F489575

General Info

Members Datasets Scaffolds Average Seq Length
1076 510 2154 395

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10013544|Ga0055531_100135443
Length 428
Sequence MKRDEGEGRSAHCATEAPRKAPNAGRASMHPMSKPSTNLIHHPYVPPATFAAPQPGVFKASTVFFADVAAMRARDWRTKAGYTYGLHGTPTTFTLEERLATLEGGTECLLVPSGLAAISLVSFAFLKTGDEVLIPDNAYGPNKALATGELANFGVTHRLYDAMNPADLAAKLSERTRLVWLEAAGSVTMEFPDLPALASICRARGVMTVLDNTWGAGLAFAPFDFNGSGQGVDISVHALTKYPSGGGDVLMGSVTTRDERLHRALKLTHMRMGFGIGVGDVETLLRSLPSIALRYAAHDRAARELAGWLNGCEEIAQVLHPALEDSPGHTHWRALCGETNLAAGLFSVVFDERYSTEQVDRFCDSLQLFRLGYSWGGPISLVVPYDIGLMRDASVARWPYKGTLVRFSIGLEDVEDLRADLQQALARM

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
138 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
146 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
147 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
151 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
217 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
225 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
226 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
227 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
228 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
229 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
230 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
231 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
261 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
262 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
265 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
266 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
267 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
268 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
269 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
270 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
271 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
272 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
273 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
274 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
275 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
276 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
277 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
280 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
281 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
286 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
287 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
288 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
289 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
300 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
301 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
304 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
321 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
322 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
323 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
324 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
325 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
326 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
327 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
330 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
333 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
336 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
337 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
340 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
341 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
342 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
343 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
344 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
345 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
346 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
347 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
348 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
349 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
350 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
351 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
352 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
353 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
354 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
355 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
356 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
357 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
360 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
363 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
364 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
365 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
366 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
367 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
370 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
371 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
381 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
385 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
386 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
393 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
394 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
395 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
396 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
399 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
409 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
410 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
411 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
412 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
413 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
414 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
415 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
416 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
417 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
418 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
419 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
420 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
421 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
422 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
423 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
424 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
425 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
426 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
427 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
430 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
431 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
432 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
434 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
435 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
436 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
437 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
438 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
439 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
440 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
441 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
442 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
443 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
444 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
445 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
446 2643221556 Massilia sp. Root1485 Isolate Unclassified
447 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
448 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
449 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
450 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
451 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
452 2643221658 Variovorax sp. Root411 Isolate Unclassified
453 2643221660 Methylibium sp. Root1272 Isolate Unclassified
454 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
455 2643221672 Variovorax sp. Root434 Isolate Unclassified
456 2643221683 Variovorax sp. Root473 Isolate Unclassified
457 2643221684 Massilia sp. Root133 Isolate Unclassified
458 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
459 2738541277 Variovorax sp. GV051 Isolate Unclassified
460 2738541307 Variovorax sp. GV008 Isolate Unclassified
461 2738543013 Variovorax sp. BT01 Isolate Unclassified
462 2738543019 Variovorax sp. GV040 Isolate Unclassified
463 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
464 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
465 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
466 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
467 2818991436 Collimonas arenae 515 Isolate Unclassified
468 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
469 2818991446 Variovorax sp. 1180 Isolate Unclassified
470 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
471 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
472 2842677519 Variovorax sp. R-72495 Isolate Unclassified
473 2842733646 Variovorax sp. R-72446 Isolate Unclassified
474 2842747753 Variovorax sp. R-72060 Isolate Unclassified
475 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
476 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
477 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
478 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
479 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
480 2885198086 Variovorax sp. 679 Isolate Unclassified
481 2885211737 Variovorax sp. 553 Isolate Unclassified
482 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
483 2899924645 Variovorax sp. 369 Isolate Unclassified
484 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
485 2904456579 Variovorax sp. 2002 Isolate Unclassified
486 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
487 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
488 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
489 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
490 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
491 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
492 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
493 2928037797 Variovorax sp. 1126 Isolate Unclassified
494 2928044640 Variovorax sp. 1128 Isolate Unclassified
495 2928051484 Variovorax sp. 1133 Isolate Unclassified
496 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
497 2928070936 Variovorax gossypii 1167 Isolate Unclassified
498 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
499 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
500 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
501 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
502 2929520902 Variovorax beijingensis 502 Isolate Unclassified
503 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
504 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
505 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
506 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
507 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
508 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
509 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
510 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.57
Metatranscriptomes 0.28
Isolates 7.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 23.98
Nodule 0.46
Rhizoplane 2.23
Rhizosphere 61.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10013544 3300003794 Bacteria 3751
2 JGI24740J21852_10001948 3300001979 Bacteria 9448
3 JGI24740J21852_10030573 3300001979 Bacteria 1749
4 JGI25155J39150_1000002 3300002704 Bacteria 292156
5 JGI25155J39150_1000691 3300002704 Bacteria 6256
6 JGI25156J39149_1000003 3300002705 Bacteria 305434
7 JGI25156J39149_1000114 3300002705 Bacteria 57756
8 JGI25156J39149_1000892 3300002705 Bacteria 14717
9 JGI25156J39149_1006515 3300002705 Bacteria 3179
10 JGI25154J39366_1000009 3300002738 Bacteria 305408
11 JGI25154J39366_1000411 3300002738 Bacteria 23133
12 JGI25154J39366_1001903 3300002738 Bacteria 6318
13 JGI25158J39367_1010631 3300002739 Bacteria 1240
14 JGI25157J39369_1000002 3300002741 Bacteria 305434
15 JGI25157J39369_1000015 3300002741 Bacteria 194042
16 JGI25157J39369_1000382 3300002741 Bacteria 30479
17 JGI25152J39213_1003863 3300002773 Bacteria 4932
18 JGI25152J39213_1004531 3300002773 Bacteria 4345
19 JGI25152J39213_1005460 3300002773 Bacteria 3701
20 JGI25150J39212_1000565 3300002774 Bacteria 14789
21 JGI25150J39212_1000739 3300002774 Bacteria 11582
22 JGI25150J39212_1001528 3300002774 Bacteria 6363
23 JGI25150J39212_1004000 3300002774 Bacteria 3353
24 JGI25150J39212_1009619 3300002774 Bacteria 1830
25 JGI25159J45721_1002000 3300002987 Bacteria 8098
26 JGI25159J45721_1002011 3300002987 Bacteria 8068
27 JGI25159J45721_1003775 3300002987 Bacteria 5225
28 JGI25159J45721_1005761 3300002987 Bacteria 3833
29 JGI25151J46595_10000913 3300003187 Bacteria 23081
30 JGI25151J46595_10007569 3300003187 Bacteria 5307
31 JGI25151J46595_10012667 3300003187 Bacteria 3827
32 JGI25151J46595_10013335 3300003187 Bacteria 3701
33 JGI25153J46596_10001949 3300003215 Bacteria 12229
34 JGI25153J46596_10004931 3300003215 Bacteria 7091
35 JGI25153J46596_10008323 3300003215 Bacteria 4977
36 JGI25153J46596_10012325 3300003215 Bacteria 3701
37 rootH1_10005490 3300003316 Bacteria 4486
38 rootH1_10005490 3300003323 Bacteria 4253
39 rootH1_10028592 3300003316 Bacteria 2016
40 rootH1_10028592 3300003323 Bacteria 35557
41 rootH1_10066715 3300003316 Bacteria 2940
42 rootH2_10021047 3300003320 Bacteria 1998
43 rootL2_10024592 3300003322 Bacteria 3297
44 rootL2_10059824 3300003322 Bacteria 3378
45 rootL2_10151440 3300003322 Bacteria 3857
46 rootL2_10151441 3300003322 Bacteria 3623
47 rootH1_10082267 3300003323 Bacteria 1826
48 rootH1_10127265 3300003323 Bacteria 1753
49 JGI25160J50197_1000305 3300003354 Bacteria 34747
50 JGI25160J50197_1009151 3300003354 Bacteria 3701
51 JGI25160J50197_1009161 3300003354 Bacteria 3698
52 JGI25161J50226_1000018 3300003374 Bacteria 172599
53 JGI25161J50226_1001955 3300003374 Bacteria 5670
54 JGI25161J50226_1002370 3300003374 Bacteria 4861
55 Ga0006562J51391_1079656 3300003578 Bacteria 7750
56 Ga0032354_1026629 3300003693 Bacteria 3261
57 Ga0055539_1000170 3300003752 Bacteria 57928
58 Ga0055533_1000010 3300003756 Bacteria 491196
59 Ga0055532_1000050 3300003758 Bacteria 169240
60 Ga0055525_1000025 3300003759 Bacteria 347582
61 Ga0055535_1000272 3300003761 Bacteria 54297
62 Ga0055535_1001094 3300003761 Bacteria 16519
63 Ga0055542_1000027 3300003762 Bacteria 254819
64 Ga0055529_1000303 3300003763 Bacteria 56663
65 Ga0055526_1003334 3300003771 Bacteria 10266
66 Ga0055526_1007206 3300003771 Bacteria 5840
67 Ga0055526_1009048 3300003771 Bacteria 4859
68 Ga0055526_1010409 3300003771 Bacteria 4329
69 Ga0055537_1000008 3300003773 Bacteria 142572
70 Ga0055537_1001609 3300003773 Bacteria 8505
71 Ga0055537_1004710 3300003773 Bacteria 3833
72 Ga0055537_1008970 3300003773 Bacteria 2252
73 Ga0055524_1000083 3300003775 Bacteria 119259
74 Ga0055524_1008285 3300003775 Bacteria 4329
75 Ga0055524_1008318 3300003775 Bacteria 4320
76 Ga0055536_1001279 3300003781 Bacteria 15502
77 Ga0055536_1003548 3300003781 Bacteria 8348
78 Ga0055536_1008349 3300003781 Bacteria 4469
79 Ga0055536_1009960 3300003781 Bacteria 3846
80 Ga0055536_1017236 3300003781 Bacteria 2374
81 Ga0055534_1001020 3300003784 Bacteria 12310
82 Ga0055534_1001670 3300003784 Bacteria 8513
83 Ga0055534_1002378 3300003784 Bacteria 6554
84 Ga0055534_1004960 3300003784 Bacteria 3701
85 Ga0055534_1007216 3300003784 Bacteria 2686
86 Ga0055528_1000803 3300003790 Bacteria 21689
87 Ga0055528_1003113 3300003790 Bacteria 8513
88 Ga0055528_1008869 3300003790 Bacteria 4256
89 Ga0055528_1019437 3300003790 Bacteria 2252
90 Ga0055530_10000211 3300003791 Bacteria 52600
91 Ga0055530_10001348 3300003791 Bacteria 18336
92 Ga0055540_1000012 3300003792 Bacteria 262667
93 Ga0055540_1002608 3300003792 Bacteria 9384
94 Ga0055540_1003019 3300003792 Bacteria 8415
95 Ga0055540_1007006 3300003792 Bacteria 4348
96 Ga0055540_1012261 3300003792 Bacteria 2703
97 Ga0055531_10001052 3300003794 Bacteria 21756
98 Ga0055531_10003480 3300003794 Bacteria 10014
99 Ga0055531_10006241 3300003794 Bacteria 6804
100 Ga0055541_1000819 3300003841 Bacteria 7654
101 Ga0058692_1000048 3300003856 Bacteria 110906
102 Ga0055543_1000542 3300004625 Bacteria 21255
103 Ga0055543_1002593 3300004625 Bacteria 5850
104 Ga0055543_1004978 3300004625 Bacteria 3478
105 Ga0065165_1009407 3300005262 Bacteria 4385
106 Ga0065165_1013299 3300005262 Bacteria 3283
107 Ga0065165_1013384 3300005262 Bacteria 3265
108 Ga0065165_1018335 3300005262 Bacteria 2536
109 Ga0065703_1000509 3300005272 Bacteria 21018
110 Ga0065714_10069896 3300005288 Bacteria 4044
111 Ga0065704_10121033 3300005289 Bacteria 1772
112 Ga0065707_10087372 3300005295 Bacteria 5054
113 Ga0070658_10018493 3300005327 Bacteria 5579
114 Ga0070658_10038314 3300005327 Bacteria 3866
115 Ga0070658_10040315 3300005327 Bacteria 3767
116 Ga0070658_10171620 3300005327 Bacteria 1822
117 Ga0070676_10015051 3300005328 Bacteria 4261
118 Ga0070670_100033286 3300005331 Bacteria 4439
119 Ga0070670_100039435 3300005331 Bacteria 4061
120 Ga0068869_100010918 3300005334 Bacteria 5943
121 Ga0068869_100130324 3300005334 Bacteria 1932
122 Ga0070666_10027485 3300005335 Bacteria 3726
123 Ga0070680_100020784 3300005336 Bacteria 5208
124 Ga0070680_100059021 3300005336 Bacteria 3138
125 Ga0068868_100031542 3300005338 Bacteria 4072
126 Ga0068868_100045313 3300005338 Bacteria 3440
127 Ga0068868_100096815 3300005338 Bacteria 2384
128 Ga0070660_100025701 3300005339 Bacteria 4378
129 Ga0070660_100030405 3300005339 Bacteria 4052
130 Ga0070660_100068993 3300005339 Bacteria 2756
131 Ga0070687_100019322 3300005343 Bacteria 3168
132 Ga0070661_100079125 3300005344 Bacteria 2425
133 Ga0070668_100026977 3300005347 Bacteria 4360
134 Ga0070669_100000505 3300005353 Bacteria 29404
135 Ga0070669_100026320 3300005353 Bacteria 4185
136 Ga0070669_100049534 3300005353 Bacteria 3066
137 Ga0070675_100037029 3300005354 Bacteria 3972
138 Ga0070675_100197203 3300005354 Bacteria 1746
139 Ga0070671_100010843 3300005355 Bacteria 7312
140 Ga0070671_100193314 3300005355 Bacteria 1725
141 Ga0070674_100105629 3300005356 Bacteria 2059
142 Ga0070674_100242453 3300005356 Bacteria 1412
143 Ga0070673_100013275 3300005364 Bacteria 5690
144 Ga0070673_100157786 3300005364 Bacteria 1927
145 Ga0070659_100030067 3300005366 Bacteria 4202
146 Ga0070659_100041871 3300005366 Bacteria 3581
147 Ga0070667_100014015 3300005367 Bacteria 6626
148 Ga0070667_100069592 3300005367 Bacteria 2995
149 Ga0070700_100033487 3300005441 Bacteria 3095
150 Ga0070708_100226695 3300005445 Bacteria 1753
151 Ga0070708_100402903 3300005445 Bacteria 1290
152 Ga0070663_100001487 3300005455 Bacteria 12886
153 Ga0070678_100056477 3300005456 Bacteria 2871
154 Ga0070678_100062218 3300005456 Bacteria 2755
155 Ga0070678_100304656 3300005456 Bacteria 1355
156 Ga0070662_100002137 3300005457 Bacteria 12120
157 Ga0070662_100062258 3300005457 Bacteria 2726
158 Ga0070662_100064353 3300005457 Bacteria 2685
159 Ga0070662_100074332 3300005457 Bacteria 2514
160 Ga0070662_100121964 3300005457 Bacteria 1999
161 Ga0068867_100000068 3300005459 Bacteria 62945
162 Ga0068867_100002788 3300005459 Bacteria 12291
163 Ga0068867_100080469 3300005459 Bacteria 2453
164 Ga0070706_100000546 3300005467 Bacteria 43742
165 Ga0070707_100020993 3300005468 Bacteria 6166
166 Ga0070698_100056391 3300005471 Bacteria 3982
167 Ga0070699_100157087 3300005518 Bacteria 2012
168 Ga0070679_100016791 3300005530 Bacteria 7074
169 Ga0070679_100092470 3300005530 Bacteria 3012
170 Ga0068853_100006411 3300005539 Bacteria 9350
171 Ga0068853_100135846 3300005539 Bacteria 2204
172 Ga0068853_100290528 3300005539 Bacteria 1509
173 Ga0068853_100298045 3300005539 Bacteria 1490
174 Ga0070672_100031212 3300005543 Bacteria 4009
175 Ga0070672_100046346 3300005543 Bacteria 3368
176 Ga0070672_100052964 3300005543 Bacteria 3171
177 Ga0070672_100058235 3300005543 Bacteria 3035
178 Ga0070686_100123044 3300005544 Bacteria 1784
179 Ga0070665_100057573 3300005548 Bacteria 3896
180 Ga0070665_100305252 3300005548 Bacteria 1595
181 Ga0068855_100016796 3300005563 Bacteria 8800
182 Ga0068855_100054224 3300005563 Bacteria 4712
183 Ga0068855_100078830 3300005563 Bacteria 3821
184 Ga0068855_100093120 3300005563 Bacteria 3475
185 Ga0070664_100034408 3300005564 Bacteria 4250
186 Ga0070664_100073880 3300005564 Bacteria 2926
187 Ga0068857_100120816 3300005577 Bacteria 2359
188 Ga0068854_100114687 3300005578 Bacteria 2037
189 Ga0068856_100094383 3300005614 Bacteria 2978
190 Ga0068852_100072580 3300005616 Bacteria 3025
191 Ga0068852_100135184 3300005616 Bacteria 2276
192 Ga0068852_100145677 3300005616 Bacteria 2197
193 Ga0068859_100132548 3300005617 Bacteria 2564
194 Ga0068864_100168139 3300005618 Bacteria 1998
195 Ga0068866_10019208 3300005718 Bacteria 3105
196 Ga0068861_100007929 3300005719 Bacteria 7306
197 Ga0068870_10041881 3300005840 Bacteria 2382
198 Ga0068863_100025781 3300005841 Bacteria 5608
199 Ga0068863_100233463 3300005841 Bacteria 1775
200 Ga0068858_100081232 3300005842 Bacteria 3013
201 Ga0068860_100001531 3300005843 Bacteria 24900
202 Ga0068860_100024244 3300005843 Bacteria 5865
203 Ga0068860_100092512 3300005843 Bacteria 2882
204 Ga0068860_100110616 3300005843 Bacteria 2626
205 Ga0068862_100014947 3300005844 Bacteria 6448
206 Ga0068862_100173655 3300005844 Bacteria 1930
207 Ga0068862_100177323 3300005844 Bacteria 1911
208 Ga0075365_10001836 3300006038 Bacteria 9950
209 Ga0075365_10008898 3300006038 Bacteria 5731
210 Ga0075368_10040997 3300006042 Bacteria 1818
211 Ga0075363_100001597 3300006048 Bacteria 8718
212 Ga0075363_100005158 3300006048 Bacteria 5781
213 Ga0075364_10013716 3300006051 Bacteria 4991
214 Ga0075432_10000616 3300006058 Bacteria 10821
215 Ga0075432_10015499 3300006058 Bacteria 2600
216 Ga0075362_10009027 3300006177 Bacteria 3838
217 Ga0075366_10006250 3300006195 Bacteria 6512
218 Ga0075366_10019182 3300006195 Bacteria 3953
219 Ga0075366_10032602 3300006195 Bacteria 3067
220 Ga0075366_10039702 3300006195 Bacteria 2781
221 Ga0075366_10052693 3300006195 Bacteria 2417
222 Ga0075366_10138517 3300006195 Bacteria 1470
223 Ga0097621_100182539 3300006237 Bacteria 1813
224 Ga0075370_10000587 3300006353 Bacteria 14051
225 Ga0075370_10001047 3300006353 Bacteria 11498
226 Ga0075370_10001173 3300006353 Bacteria 11030
227 Ga0075370_10006112 3300006353 Bacteria 6038
228 Ga0075370_10007691 3300006353 Bacteria 5502
229 Ga0075370_10008959 3300006353 Bacteria 5174
230 Ga0075370_10024844 3300006353 Bacteria 3312
231 Ga0075370_10035531 3300006353 Bacteria 2797
232 Ga0068871_100099219 3300006358 Bacteria 2437
233 Ga0068871_100112165 3300006358 Bacteria 2294
234 Ga0075429_100001338 3300006880 Bacteria 20124
235 Ga0068865_100021324 3300006881 Bacteria 4211
236 Ga0097620_100132552 3300006931 Bacteria 2564
237 Ga0099826_10004770 3300006948 Bacteria 9573
238 Ga0105251_10020910 3300009011 Bacteria 3429
239 Ga0105244_10013824 3300009036 Bacteria 4696
240 Ga0105244_10014112 3300009036 Bacteria 4634
241 Ga0105244_10042806 3300009036 Bacteria 2339
242 Ga0105244_10103317 3300009036 Bacteria 1392
243 Ga0105240_10009231 3300009093 Bacteria 13992
244 Ga0105240_10010696 3300009093 Bacteria 12874
245 Ga0105240_10021627 3300009093 Bacteria 8555
246 Ga0105240_10502748 3300009093 Bacteria 1347
247 Ga0105247_10000594 3300009101 Bacteria 29366
248 Ga0105247_10009842 3300009101 Bacteria 5794
249 Ga0105243_10001337 3300009148 Bacteria 21977
250 Ga0105243_10001406 3300009148 Bacteria 21287
251 Ga0105243_10001511 3300009148 Bacteria 20313
252 Ga0105243_10005195 3300009148 Bacteria 10188
253 Ga0105243_10113599 3300009148 Bacteria 2271
254 Ga0105243_10130169 3300009148 Bacteria 2134
255 Ga0105241_10007529 3300009174 Bacteria 8008
256 Ga0105241_10015401 3300009174 Bacteria 5600
257 Ga0105242_10049900 3300009176 Bacteria 3407
258 Ga0105242_10171471 3300009176 Bacteria 1907
259 Ga0105248_10055655 3300009177 Bacteria 4438
260 Ga0105248_10228257 3300009177 Bacteria 2096
261 Ga0105248_10228943 3300009177 Bacteria 2092
262 Ga0105248_10274930 3300009177 Bacteria 1896
263 Ga0105248_10377590 3300009177 Bacteria 1596
264 Ga0105237_10007228 3300009545 Bacteria 12184
265 Ga0105238_10152057 3300009551 Bacteria 2290
266 Ga0105249_10001295 3300009553 Bacteria 21902
267 Ga0105249_10178571 3300009553 Bacteria 2064
268 Ga0105239_10008196 3300010375 Bacteria 11921
269 Ga0105239_10028770 3300010375 Bacteria 6111
270 Ga0105239_10326941 3300010375 Bacteria 1729
271 Ga0157326_1003845 3300012513 Bacteria 1577
272 Ga0157373_10028793 3300013100 Bacteria 4006
273 Ga0157373_10053200 3300013100 Bacteria 2879
274 Ga0157371_10000026 3300013102 Bacteria 274703
275 Ga0157371_10003698 3300013102 Bacteria 13731
276 Ga0157371_10038683 3300013102 Bacteria 3412
277 Ga0157370_10024246 3300013104 Bacteria 6010
278 Ga0157369_10012180 3300013105 Bacteria 9761
279 Ga0157374_10029219 3300013296 Bacteria 4988
280 Ga0157378_10003676 3300013297 Bacteria 13606
281 Ga0157378_10121800 3300013297 Bacteria 2405
282 Ga0163162_10000997 3300013306 Bacteria 26311
283 Ga0163162_10037247 3300013306 Bacteria 4853
284 Ga0157375_10027584 3300013308 Bacteria 5309
285 Ga0157375_10057010 3300013308 Bacteria 3860
286 Ga0157375_10324453 3300013308 Bacteria 1704
287 Ga0157375_10420560 3300013308 Bacteria 1502
288 Ga0182008_10000838 3300014497 Bacteria 21458
289 Ga0182008_10005897 3300014497 Bacteria 6922
290 Ga0182008_10007674 3300014497 Bacteria 5946
291 Ga0182008_10034289 3300014497 Bacteria 2545
292 Ga0182008_10041559 3300014497 Bacteria 2293
293 Ga0157377_10000082 3300014745 Bacteria 74078
294 Ga0157379_10034173 3300014968 Bacteria 4532
295 Ga0157376_10003154 3300014969 Bacteria 11324
296 Ga0157376_10191638 3300014969 Bacteria 1875
297 Ga0182006_1001492 3300015261 Bacteria 14052
298 Ga0182007_10001563 3300015262 Bacteria 12216
299 Ga0182007_10001757 3300015262 Bacteria 11382
300 Ga0182007_10004781 3300015262 Bacteria 6086
301 Ga0182007_10010798 3300015262 Bacteria 3588
302 Ga0182005_1005148 3300015265 Bacteria 4114
303 Ga0183362_10001 3300015683 Bacteria 2046624
304 Ga0163161_10000065 3300017792 Bacteria 108321
305 Ga0163161_10012915 3300017792 Bacteria 5803
306 Ga0163161_10032482 3300017792 Bacteria 3727
307 Ga0163161_10049481 3300017792 Bacteria 3038
308 Ga0213872_10000160 3300021361 Bacteria 61551
309 Ga0213872_10002596 3300021361 Bacteria 10511
310 Ga0213872_10045361 3300021361 Bacteria 2000
311 Ga0213872_10066727 3300021361 Bacteria 1624
312 Ga0209435_100001 3300025206 Bacteria 1424171
313 Ga0209435_100029 3300025206 Bacteria 176358
314 Ga0209436_105483 3300025208 Bacteria 2912
315 Ga0209436_108819 3300025208 Bacteria 1971
316 Ga0209674_100003 3300025226 Bacteria 2196646
317 Ga0209672_100563 3300025228 Bacteria 19696
318 Ga0209147_100004 3300025229 Bacteria 1371850
319 Ga0209563_100003 3300025230 Bacteria 1932942
320 Ga0209563_100010 3300025230 Bacteria 1337457
321 Ga0207427_100468 3300025231 Bacteria 22112
322 Ga0209258_100048 3300025242 Bacteria 365881
323 Ga0209258_100163 3300025242 Bacteria 149677
324 Ga0209258_100903 3300025242 Bacteria 15270
325 Ga0207425_1000204 3300025245 Bacteria 47226
326 Ga0207425_1000275 3300025245 Bacteria 37897
327 Ga0207425_1001012 3300025245 Bacteria 13169
328 Ga0207425_1003668 3300025245 Bacteria 4835
329 Ga0207425_1005152 3300025245 Bacteria 3773
330 Ga0209646_1000001 3300025246 Bacteria 3092932
331 Ga0209646_1000109 3300025246 Bacteria 158348
332 Ga0209646_1000226 3300025246 Bacteria 60008
333 Ga0209026_1000003 3300025250 Bacteria 1060571
334 Ga0209026_1000021 3300025250 Bacteria 375165
335 Ga0209026_1000467 3300025250 Bacteria 31163
336 Ga0209677_100106 3300025253 Bacteria 89125
337 Ga0209677_100480 3300025253 Bacteria 22721
338 Ga0209677_103060 3300025253 Bacteria 5715
339 Ga0209677_106594 3300025253 Bacteria 2709
340 Ga0209148_1000040 3300025254 Bacteria 473531
341 Ga0209148_1000811 3300025254 Bacteria 22634
342 Ga0209148_1004695 3300025254 Bacteria 3294
343 Ga0209759_1000001 3300025256 Bacteria 2799452
344 Ga0209759_1000025 3300025256 Bacteria 317082
345 Ga0209759_1000698 3300025256 Bacteria 30092
346 Ga0209759_1000939 3300025256 Bacteria 20977
347 Ga0209759_1011786 3300025256 Bacteria 2462
348 Ga0209129_1000007 3300025258 Bacteria 771325
349 Ga0209129_1000025 3300025258 Bacteria 413639
350 Ga0209129_1001079 3300025258 Bacteria 16032
351 Ga0209129_1004771 3300025258 Bacteria 5128
352 Ga0209129_1011044 3300025258 Bacteria 2191
353 Ga0209565_1000004 3300025263 Bacteria 983150
354 Ga0209565_1000105 3300025263 Bacteria 122895
355 Ga0209565_1000153 3300025263 Bacteria 92909
356 Ga0209565_1000974 3300025263 Bacteria 14824
357 Ga0209565_1002008 3300025263 Bacteria 7887
358 Ga0209455_1000059 3300025272 Bacteria 339995
359 Ga0209673_1000074 3300025273 Bacteria 233552
360 Ga0209673_1000794 3300025273 Bacteria 42072
361 Ga0209673_1001641 3300025273 Bacteria 19354
362 Ga0209673_1001648 3300025273 Bacteria 19319
363 Ga0209673_1002152 3300025273 Bacteria 14596
364 Ga0209130_1000050 3300025284 Bacteria 222092
365 Ga0209130_1000172 3300025284 Bacteria 93199
366 Ga0209130_1000329 3300025284 Bacteria 54511
367 Ga0209130_1000584 3300025284 Bacteria 35499
368 Ga0209130_1001746 3300025284 Bacteria 12941
369 Ga0209675_1000044 3300025291 Bacteria 230392
370 Ga0209675_1000150 3300025291 Bacteria 92909
371 Ga0209675_1001275 3300025291 Bacteria 15058
372 Ga0209675_1001400 3300025291 Bacteria 13998
373 Ga0209675_1001905 3300025291 Bacteria 11256
374 Ga0209675_1003456 3300025291 Bacteria 7502
375 Ga0209676_1000004 3300025292 Bacteria 1138360
376 Ga0209676_1000029 3300025292 Bacteria 520536
377 Ga0209676_1001207 3300025292 Bacteria 27585
378 Ga0209676_1001472 3300025292 Bacteria 21882
379 Ga0209676_1002733 3300025292 Bacteria 11845
380 Ga0209676_1002909 3300025292 Bacteria 11198
381 Ga0209676_1010857 3300025292 Bacteria 3739
382 Ga0209025_1000111 3300025294 Bacteria 218982
383 Ga0209025_1000217 3300025294 Bacteria 137909
384 Ga0209025_1000624 3300025294 Bacteria 62814
385 Ga0209025_1001851 3300025294 Bacteria 24838
386 Ga0209025_1003136 3300025294 Bacteria 16165
387 Ga0209025_1033805 3300025294 Bacteria 2353
388 Ga0209025_1052123 3300025294 Bacteria 1618
389 Ga0209564_1000039 3300025295 Bacteria 413604
390 Ga0209564_1000153 3300025295 Bacteria 166910
391 Ga0209564_1000337 3300025295 Bacteria 90545
392 Ga0209564_1000470 3300025295 Bacteria 67507
393 Ga0209564_1002160 3300025295 Bacteria 16575
394 Ga0209564_1029015 3300025295 Bacteria 1751
395 Ga0209758_1000025 3300025297 Bacteria 586687
396 Ga0209758_1000163 3300025297 Bacteria 151988
397 Ga0209758_1000287 3300025297 Bacteria 99234
398 Ga0209758_1003748 3300025297 Bacteria 13455
399 Ga0209758_1007561 3300025297 Bacteria 7346
400 Ga0209050_1000002 3300025298 Bacteria 1792849
401 Ga0209050_1000003 3300025298 Bacteria 1609245
402 Ga0209050_1000325 3300025298 Bacteria 95686
403 Ga0209050_1000412 3300025298 Bacteria 79647
404 Ga0209050_1004195 3300025298 Bacteria 9969
405 Ga0209050_1004259 3300025298 Bacteria 9827
406 Ga0209050_1005909 3300025298 Bacteria 7472
407 Ga0209050_1013114 3300025298 Bacteria 3720
408 Ga0209050_1030822 3300025298 Bacteria 1685
409 Ga0209256_1000001 3300025299 Bacteria 2166974
410 Ga0209256_1000425 3300025299 Bacteria 66308
411 Ga0209256_1001308 3300025299 Bacteria 26755
412 Ga0207426_1000001 3300025302 Bacteria 1341301
413 Ga0207426_1000028 3300025302 Bacteria 483955
414 Ga0207426_1000071 3300025302 Bacteria 329539
415 Ga0207426_1000692 3300025302 Bacteria 40473
416 Ga0209051_1000002 3300025303 Bacteria 1631846
417 Ga0209051_1000003 3300025303 Bacteria 1609245
418 Ga0209051_1000150 3300025303 Bacteria 132005
419 Ga0209051_1000268 3300025303 Bacteria 87155
420 Ga0209051_1002642 3300025303 Bacteria 12547
421 Ga0209051_1003236 3300025303 Bacteria 10831
422 Ga0209051_1005495 3300025303 Bacteria 7392
423 Ga0209051_1010554 3300025303 Bacteria 4648
424 Ga0209257_1000002 3300025304 Bacteria 1767052
425 Ga0209257_1000012 3300025304 Bacteria 1111138
426 Ga0209257_1000018 3300025304 Bacteria 836016
427 Ga0209257_1000275 3300025304 Bacteria 116952
428 Ga0209257_1003064 3300025304 Bacteria 15069
429 Ga0209257_1005491 3300025304 Bacteria 8863
430 Ga0209257_1019944 3300025304 Bacteria 2500
431 Ga0207655_1001363 3300025728 Bacteria 22908
432 Ga0207655_1006525 3300025728 Bacteria 7714
433 Ga0207655_1015011 3300025728 Bacteria 4336
434 Ga0207655_1023715 3300025728 Bacteria 3032
435 Ga0207655_1023716 3300025728 Bacteria 3032
436 Ga0207713_1001071 3300025735 Bacteria 23607
437 Ga0207710_10000101 3300025900 Bacteria 110473
438 Ga0207645_10013979 3300025907 Bacteria 5385
439 Ga0207645_10014211 3300025907 Bacteria 5332
440 Ga0207643_10047783 3300025908 Bacteria 2423
441 Ga0207705_10002959 3300025909 Bacteria 12985
442 Ga0207705_10074242 3300025909 Bacteria 2468
443 Ga0207705_10136840 3300025909 Bacteria 1827
444 Ga0207705_10152743 3300025909 Bacteria 1731
445 Ga0207684_10001739 3300025910 Bacteria 23022
446 Ga0207654_10022538 3300025911 Bacteria 3361
447 Ga0207707_10107137 3300025912 Bacteria 2443
448 Ga0207695_10011560 3300025913 Bacteria 10679
449 Ga0207695_10030297 3300025913 Bacteria 5958
450 Ga0207695_10042490 3300025913 Bacteria 4854
451 Ga0207695_10059896 3300025913 Bacteria 3945
452 Ga0207671_10001984 3300025914 Bacteria 22567
453 Ga0207671_10119321 3300025914 Bacteria 2015
454 Ga0207660_10042800 3300025917 Bacteria 3180
455 Ga0207660_10060346 3300025917 Bacteria 2726
456 Ga0207662_10059590 3300025918 Bacteria 2288
457 Ga0207657_10009739 3300025919 Bacteria 9636
458 Ga0207657_10009825 3300025919 Bacteria 9585
459 Ga0207657_10010523 3300025919 Bacteria 9225
460 Ga0207657_10080655 3300025919 Bacteria 2735
461 Ga0207657_10134212 3300025919 Bacteria 2027
462 Ga0207649_10109335 3300025920 Bacteria 1844
463 Ga0207652_10015197 3300025921 Bacteria 6247
464 Ga0207652_10029783 3300025921 Bacteria 4568
465 Ga0207652_10173747 3300025921 Bacteria 1934
466 Ga0207646_10097052 3300025922 Bacteria 2640
467 Ga0207681_10000574 3300025923 Bacteria 25057
468 Ga0207681_10028233 3300025923 Bacteria 3634
469 Ga0207659_10053796 3300025926 Bacteria 2872
470 Ga0207659_10080380 3300025926 Bacteria 2408
471 Ga0207659_10247898 3300025926 Bacteria 1444
472 Ga0207687_10233512 3300025927 Bacteria 1454
473 Ga0207644_10002692 3300025931 Bacteria 11453
474 Ga0207644_10249281 3300025931 Bacteria 1416
475 Ga0207690_10014813 3300025932 Bacteria 4717
476 Ga0207690_10058414 3300025932 Bacteria 2609
477 Ga0207690_10099836 3300025932 Bacteria 2070
478 Ga0207706_10000870 3300025933 Bacteria 31103
479 Ga0207706_10054396 3300025933 Bacteria 3533
480 Ga0207706_10157795 3300025933 Bacteria 1995
481 Ga0207706_10212156 3300025933 Bacteria 1697
482 Ga0207709_10000016 3300025935 Bacteria 478406
483 Ga0207709_10000708 3300025935 Bacteria 26838
484 Ga0207709_10000935 3300025935 Bacteria 21921
485 Ga0207709_10001525 3300025935 Bacteria 15969
486 Ga0207709_10146834 3300025935 Bacteria 1628
487 Ga0207669_10198134 3300025937 Bacteria 1455
488 Ga0207704_10002077 3300025938 Bacteria 8967
489 Ga0207704_10078247 3300025938 Bacteria 2126
490 Ga0207691_10032616 3300025940 Bacteria 4856
491 Ga0207691_10039953 3300025940 Bacteria 4338
492 Ga0207691_10050244 3300025940 Bacteria 3818
493 Ga0207691_10139534 3300025940 Bacteria 2137
494 Ga0207691_10201782 3300025940 Bacteria 1730
495 Ga0207691_10215654 3300025940 Bacteria 1666
496 Ga0207711_10032486 3300025941 Bacteria 4412
497 Ga0207711_10147324 3300025941 Bacteria 2121
498 Ga0207689_10010345 3300025942 Bacteria 8038
499 Ga0207679_10002869 3300025945 Bacteria 10689
500 Ga0207679_10023704 3300025945 Bacteria 4200
501 Ga0207667_10021039 3300025949 Bacteria 7235
502 Ga0207667_10021230 3300025949 Bacteria 7198
503 Ga0207667_10031970 3300025949 Bacteria 5676
504 Ga0207667_10042317 3300025949 Bacteria 4842
505 Ga0207651_10012132 3300025960 Bacteria 4860
506 Ga0207651_10043131 3300025960 Bacteria 3008
507 Ga0207651_10219706 3300025960 Bacteria 1535
508 Ga0207712_10000551 3300025961 Bacteria 30254
509 Ga0207712_10086714 3300025961 Bacteria 2294
510 Ga0207640_10016500 3300025981 Bacteria 4297
511 Ga0207640_10086743 3300025981 Bacteria 2156
512 Ga0207677_10011035 3300026023 Bacteria 5134
513 Ga0207677_10097689 3300026023 Bacteria 2152
514 Ga0207677_10121761 3300026023 Bacteria 1964
515 Ga0207703_10044201 3300026035 Bacteria 3579
516 Ga0207639_10027119 3300026041 Bacteria 4169
517 Ga0207639_10165375 3300026041 Bacteria 1868
518 Ga0207639_10253920 3300026041 Bacteria 1534
519 Ga0207678_10000695 3300026067 Bacteria 30735
520 Ga0207678_10026748 3300026067 Bacteria 5032
521 Ga0207708_10023165 3300026075 Bacteria 4692
522 Ga0207702_10000777 3300026078 Bacteria 33801
523 Ga0207641_10016728 3300026088 Bacteria 6007
524 Ga0207641_10039534 3300026088 Bacteria 3945
525 Ga0207648_10000942 3300026089 Bacteria 32855
526 Ga0207648_10018717 3300026089 Bacteria 6263
527 Ga0207648_10029808 3300026089 Bacteria 4838
528 Ga0207648_10057254 3300026089 Bacteria 3400
529 Ga0207648_10072233 3300026089 Bacteria 3007
530 Ga0207648_10240105 3300026089 Bacteria 1613
531 Ga0207648_10352833 3300026089 Bacteria 1326
532 Ga0207676_10226500 3300026095 Bacteria 1668
533 Ga0207676_10229631 3300026095 Bacteria 1658
534 Ga0207674_10119637 3300026116 Bacteria 2602
535 Ga0207675_100016211 3300026118 Bacteria 6956
536 Ga0207675_100074804 3300026118 Bacteria 3170
537 Ga0207683_10018876 3300026121 Bacteria 5883
538 Ga0207683_10058740 3300026121 Bacteria 3377
539 Ga0207683_10062093 3300026121 Bacteria 3290
540 Ga0207683_10189828 3300026121 Bacteria 1865
541 Ga0207683_10208442 3300026121 Bacteria 1778
542 Ga0207683_10217150 3300026121 Bacteria 1742
543 Ga0207698_10081964 3300026142 Bacteria 2606
544 Ga0207698_10130412 3300026142 Bacteria 2147
545 Ga0209371_1000024 3300027312 Bacteria 477286
546 Ga0209968_1000143 3300027526 Bacteria 12451
547 Ga0209970_1000316 3300027614 Bacteria 7988
548 Ga0209282_1003855 3300027666 Bacteria 9004
549 Ga0209966_1000207 3300027695 Bacteria 24304
550 Ga0209974_10000633 3300027876 Bacteria 11826
551 Ga0268266_10060787 3300028379 Bacteria 3257
552 Ga0268265_10016091 3300028380 Bacteria 5133
553 Ga0268265_10027322 3300028380 Bacteria 4072
554 Ga0268265_10056711 3300028380 Bacteria 2982
555 Ga0268264_10025605 3300028381 Bacteria 4820
556 Ga0268264_10030263 3300028381 Bacteria 4437
557 Ga0268264_10161478 3300028381 Bacteria 2019
558 Ga0265336_10000051 3300028666 Bacteria 114796
559 Ga0307515_10000176 3300028794 Bacteria 157429
560 Ga0307515_10000208 3300028794 Bacteria 144484
561 Ga0307515_10063698 3300028794 Bacteria 5171
562 Ga0307515_10070475 3300028794 Bacteria 4757
563 Ga0265338_10000886 3300028800 Bacteria 50490
564 Ga0265324_10001963 3300029957 Bacteria 11029
565 Ga0268256_1000026 3300030500 Bacteria 477260
566 Ga0307511_10053635 3300030521 Bacteria 3192
567 Ga0314311_1179254 3300030733 Bacteria 16235
568 Ga0316183_1001985 3300030742 Bacteria 1876
569 Ga0316181_1151309 3300030744 Bacteria 4744
570 Ga0265332_10079524 3300031238 Bacteria 1391
571 Ga0265327_10000293 3300031251 Bacteria 96862
572 Ga0307513_10000014 3300031456 Bacteria 303157
573 Ga0307513_10000019 3300031456 Bacteria 231194
574 Ga0307513_10016405 3300031456 Bacteria 8934
575 Ga0307513_10174396 3300031456 Bacteria 2023
576 Ga0307509_10014457 3300031507 Bacteria 9278
577 Ga0307408_100013762 3300031548 Bacteria 5370
578 Ga0307408_100042391 3300031548 Bacteria 3232
579 Ga0307408_100049207 3300031548 Bacteria 3026
580 Ga0307408_100094446 3300031548 Bacteria 2264
581 Ga0307514_10061998 3300031649 Bacteria 2846
582 Ga0265314_10001602 3300031711 Bacteria 24888
583 Ga0307516_10000038 3300031730 Bacteria 147103
584 Ga0307516_10000991 3300031730 Bacteria 39211
585 Ga0307516_10003242 3300031730 Bacteria 21112
586 Ga0307516_10006162 3300031730 Bacteria 14127
587 Ga0307516_10007930 3300031730 Bacteria 12092
588 Ga0307405_10015874 3300031731 Bacteria 4091
589 Ga0307405_10039134 3300031731 Bacteria 2863
590 Ga0307413_10026530 3300031824 Bacteria 3194
591 Ga0307410_10002488 3300031852 Bacteria 8904
592 Ga0307406_10009219 3300031901 Bacteria 5529
593 Ga0307406_10033616 3300031901 Bacteria 3140
594 Ga0307412_10004172 3300031911 Bacteria 8057
595 Ga0307412_10020309 3300031911 Bacteria 4041
596 Ga0307412_10046994 3300031911 Bacteria 2832
597 Ga0307412_10096528 3300031911 Bacteria 2080
598 Ga0307412_10221529 3300031911 Bacteria 1450
599 Ga0307409_100010095 3300031995 Bacteria 5845
600 Ga0307416_100040963 3300032002 Bacteria 3604
601 Ga0307416_100049597 3300032002 Bacteria 3339
602 Ga0307414_10121277 3300032004 Bacteria 2010
603 Ga0307414_10216194 3300032004 Bacteria 1570
604 Ga0307411_10083090 3300032005 Bacteria 2211
605 Ga0307510_10001123 3300033180 Bacteria 28660
606 Ga0307510_10017254 3300033180 Bacteria 8519
607 Ga0307510_10040632 3300033180 Bacteria 5103
608 Ga0373934_0009439 3300035086 Bacteria 3656
609 Ga0373931_0009122 3300035691 Bacteria 4734
610 Ga0373947_0128073 3300035725 Bacteria 1618
611 Ga0373925_0002844 3300037068 Bacteria 13661
612 Ga0395899_0006950 3300037312 Bacteria 8766
613 Ga0395899_0007132 3300037312 Bacteria 8647
614 Ga0395899_0028515 3300037312 Bacteria 4203
615 Ga0395900_0000133 3300037418 Bacteria 124692
616 Ga0395900_0000149 3300037418 Bacteria 117114
617 Ga0395900_0002435 3300037418 Bacteria 20495
618 Ga0395900_0004365 3300037418 Bacteria 14999
619 Ga0395900_0006302 3300037418 Bacteria 12376
620 Ga0395900_0031630 3300037418 Bacteria 5439
621 Ga0395900_0034295 3300037418 Bacteria 5225
622 Ga0395900_0235613 3300037418 Bacteria 1838
623 Ga0395900_0245901 3300037418 Bacteria 1792
624 Ga0395898_0000337 3300037466 Bacteria 106044
625 Ga0395898_0020151 3300037466 Bacteria 6775
626 Ga0395898_0034130 3300037466 Bacteria 5073
627 Ga0395898_0035162 3300037466 Bacteria 4986
628 Ga0395898_0042577 3300037466 Bacteria 4479
629 Ga0395905_0000106 3300037471 Bacteria 140180
630 Ga0395905_0001392 3300037471 Bacteria 29351
631 Ga0395905_0002252 3300037471 Bacteria 21683
632 Ga0395905_0005981 3300037471 Bacteria 12321
633 Ga0395905_0016439 3300037471 Bacteria 7033
634 Ga0395905_0017636 3300037471 Bacteria 6776
635 Ga0395905_0018080 3300037471 Bacteria 6691
636 Ga0395905_0029529 3300037471 Bacteria 5165
637 Ga0395905_0039884 3300037471 Bacteria 4405
638 Ga0395905_0051530 3300037471 Bacteria 3856
639 Ga0395905_0074491 3300037471 Bacteria 3181
640 Ga0395905_0085495 3300037471 Bacteria 2955
641 Ga0395905_0099383 3300037471 Bacteria 2733
642 Ga0395905_0371981 3300037471 Bacteria 1322
643 Ga0395901_0000025 3300038443 Bacteria 263463
644 Ga0395901_0000642 3300038443 Bacteria 40498
645 Ga0395901_0009185 3300038443 Bacteria 10017
646 Ga0395901_0045024 3300038443 Bacteria 4578
647 Ga0395901_0049222 3300038443 Bacteria 4378
648 Ga0395901_0067327 3300038443 Bacteria 3729
649 Ga0395901_0184677 3300038443 Bacteria 2187
650 Ga0395901_0193220 3300038443 Bacteria 2134
651 Ga0395901_0239099 3300038443 Bacteria 1894
652 Ga0436361_0269778 3300039447 Bacteria 4202
653 Ga0436361_0598496 3300039447 Bacteria 3929
654 Ga0436361_0927296 3300039447 Bacteria 36814
655 Ga0436361_0983078 3300039447 Bacteria 65033
656 Ga0436363_1141908 3300039450 Bacteria 1150
657 Ga0439436_0001977 3300041404 Bacteria 6082
658 Ga0439436_0005987 3300041404 Bacteria 3728
659 Ga0439447_007671 3300041407 Bacteria 3399
660 Ga0439466_0009605 3300041411 Bacteria 3615
661 Ga0439465_0002491 3300041413 Bacteria 6012
662 Ga0451793_0918201 3300041452 Bacteria 1978
663 Ga0439431_0002490 3300041997 Bacteria 4076
664 Ga0439442_001712 3300042002 Bacteria 4306
665 Ga0439442_017395 3300042002 Bacteria 1483
666 Ga0439448_0017000 3300042005 Bacteria 2218
667 Ga0439448_0024808 3300042005 Bacteria 1877
668 Ga0439432_007707 3300042006 Bacteria 3808
669 Ga0439432_013461 3300042006 Bacteria 2782
670 Ga0439449_0001308 3300042007 Bacteria 9751
671 Ga0439449_0015038 3300042007 Bacteria 2908
672 Ga0439452_000862 3300042010 Bacteria 14047
673 Ga0439455_0011014 3300042012 Bacteria 2001
674 Ga0439457_003229 3300042014 Bacteria 4480
675 Ga0450898_001424 3300042134 Bacteria 3151
676 Ga0450904_003320 3300042139 Bacteria 1758
677 Ga0450906_004454 3300042145 Bacteria 2939
678 Ga0450907_011080 3300042146 Bacteria 1497
679 Ga0439458_0006666 3300042157 Bacteria 2574
680 Ga0439434_0001479 3300042435 Bacteria 6764
681 Ga0439434_0001932 3300042435 Bacteria 5999
682 Ga0439434_0005809 3300042435 Bacteria 3604
683 Ga0439464_0039030 3300042439 Bacteria 1349
684 Ga0450918_007734 3300042531 Bacteria 1895
685 Ga0450893_0003457 3300042532 Bacteria 2488
686 Ga0451577_0000297 3300042876 Bacteria 96727
687 Ga0451577_0008662 3300042876 Bacteria 9879
688 Ga0451577_0117534 3300042876 Bacteria 2382
689 Ga0451577_0241888 3300042876 Bacteria 1633
690 Ga0451577_0269987 3300042876 Bacteria 1540
691 Ga0466969_0000037 3300044656 Bacteria 75663
692 Ga0466969_0004528 3300044656 Bacteria 7398
693 Ga0466969_0031793 3300044656 Bacteria 2685
694 Ga0466969_0032766 3300044656 Bacteria 2641
695 Ga0466969_0050869 3300044656 Bacteria 2041
696 Ga0466972_0003017 3300044658 Bacteria 8342
697 Ga0466972_0003281 3300044658 Bacteria 8018
698 Ga0466972_0008997 3300044658 Bacteria 5013
699 Ga0466972_0098291 3300044658 Bacteria 1386
700 Ga0466965_0000584 3300044683 Bacteria 13248
701 Ga0466965_0004880 3300044683 Bacteria 5989
702 Ga0466965_0029534 3300044683 Bacteria 2668
703 Ga0466966_0005235 3300044684 Bacteria 8527
704 Ga0466966_0006849 3300044684 Bacteria 7547
705 Ga0466966_0078955 3300044684 Bacteria 2052
706 Ga0466966_0157452 3300044684 Bacteria 1383
707 Ga0466961_0036216 3300044693 Bacteria 3167
708 Ga0466961_0040230 3300044693 Bacteria 2997
709 Ga0466961_0055341 3300044693 Bacteria 2529
710 Ga0466963_0097288 3300044694 Bacteria 2011
711 Ga0466964_0001090 3300044706 Bacteria 9091
712 Ga0466964_0014482 3300044706 Bacteria 3000
713 Ga0466964_0146560 3300044706 Bacteria 1090
714 Ga0453684_0001350 3300044712 Bacteria 71680
715 Ga0453684_0034029 3300044712 Bacteria 7086
716 Ga0453684_0156600 3300044712 Bacteria 2700
717 Ga0453684_0180964 3300044712 Bacteria 2475
718 Ga0453684_0323749 3300044712 Bacteria 1745
719 Ga0466968_0000616 3300044735 Bacteria 12152
720 Ga0466970_0033717 3300044765 Bacteria 2707
721 Ga0466970_0074021 3300044765 Bacteria 1833
722 Ga0466957_0002832 3300044842 Bacteria 9380
723 Ga0466957_0024178 3300044842 Bacteria 3594
724 Ga0466957_0043523 3300044842 Bacteria 2719
725 Ga0466957_0182616 3300044842 Bacteria 1371
726 Ga0466960_0005116 3300044901 Bacteria 5187
727 Ga0466960_0051914 3300044901 Bacteria 1982
728 Ga0466960_0056313 3300044901 Bacteria 1914
729 Ga0466960_0095495 3300044901 Bacteria 1522
730 Ga0466959_0004947 3300045049 Bacteria 9027
731 Ga0466959_0004984 3300045049 Bacteria 9004
732 Ga0466959_0034076 3300045049 Bacteria 3767
733 Ga0466959_0064400 3300045049 Bacteria 2661
734 Ga0466959_0117360 3300045049 Bacteria 1894
735 Ga0451576_0045374 3300045051 Bacteria 4629
736 Ga0451576_0049001 3300045051 Bacteria 4433
737 Ga0451576_0195343 3300045051 Bacteria 2113
738 Ga0466958_0004695 3300045836 Bacteria 7252
739 Ga0466967_0007605 3300045976 Bacteria 7835
740 Ga0466967_0147630 3300045976 Bacteria 2194
741 Ga0495617_000060 3300046452 Bacteria 97123
742 Ga0495592_0054617 3300046454 Bacteria 2959
743 Ga0495590_0000469 3300046457 Bacteria 19973
744 Ga0495590_0016155 3300046457 Bacteria 2697
745 Ga0495590_0036469 3300046457 Bacteria 1715
746 Ga0495629_0079480 3300046459 Bacteria 2290
747 Ga0495638_0088844 3300046460 Bacteria 1865
748 Ga0495651_0010041 3300046462 Bacteria 7277
749 Ga0495653_0027174 3300046463 Bacteria 4580
750 Ga0495650_0004422 3300046471 Bacteria 9635
751 Ga0495650_0005380 3300046471 Bacteria 8329
752 Ga0495650_0041716 3300046471 Bacteria 1960
753 Ga0495580_0058047 3300046472 Bacteria 2723
754 Ga0495582_0003728 3300046473 Bacteria 8585
755 Ga0495605_0000049 3300046474 Bacteria 166669
756 Ga0495605_0000179 3300046474 Bacteria 80278
757 Ga0495605_0003347 3300046474 Bacteria 9584
758 Ga0495584_0003026 3300046491 Bacteria 9328
759 Ga0495584_0015708 3300046491 Bacteria 3860
760 Ga0495584_0055303 3300046491 Bacteria 1997
761 Ga0495585_0011959 3300046492 Bacteria 5125
762 Ga0495594_0054169 3300046499 Bacteria 2210
763 Ga0495596_0004693 3300046500 Bacteria 6610
764 Ga0495596_0010059 3300046500 Bacteria 4135
765 Ga0495607_0004477 3300046501 Bacteria 10250
766 Ga0495607_0011765 3300046501 Bacteria 5803
767 Ga0495607_0021811 3300046501 Bacteria 4027
768 Ga0495607_0037071 3300046501 Bacteria 2931
769 Ga0495607_0038404 3300046501 Bacteria 2868
770 Ga0495607_0102588 3300046501 Bacteria 1529
771 Ga0495583_0000433 3300046506 Bacteria 63058
772 Ga0495583_0004420 3300046506 Bacteria 10069
773 Ga0495606_0000087 3300046507 Bacteria 156407
774 Ga0495606_0017575 3300046507 Bacteria 5399
775 Ga0495606_0018193 3300046507 Bacteria 5280
776 Ga0495610_0012490 3300046512 Bacteria 5108
777 Ga0495610_0044721 3300046512 Bacteria 2196
778 Ga0495616_0000426 3300046513 Bacteria 32236
779 Ga0495616_0004175 3300046513 Bacteria 9155
780 Ga0495616_0006481 3300046513 Bacteria 7081
781 Ga0495616_0009329 3300046513 Bacteria 5750
782 Ga0495616_0023347 3300046513 Bacteria 3327
783 Ga0495616_0040625 3300046513 Bacteria 2375
784 Ga0495616_0052239 3300046513 Bacteria 2035
785 Ga0495618_0050801 3300046514 Bacteria 2620
786 Ga0495620_0052397 3300046515 Bacteria 1733
787 Ga0495628_0003181 3300046516 Bacteria 14713
788 Ga0495630_0077778 3300046517 Bacteria 2501
789 Ga0495631_0001031 3300046518 Bacteria 17308
790 Ga0495632_0012365 3300046519 Bacteria 4926
791 Ga0495632_0013218 3300046519 Bacteria 4720
792 Ga0495637_0000813 3300046520 Bacteria 20603
793 Ga0495637_0051307 3300046520 Bacteria 1727
794 Ga0495643_0002868 3300046522 Bacteria 13097
795 Ga0495643_0003958 3300046522 Bacteria 10595
796 Ga0495643_0020035 3300046522 Bacteria 3863
797 Ga0495643_0101468 3300046522 Bacteria 1474
798 Ga0495644_0017329 3300046523 Bacteria 2754
799 Ga0495648_0001084 3300046524 Bacteria 27665
800 Ga0495648_0002496 3300046524 Bacteria 16889
801 Ga0495666_0001684 3300046526 Bacteria 10917
802 Ga0495642_0000083 3300046528 Bacteria 55163
803 Ga0495642_0000757 3300046528 Bacteria 15886
804 Ga0495642_0008038 3300046528 Bacteria 4035
805 Ga0495642_0017521 3300046528 Bacteria 2799
806 Ga0495652_0030206 3300046529 Bacteria 4755
807 Ga0495652_0107795 3300046529 Bacteria 2247
808 Ga0495654_0027511 3300046530 Bacteria 2915
809 Ga0495654_0037661 3300046530 Bacteria 2423
810 Ga0495665_0023329 3300046531 Bacteria 3322
811 Ga0495587_0026612 3300046536 Bacteria 3526
812 Ga0495609_0000001 3300046538 Bacteria 1060094
813 Ga0495609_0035223 3300046538 Bacteria 2266
814 Ga0495621_0019541 3300046539 Bacteria 2214
815 Ga0495621_0042031 3300046539 Bacteria 1608
816 Ga0495597_0000879 3300046542 Bacteria 23385
817 Ga0495597_0011196 3300046542 Bacteria 4352
818 Ga0495597_0036237 3300046542 Bacteria 2222
819 Ga0495633_0065688 3300046558 Bacteria 1695
820 Ga0495656_0000076 3300046615 Bacteria 44185
821 Ga0495668_0000350 3300046616 Bacteria 61356
822 Ga0495668_0004844 3300046616 Bacteria 9364
823 Ga0495668_0147491 3300046616 Bacteria 1288
824 Ga0495634_0008870 3300046642 Bacteria 7455
825 Ga0495625_0000436 3300046660 Bacteria 62756
826 Ga0495625_0005633 3300046660 Bacteria 11356
827 Ga0495625_0018265 3300046660 Bacteria 5479
828 Ga0495661_0000206 3300046665 Bacteria 68072
829 Ga0495661_0001903 3300046665 Bacteria 16635
830 Ga0495661_0026153 3300046665 Bacteria 3760
831 Ga0495661_0121234 3300046665 Bacteria 1444
832 Ga0495588_0000041 3300046674 Bacteria 377896
833 Ga0495588_0029447 3300046674 Bacteria 2754
834 Ga0495588_0091417 3300046674 Bacteria 1594
835 Ga0495623_0025518 3300046679 Bacteria 3807
836 Ga0495623_0049650 3300046679 Bacteria 2658
837 Ga0495658_0011945 3300046683 Bacteria 4383
838 Ga0495669_0007042 3300046684 Bacteria 4708
839 Ga0495669_0042485 3300046684 Bacteria 2021
840 Ga0495670_0055196 3300046691 Bacteria 1992
841 Ga0495670_0070115 3300046691 Bacteria 1773
842 Ga0495671_0004464 3300046692 Bacteria 8361
843 Ga0495671_0006548 3300046692 Bacteria 6718
844 Ga0495649_0001533 3300046694 Bacteria 17354
845 Ga0495589_0000152 3300046794 Bacteria 64153
846 Ga0495589_0000250 3300046794 Bacteria 43941
847 Ga0495589_0023435 3300046794 Bacteria 3145
848 Ga0495589_0047401 3300046794 Bacteria 2130
849 Ga0495600_0090718 3300046809 Bacteria 1993
850 Ga0495660_0000288 3300046810 Bacteria 46688
851 Ga0495660_0022910 3300046810 Bacteria 3564
852 Ga0495660_0043850 3300046810 Bacteria 2464
853 Ga0495672_0000290 3300047320 Bacteria 69104
854 Ga0495672_0003480 3300047320 Bacteria 13465
855 Ga0495672_0028853 3300047320 Bacteria 3503
856 Ga0495672_0030962 3300047320 Bacteria 3346
857 Ga0495676_0006422 3300047321 Bacteria 10830
858 Ga0495676_0160374 3300047321 Bacteria 1592
859 Ga0495683_0069918 3300047323 Bacteria 1724
860 Ga0495683_0096576 3300047323 Bacteria 1425
861 Ga0495687_000023 3300047443 Bacteria 317750
862 Ga0495687_000027 3300047443 Bacteria 299689
863 Ga0495687_000576 3300047443 Bacteria 43087
864 Ga0495687_035872 3300047443 Bacteria 2224
865 Ga0495687_038404 3300047443 Bacteria 2125
866 Ga0495675_0013071 3300047444 Bacteria 5236
867 Ga0495677_0000001 3300047445 Bacteria 715000
868 Ga0495677_0001805 3300047445 Bacteria 8559
869 Ga0495677_0008447 3300047445 Bacteria 3823
870 Ga0495686_0000222 3300047472 Bacteria 104411
871 Ga0495686_0006302 3300047472 Bacteria 9116
872 Ga0495686_0099767 3300047472 Bacteria 1752
873 Ga0495686_0150721 3300047472 Bacteria 1365
874 Ga0495602_0037073 3300048088 Bacteria 4530
875 Ga0495614_0001247 3300048089 Bacteria 10942
876 Ga0495626_0000037 3300048091 Bacteria 178573
877 Ga0495626_0000520 3300048091 Bacteria 38584
878 Ga0495626_0009773 3300048091 Bacteria 5164
879 Ga0496100_0013999 3300048903 Bacteria 4645
880 Ga0496101_0003842 3300048904 Bacteria 9392
881 Ga0496101_0093699 3300048904 Bacteria 2237
882 Ga0496102_0011197 3300048905 Bacteria 7725
883 Ga0496102_0015225 3300048905 Bacteria 6695
884 Ga0496102_0136122 3300048905 Bacteria 2302
885 Ga0496104_0000625 3300048907 Bacteria 30296
886 Ga0496104_0220223 3300048907 Bacteria 1810
887 Ga0496105_0000638 3300048908 Bacteria 23463
888 Ga0496106_0119092 3300048909 Bacteria 2062
889 Ga0496107_0025622 3300048910 Bacteria 4176
890 Ga0496108_0309349 3300048911 Bacteria 1377
891 Ga0496108_0334502 3300048911 Bacteria 1321
892 Ga0496109_0038690 3300048912 Bacteria 4313
893 Ga0496109_0351051 3300048912 Bacteria 1393
894 Ga0496110_0068024 3300048913 Bacteria 3152
895 Ga0496110_0069420 3300048913 Bacteria 3120
896 Ga0496110_0193355 3300048913 Bacteria 1847
897 Ga0496114_0198788 3300048917 Bacteria 1755
898 Ga0496115_0193859 3300048918 Bacteria 1679
899 Ga0496116_0009153 3300048919 Bacteria 8484
900 Ga0496117_0013047 3300048920 Bacteria 7275
901 Ga0496117_0146500 3300048920 Bacteria 1405
902 Ga0496118_0044479 3300048921 Bacteria 3477
903 Ga0496121_0014532 3300048924 Bacteria 8347
904 Ga0496121_0024441 3300048924 Bacteria 5776
905 Ga0496121_0089658 3300048924 Bacteria 2406
906 Ga0496122_0000103 3300048925 Bacteria 196819
907 Ga0496122_0010319 3300048925 Bacteria 9661
908 Ga0496122_0011628 3300048925 Bacteria 8880
909 Ga0496123_0000261 3300048926 Bacteria 106547
910 Ga0496123_0001777 3300048926 Bacteria 28404
911 Ga0496123_0016312 3300048926 Bacteria 6042
912 Ga0496123_0043105 3300048926 Bacteria 3104
913 Ga0496124_0000919 3300048927 Bacteria 47561
914 Ga0496124_0005843 3300048927 Bacteria 13656
915 Ga0496124_0016567 3300048927 Bacteria 6996
916 Ga0496124_0038513 3300048927 Bacteria 4151
917 Ga0496124_0045738 3300048927 Bacteria 3752
918 Ga0496124_0055493 3300048927 Bacteria 3348
919 Ga0496125_0009347 3300048928 Bacteria 10100
920 Ga0496125_0025933 3300048928 Bacteria 5355
921 Ga0496125_0036972 3300048928 Bacteria 4252
922 Ga0496125_0051204 3300048928 Bacteria 3408
923 Ga0496125_0070582 3300048928 Bacteria 2734
924 Ga0496126_0126193 3300048929 Bacteria 2215
925 Ga0495678_014512 3300049459 Bacteria 3660
926 Ga0501033_0086909 3300049570 Bacteria 2289
927 Ga0501037_0244940 3300049573 Bacteria 1256
928 Ga0501043_0000013 3300049579 Bacteria 185639
929 Ga0501046_0000125 3300049580 Bacteria 81656
930 Ga0501047_0000040 3300049581 Bacteria 185677
931 Ga0501047_0081898 3300049581 Bacteria 3102
932 Ga0501048_0002958 3300049582 Bacteria 12974
933 Ga0501048_0234800 3300049582 Bacteria 1301
934 Ga0501067_0066636 3300049583 Bacteria 1993
935 Ga0501198_000006 3300049649 Bacteria 129954
936 Ga0501222_000007 3300049662 Bacteria 126703
937 Ga0501249_001056 3300049679 Bacteria 5870
938 Ga0501252_003423 3300049682 Bacteria 1635
939 Ga0501035_0000544 3300049822 Bacteria 41893
940 Ga0501035_0000619 3300049822 Bacteria 39116
941 Ga0501035_0038533 3300049822 Bacteria 4327
942 Ga0501035_0199270 3300049822 Bacteria 1718
943 Ga0501045_0007309 3300049824 Bacteria 7674
944 nmdc:mga03683_72044_c1 3300050489 Bacteria 1479
945 nmdc:mga03n38_12421_c1 3300050490 Bacteria 3204
946 nmdc:mga00v17_43474_c1 3300050491 Bacteria 2706
947 nmdc:mga0yw44_8064_c1 3300050492 Bacteria 5225
948 nmdc:mga0k408_14479_c1 3300050493 Bacteria 4347
949 nmdc:mga0k408_24141_c1 3300050493 Bacteria 3435
950 nmdc:mga0k408_28275_c1 3300050493 Bacteria 3187
951 nmdc:mga0k408_3121_c1 3300050493 Bacteria 8784
952 nmdc:mga0k408_57296_c1 3300050493 Bacteria 2262
953 nmdc:mga0k408_7091_c1 3300050493 Bacteria 5987
954 nmdc:mga0k408_82161_c1 3300050493 Bacteria 1887
955 nmdc:mga07m45_1225_c1 3300050496 Bacteria 11621
956 nmdc:mga07m45_6523_c1 3300050496 Bacteria 5904
957 nmdc:mga07m45_716_c1 3300050496 Bacteria 14102
958 nmdc:mga07m45_73290_c1 3300050496 Bacteria 1949
959 nmdc:mga05p37_39567_c1 3300050507 Bacteria 5789
960 nmdc:mga09592_34033_c1 3300050508 Bacteria 4259
961 nmdc:mga08y16_108239_c1 3300050511 Bacteria 2893
962 Ga0500635_0000145 3300053080 Bacteria 40070
963 Ga0500635_0034076 3300053080 Bacteria 1665
964 Ga0500578_0000263 3300053086 Bacteria 65524
965 Ga0500646_0011157 3300053090 Bacteria 2307
966 Ga0500651_0000042 3300053093 Bacteria 87895
967 Ga0500571_000385 3300053110 Bacteria 17471
968 Ga0500593_000087 3300053117 Bacteria 33673
969 Ga0500593_000436 3300053117 Bacteria 16451
970 Ga0500593_016958 3300053117 Bacteria 3162
971 Ga0500607_001690 3300053121 Bacteria 19265
972 Ga0500607_010259 3300053121 Bacteria 5593
973 Ga0500608_015146 3300053122 Bacteria 3458
974 Ga0500626_009829 3300053128 Bacteria 3993
975 Ga0500628_001481 3300053129 Bacteria 4015
976 Ga0500652_001450 3300053131 Bacteria 7359
977 Ga0500655_001604 3300053133 Bacteria 4268
978 Ga0500658_0002529 3300053134 Bacteria 7084
979 Ga0500658_0005455 3300053134 Bacteria 4729
980 Ga0500559_0001528 3300053136 Bacteria 12968
981 Ga0500559_0014366 3300053136 Bacteria 3347
982 Ga0500559_0063266 3300053136 Bacteria 1653
983 Ga0500564_004037 3300053138 Bacteria 5804
984 Ga0500568_0016364 3300053139 Bacteria 3299
985 Ga0500568_0050876 3300053139 Bacteria 1631
986 Ga0500574_001626 3300053141 Bacteria 3424
987 Ga0500619_000055 3300053154 Bacteria 34804
988 Ga0500622_0000106 3300053156 Bacteria 85750
989 Ga0500622_0005905 3300053156 Bacteria 7221
990 Ga0500634_0037894 3300053161 Bacteria 2622
991 Ga0500636_0015185 3300053177 Bacteria 4534
992 Ga0500636_0021939 3300053177 Bacteria 3779
993 Ga0500636_0037982 3300053177 Bacteria 2848
994 Ga0500645_000100 3300053730 Bacteria 68299
995 Ga0500645_005164 3300053730 Bacteria 4864
996 Ga0500661_008746 3300055283 Bacteria 1862
997 Ga0500661_016312 3300055283 Bacteria 1328
998 Ga0590071_001534 3300059421 Bacteria 6044
999 Ga0587079_002337 3300059647 Bacteria 2305
1000 Ga0466962_0004778 3300061719 Bacteria 6515
1001 Ga0466962_0051617 3300061719 Bacteria 1966
1002 2511245751 2511231002 Bacteria 5042903
1003 2513226692 2513020051 Bacteria 6053213
1004 2550693309 2548876994 Bacteria 4904866
1005 2552747549 2551306352 Bacteria 3873115
1006 2587726789 2585428057 Bacteria 6737412
1007 2587732270 2585428058 Bacteria 6853932
1008 2588295723 2588253510 Bacteria 6901809
1009 2599625023 2599185214 Bacteria 8209958
1010 2599673035 2599185226 Bacteria 8233575
1011 2599682515 2599185227 Bacteria 8246414
1012 2599694643 2599185229 Bacteria 8216126
1013 2640735813 2639762793 Bacteria 3943681
1014 2643799065 2643221556 Bacteria 7251154
1015 2643971875 2643221592 Bacteria 6608788
1016 2644030726 2643221603 Bacteria 6147767
1017 2644139364 2643221625 Bacteria 6512927
1018 2644159401 2643221628 Bacteria 5745828
1019 2644274974 2643221648 Bacteria 6521465
1020 2644329328 2643221658 Bacteria 6064537
1021 2644337976 2643221660 Bacteria 4208257
1022 2644361934 2643221665 Bacteria 4699229
1023 2644401202 2643221672 Bacteria 6322190
1024 2644467953 2643221683 Bacteria 5749203
1025 2644473604 2643221684 Bacteria 7145183
1026 2678229076 2675903507 Bacteria 3737791
1027 2738717466 2738541277 Bacteria 7458140
1028 2738879068 2738541307 Bacteria 8606193
1029 2739248863 2738543013 Bacteria 5618633
1030 2739278152 2738543019 Bacteria 7459457
1031 2745159963 2744054655 Bacteria 3552603
1032 2774390380 2773857761 Bacteria 3837365
1033 2774437765 2773857770 Bacteria 3911866
1034 2809143043 2808606418 Bacteria 6724496
1035 2819540851 2818991436 Bacteria 5376622
1036 2819593473 2818991445 Bacteria 4955017
1037 2819596977 2818991446 Bacteria 7757362
1038 2831266059 2831265667 Bacteria 7184833
1039 2838057812 2838054893 Bacteria 7451788
1040 2842679080 2842677519 Bacteria 5615038
1041 2842735972 2842733646 Bacteria 5716726
1042 2842748329 2842747753 Bacteria 5578255
1043 2881102193 2881101125 Bacteria 4590519
1044 2884814810 2884811622 Bacteria 5552861
1045 2884840005 2884836552 Bacteria 5219991
1046 2884857227 2884852848 Bacteria 5221161
1047 2885197487 2885192300 Bacteria 5882526
1048 2885203720 2885198086 Bacteria 7212419
1049 2885216930 2885211737 Bacteria 7212420
1050 2896157814 2896154374 Bacteria 5221518
1051 2899930281 2899924645 Bacteria 7487985
1052 2904456245 2904449895 Bacteria 6927402
1053 2904457601 2904456579 Bacteria 6819253
1054 2904482914 2904479285 Bacteria 5073931
1055 2904543644 2904541872 Bacteria 8915136
1056 2916700238 2916699645 Bacteria 3568996
1057 2919184734 2919182534 Bacteria 3907101
1058 2919466956 2919462493 Bacteria 5817112
1059 2919507544 2919506607 Bacteria 3392955
1060 2919704861 2919704043 Bacteria 5560311
1061 2928039394 2928037797 Bacteria 7273642
1062 2928045001 2928044640 Bacteria 7271509
1063 2928052802 2928051484 Bacteria 7773759
1064 2928064525 2928064002 Bacteria 7419480
1065 2928075060 2928070936 Bacteria 8062541
1066 2928088238 2928084124 Bacteria 7159212
1067 2928116312 2928115317 Bacteria 6477646
1068 2928517453 2928515477 Bacteria 4448421
1069 2929162805 2929160207 Bacteria 9075316
1070 2929527354 2929520902 Bacteria 6765052
1071 2945911317 2945909444 Bacteria 7065066
1072 2945947330 2945945610 Bacteria 5951079
1073 2945977651 2945972063 Bacteria 6086495
1074 2945986395 2945984333 Bacteria 7358892
1075 2954772632 2954767861 Bacteria 5535784
1076 2984571889 2984568884 Bacteria 3884413
1077 8033234137 8033232454 Bacteria 3202805
1078 8047679337 8047673197 Bacteria 7395230
1079 Ga0055531_10013544
1080 JGI24740J21852_10001948
1081 JGI24740J21852_10030573
1082 JGI25155J39150_1000002
1083 JGI25155J39150_1000691
1084 JGI25156J39149_1000003
1085 JGI25156J39149_1000114
1086 JGI25156J39149_1000892
1087 JGI25156J39149_1006515
1088 JGI25154J39366_1000009
1089 JGI25154J39366_1000411
1090 JGI25154J39366_1001903
1091 JGI25158J39367_1010631
1092 JGI25157J39369_1000002
1093 JGI25157J39369_1000015
1094 JGI25157J39369_1000382
1095 JGI25152J39213_1003863
1096 JGI25152J39213_1004531
1097 JGI25152J39213_1005460
1098 JGI25150J39212_1000565
1099 JGI25150J39212_1000739
1100 JGI25150J39212_1001528
1101 JGI25150J39212_1004000
1102 JGI25150J39212_1009619
1103 JGI25159J45721_1002000
1104 JGI25159J45721_1002011
1105 JGI25159J45721_1003775
1106 JGI25159J45721_1005761
1107 JGI25151J46595_10000913
1108 JGI25151J46595_10007569
1109 JGI25151J46595_10012667
1110 JGI25151J46595_10013335
1111 JGI25153J46596_10001949
1112 JGI25153J46596_10004931
1113 JGI25153J46596_10008323
1114 JGI25153J46596_10012325
1115 rootH1_10005490
1116 rootH1_10028592
1117 rootH1_10066715
1118 rootH2_10021047
1119 rootL2_10024592
1120 rootL2_10059824
1121 rootL2_10151440
1122 rootL2_10151441
1123 rootH1_10082267
1124 rootH1_10127265
1125 JGI25160J50197_1000305
1126 JGI25160J50197_1009151
1127 JGI25160J50197_1009161
1128 JGI25161J50226_1000018
1129 JGI25161J50226_1001955
1130 JGI25161J50226_1002370
1131 Ga0006562J51391_1079656
1132 Ga0032354_1026629
1133 Ga0055539_1000170
1134 Ga0055533_1000010
1135 Ga0055532_1000050
1136 Ga0055525_1000025
1137 Ga0055535_1000272
1138 Ga0055535_1001094
1139 Ga0055542_1000027
1140 Ga0055529_1000303
1141 Ga0055526_1003334
1142 Ga0055526_1007206
1143 Ga0055526_1009048
1144 Ga0055526_1010409
1145 Ga0055537_1000008
1146 Ga0055537_1001609
1147 Ga0055537_1004710
1148 Ga0055537_1008970
1149 Ga0055524_1000083
1150 Ga0055524_1008285
1151 Ga0055524_1008318
1152 Ga0055536_1001279
1153 Ga0055536_1003548
1154 Ga0055536_1008349
1155 Ga0055536_1009960
1156 Ga0055536_1017236
1157 Ga0055534_1001020
1158 Ga0055534_1001670
1159 Ga0055534_1002378
1160 Ga0055534_1004960
1161 Ga0055534_1007216
1162 Ga0055528_1000803
1163 Ga0055528_1003113
1164 Ga0055528_1008869
1165 Ga0055528_1019437
1166 Ga0055530_10000211
1167 Ga0055530_10001348
1168 Ga0055540_1000012
1169 Ga0055540_1002608
1170 Ga0055540_1003019
1171 Ga0055540_1007006
1172 Ga0055540_1012261
1173 Ga0055531_10001052
1174 Ga0055531_10003480
1175 Ga0055531_10006241
1176 Ga0055541_1000819
1177 Ga0058692_1000048
1178 Ga0055543_1000542
1179 Ga0055543_1002593
1180 Ga0055543_1004978
1181 Ga0065165_1009407
1182 Ga0065165_1013299
1183 Ga0065165_1013384
1184 Ga0065165_1018335
1185 Ga0065703_1000509
1186 Ga0065714_10069896
1187 Ga0065704_10121033
1188 Ga0065707_10087372
1189 Ga0070658_10018493
1190 Ga0070658_10038314
1191 Ga0070658_10040315
1192 Ga0070658_10171620
1193 Ga0070676_10015051
1194 Ga0070670_100033286
1195 Ga0070670_100039435
1196 Ga0068869_100010918
1197 Ga0068869_100130324
1198 Ga0070666_10027485
1199 Ga0070680_100020784
1200 Ga0070680_100059021
1201 Ga0068868_100031542
1202 Ga0068868_100045313
1203 Ga0068868_100096815
1204 Ga0070660_100025701
1205 Ga0070660_100030405
1206 Ga0070660_100068993
1207 Ga0070687_100019322
1208 Ga0070661_100079125
1209 Ga0070668_100026977
1210 Ga0070669_100000505
1211 Ga0070669_100026320
1212 Ga0070669_100049534
1213 Ga0070675_100037029
1214 Ga0070675_100197203
1215 Ga0070671_100010843
1216 Ga0070671_100193314
1217 Ga0070674_100105629
1218 Ga0070674_100242453
1219 Ga0070673_100013275
1220 Ga0070673_100157786
1221 Ga0070659_100030067
1222 Ga0070659_100041871
1223 Ga0070667_100014015
1224 Ga0070667_100069592
1225 Ga0070700_100033487
1226 Ga0070708_100226695
1227 Ga0070708_100402903
1228 Ga0070663_100001487
1229 Ga0070678_100056477
1230 Ga0070678_100062218
1231 Ga0070678_100304656
1232 Ga0070662_100002137
1233 Ga0070662_100062258
1234 Ga0070662_100064353
1235 Ga0070662_100074332
1236 Ga0070662_100121964
1237 Ga0068867_100000068
1238 Ga0068867_100002788
1239 Ga0068867_100080469
1240 Ga0070706_100000546
1241 Ga0070707_100020993
1242 Ga0070698_100056391
1243 Ga0070699_100157087
1244 Ga0070679_100016791
1245 Ga0070679_100092470
1246 Ga0068853_100006411
1247 Ga0068853_100135846
1248 Ga0068853_100290528
1249 Ga0068853_100298045
1250 Ga0070672_100031212
1251 Ga0070672_100046346
1252 Ga0070672_100052964
1253 Ga0070672_100058235
1254 Ga0070686_100123044
1255 Ga0070665_100057573
1256 Ga0070665_100305252
1257 Ga0068855_100016796
1258 Ga0068855_100054224
1259 Ga0068855_100078830
1260 Ga0068855_100093120
1261 Ga0070664_100034408
1262 Ga0070664_100073880
1263 Ga0068857_100120816
1264 Ga0068854_100114687
1265 Ga0068856_100094383
1266 Ga0068852_100072580
1267 Ga0068852_100135184
1268 Ga0068852_100145677
1269 Ga0068859_100132548
1270 Ga0068864_100168139
1271 Ga0068866_10019208
1272 Ga0068861_100007929
1273 Ga0068870_10041881
1274 Ga0068863_100025781
1275 Ga0068863_100233463
1276 Ga0068858_100081232
1277 Ga0068860_100001531
1278 Ga0068860_100024244
1279 Ga0068860_100092512
1280 Ga0068860_100110616
1281 Ga0068862_100014947
1282 Ga0068862_100173655
1283 Ga0068862_100177323
1284 Ga0075365_10001836
1285 Ga0075365_10008898
1286 Ga0075368_10040997
1287 Ga0075363_100001597
1288 Ga0075363_100005158
1289 Ga0075364_10013716
1290 Ga0075432_10000616
1291 Ga0075432_10015499
1292 Ga0075362_10009027
1293 Ga0075366_10006250
1294 Ga0075366_10019182
1295 Ga0075366_10032602
1296 Ga0075366_10039702
1297 Ga0075366_10052693
1298 Ga0075366_10138517
1299 Ga0097621_100182539
1300 Ga0075370_10000587
1301 Ga0075370_10001047
1302 Ga0075370_10001173
1303 Ga0075370_10006112
1304 Ga0075370_10007691
1305 Ga0075370_10008959
1306 Ga0075370_10024844
1307 Ga0075370_10035531
1308 Ga0068871_100099219
1309 Ga0068871_100112165
1310 Ga0075429_100001338
1311 Ga0068865_100021324
1312 Ga0097620_100132552
1313 Ga0099826_10004770
1314 Ga0105251_10020910
1315 Ga0105244_10013824
1316 Ga0105244_10014112
1317 Ga0105244_10042806
1318 Ga0105244_10103317
1319 Ga0105240_10009231
1320 Ga0105240_10010696
1321 Ga0105240_10021627
1322 Ga0105240_10502748
1323 Ga0105247_10000594
1324 Ga0105247_10009842
1325 Ga0105243_10001337
1326 Ga0105243_10001406
1327 Ga0105243_10001511
1328 Ga0105243_10005195
1329 Ga0105243_10113599
1330 Ga0105243_10130169
1331 Ga0105241_10007529
1332 Ga0105241_10015401
1333 Ga0105242_10049900
1334 Ga0105242_10171471
1335 Ga0105248_10055655
1336 Ga0105248_10228257
1337 Ga0105248_10228943
1338 Ga0105248_10274930
1339 Ga0105248_10377590
1340 Ga0105237_10007228
1341 Ga0105238_10152057
1342 Ga0105249_10001295
1343 Ga0105249_10178571
1344 Ga0105239_10008196
1345 Ga0105239_10028770
1346 Ga0105239_10326941
1347 Ga0157326_1003845
1348 Ga0157373_10028793
1349 Ga0157373_10053200
1350 Ga0157371_10000026
1351 Ga0157371_10003698
1352 Ga0157371_10038683
1353 Ga0157370_10024246
1354 Ga0157369_10012180
1355 Ga0157374_10029219
1356 Ga0157378_10003676
1357 Ga0157378_10121800
1358 Ga0163162_10000997
1359 Ga0163162_10037247
1360 Ga0157375_10027584
1361 Ga0157375_10057010
1362 Ga0157375_10324453
1363 Ga0157375_10420560
1364 Ga0182008_10000838
1365 Ga0182008_10005897
1366 Ga0182008_10007674
1367 Ga0182008_10034289
1368 Ga0182008_10041559
1369 Ga0157377_10000082
1370 Ga0157379_10034173
1371 Ga0157376_10003154
1372 Ga0157376_10191638
1373 Ga0182006_1001492
1374 Ga0182007_10001563
1375 Ga0182007_10001757
1376 Ga0182007_10004781
1377 Ga0182007_10010798
1378 Ga0182005_1005148
1379 Ga0183362_10001
1380 Ga0163161_10000065
1381 Ga0163161_10012915
1382 Ga0163161_10032482
1383 Ga0163161_10049481
1384 Ga0213872_10000160
1385 Ga0213872_10002596
1386 Ga0213872_10045361
1387 Ga0213872_10066727
1388 Ga0209435_100001
1389 Ga0209435_100029
1390 Ga0209436_105483
1391 Ga0209436_108819
1392 Ga0209674_100003
1393 Ga0209672_100563
1394 Ga0209147_100004
1395 Ga0209563_100003
1396 Ga0209563_100010
1397 Ga0207427_100468
1398 Ga0209258_100048
1399 Ga0209258_100163
1400 Ga0209258_100903
1401 Ga0207425_1000204
1402 Ga0207425_1000275
1403 Ga0207425_1001012
1404 Ga0207425_1003668
1405 Ga0207425_1005152
1406 Ga0209646_1000001
1407 Ga0209646_1000109
1408 Ga0209646_1000226
1409 Ga0209026_1000003
1410 Ga0209026_1000021
1411 Ga0209026_1000467
1412 Ga0209677_100106
1413 Ga0209677_100480
1414 Ga0209677_103060
1415 Ga0209677_106594
1416 Ga0209148_1000040
1417 Ga0209148_1000811
1418 Ga0209148_1004695
1419 Ga0209759_1000001
1420 Ga0209759_1000025
1421 Ga0209759_1000698
1422 Ga0209759_1000939
1423 Ga0209759_1011786
1424 Ga0209129_1000007
1425 Ga0209129_1000025
1426 Ga0209129_1001079
1427 Ga0209129_1004771
1428 Ga0209129_1011044
1429 Ga0209565_1000004
1430 Ga0209565_1000105
1431 Ga0209565_1000153
1432 Ga0209565_1000974
1433 Ga0209565_1002008
1434 Ga0209455_1000059
1435 Ga0209673_1000074
1436 Ga0209673_1000794
1437 Ga0209673_1001641
1438 Ga0209673_1001648
1439 Ga0209673_1002152
1440 Ga0209130_1000050
1441 Ga0209130_1000172
1442 Ga0209130_1000329
1443 Ga0209130_1000584
1444 Ga0209130_1001746
1445 Ga0209675_1000044
1446 Ga0209675_1000150
1447 Ga0209675_1001275
1448 Ga0209675_1001400
1449 Ga0209675_1001905
1450 Ga0209675_1003456
1451 Ga0209676_1000004
1452 Ga0209676_1000029
1453 Ga0209676_1001207
1454 Ga0209676_1001472
1455 Ga0209676_1002733
1456 Ga0209676_1002909
1457 Ga0209676_1010857
1458 Ga0209025_1000111
1459 Ga0209025_1000217
1460 Ga0209025_1000624
1461 Ga0209025_1001851
1462 Ga0209025_1003136
1463 Ga0209025_1033805
1464 Ga0209025_1052123
1465 Ga0209564_1000039
1466 Ga0209564_1000153
1467 Ga0209564_1000337
1468 Ga0209564_1000470
1469 Ga0209564_1002160
1470 Ga0209564_1029015
1471 Ga0209758_1000025
1472 Ga0209758_1000163
1473 Ga0209758_1000287
1474 Ga0209758_1003748
1475 Ga0209758_1007561
1476 Ga0209050_1000002
1477 Ga0209050_1000003
1478 Ga0209050_1000325
1479 Ga0209050_1000412
1480 Ga0209050_1004195
1481 Ga0209050_1004259
1482 Ga0209050_1005909
1483 Ga0209050_1013114
1484 Ga0209050_1030822
1485 Ga0209256_1000001
1486 Ga0209256_1000425
1487 Ga0209256_1001308
1488 Ga0207426_1000001
1489 Ga0207426_1000028
1490 Ga0207426_1000071
1491 Ga0207426_1000692
1492 Ga0209051_1000002
1493 Ga0209051_1000003
1494 Ga0209051_1000150
1495 Ga0209051_1000268
1496 Ga0209051_1002642
1497 Ga0209051_1003236
1498 Ga0209051_1005495
1499 Ga0209051_1010554
1500 Ga0209257_1000002
1501 Ga0209257_1000012
1502 Ga0209257_1000018
1503 Ga0209257_1000275
1504 Ga0209257_1003064
1505 Ga0209257_1005491
1506 Ga0209257_1019944
1507 Ga0207655_1001363
1508 Ga0207655_1006525
1509 Ga0207655_1015011
1510 Ga0207655_1023715
1511 Ga0207655_1023716
1512 Ga0207713_1001071
1513 Ga0207710_10000101
1514 Ga0207645_10013979
1515 Ga0207645_10014211
1516 Ga0207643_10047783
1517 Ga0207705_10002959
1518 Ga0207705_10074242
1519 Ga0207705_10136840
1520 Ga0207705_10152743
1521 Ga0207684_10001739
1522 Ga0207654_10022538
1523 Ga0207707_10107137
1524 Ga0207695_10011560
1525 Ga0207695_10030297
1526 Ga0207695_10042490
1527 Ga0207695_10059896
1528 Ga0207671_10001984
1529 Ga0207671_10119321
1530 Ga0207660_10042800
1531 Ga0207660_10060346
1532 Ga0207662_10059590
1533 Ga0207657_10009739
1534 Ga0207657_10009825
1535 Ga0207657_10010523
1536 Ga0207657_10080655
1537 Ga0207657_10134212
1538 Ga0207649_10109335
1539 Ga0207652_10015197
1540 Ga0207652_10029783
1541 Ga0207652_10173747
1542 Ga0207646_10097052
1543 Ga0207681_10000574
1544 Ga0207681_10028233
1545 Ga0207659_10053796
1546 Ga0207659_10080380
1547 Ga0207659_10247898
1548 Ga0207687_10233512
1549 Ga0207644_10002692
1550 Ga0207644_10249281
1551 Ga0207690_10014813
1552 Ga0207690_10058414
1553 Ga0207690_10099836
1554 Ga0207706_10000870
1555 Ga0207706_10054396
1556 Ga0207706_10157795
1557 Ga0207706_10212156
1558 Ga0207709_10000016
1559 Ga0207709_10000708
1560 Ga0207709_10000935
1561 Ga0207709_10001525
1562 Ga0207709_10146834
1563 Ga0207669_10198134
1564 Ga0207704_10002077
1565 Ga0207704_10078247
1566 Ga0207691_10032616
1567 Ga0207691_10039953
1568 Ga0207691_10050244
1569 Ga0207691_10139534
1570 Ga0207691_10201782
1571 Ga0207691_10215654
1572 Ga0207711_10032486
1573 Ga0207711_10147324
1574 Ga0207689_10010345
1575 Ga0207679_10002869
1576 Ga0207679_10023704
1577 Ga0207667_10021039
1578 Ga0207667_10021230
1579 Ga0207667_10031970
1580 Ga0207667_10042317
1581 Ga0207651_10012132
1582 Ga0207651_10043131
1583 Ga0207651_10219706
1584 Ga0207712_10000551
1585 Ga0207712_10086714
1586 Ga0207640_10016500
1587 Ga0207640_10086743
1588 Ga0207677_10011035
1589 Ga0207677_10097689
1590 Ga0207677_10121761
1591 Ga0207703_10044201
1592 Ga0207639_10027119
1593 Ga0207639_10165375
1594 Ga0207639_10253920
1595 Ga0207678_10000695
1596 Ga0207678_10026748
1597 Ga0207708_10023165
1598 Ga0207702_10000777
1599 Ga0207641_10016728
1600 Ga0207641_10039534
1601 Ga0207648_10000942
1602 Ga0207648_10018717
1603 Ga0207648_10029808
1604 Ga0207648_10057254
1605 Ga0207648_10072233
1606 Ga0207648_10240105
1607 Ga0207648_10352833
1608 Ga0207676_10226500
1609 Ga0207676_10229631
1610 Ga0207674_10119637
1611 Ga0207675_100016211
1612 Ga0207675_100074804
1613 Ga0207683_10018876
1614 Ga0207683_10058740
1615 Ga0207683_10062093
1616 Ga0207683_10189828
1617 Ga0207683_10208442
1618 Ga0207683_10217150
1619 Ga0207698_10081964
1620 Ga0207698_10130412
1621 Ga0209371_1000024
1622 Ga0209968_1000143
1623 Ga0209970_1000316
1624 Ga0209282_1003855
1625 Ga0209966_1000207
1626 Ga0209974_10000633
1627 Ga0268266_10060787
1628 Ga0268265_10016091
1629 Ga0268265_10027322
1630 Ga0268265_10056711
1631 Ga0268264_10025605
1632 Ga0268264_10030263
1633 Ga0268264_10161478
1634 Ga0265336_10000051
1635 Ga0307515_10000176
1636 Ga0307515_10000208
1637 Ga0307515_10063698
1638 Ga0307515_10070475
1639 Ga0265338_10000886
1640 Ga0265324_10001963
1641 Ga0268256_1000026
1642 Ga0307511_10053635
1643 Ga0314311_1179254
1644 Ga0316183_1001985
1645 Ga0316181_1151309
1646 Ga0265332_10079524
1647 Ga0265327_10000293
1648 Ga0307513_10000014
1649 Ga0307513_10000019
1650 Ga0307513_10016405
1651 Ga0307513_10174396
1652 Ga0307509_10014457
1653 Ga0307408_100013762
1654 Ga0307408_100042391
1655 Ga0307408_100049207
1656 Ga0307408_100094446
1657 Ga0307514_10061998
1658 Ga0265314_10001602
1659 Ga0307516_10000038
1660 Ga0307516_10000991
1661 Ga0307516_10003242
1662 Ga0307516_10006162
1663 Ga0307516_10007930
1664 Ga0307405_10015874
1665 Ga0307405_10039134
1666 Ga0307413_10026530
1667 Ga0307410_10002488
1668 Ga0307406_10009219
1669 Ga0307406_10033616
1670 Ga0307412_10004172
1671 Ga0307412_10020309
1672 Ga0307412_10046994
1673 Ga0307412_10096528
1674 Ga0307412_10221529
1675 Ga0307409_100010095
1676 Ga0307416_100040963
1677 Ga0307416_100049597
1678 Ga0307414_10121277
1679 Ga0307414_10216194
1680 Ga0307411_10083090
1681 Ga0307510_10001123
1682 Ga0307510_10017254
1683 Ga0307510_10040632
1684 Ga0373934_0009439
1685 Ga0373931_0009122
1686 Ga0373947_0128073
1687 Ga0373925_0002844
1688 Ga0395899_0006950
1689 Ga0395899_0007132
1690 Ga0395899_0028515
1691 Ga0395900_0000133
1692 Ga0395900_0000149
1693 Ga0395900_0002435
1694 Ga0395900_0004365
1695 Ga0395900_0006302
1696 Ga0395900_0031630
1697 Ga0395900_0034295
1698 Ga0395900_0235613
1699 Ga0395900_0245901
1700 Ga0395898_0000337
1701 Ga0395898_0020151
1702 Ga0395898_0034130
1703 Ga0395898_0035162
1704 Ga0395898_0042577
1705 Ga0395905_0000106
1706 Ga0395905_0001392
1707 Ga0395905_0002252
1708 Ga0395905_0005981
1709 Ga0395905_0016439
1710 Ga0395905_0017636
1711 Ga0395905_0018080
1712 Ga0395905_0029529
1713 Ga0395905_0039884
1714 Ga0395905_0051530
1715 Ga0395905_0074491
1716 Ga0395905_0085495
1717 Ga0395905_0099383
1718 Ga0395905_0371981
1719 Ga0395901_0000025
1720 Ga0395901_0000642
1721 Ga0395901_0009185
1722 Ga0395901_0045024
1723 Ga0395901_0049222
1724 Ga0395901_0067327
1725 Ga0395901_0184677
1726 Ga0395901_0193220
1727 Ga0395901_0239099
1728 Ga0436361_0269778
1729 Ga0436361_0598496
1730 Ga0436361_0927296
1731 Ga0436361_0983078
1732 Ga0436363_1141908
1733 Ga0439436_0001977
1734 Ga0439436_0005987
1735 Ga0439447_007671
1736 Ga0439466_0009605
1737 Ga0439465_0002491
1738 Ga0451793_0918201
1739 Ga0439431_0002490
1740 Ga0439442_001712
1741 Ga0439442_017395
1742 Ga0439448_0017000
1743 Ga0439448_0024808
1744 Ga0439432_007707
1745 Ga0439432_013461
1746 Ga0439449_0001308
1747 Ga0439449_0015038
1748 Ga0439452_000862
1749 Ga0439455_0011014
1750 Ga0439457_003229
1751 Ga0450898_001424
1752 Ga0450904_003320
1753 Ga0450906_004454
1754 Ga0450907_011080
1755 Ga0439458_0006666
1756 Ga0439434_0001479
1757 Ga0439434_0001932
1758 Ga0439434_0005809
1759 Ga0439464_0039030
1760 Ga0450918_007734
1761 Ga0450893_0003457
1762 Ga0451577_0000297
1763 Ga0451577_0008662
1764 Ga0451577_0117534
1765 Ga0451577_0241888
1766 Ga0451577_0269987
1767 Ga0466969_0000037
1768 Ga0466969_0004528
1769 Ga0466969_0031793
1770 Ga0466969_0032766
1771 Ga0466969_0050869
1772 Ga0466972_0003017
1773 Ga0466972_0003281
1774 Ga0466972_0008997
1775 Ga0466972_0098291
1776 Ga0466965_0000584
1777 Ga0466965_0004880
1778 Ga0466965_0029534
1779 Ga0466966_0005235
1780 Ga0466966_0006849
1781 Ga0466966_0078955
1782 Ga0466966_0157452
1783 Ga0466961_0036216
1784 Ga0466961_0040230
1785 Ga0466961_0055341
1786 Ga0466963_0097288
1787 Ga0466964_0001090
1788 Ga0466964_0014482
1789 Ga0466964_0146560
1790 Ga0453684_0001350
1791 Ga0453684_0034029
1792 Ga0453684_0156600
1793 Ga0453684_0180964
1794 Ga0453684_0323749
1795 Ga0466968_0000616
1796 Ga0466970_0033717
1797 Ga0466970_0074021
1798 Ga0466957_0002832
1799 Ga0466957_0024178
1800 Ga0466957_0043523
1801 Ga0466957_0182616
1802 Ga0466960_0005116
1803 Ga0466960_0051914
1804 Ga0466960_0056313
1805 Ga0466960_0095495
1806 Ga0466959_0004947
1807 Ga0466959_0004984
1808 Ga0466959_0034076
1809 Ga0466959_0064400
1810 Ga0466959_0117360
1811 Ga0451576_0045374
1812 Ga0451576_0049001
1813 Ga0451576_0195343
1814 Ga0466958_0004695
1815 Ga0466967_0007605
1816 Ga0466967_0147630
1817 Ga0495617_000060
1818 Ga0495592_0054617
1819 Ga0495590_0000469
1820 Ga0495590_0016155
1821 Ga0495590_0036469
1822 Ga0495629_0079480
1823 Ga0495638_0088844
1824 Ga0495651_0010041
1825 Ga0495653_0027174
1826 Ga0495650_0004422
1827 Ga0495650_0005380
1828 Ga0495650_0041716
1829 Ga0495580_0058047
1830 Ga0495582_0003728
1831 Ga0495605_0000049
1832 Ga0495605_0000179
1833 Ga0495605_0003347
1834 Ga0495584_0003026
1835 Ga0495584_0015708
1836 Ga0495584_0055303
1837 Ga0495585_0011959
1838 Ga0495594_0054169
1839 Ga0495596_0004693
1840 Ga0495596_0010059
1841 Ga0495607_0004477
1842 Ga0495607_0011765
1843 Ga0495607_0021811
1844 Ga0495607_0037071
1845 Ga0495607_0038404
1846 Ga0495607_0102588
1847 Ga0495583_0000433
1848 Ga0495583_0004420
1849 Ga0495606_0000087
1850 Ga0495606_0017575
1851 Ga0495606_0018193
1852 Ga0495610_0012490
1853 Ga0495610_0044721
1854 Ga0495616_0000426
1855 Ga0495616_0004175
1856 Ga0495616_0006481
1857 Ga0495616_0009329
1858 Ga0495616_0023347
1859 Ga0495616_0040625
1860 Ga0495616_0052239
1861 Ga0495618_0050801
1862 Ga0495620_0052397
1863 Ga0495628_0003181
1864 Ga0495630_0077778
1865 Ga0495631_0001031
1866 Ga0495632_0012365
1867 Ga0495632_0013218
1868 Ga0495637_0000813
1869 Ga0495637_0051307
1870 Ga0495643_0002868
1871 Ga0495643_0003958
1872 Ga0495643_0020035
1873 Ga0495643_0101468
1874 Ga0495644_0017329
1875 Ga0495648_0001084
1876 Ga0495648_0002496
1877 Ga0495666_0001684
1878 Ga0495642_0000083
1879 Ga0495642_0000757
1880 Ga0495642_0008038
1881 Ga0495642_0017521
1882 Ga0495652_0030206
1883 Ga0495652_0107795
1884 Ga0495654_0027511
1885 Ga0495654_0037661
1886 Ga0495665_0023329
1887 Ga0495587_0026612
1888 Ga0495609_0000001
1889 Ga0495609_0035223
1890 Ga0495621_0019541
1891 Ga0495621_0042031
1892 Ga0495597_0000879
1893 Ga0495597_0011196
1894 Ga0495597_0036237
1895 Ga0495633_0065688
1896 Ga0495656_0000076
1897 Ga0495668_0000350
1898 Ga0495668_0004844
1899 Ga0495668_0147491
1900 Ga0495634_0008870
1901 Ga0495625_0000436
1902 Ga0495625_0005633
1903 Ga0495625_0018265
1904 Ga0495661_0000206
1905 Ga0495661_0001903
1906 Ga0495661_0026153
1907 Ga0495661_0121234
1908 Ga0495588_0000041
1909 Ga0495588_0029447
1910 Ga0495588_0091417
1911 Ga0495623_0025518
1912 Ga0495623_0049650
1913 Ga0495658_0011945
1914 Ga0495669_0007042
1915 Ga0495669_0042485
1916 Ga0495670_0055196
1917 Ga0495670_0070115
1918 Ga0495671_0004464
1919 Ga0495671_0006548
1920 Ga0495649_0001533
1921 Ga0495589_0000152
1922 Ga0495589_0000250
1923 Ga0495589_0023435
1924 Ga0495589_0047401
1925 Ga0495600_0090718
1926 Ga0495660_0000288
1927 Ga0495660_0022910
1928 Ga0495660_0043850
1929 Ga0495672_0000290
1930 Ga0495672_0003480
1931 Ga0495672_0028853
1932 Ga0495672_0030962
1933 Ga0495676_0006422
1934 Ga0495676_0160374
1935 Ga0495683_0069918
1936 Ga0495683_0096576
1937 Ga0495687_000023
1938 Ga0495687_000027
1939 Ga0495687_000576
1940 Ga0495687_035872
1941 Ga0495687_038404
1942 Ga0495675_0013071
1943 Ga0495677_0000001
1944 Ga0495677_0001805
1945 Ga0495677_0008447
1946 Ga0495686_0000222
1947 Ga0495686_0006302
1948 Ga0495686_0099767
1949 Ga0495686_0150721
1950 Ga0495602_0037073
1951 Ga0495614_0001247
1952 Ga0495626_0000037
1953 Ga0495626_0000520
1954 Ga0495626_0009773
1955 Ga0496100_0013999
1956 Ga0496101_0003842
1957 Ga0496101_0093699
1958 Ga0496102_0011197
1959 Ga0496102_0015225
1960 Ga0496102_0136122
1961 Ga0496104_0000625
1962 Ga0496104_0220223
1963 Ga0496105_0000638
1964 Ga0496106_0119092
1965 Ga0496107_0025622
1966 Ga0496108_0309349
1967 Ga0496108_0334502
1968 Ga0496109_0038690
1969 Ga0496109_0351051
1970 Ga0496110_0068024
1971 Ga0496110_0069420
1972 Ga0496110_0193355
1973 Ga0496114_0198788
1974 Ga0496115_0193859
1975 Ga0496116_0009153
1976 Ga0496117_0013047
1977 Ga0496117_0146500
1978 Ga0496118_0044479
1979 Ga0496121_0014532
1980 Ga0496121_0024441
1981 Ga0496121_0089658
1982 Ga0496122_0000103
1983 Ga0496122_0010319
1984 Ga0496122_0011628
1985 Ga0496123_0000261
1986 Ga0496123_0001777
1987 Ga0496123_0016312
1988 Ga0496123_0043105
1989 Ga0496124_0000919
1990 Ga0496124_0005843
1991 Ga0496124_0016567
1992 Ga0496124_0038513
1993 Ga0496124_0045738
1994 Ga0496124_0055493
1995 Ga0496125_0009347
1996 Ga0496125_0025933
1997 Ga0496125_0036972
1998 Ga0496125_0051204
1999 Ga0496125_0070582
2000 Ga0496126_0126193
2001 Ga0495678_014512
2002 Ga0501033_0086909
2003 Ga0501037_0244940
2004 Ga0501043_0000013
2005 Ga0501046_0000125
2006 Ga0501047_0000040
2007 Ga0501047_0081898
2008 Ga0501048_0002958
2009 Ga0501048_0234800
2010 Ga0501067_0066636
2011 Ga0501198_000006
2012 Ga0501222_000007
2013 Ga0501249_001056
2014 Ga0501252_003423
2015 Ga0501035_0000544
2016 Ga0501035_0000619
2017 Ga0501035_0038533
2018 Ga0501035_0199270
2019 Ga0501045_0007309
2020 nmdc:mga03683_72044_c1
2021 nmdc:mga03n38_12421_c1
2022 nmdc:mga00v17_43474_c1
2023 nmdc:mga0yw44_8064_c1
2024 nmdc:mga0k408_14479_c1
2025 nmdc:mga0k408_24141_c1
2026 nmdc:mga0k408_28275_c1
2027 nmdc:mga0k408_3121_c1
2028 nmdc:mga0k408_57296_c1
2029 nmdc:mga0k408_7091_c1
2030 nmdc:mga0k408_82161_c1
2031 nmdc:mga07m45_1225_c1
2032 nmdc:mga07m45_6523_c1
2033 nmdc:mga07m45_716_c1
2034 nmdc:mga07m45_73290_c1
2035 nmdc:mga05p37_39567_c1
2036 nmdc:mga09592_34033_c1
2037 nmdc:mga08y16_108239_c1
2038 Ga0500635_0000145
2039 Ga0500635_0034076
2040 Ga0500578_0000263
2041 Ga0500646_0011157
2042 Ga0500651_0000042
2043 Ga0500571_000385
2044 Ga0500593_000087
2045 Ga0500593_000436
2046 Ga0500593_016958
2047 Ga0500607_001690
2048 Ga0500607_010259
2049 Ga0500608_015146
2050 Ga0500626_009829
2051 Ga0500628_001481
2052 Ga0500652_001450
2053 Ga0500655_001604
2054 Ga0500658_0002529
2055 Ga0500658_0005455
2056 Ga0500559_0001528
2057 Ga0500559_0014366
2058 Ga0500559_0063266
2059 Ga0500564_004037
2060 Ga0500568_0016364
2061 Ga0500568_0050876
2062 Ga0500574_001626
2063 Ga0500619_000055
2064 Ga0500622_0000106
2065 Ga0500622_0005905
2066 Ga0500634_0037894
2067 Ga0500636_0015185
2068 Ga0500636_0021939
2069 Ga0500636_0037982
2070 Ga0500645_000100
2071 Ga0500645_005164
2072 Ga0500661_008746
2073 Ga0500661_016312
2074 Ga0590071_001534
2075 Ga0587079_002337
2076 Ga0466962_0004778
2077 Ga0466962_0051617
2078 2511245751
2079 2513226692
2080 2550693309
2081 2552747549
2082 2587726789
2083 2587732270
2084 2588295723
2085 2599625023
2086 2599673035
2087 2599682515
2088 2599694643
2089 2640735813
2090 2643799065
2091 2643971875
2092 2644030726
2093 2644139364
2094 2644159401
2095 2644274974
2096 2644329328
2097 2644337976
2098 2644361934
2099 2644401202
2100 2644467953
2101 2644473604
2102 2678229076
2103 2738717466
2104 2738879068
2105 2739248863
2106 2739278152
2107 2745159963
2108 2774390380
2109 2774437765
2110 2809143043
2111 2819540851
2112 2819593473
2113 2819596977
2114 2831266059
2115 2838057812
2116 2842679080
2117 2842735972
2118 2842748329
2119 2881102193
2120 2884814810
2121 2884840005
2122 2884857227
2123 2885197487
2124 2885203720
2125 2885216930
2126 2896157814
2127 2899930281
2128 2904456245
2129 2904457601
2130 2904482914
2131 2904543644
2132 2916700238
2133 2919184734
2134 2919466956
2135 2919507544
2136 2919704861
2137 2928039394
2138 2928045001
2139 2928052802
2140 2928064525
2141 2928075060
2142 2928088238
2143 2928116312
2144 2928517453
2145 2929162805
2146 2929527354
2147 2945911317
2148 2945947330
2149 2945977651
2150 2945986395
2151 2954772632
2152 2984571889
2153 8033234137
2154 8047679337

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

36

426

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l0o-assembly3.cif.gz_A structure determination of cystathionine gamma-synthase from helicobacter pylori 0.9526 65 399
4l0o-assembly2.cif.gz_O-2 structure determination of cystathionine gamma-synthase from helicobacter pylori 0.9393 58 398
6khq-assembly1.cif.gz_A-2 bacterial cystathionine gamma-lyase mccb of staphylococcus aureus with cofactor plp 0.9364 33 399
3qhx-assembly1.cif.gz_C crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes 0.9341 59 397
4u2h-assembly2.cif.gz_G the crystal structure of apo cale6, a methionine gamma lyase from micromonospora echinospora 0.9323 61 398
ID Description Score Start End Superfamily
af_A4I885_262_396_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9619 266 401 3.90.1150.10
1pffB01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9439 72 262 3.40.640.10
af_Q5ACX5_11_251_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.929 29 260 3.40.640.10
af_A4I885_262_396_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9275 266 401 3.90.1150.10
af_A4IBL4_19_270_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9231 25 260 3.40.640.10
ID Description Score Start End GO Terms
AF-K2LL61-F1-model_v4 Cys/Met metabolism pyridoxal-phosphate-dependent protein 0.9713 77 404 GO:0019346
GO:0019450
GO:0030170
GO:0047804
AF-A0A7C7X156-F1-model_v4 deleted 0.9687 103 313
AF-A0A529Y0P1-F1-model_v4 Cystathionine beta-lyase (EC 4.4.1.8) 0.9679 99 368 GO:0019346
GO:0019450
GO:0030170
GO:0047804
AF-A0A3B9EKY8-F1-model_v4 Cystathionine beta-lyase 0.9672 74 398 GO:0009086
GO:0019346
GO:0019450
GO:0030170
GO:0047804
AF-K2LL61-F1-model_v4 Cys/Met metabolism pyridoxal-phosphate-dependent protein 0.9654 77 404 GO:0019346
GO:0019450
GO:0030170
GO:0047804

Map