 | |||
| 1855 | Ga0496117_0002125 | |||
| 1856 | Ga0496117_0002831 | |||
| 1857 | Ga0496117_0003138 | |||
| 1858 | Ga0496117_0006628 | |||
| 1859 | Ga0496117_0008859 | |||
| 1860 | Ga0496117_0021272 | |||
| 1861 | Ga0496117_0049167 | |||
| 1862 | Ga0496117_0052054 | |||
| 1863 | Ga0496117_0054878 | |||
| 1864 | Ga0496118_0006257 | |||
| 1865 | Ga0496118_0006536 | |||
| 1866 | Ga0496118_0025614 | |||
| 1867 | Ga0496118_0027731 | |||
| 1868 | Ga0496118_0032911 | |||
| 1869 | Ga0496118_0032940 | |||
| 1870 | Ga0496118_0041866 | |||
| 1871 | Ga0496119_0000130 | |||
| 1872 | Ga0496119_0025020 | |||
| 1873 | Ga0496120_0001123 | |||
| 1874 | Ga0496120_0032235 | |||
| 1875 | Ga0496120_0045803 | |||
| 1876 | Ga0496121_0000781 | |||
| 1877 | Ga0496121_0002035 | |||
| 1878 | Ga0496121_0010893 | |||
| 1879 | Ga0496121_0040850 | |||
| 1880 | Ga0496121_0046437 | |||
| 1881 | Ga0496121_0075467 | |||
| 1882 | Ga0496122_0001762 | |||
| 1883 | Ga0496122_0006421 | |||
| 1884 | Ga0496122_0018352 | |||
| 1885 | Ga0496122_0018887 | |||
| 1886 | Ga0496122_0021949 | |||
| 1887 | Ga0496122_0029502 | |||
| 1888 | Ga0496122_0040241 | |||
| 1889 | Ga0496122_0124302 | |||
| 1890 | Ga0496122_0158864 | |||
| 1891 | Ga0496122_0178245 | |||
| 1892 | Ga0496123_0001295 | |||
| 1893 | Ga0496123_0005038 | |||
| 1894 | Ga0496123_0010414 | |||
| 1895 | Ga0496123_0014533 | |||
| 1896 | Ga0496123_0028125 | |||
| 1897 | Ga0496123_0087768 | |||
| 1898 | Ga0496124_0000382 | |||
| 1899 | Ga0496124_0002323 | |||
| 1900 | Ga0496124_0010744 | |||
| 1901 | Ga0496124_0026032 | |||
| 1902 | Ga0496124_0029001 | |||
| 1903 | Ga0496124_0031178 | |||
| 1904 | Ga0496124_0036947 | |||
| 1905 | Ga0496124_0043400 | |||
| 1906 | Ga0496124_0058258 | |||
| 1907 | Ga0496124_0100434 | |||
| 1908 | Ga0496124_0122764 | |||
| 1909 | Ga0496124_0169951 | |||
| 1910 | Ga0496125_0002291 | |||
| 1911 | Ga0496125_0006854 | |||
| 1912 | Ga0496125_0019099 | |||
| 1913 | Ga0496125_0021660 | |||
| 1914 | Ga0496125_0025862 | |||
| 1915 | Ga0496125_0054616 | |||
| 1916 | Ga0496125_0100107 | |||
| 1917 | Ga0496126_0022741 | |||
| 1918 | Ga0496126_0049246 | |||
| 1919 | Ga0495678_000688 | |||
| 1920 | Ga0495678_007338 | |||
| 1921 | Ga0495678_007420 | |||
| 1922 | Ga0495678_010370 | |||
| 1923 | Ga0495678_010418 | |||
| 1924 | Ga0495678_017505 | |||
| 1925 | Ga0495678_020346 | |||
| 1926 | Ga0495678_060946 | |||
| 1927 | Ga0495682_0001672 | |||
| 1928 | Ga0495682_0007675 | |||
| 1929 | Ga0495682_0016549 | |||
| 1930 | Ga0501034_0000325 | |||
| 1931 | Ga0501039_0063602 | |||
| 1932 | nmdc:mga0sz30_22593_c1 | |||
| 1933 | Ga0500659_0013100 | |||
| 1934 | Ga0500573_0031135 | |||
| 1935 | Ga0500577_0026732 | |||
| 1936 | Ga0500634_0011370 | |||
| 1937 | 2842809663 | |||
| 1938 | 2511256778 | |||
| 1939 | 2511266739 | |||
| 1940 | 2511274727 | |||
| 1941 | 2511303140 | |||
| 1942 | 2511314149 | |||
| 1943 | 2511319696 | |||
| 1944 | 2511329035 | |||
| 1945 | 2511330502 | |||
| 1946 | 2511344980 | |||
| 1947 | 2511360102 | |||
| 1948 | 2511360767 | |||
| 1949 | 2511371461 | |||
| 1950 | 2511376236 | |||
| 1951 | 2511826134 | |||
| 1952 | 2512324762 | |||
| 1953 | 2555248684 | |||
| 1954 | 2583793842 | |||
| 1955 | 2597856970 | |||
| 1956 | 2597862607 | |||
| 1957 | 2597871258 | |||
| 1958 | 2599328632 | |||
| 1959 | 2599357154 | |||
| 1960 | 2599362059 | |||
| 1961 | 2599368379 | |||
| 1962 | 2599375168 | |||
| 1963 | 2599382259 | |||
| 1964 | 2599388706 | |||
| 1965 | 2599394026 | |||
| 1966 | 2599402026 | |||
| 1967 | 2599405791 | |||
| 1968 | 2599464345 | |||
| 1969 | 2599468665 | |||
| 1970 | 2599483994 | |||
| 1971 | 2599493364 | |||
| 1972 | 2599504317 | |||
| 1973 | 2599510652 | |||
| 1974 | 2599512322 | |||
| 1975 | 2599520479 | |||
| 1976 | 2599613607 | |||
| 1977 | 2599772523 | |||
| 1978 | 2599801645 | |||
| 1979 | 2599883655 | |||
| 1980 | 2599888755 | |||
| 1981 | 2599890998 | |||
| 1982 | 2599900385 | |||
| 1983 | 2599933422 | |||
| 1984 | 2599944125 | |||
| 1985 | 2599952017 | |||
| 1986 | 2599956343 | |||
| 1987 | 2599961280 | |||
| 1988 | 2599968405 | |||
| 1989 | 2599979704 | |||
| 1990 | 2599985037 | |||
| 1991 | 2599989337 | |||
| 1992 | 2599994250 | |||
| 1993 | 2600000267 | |||
| 1994 | 2600008763 | |||
| 1995 | 2600013529 | |||
| 1996 | 2600020982 | |||
| 1997 | 2600023545 | |||
| 1998 | 2600030653 | |||
| 1999 | 2600037010 | |||
| 2000 | 2600042433 | |||
| 2001 | 2600049571 | |||
| 2002 | 2600055920 | |||
| 2003 | 2600060496 | |||
| 2004 | 2600065595 | |||
| 2005 | 2600070754 | |||
| 2006 | 2600078279 | |||
| 2007 | 2600216622 | |||
| 2008 | 2600360460 | |||
| 2009 | 2600365933 | |||
| 2010 | 2600442311 | |||
| 2011 | 2601689289 | |||
| 2012 | 2601776785 | |||
| 2013 | 2601796408 | |||
| 2014 | 2602009724 | |||
| 2015 | 2606073558 | |||
| 2016 | 2606126798 | |||
| 2017 | 2621298058 | |||
| 2018 | 2624482056 | |||
| 2019 | 2624490859 | |||
| 2020 | 2643845096 | |||
| 2021 | 2643871788 | |||
| 2022 | 2643956622 | |||
| 2023 | 2644025335 | |||
| 2024 | 2644286231 | |||
| 2025 | 2644624289 | |||
| 2026 | 2652546047 | |||
| 2027 | 2671093045 | |||
| 2028 | 2671098698 | |||
| 2029 | 2671129072 | |||
| 2030 | 2671768594 | |||
| 2031 | 2677900198 | |||
| 2032 | 2678264470 | |||
| 2033 | 2715751366 | |||
| 2034 | 2715758357 | |||
| 2035 | 2718635298 | |||
| 2036 | 2723250165 | |||
| 2037 | 2738675188 | |||
| 2038 | 2738753592 | |||
| 2039 | 2738812075 | |||
| 2040 | 2738862581 | |||
| 2041 | 2738899435 | |||
| 2042 | 2739197041 | |||
| 2043 | 2739259110 | |||
| 2044 | 2739264380 | |||
| 2045 | 2739293502 | |||
| 2046 | 2743736395 | |||
| 2047 | 2745004924 | |||
| 2048 | 2774132994 | |||
| 2049 | 2784317933 | |||
| 2050 | 2794595941 | |||
| 2051 | 2807455696 | |||
| 2052 | 2808924240 | |||
| 2053 | 2808929852 | |||
| 2054 | 2808936997 | |||
| 2055 | 2808946375 | |||
| 2056 | 2808952073 | |||
| 2057 | 2808957202 | |||
| 2058 | 2808965307 | |||
| 2059 | 2808980764 | |||
| 2060 | 2808996437 | |||
| 2061 | 2809000205 | |||
| 2062 | 2809218980 | |||
| 2063 | 2812371315 | |||
| 2064 | 2817492802 | |||
| 2065 | 2819655794 | |||
| 2066 | 2819703819 | |||
| 2067 | 2823424427 | |||
| 2068 | 2825656587 | |||
| 2069 | 2826583630 | |||
| 2070 | 2834031593 | |||
| 2071 | 2842818126 | |||
| 2072 | 2842827386 | |||
| 2073 | 2842836658 | |||
| 2074 | 2842843065 | |||
| 2075 | 2842844774 | |||
| 2076 | 2842849239 | |||
| 2077 | 2842859279 | |||
| 2078 | 2844669281 | |||
| 2079 | 2852612828 | |||
| 2080 | 2852661384 | |||
| 2081 | 2852669437 | |||
| 2082 | 2860871891 | |||
| 2083 | 2878034037 | |||
| 2084 | 2880234662 | |||
| 2085 | 2904521204 | |||
| 2086 | 2904555233 | |||
| 2087 | 2908451341 | |||
| 2088 | 2912967519 | |||
| 2089 | 2913040948 | |||
| 2090 | 2917072555 | |||
| 2091 | 2919069341 | |||
| 2092 | 2919157354 | |||
| 2093 | 2919388137 | |||
| 2094 | 2919486295 | |||
| 2095 | 2919489676 | |||
| 2096 | 2919504154 | |||
| 2097 | 2919703285 | |||
| 2098 | 2923155409 | |||
| 2099 | 2923525428 | |||
| 2100 | 2923589984 | |||
| 2101 | 2926065273 | |||
| 2102 | 2929148446 | |||
| 2103 | 2929193970 | |||
| 2104 | 2931374138 | |||
| 2105 | 2931395262 | |||
| 2106 | 2931396700 | |||
| 2107 | 2935354719 | |||
| 2108 | 2939637499 | |||
| 2109 | 2939653029 | |||
| 2110 | 2945932058 | |||
| 2111 | 2946008172 | |||
| 2112 | 2946032464 | |||
| 2113 | 2947239273 | |||
| 2114 | 2969308817 | |||
| 2115 | 2974289806 | |||
| 2116 | 2988730047 | |||
| 2117 | 2998144120 | |||
| 2118 | 3007253136 | |||
| 2119 | 3007424367 | |||
| 2120 | 3007619614 | |||
| 2121 | 3007719045 | |||
| 2122 | 3007858897 | |||
| 2123 | 3007865550 | |||
| 2124 | 637319139 | |||
| 2125 | 8011355530 | |||
| 2126 | 8015689630 | |||
| 2127 | 8019772724 | |||
| 2128 | 8019779414 | |||
| 2129 | 8029996761 | |||
| 2130 | 8034967022 | |||
| 2131 | 8054289522 | |||
| 2132 | 8054349105 | |||
| 2133 | 8054507765 | |||
| 2134 | 8054931083 | |||
| 2135 | 8055772766 | |||
| 2136 | 8055822702 | |||
| 2137 | 8056117829 | |||
| 2138 | 8056124490 | |||
| 2139 | 8056130391 | |||
| 2140 | 8056136153 | |||
| 2141 | 8056139032 | |||
| 2142 | 8056144925 | |||
| 2143 | 8056150031 | |||
| 2144 | 8056155167 | |||
| 2145 | 8056162410 | |||
| 2146 | 8056167164 | |||
| 2147 | 8056173133 | |||
| 2148 | 8056180119 | |||
| 2149 | 8056572858 | |||
| 2150 | 8057799187 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2r1f-assembly1.cif.gz_A | crystal structure of predicted aminodeoxychorismate lyase from escherichia coli | 0.9264 | 82 | 339 |
| 2r1f-assembly1.cif.gz_A | crystal structure of predicted aminodeoxychorismate lyase from escherichia coli | 0.9162 | 82 | 339 |
| 4iiw-assembly1.cif.gz_A-5 | 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes | 0.6169 | 37 | 325 |
| 4iiw-assembly1.cif.gz_B | 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes | 0.6034 | 39 | 326 |
| 4iiw-assembly1.cif.gz_A-5 | 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes | 0.5871 | 37 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2r1fA03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.8736 | 303 | 339 | 3.30.160.60 |
| 2r1fB03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.8675 | 303 | 339 | 3.30.160.60 |
| 2r1fA03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.8149 | 303 | 339 | 3.30.160.60 |
| 2r1fB03 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.8097 | 303 | 339 | 3.30.160.60 |
| 4iiwB01 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Endolytic murein transglycosylase | 0.8076 | 39 | 109 | 3.30.1490.480 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7QM62-F1-model_v4 | deleted | 0.9797 | 1 | 272 |
|
| AF-A0A2R7QM62-F1-model_v4 | deleted | 0.9726 | 1 | 272 |
|
| AF-A0A6L7KY20-F1-model_v4 | deleted | 0.9585 | 109 | 335 |
|
| AF-A0A655Q7T4-F1-model_v4 | deleted | 0.9561 | 109 | 337 |
|
| AF-A0A655ZJ18-F1-model_v4 | deleted | 0.9517 | 94 | 337 |
|