F489575
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1076 | 510 | 2154 | 395 |
Family's Representative Sequence
| Representative Sequence | 3300003794|Ga0055531_10013544|Ga0055531_100135443 |
| Length | 428 |
| Sequence | MKRDEGEGRSAHCATEAPRKAPNAGRASMHPMSKPSTNLIHHPYVPPATFAAPQPGVFKASTVFFADVAAMRARDWRTKAGYTYGLHGTPTTFTLEERLATLEGGTECLLVPSGLAAISLVSFAFLKTGDEVLIPDNAYGPNKALATGELANFGVTHRLYDAMNPADLAAKLSERTRLVWLEAAGSVTMEFPDLPALASICRARGVMTVLDNTWGAGLAFAPFDFNGSGQGVDISVHALTKYPSGGGDVLMGSVTTRDERLHRALKLTHMRMGFGIGVGDVETLLRSLPSIALRYAAHDRAARELAGWLNGCEEIAQVLHPALEDSPGHTHWRALCGETNLAAGLFSVVFDERYSTEQVDRFCDSLQLFRLGYSWGGPISLVVPYDIGLMRDASVARWPYKGTLVRFSIGLEDVEDLRADLQQALARM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 38 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 41 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 228 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 229 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 230 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 231 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 261 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 262 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 263 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 264 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 266 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 267 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 268 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 269 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 270 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 271 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 272 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 273 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 274 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 275 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 276 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 277 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 278 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 279 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 280 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 281 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 282 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 283 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 284 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 285 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 286 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 287 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 288 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 289 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 290 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 291 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 292 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 367 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 368 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 369 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 370 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 371 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 374 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 375 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 376 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 377 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 380 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 381 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 382 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 383 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 384 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 385 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 394 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 395 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 396 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 401 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 404 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 405 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 409 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 410 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 411 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 412 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 414 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 415 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 416 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 417 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 418 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 419 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 420 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 425 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 426 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 427 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 428 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 430 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 431 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 432 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 434 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 435 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 436 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 437 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 438 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 439 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 440 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 441 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 442 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 443 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 444 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 445 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 446 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 447 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 448 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 449 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 450 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 451 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 452 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 453 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 454 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 455 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 456 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 457 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 458 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 459 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 460 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 461 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 462 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 463 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 464 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 465 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 466 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 467 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 468 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 469 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 470 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 471 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 472 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 473 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 474 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 475 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 476 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 477 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 478 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 479 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 480 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 481 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 482 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 483 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 484 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 485 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 486 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 487 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 488 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 489 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 490 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 491 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 492 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 493 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 494 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 495 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 496 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 497 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 498 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 499 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 500 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 501 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 502 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 503 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 504 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 505 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 506 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 507 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 508 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 509 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 510 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.57 |
| Metatranscriptomes | 0.28 |
| Isolates | 7.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 23.98 |
| Nodule | 0.46 |
| Rhizoplane | 2.23 |
| Rhizosphere | 61.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055531_10013544 | 3300003794 | Bacteria | 3751 |
| 2 | JGI24740J21852_10001948 | 3300001979 | Bacteria | 9448 |
| 3 | JGI24740J21852_10030573 | 3300001979 | Bacteria | 1749 |
| 4 | JGI25155J39150_1000002 | 3300002704 | Bacteria | 292156 |
| 5 | JGI25155J39150_1000691 | 3300002704 | Bacteria | 6256 |
| 6 | JGI25156J39149_1000003 | 3300002705 | Bacteria | 305434 |
| 7 | JGI25156J39149_1000114 | 3300002705 | Bacteria | 57756 |
| 8 | JGI25156J39149_1000892 | 3300002705 | Bacteria | 14717 |
| 9 | JGI25156J39149_1006515 | 3300002705 | Bacteria | 3179 |
| 10 | JGI25154J39366_1000009 | 3300002738 | Bacteria | 305408 |
| 11 | JGI25154J39366_1000411 | 3300002738 | Bacteria | 23133 |
| 12 | JGI25154J39366_1001903 | 3300002738 | Bacteria | 6318 |
| 13 | JGI25158J39367_1010631 | 3300002739 | Bacteria | 1240 |
| 14 | JGI25157J39369_1000002 | 3300002741 | Bacteria | 305434 |
| 15 | JGI25157J39369_1000015 | 3300002741 | Bacteria | 194042 |
| 16 | JGI25157J39369_1000382 | 3300002741 | Bacteria | 30479 |
| 17 | JGI25152J39213_1003863 | 3300002773 | Bacteria | 4932 |
| 18 | JGI25152J39213_1004531 | 3300002773 | Bacteria | 4345 |
| 19 | JGI25152J39213_1005460 | 3300002773 | Bacteria | 3701 |
| 20 | JGI25150J39212_1000565 | 3300002774 | Bacteria | 14789 |
| 21 | JGI25150J39212_1000739 | 3300002774 | Bacteria | 11582 |
| 22 | JGI25150J39212_1001528 | 3300002774 | Bacteria | 6363 |
| 23 | JGI25150J39212_1004000 | 3300002774 | Bacteria | 3353 |
| 24 | JGI25150J39212_1009619 | 3300002774 | Bacteria | 1830 |
| 25 | JGI25159J45721_1002000 | 3300002987 | Bacteria | 8098 |
| 26 | JGI25159J45721_1002011 | 3300002987 | Bacteria | 8068 |
| 27 | JGI25159J45721_1003775 | 3300002987 | Bacteria | 5225 |
| 28 | JGI25159J45721_1005761 | 3300002987 | Bacteria | 3833 |
| 29 | JGI25151J46595_10000913 | 3300003187 | Bacteria | 23081 |
| 30 | JGI25151J46595_10007569 | 3300003187 | Bacteria | 5307 |
| 31 | JGI25151J46595_10012667 | 3300003187 | Bacteria | 3827 |
| 32 | JGI25151J46595_10013335 | 3300003187 | Bacteria | 3701 |
| 33 | JGI25153J46596_10001949 | 3300003215 | Bacteria | 12229 |
| 34 | JGI25153J46596_10004931 | 3300003215 | Bacteria | 7091 |
| 35 | JGI25153J46596_10008323 | 3300003215 | Bacteria | 4977 |
| 36 | JGI25153J46596_10012325 | 3300003215 | Bacteria | 3701 |
| 37 | rootH1_10005490 | 3300003316 | Bacteria | 4486 |
| 38 | rootH1_10005490 | 3300003323 | Bacteria | 4253 |
| 39 | rootH1_10028592 | 3300003316 | Bacteria | 2016 |
| 40 | rootH1_10028592 | 3300003323 | Bacteria | 35557 |
| 41 | rootH1_10066715 | 3300003316 | Bacteria | 2940 |
| 42 | rootH2_10021047 | 3300003320 | Bacteria | 1998 |
| 43 | rootL2_10024592 | 3300003322 | Bacteria | 3297 |
| 44 | rootL2_10059824 | 3300003322 | Bacteria | 3378 |
| 45 | rootL2_10151440 | 3300003322 | Bacteria | 3857 |
| 46 | rootL2_10151441 | 3300003322 | Bacteria | 3623 |
| 47 | rootH1_10082267 | 3300003323 | Bacteria | 1826 |
| 48 | rootH1_10127265 | 3300003323 | Bacteria | 1753 |
| 49 | JGI25160J50197_1000305 | 3300003354 | Bacteria | 34747 |
| 50 | JGI25160J50197_1009151 | 3300003354 | Bacteria | 3701 |
| 51 | JGI25160J50197_1009161 | 3300003354 | Bacteria | 3698 |
| 52 | JGI25161J50226_1000018 | 3300003374 | Bacteria | 172599 |
| 53 | JGI25161J50226_1001955 | 3300003374 | Bacteria | 5670 |
| 54 | JGI25161J50226_1002370 | 3300003374 | Bacteria | 4861 |
| 55 | Ga0006562J51391_1079656 | 3300003578 | Bacteria | 7750 |
| 56 | Ga0032354_1026629 | 3300003693 | Bacteria | 3261 |
| 57 | Ga0055539_1000170 | 3300003752 | Bacteria | 57928 |
| 58 | Ga0055533_1000010 | 3300003756 | Bacteria | 491196 |
| 59 | Ga0055532_1000050 | 3300003758 | Bacteria | 169240 |
| 60 | Ga0055525_1000025 | 3300003759 | Bacteria | 347582 |
| 61 | Ga0055535_1000272 | 3300003761 | Bacteria | 54297 |
| 62 | Ga0055535_1001094 | 3300003761 | Bacteria | 16519 |
| 63 | Ga0055542_1000027 | 3300003762 | Bacteria | 254819 |
| 64 | Ga0055529_1000303 | 3300003763 | Bacteria | 56663 |
| 65 | Ga0055526_1003334 | 3300003771 | Bacteria | 10266 |
| 66 | Ga0055526_1007206 | 3300003771 | Bacteria | 5840 |
| 67 | Ga0055526_1009048 | 3300003771 | Bacteria | 4859 |
| 68 | Ga0055526_1010409 | 3300003771 | Bacteria | 4329 |
| 69 | Ga0055537_1000008 | 3300003773 | Bacteria | 142572 |
| 70 | Ga0055537_1001609 | 3300003773 | Bacteria | 8505 |
| 71 | Ga0055537_1004710 | 3300003773 | Bacteria | 3833 |
| 72 | Ga0055537_1008970 | 3300003773 | Bacteria | 2252 |
| 73 | Ga0055524_1000083 | 3300003775 | Bacteria | 119259 |
| 74 | Ga0055524_1008285 | 3300003775 | Bacteria | 4329 |
| 75 | Ga0055524_1008318 | 3300003775 | Bacteria | 4320 |
| 76 | Ga0055536_1001279 | 3300003781 | Bacteria | 15502 |
| 77 | Ga0055536_1003548 | 3300003781 | Bacteria | 8348 |
| 78 | Ga0055536_1008349 | 3300003781 | Bacteria | 4469 |
| 79 | Ga0055536_1009960 | 3300003781 | Bacteria | 3846 |
| 80 | Ga0055536_1017236 | 3300003781 | Bacteria | 2374 |
| 81 | Ga0055534_1001020 | 3300003784 | Bacteria | 12310 |
| 82 | Ga0055534_1001670 | 3300003784 | Bacteria | 8513 |
| 83 | Ga0055534_1002378 | 3300003784 | Bacteria | 6554 |
| 84 | Ga0055534_1004960 | 3300003784 | Bacteria | 3701 |
| 85 | Ga0055534_1007216 | 3300003784 | Bacteria | 2686 |
| 86 | Ga0055528_1000803 | 3300003790 | Bacteria | 21689 |
| 87 | Ga0055528_1003113 | 3300003790 | Bacteria | 8513 |
| 88 | Ga0055528_1008869 | 3300003790 | Bacteria | 4256 |
| 89 | Ga0055528_1019437 | 3300003790 | Bacteria | 2252 |
| 90 | Ga0055530_10000211 | 3300003791 | Bacteria | 52600 |
| 91 | Ga0055530_10001348 | 3300003791 | Bacteria | 18336 |
| 92 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 93 | Ga0055540_1002608 | 3300003792 | Bacteria | 9384 |
| 94 | Ga0055540_1003019 | 3300003792 | Bacteria | 8415 |
| 95 | Ga0055540_1007006 | 3300003792 | Bacteria | 4348 |
| 96 | Ga0055540_1012261 | 3300003792 | Bacteria | 2703 |
| 97 | Ga0055531_10001052 | 3300003794 | Bacteria | 21756 |
| 98 | Ga0055531_10003480 | 3300003794 | Bacteria | 10014 |
| 99 | Ga0055531_10006241 | 3300003794 | Bacteria | 6804 |
| 100 | Ga0055541_1000819 | 3300003841 | Bacteria | 7654 |
| 101 | Ga0058692_1000048 | 3300003856 | Bacteria | 110906 |
| 102 | Ga0055543_1000542 | 3300004625 | Bacteria | 21255 |
| 103 | Ga0055543_1002593 | 3300004625 | Bacteria | 5850 |
| 104 | Ga0055543_1004978 | 3300004625 | Bacteria | 3478 |
| 105 | Ga0065165_1009407 | 3300005262 | Bacteria | 4385 |
| 106 | Ga0065165_1013299 | 3300005262 | Bacteria | 3283 |
| 107 | Ga0065165_1013384 | 3300005262 | Bacteria | 3265 |
| 108 | Ga0065165_1018335 | 3300005262 | Bacteria | 2536 |
| 109 | Ga0065703_1000509 | 3300005272 | Bacteria | 21018 |
| 110 | Ga0065714_10069896 | 3300005288 | Bacteria | 4044 |
| 111 | Ga0065704_10121033 | 3300005289 | Bacteria | 1772 |
| 112 | Ga0065707_10087372 | 3300005295 | Bacteria | 5054 |
| 113 | Ga0070658_10018493 | 3300005327 | Bacteria | 5579 |
| 114 | Ga0070658_10038314 | 3300005327 | Bacteria | 3866 |
| 115 | Ga0070658_10040315 | 3300005327 | Bacteria | 3767 |
| 116 | Ga0070658_10171620 | 3300005327 | Bacteria | 1822 |
| 117 | Ga0070676_10015051 | 3300005328 | Bacteria | 4261 |
| 118 | Ga0070670_100033286 | 3300005331 | Bacteria | 4439 |
| 119 | Ga0070670_100039435 | 3300005331 | Bacteria | 4061 |
| 120 | Ga0068869_100010918 | 3300005334 | Bacteria | 5943 |
| 121 | Ga0068869_100130324 | 3300005334 | Bacteria | 1932 |
| 122 | Ga0070666_10027485 | 3300005335 | Bacteria | 3726 |
| 123 | Ga0070680_100020784 | 3300005336 | Bacteria | 5208 |
| 124 | Ga0070680_100059021 | 3300005336 | Bacteria | 3138 |
| 125 | Ga0068868_100031542 | 3300005338 | Bacteria | 4072 |
| 126 | Ga0068868_100045313 | 3300005338 | Bacteria | 3440 |
| 127 | Ga0068868_100096815 | 3300005338 | Bacteria | 2384 |
| 128 | Ga0070660_100025701 | 3300005339 | Bacteria | 4378 |
| 129 | Ga0070660_100030405 | 3300005339 | Bacteria | 4052 |
| 130 | Ga0070660_100068993 | 3300005339 | Bacteria | 2756 |
| 131 | Ga0070687_100019322 | 3300005343 | Bacteria | 3168 |
| 132 | Ga0070661_100079125 | 3300005344 | Bacteria | 2425 |
| 133 | Ga0070668_100026977 | 3300005347 | Bacteria | 4360 |
| 134 | Ga0070669_100000505 | 3300005353 | Bacteria | 29404 |
| 135 | Ga0070669_100026320 | 3300005353 | Bacteria | 4185 |
| 136 | Ga0070669_100049534 | 3300005353 | Bacteria | 3066 |
| 137 | Ga0070675_100037029 | 3300005354 | Bacteria | 3972 |
| 138 | Ga0070675_100197203 | 3300005354 | Bacteria | 1746 |
| 139 | Ga0070671_100010843 | 3300005355 | Bacteria | 7312 |
| 140 | Ga0070671_100193314 | 3300005355 | Bacteria | 1725 |
| 141 | Ga0070674_100105629 | 3300005356 | Bacteria | 2059 |
| 142 | Ga0070674_100242453 | 3300005356 | Bacteria | 1412 |
| 143 | Ga0070673_100013275 | 3300005364 | Bacteria | 5690 |
| 144 | Ga0070673_100157786 | 3300005364 | Bacteria | 1927 |
| 145 | Ga0070659_100030067 | 3300005366 | Bacteria | 4202 |
| 146 | Ga0070659_100041871 | 3300005366 | Bacteria | 3581 |
| 147 | Ga0070667_100014015 | 3300005367 | Bacteria | 6626 |
| 148 | Ga0070667_100069592 | 3300005367 | Bacteria | 2995 |
| 149 | Ga0070700_100033487 | 3300005441 | Bacteria | 3095 |
| 150 | Ga0070708_100226695 | 3300005445 | Bacteria | 1753 |
| 151 | Ga0070708_100402903 | 3300005445 | Bacteria | 1290 |
| 152 | Ga0070663_100001487 | 3300005455 | Bacteria | 12886 |
| 153 | Ga0070678_100056477 | 3300005456 | Bacteria | 2871 |
| 154 | Ga0070678_100062218 | 3300005456 | Bacteria | 2755 |
| 155 | Ga0070678_100304656 | 3300005456 | Bacteria | 1355 |
| 156 | Ga0070662_100002137 | 3300005457 | Bacteria | 12120 |
| 157 | Ga0070662_100062258 | 3300005457 | Bacteria | 2726 |
| 158 | Ga0070662_100064353 | 3300005457 | Bacteria | 2685 |
| 159 | Ga0070662_100074332 | 3300005457 | Bacteria | 2514 |
| 160 | Ga0070662_100121964 | 3300005457 | Bacteria | 1999 |
| 161 | Ga0068867_100000068 | 3300005459 | Bacteria | 62945 |
| 162 | Ga0068867_100002788 | 3300005459 | Bacteria | 12291 |
| 163 | Ga0068867_100080469 | 3300005459 | Bacteria | 2453 |
| 164 | Ga0070706_100000546 | 3300005467 | Bacteria | 43742 |
| 165 | Ga0070707_100020993 | 3300005468 | Bacteria | 6166 |
| 166 | Ga0070698_100056391 | 3300005471 | Bacteria | 3982 |
| 167 | Ga0070699_100157087 | 3300005518 | Bacteria | 2012 |
| 168 | Ga0070679_100016791 | 3300005530 | Bacteria | 7074 |
| 169 | Ga0070679_100092470 | 3300005530 | Bacteria | 3012 |
| 170 | Ga0068853_100006411 | 3300005539 | Bacteria | 9350 |
| 171 | Ga0068853_100135846 | 3300005539 | Bacteria | 2204 |
| 172 | Ga0068853_100290528 | 3300005539 | Bacteria | 1509 |
| 173 | Ga0068853_100298045 | 3300005539 | Bacteria | 1490 |
| 174 | Ga0070672_100031212 | 3300005543 | Bacteria | 4009 |
| 175 | Ga0070672_100046346 | 3300005543 | Bacteria | 3368 |
| 176 | Ga0070672_100052964 | 3300005543 | Bacteria | 3171 |
| 177 | Ga0070672_100058235 | 3300005543 | Bacteria | 3035 |
| 178 | Ga0070686_100123044 | 3300005544 | Bacteria | 1784 |
| 179 | Ga0070665_100057573 | 3300005548 | Bacteria | 3896 |
| 180 | Ga0070665_100305252 | 3300005548 | Bacteria | 1595 |
| 181 | Ga0068855_100016796 | 3300005563 | Bacteria | 8800 |
| 182 | Ga0068855_100054224 | 3300005563 | Bacteria | 4712 |
| 183 | Ga0068855_100078830 | 3300005563 | Bacteria | 3821 |
| 184 | Ga0068855_100093120 | 3300005563 | Bacteria | 3475 |
| 185 | Ga0070664_100034408 | 3300005564 | Bacteria | 4250 |
| 186 | Ga0070664_100073880 | 3300005564 | Bacteria | 2926 |
| 187 | Ga0068857_100120816 | 3300005577 | Bacteria | 2359 |
| 188 | Ga0068854_100114687 | 3300005578 | Bacteria | 2037 |
| 189 | Ga0068856_100094383 | 3300005614 | Bacteria | 2978 |
| 190 | Ga0068852_100072580 | 3300005616 | Bacteria | 3025 |
| 191 | Ga0068852_100135184 | 3300005616 | Bacteria | 2276 |
| 192 | Ga0068852_100145677 | 3300005616 | Bacteria | 2197 |
| 193 | Ga0068859_100132548 | 3300005617 | Bacteria | 2564 |
| 194 | Ga0068864_100168139 | 3300005618 | Bacteria | 1998 |
| 195 | Ga0068866_10019208 | 3300005718 | Bacteria | 3105 |
| 196 | Ga0068861_100007929 | 3300005719 | Bacteria | 7306 |
| 197 | Ga0068870_10041881 | 3300005840 | Bacteria | 2382 |
| 198 | Ga0068863_100025781 | 3300005841 | Bacteria | 5608 |
| 199 | Ga0068863_100233463 | 3300005841 | Bacteria | 1775 |
| 200 | Ga0068858_100081232 | 3300005842 | Bacteria | 3013 |
| 201 | Ga0068860_100001531 | 3300005843 | Bacteria | 24900 |
| 202 | Ga0068860_100024244 | 3300005843 | Bacteria | 5865 |
| 203 | Ga0068860_100092512 | 3300005843 | Bacteria | 2882 |
| 204 | Ga0068860_100110616 | 3300005843 | Bacteria | 2626 |
| 205 | Ga0068862_100014947 | 3300005844 | Bacteria | 6448 |
| 206 | Ga0068862_100173655 | 3300005844 | Bacteria | 1930 |
| 207 | Ga0068862_100177323 | 3300005844 | Bacteria | 1911 |
| 208 | Ga0075365_10001836 | 3300006038 | Bacteria | 9950 |
| 209 | Ga0075365_10008898 | 3300006038 | Bacteria | 5731 |
| 210 | Ga0075368_10040997 | 3300006042 | Bacteria | 1818 |
| 211 | Ga0075363_100001597 | 3300006048 | Bacteria | 8718 |
| 212 | Ga0075363_100005158 | 3300006048 | Bacteria | 5781 |
| 213 | Ga0075364_10013716 | 3300006051 | Bacteria | 4991 |
| 214 | Ga0075432_10000616 | 3300006058 | Bacteria | 10821 |
| 215 | Ga0075432_10015499 | 3300006058 | Bacteria | 2600 |
| 216 | Ga0075362_10009027 | 3300006177 | Bacteria | 3838 |
| 217 | Ga0075366_10006250 | 3300006195 | Bacteria | 6512 |
| 218 | Ga0075366_10019182 | 3300006195 | Bacteria | 3953 |
| 219 | Ga0075366_10032602 | 3300006195 | Bacteria | 3067 |
| 220 | Ga0075366_10039702 | 3300006195 | Bacteria | 2781 |
| 221 | Ga0075366_10052693 | 3300006195 | Bacteria | 2417 |
| 222 | Ga0075366_10138517 | 3300006195 | Bacteria | 1470 |
| 223 | Ga0097621_100182539 | 3300006237 | Bacteria | 1813 |
| 224 | Ga0075370_10000587 | 3300006353 | Bacteria | 14051 |
| 225 | Ga0075370_10001047 | 3300006353 | Bacteria | 11498 |
| 226 | Ga0075370_10001173 | 3300006353 | Bacteria | 11030 |
| 227 | Ga0075370_10006112 | 3300006353 | Bacteria | 6038 |
| 228 | Ga0075370_10007691 | 3300006353 | Bacteria | 5502 |
| 229 | Ga0075370_10008959 | 3300006353 | Bacteria | 5174 |
| 230 | Ga0075370_10024844 | 3300006353 | Bacteria | 3312 |
| 231 | Ga0075370_10035531 | 3300006353 | Bacteria | 2797 |
| 232 | Ga0068871_100099219 | 3300006358 | Bacteria | 2437 |
| 233 | Ga0068871_100112165 | 3300006358 | Bacteria | 2294 |
| 234 | Ga0075429_100001338 | 3300006880 | Bacteria | 20124 |
| 235 | Ga0068865_100021324 | 3300006881 | Bacteria | 4211 |
| 236 | Ga0097620_100132552 | 3300006931 | Bacteria | 2564 |
| 237 | Ga0099826_10004770 | 3300006948 | Bacteria | 9573 |
| 238 | Ga0105251_10020910 | 3300009011 | Bacteria | 3429 |
| 239 | Ga0105244_10013824 | 3300009036 | Bacteria | 4696 |
| 240 | Ga0105244_10014112 | 3300009036 | Bacteria | 4634 |
| 241 | Ga0105244_10042806 | 3300009036 | Bacteria | 2339 |
| 242 | Ga0105244_10103317 | 3300009036 | Bacteria | 1392 |
| 243 | Ga0105240_10009231 | 3300009093 | Bacteria | 13992 |
| 244 | Ga0105240_10010696 | 3300009093 | Bacteria | 12874 |
| 245 | Ga0105240_10021627 | 3300009093 | Bacteria | 8555 |
| 246 | Ga0105240_10502748 | 3300009093 | Bacteria | 1347 |
| 247 | Ga0105247_10000594 | 3300009101 | Bacteria | 29366 |
| 248 | Ga0105247_10009842 | 3300009101 | Bacteria | 5794 |
| 249 | Ga0105243_10001337 | 3300009148 | Bacteria | 21977 |
| 250 | Ga0105243_10001406 | 3300009148 | Bacteria | 21287 |
| 251 | Ga0105243_10001511 | 3300009148 | Bacteria | 20313 |
| 252 | Ga0105243_10005195 | 3300009148 | Bacteria | 10188 |
| 253 | Ga0105243_10113599 | 3300009148 | Bacteria | 2271 |
| 254 | Ga0105243_10130169 | 3300009148 | Bacteria | 2134 |
| 255 | Ga0105241_10007529 | 3300009174 | Bacteria | 8008 |
| 256 | Ga0105241_10015401 | 3300009174 | Bacteria | 5600 |
| 257 | Ga0105242_10049900 | 3300009176 | Bacteria | 3407 |
| 258 | Ga0105242_10171471 | 3300009176 | Bacteria | 1907 |
| 259 | Ga0105248_10055655 | 3300009177 | Bacteria | 4438 |
| 260 | Ga0105248_10228257 | 3300009177 | Bacteria | 2096 |
| 261 | Ga0105248_10228943 | 3300009177 | Bacteria | 2092 |
| 262 | Ga0105248_10274930 | 3300009177 | Bacteria | 1896 |
| 263 | Ga0105248_10377590 | 3300009177 | Bacteria | 1596 |
| 264 | Ga0105237_10007228 | 3300009545 | Bacteria | 12184 |
| 265 | Ga0105238_10152057 | 3300009551 | Bacteria | 2290 |
| 266 | Ga0105249_10001295 | 3300009553 | Bacteria | 21902 |
| 267 | Ga0105249_10178571 | 3300009553 | Bacteria | 2064 |
| 268 | Ga0105239_10008196 | 3300010375 | Bacteria | 11921 |
| 269 | Ga0105239_10028770 | 3300010375 | Bacteria | 6111 |
| 270 | Ga0105239_10326941 | 3300010375 | Bacteria | 1729 |
| 271 | Ga0157326_1003845 | 3300012513 | Bacteria | 1577 |
| 272 | Ga0157373_10028793 | 3300013100 | Bacteria | 4006 |
| 273 | Ga0157373_10053200 | 3300013100 | Bacteria | 2879 |
| 274 | Ga0157371_10000026 | 3300013102 | Bacteria | 274703 |
| 275 | Ga0157371_10003698 | 3300013102 | Bacteria | 13731 |
| 276 | Ga0157371_10038683 | 3300013102 | Bacteria | 3412 |
| 277 | Ga0157370_10024246 | 3300013104 | Bacteria | 6010 |
| 278 | Ga0157369_10012180 | 3300013105 | Bacteria | 9761 |
| 279 | Ga0157374_10029219 | 3300013296 | Bacteria | 4988 |
| 280 | Ga0157378_10003676 | 3300013297 | Bacteria | 13606 |
| 281 | Ga0157378_10121800 | 3300013297 | Bacteria | 2405 |
| 282 | Ga0163162_10000997 | 3300013306 | Bacteria | 26311 |
| 283 | Ga0163162_10037247 | 3300013306 | Bacteria | 4853 |
| 284 | Ga0157375_10027584 | 3300013308 | Bacteria | 5309 |
| 285 | Ga0157375_10057010 | 3300013308 | Bacteria | 3860 |
| 286 | Ga0157375_10324453 | 3300013308 | Bacteria | 1704 |
| 287 | Ga0157375_10420560 | 3300013308 | Bacteria | 1502 |
| 288 | Ga0182008_10000838 | 3300014497 | Bacteria | 21458 |
| 289 | Ga0182008_10005897 | 3300014497 | Bacteria | 6922 |
| 290 | Ga0182008_10007674 | 3300014497 | Bacteria | 5946 |
| 291 | Ga0182008_10034289 | 3300014497 | Bacteria | 2545 |
| 292 | Ga0182008_10041559 | 3300014497 | Bacteria | 2293 |
| 293 | Ga0157377_10000082 | 3300014745 | Bacteria | 74078 |
| 294 | Ga0157379_10034173 | 3300014968 | Bacteria | 4532 |
| 295 | Ga0157376_10003154 | 3300014969 | Bacteria | 11324 |
| 296 | Ga0157376_10191638 | 3300014969 | Bacteria | 1875 |
| 297 | Ga0182006_1001492 | 3300015261 | Bacteria | 14052 |
| 298 | Ga0182007_10001563 | 3300015262 | Bacteria | 12216 |
| 299 | Ga0182007_10001757 | 3300015262 | Bacteria | 11382 |
| 300 | Ga0182007_10004781 | 3300015262 | Bacteria | 6086 |
| 301 | Ga0182007_10010798 | 3300015262 | Bacteria | 3588 |
| 302 | Ga0182005_1005148 | 3300015265 | Bacteria | 4114 |
| 303 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 304 | Ga0163161_10000065 | 3300017792 | Bacteria | 108321 |
| 305 | Ga0163161_10012915 | 3300017792 | Bacteria | 5803 |
| 306 | Ga0163161_10032482 | 3300017792 | Bacteria | 3727 |
| 307 | Ga0163161_10049481 | 3300017792 | Bacteria | 3038 |
| 308 | Ga0213872_10000160 | 3300021361 | Bacteria | 61551 |
| 309 | Ga0213872_10002596 | 3300021361 | Bacteria | 10511 |
| 310 | Ga0213872_10045361 | 3300021361 | Bacteria | 2000 |
| 311 | Ga0213872_10066727 | 3300021361 | Bacteria | 1624 |
| 312 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 313 | Ga0209435_100029 | 3300025206 | Bacteria | 176358 |
| 314 | Ga0209436_105483 | 3300025208 | Bacteria | 2912 |
| 315 | Ga0209436_108819 | 3300025208 | Bacteria | 1971 |
| 316 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 317 | Ga0209672_100563 | 3300025228 | Bacteria | 19696 |
| 318 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 319 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 320 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 321 | Ga0207427_100468 | 3300025231 | Bacteria | 22112 |
| 322 | Ga0209258_100048 | 3300025242 | Bacteria | 365881 |
| 323 | Ga0209258_100163 | 3300025242 | Bacteria | 149677 |
| 324 | Ga0209258_100903 | 3300025242 | Bacteria | 15270 |
| 325 | Ga0207425_1000204 | 3300025245 | Bacteria | 47226 |
| 326 | Ga0207425_1000275 | 3300025245 | Bacteria | 37897 |
| 327 | Ga0207425_1001012 | 3300025245 | Bacteria | 13169 |
| 328 | Ga0207425_1003668 | 3300025245 | Bacteria | 4835 |
| 329 | Ga0207425_1005152 | 3300025245 | Bacteria | 3773 |
| 330 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 331 | Ga0209646_1000109 | 3300025246 | Bacteria | 158348 |
| 332 | Ga0209646_1000226 | 3300025246 | Bacteria | 60008 |
| 333 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 334 | Ga0209026_1000021 | 3300025250 | Bacteria | 375165 |
| 335 | Ga0209026_1000467 | 3300025250 | Bacteria | 31163 |
| 336 | Ga0209677_100106 | 3300025253 | Bacteria | 89125 |
| 337 | Ga0209677_100480 | 3300025253 | Bacteria | 22721 |
| 338 | Ga0209677_103060 | 3300025253 | Bacteria | 5715 |
| 339 | Ga0209677_106594 | 3300025253 | Bacteria | 2709 |
| 340 | Ga0209148_1000040 | 3300025254 | Bacteria | 473531 |
| 341 | Ga0209148_1000811 | 3300025254 | Bacteria | 22634 |
| 342 | Ga0209148_1004695 | 3300025254 | Bacteria | 3294 |
| 343 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 344 | Ga0209759_1000025 | 3300025256 | Bacteria | 317082 |
| 345 | Ga0209759_1000698 | 3300025256 | Bacteria | 30092 |
| 346 | Ga0209759_1000939 | 3300025256 | Bacteria | 20977 |
| 347 | Ga0209759_1011786 | 3300025256 | Bacteria | 2462 |
| 348 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 349 | Ga0209129_1000025 | 3300025258 | Bacteria | 413639 |
| 350 | Ga0209129_1001079 | 3300025258 | Bacteria | 16032 |
| 351 | Ga0209129_1004771 | 3300025258 | Bacteria | 5128 |
| 352 | Ga0209129_1011044 | 3300025258 | Bacteria | 2191 |
| 353 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 354 | Ga0209565_1000105 | 3300025263 | Bacteria | 122895 |
| 355 | Ga0209565_1000153 | 3300025263 | Bacteria | 92909 |
| 356 | Ga0209565_1000974 | 3300025263 | Bacteria | 14824 |
| 357 | Ga0209565_1002008 | 3300025263 | Bacteria | 7887 |
| 358 | Ga0209455_1000059 | 3300025272 | Bacteria | 339995 |
| 359 | Ga0209673_1000074 | 3300025273 | Bacteria | 233552 |
| 360 | Ga0209673_1000794 | 3300025273 | Bacteria | 42072 |
| 361 | Ga0209673_1001641 | 3300025273 | Bacteria | 19354 |
| 362 | Ga0209673_1001648 | 3300025273 | Bacteria | 19319 |
| 363 | Ga0209673_1002152 | 3300025273 | Bacteria | 14596 |
| 364 | Ga0209130_1000050 | 3300025284 | Bacteria | 222092 |
| 365 | Ga0209130_1000172 | 3300025284 | Bacteria | 93199 |
| 366 | Ga0209130_1000329 | 3300025284 | Bacteria | 54511 |
| 367 | Ga0209130_1000584 | 3300025284 | Bacteria | 35499 |
| 368 | Ga0209130_1001746 | 3300025284 | Bacteria | 12941 |
| 369 | Ga0209675_1000044 | 3300025291 | Bacteria | 230392 |
| 370 | Ga0209675_1000150 | 3300025291 | Bacteria | 92909 |
| 371 | Ga0209675_1001275 | 3300025291 | Bacteria | 15058 |
| 372 | Ga0209675_1001400 | 3300025291 | Bacteria | 13998 |
| 373 | Ga0209675_1001905 | 3300025291 | Bacteria | 11256 |
| 374 | Ga0209675_1003456 | 3300025291 | Bacteria | 7502 |
| 375 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 376 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 377 | Ga0209676_1001207 | 3300025292 | Bacteria | 27585 |
| 378 | Ga0209676_1001472 | 3300025292 | Bacteria | 21882 |
| 379 | Ga0209676_1002733 | 3300025292 | Bacteria | 11845 |
| 380 | Ga0209676_1002909 | 3300025292 | Bacteria | 11198 |
| 381 | Ga0209676_1010857 | 3300025292 | Bacteria | 3739 |
| 382 | Ga0209025_1000111 | 3300025294 | Bacteria | 218982 |
| 383 | Ga0209025_1000217 | 3300025294 | Bacteria | 137909 |
| 384 | Ga0209025_1000624 | 3300025294 | Bacteria | 62814 |
| 385 | Ga0209025_1001851 | 3300025294 | Bacteria | 24838 |
| 386 | Ga0209025_1003136 | 3300025294 | Bacteria | 16165 |
| 387 | Ga0209025_1033805 | 3300025294 | Bacteria | 2353 |
| 388 | Ga0209025_1052123 | 3300025294 | Bacteria | 1618 |
| 389 | Ga0209564_1000039 | 3300025295 | Bacteria | 413604 |
| 390 | Ga0209564_1000153 | 3300025295 | Bacteria | 166910 |
| 391 | Ga0209564_1000337 | 3300025295 | Bacteria | 90545 |
| 392 | Ga0209564_1000470 | 3300025295 | Bacteria | 67507 |
| 393 | Ga0209564_1002160 | 3300025295 | Bacteria | 16575 |
| 394 | Ga0209564_1029015 | 3300025295 | Bacteria | 1751 |
| 395 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 396 | Ga0209758_1000163 | 3300025297 | Bacteria | 151988 |
| 397 | Ga0209758_1000287 | 3300025297 | Bacteria | 99234 |
| 398 | Ga0209758_1003748 | 3300025297 | Bacteria | 13455 |
| 399 | Ga0209758_1007561 | 3300025297 | Bacteria | 7346 |
| 400 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 401 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 402 | Ga0209050_1000325 | 3300025298 | Bacteria | 95686 |
| 403 | Ga0209050_1000412 | 3300025298 | Bacteria | 79647 |
| 404 | Ga0209050_1004195 | 3300025298 | Bacteria | 9969 |
| 405 | Ga0209050_1004259 | 3300025298 | Bacteria | 9827 |
| 406 | Ga0209050_1005909 | 3300025298 | Bacteria | 7472 |
| 407 | Ga0209050_1013114 | 3300025298 | Bacteria | 3720 |
| 408 | Ga0209050_1030822 | 3300025298 | Bacteria | 1685 |
| 409 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 410 | Ga0209256_1000425 | 3300025299 | Bacteria | 66308 |
| 411 | Ga0209256_1001308 | 3300025299 | Bacteria | 26755 |
| 412 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 413 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 414 | Ga0207426_1000071 | 3300025302 | Bacteria | 329539 |
| 415 | Ga0207426_1000692 | 3300025302 | Bacteria | 40473 |
| 416 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 417 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 418 | Ga0209051_1000150 | 3300025303 | Bacteria | 132005 |
| 419 | Ga0209051_1000268 | 3300025303 | Bacteria | 87155 |
| 420 | Ga0209051_1002642 | 3300025303 | Bacteria | 12547 |
| 421 | Ga0209051_1003236 | 3300025303 | Bacteria | 10831 |
| 422 | Ga0209051_1005495 | 3300025303 | Bacteria | 7392 |
| 423 | Ga0209051_1010554 | 3300025303 | Bacteria | 4648 |
| 424 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 425 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 426 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 427 | Ga0209257_1000275 | 3300025304 | Bacteria | 116952 |
| 428 | Ga0209257_1003064 | 3300025304 | Bacteria | 15069 |
| 429 | Ga0209257_1005491 | 3300025304 | Bacteria | 8863 |
| 430 | Ga0209257_1019944 | 3300025304 | Bacteria | 2500 |
| 431 | Ga0207655_1001363 | 3300025728 | Bacteria | 22908 |
| 432 | Ga0207655_1006525 | 3300025728 | Bacteria | 7714 |
| 433 | Ga0207655_1015011 | 3300025728 | Bacteria | 4336 |
| 434 | Ga0207655_1023715 | 3300025728 | Bacteria | 3032 |
| 435 | Ga0207655_1023716 | 3300025728 | Bacteria | 3032 |
| 436 | Ga0207713_1001071 | 3300025735 | Bacteria | 23607 |
| 437 | Ga0207710_10000101 | 3300025900 | Bacteria | 110473 |
| 438 | Ga0207645_10013979 | 3300025907 | Bacteria | 5385 |
| 439 | Ga0207645_10014211 | 3300025907 | Bacteria | 5332 |
| 440 | Ga0207643_10047783 | 3300025908 | Bacteria | 2423 |
| 441 | Ga0207705_10002959 | 3300025909 | Bacteria | 12985 |
| 442 | Ga0207705_10074242 | 3300025909 | Bacteria | 2468 |
| 443 | Ga0207705_10136840 | 3300025909 | Bacteria | 1827 |
| 444 | Ga0207705_10152743 | 3300025909 | Bacteria | 1731 |
| 445 | Ga0207684_10001739 | 3300025910 | Bacteria | 23022 |
| 446 | Ga0207654_10022538 | 3300025911 | Bacteria | 3361 |
| 447 | Ga0207707_10107137 | 3300025912 | Bacteria | 2443 |
| 448 | Ga0207695_10011560 | 3300025913 | Bacteria | 10679 |
| 449 | Ga0207695_10030297 | 3300025913 | Bacteria | 5958 |
| 450 | Ga0207695_10042490 | 3300025913 | Bacteria | 4854 |
| 451 | Ga0207695_10059896 | 3300025913 | Bacteria | 3945 |
| 452 | Ga0207671_10001984 | 3300025914 | Bacteria | 22567 |
| 453 | Ga0207671_10119321 | 3300025914 | Bacteria | 2015 |
| 454 | Ga0207660_10042800 | 3300025917 | Bacteria | 3180 |
| 455 | Ga0207660_10060346 | 3300025917 | Bacteria | 2726 |
| 456 | Ga0207662_10059590 | 3300025918 | Bacteria | 2288 |
| 457 | Ga0207657_10009739 | 3300025919 | Bacteria | 9636 |
| 458 | Ga0207657_10009825 | 3300025919 | Bacteria | 9585 |
| 459 | Ga0207657_10010523 | 3300025919 | Bacteria | 9225 |
| 460 | Ga0207657_10080655 | 3300025919 | Bacteria | 2735 |
| 461 | Ga0207657_10134212 | 3300025919 | Bacteria | 2027 |
| 462 | Ga0207649_10109335 | 3300025920 | Bacteria | 1844 |
| 463 | Ga0207652_10015197 | 3300025921 | Bacteria | 6247 |
| 464 | Ga0207652_10029783 | 3300025921 | Bacteria | 4568 |
| 465 | Ga0207652_10173747 | 3300025921 | Bacteria | 1934 |
| 466 | Ga0207646_10097052 | 3300025922 | Bacteria | 2640 |
| 467 | Ga0207681_10000574 | 3300025923 | Bacteria | 25057 |
| 468 | Ga0207681_10028233 | 3300025923 | Bacteria | 3634 |
| 469 | Ga0207659_10053796 | 3300025926 | Bacteria | 2872 |
| 470 | Ga0207659_10080380 | 3300025926 | Bacteria | 2408 |
| 471 | Ga0207659_10247898 | 3300025926 | Bacteria | 1444 |
| 472 | Ga0207687_10233512 | 3300025927 | Bacteria | 1454 |
| 473 | Ga0207644_10002692 | 3300025931 | Bacteria | 11453 |
| 474 | Ga0207644_10249281 | 3300025931 | Bacteria | 1416 |
| 475 | Ga0207690_10014813 | 3300025932 | Bacteria | 4717 |
| 476 | Ga0207690_10058414 | 3300025932 | Bacteria | 2609 |
| 477 | Ga0207690_10099836 | 3300025932 | Bacteria | 2070 |
| 478 | Ga0207706_10000870 | 3300025933 | Bacteria | 31103 |
| 479 | Ga0207706_10054396 | 3300025933 | Bacteria | 3533 |
| 480 | Ga0207706_10157795 | 3300025933 | Bacteria | 1995 |
| 481 | Ga0207706_10212156 | 3300025933 | Bacteria | 1697 |
| 482 | Ga0207709_10000016 | 3300025935 | Bacteria | 478406 |
| 483 | Ga0207709_10000708 | 3300025935 | Bacteria | 26838 |
| 484 | Ga0207709_10000935 | 3300025935 | Bacteria | 21921 |
| 485 | Ga0207709_10001525 | 3300025935 | Bacteria | 15969 |
| 486 | Ga0207709_10146834 | 3300025935 | Bacteria | 1628 |
| 487 | Ga0207669_10198134 | 3300025937 | Bacteria | 1455 |
| 488 | Ga0207704_10002077 | 3300025938 | Bacteria | 8967 |
| 489 | Ga0207704_10078247 | 3300025938 | Bacteria | 2126 |
| 490 | Ga0207691_10032616 | 3300025940 | Bacteria | 4856 |
| 491 | Ga0207691_10039953 | 3300025940 | Bacteria | 4338 |
| 492 | Ga0207691_10050244 | 3300025940 | Bacteria | 3818 |
| 493 | Ga0207691_10139534 | 3300025940 | Bacteria | 2137 |
| 494 | Ga0207691_10201782 | 3300025940 | Bacteria | 1730 |
| 495 | Ga0207691_10215654 | 3300025940 | Bacteria | 1666 |
| 496 | Ga0207711_10032486 | 3300025941 | Bacteria | 4412 |
| 497 | Ga0207711_10147324 | 3300025941 | Bacteria | 2121 |
| 498 | Ga0207689_10010345 | 3300025942 | Bacteria | 8038 |
| 499 | Ga0207679_10002869 | 3300025945 | Bacteria | 10689 |
| 500 | Ga0207679_10023704 | 3300025945 | Bacteria | 4200 |
| 501 | Ga0207667_10021039 | 3300025949 | Bacteria | 7235 |
| 502 | Ga0207667_10021230 | 3300025949 | Bacteria | 7198 |
| 503 | Ga0207667_10031970 | 3300025949 | Bacteria | 5676 |
| 504 | Ga0207667_10042317 | 3300025949 | Bacteria | 4842 |
| 505 | Ga0207651_10012132 | 3300025960 | Bacteria | 4860 |
| 506 | Ga0207651_10043131 | 3300025960 | Bacteria | 3008 |
| 507 | Ga0207651_10219706 | 3300025960 | Bacteria | 1535 |
| 508 | Ga0207712_10000551 | 3300025961 | Bacteria | 30254 |
| 509 | Ga0207712_10086714 | 3300025961 | Bacteria | 2294 |
| 510 | Ga0207640_10016500 | 3300025981 | Bacteria | 4297 |
| 511 | Ga0207640_10086743 | 3300025981 | Bacteria | 2156 |
| 512 | Ga0207677_10011035 | 3300026023 | Bacteria | 5134 |
| 513 | Ga0207677_10097689 | 3300026023 | Bacteria | 2152 |
| 514 | Ga0207677_10121761 | 3300026023 | Bacteria | 1964 |
| 515 | Ga0207703_10044201 | 3300026035 | Bacteria | 3579 |
| 516 | Ga0207639_10027119 | 3300026041 | Bacteria | 4169 |
| 517 | Ga0207639_10165375 | 3300026041 | Bacteria | 1868 |
| 518 | Ga0207639_10253920 | 3300026041 | Bacteria | 1534 |
| 519 | Ga0207678_10000695 | 3300026067 | Bacteria | 30735 |
| 520 | Ga0207678_10026748 | 3300026067 | Bacteria | 5032 |
| 521 | Ga0207708_10023165 | 3300026075 | Bacteria | 4692 |
| 522 | Ga0207702_10000777 | 3300026078 | Bacteria | 33801 |
| 523 | Ga0207641_10016728 | 3300026088 | Bacteria | 6007 |
| 524 | Ga0207641_10039534 | 3300026088 | Bacteria | 3945 |
| 525 | Ga0207648_10000942 | 3300026089 | Bacteria | 32855 |
| 526 | Ga0207648_10018717 | 3300026089 | Bacteria | 6263 |
| 527 | Ga0207648_10029808 | 3300026089 | Bacteria | 4838 |
| 528 | Ga0207648_10057254 | 3300026089 | Bacteria | 3400 |
| 529 | Ga0207648_10072233 | 3300026089 | Bacteria | 3007 |
| 530 | Ga0207648_10240105 | 3300026089 | Bacteria | 1613 |
| 531 | Ga0207648_10352833 | 3300026089 | Bacteria | 1326 |
| 532 | Ga0207676_10226500 | 3300026095 | Bacteria | 1668 |
| 533 | Ga0207676_10229631 | 3300026095 | Bacteria | 1658 |
| 534 | Ga0207674_10119637 | 3300026116 | Bacteria | 2602 |
| 535 | Ga0207675_100016211 | 3300026118 | Bacteria | 6956 |
| 536 | Ga0207675_100074804 | 3300026118 | Bacteria | 3170 |
| 537 | Ga0207683_10018876 | 3300026121 | Bacteria | 5883 |
| 538 | Ga0207683_10058740 | 3300026121 | Bacteria | 3377 |
| 539 | Ga0207683_10062093 | 3300026121 | Bacteria | 3290 |
| 540 | Ga0207683_10189828 | 3300026121 | Bacteria | 1865 |
| 541 | Ga0207683_10208442 | 3300026121 | Bacteria | 1778 |
| 542 | Ga0207683_10217150 | 3300026121 | Bacteria | 1742 |
| 543 | Ga0207698_10081964 | 3300026142 | Bacteria | 2606 |
| 544 | Ga0207698_10130412 | 3300026142 | Bacteria | 2147 |
| 545 | Ga0209371_1000024 | 3300027312 | Bacteria | 477286 |
| 546 | Ga0209968_1000143 | 3300027526 | Bacteria | 12451 |
| 547 | Ga0209970_1000316 | 3300027614 | Bacteria | 7988 |
| 548 | Ga0209282_1003855 | 3300027666 | Bacteria | 9004 |
| 549 | Ga0209966_1000207 | 3300027695 | Bacteria | 24304 |
| 550 | Ga0209974_10000633 | 3300027876 | Bacteria | 11826 |
| 551 | Ga0268266_10060787 | 3300028379 | Bacteria | 3257 |
| 552 | Ga0268265_10016091 | 3300028380 | Bacteria | 5133 |
| 553 | Ga0268265_10027322 | 3300028380 | Bacteria | 4072 |
| 554 | Ga0268265_10056711 | 3300028380 | Bacteria | 2982 |
| 555 | Ga0268264_10025605 | 3300028381 | Bacteria | 4820 |
| 556 | Ga0268264_10030263 | 3300028381 | Bacteria | 4437 |
| 557 | Ga0268264_10161478 | 3300028381 | Bacteria | 2019 |
| 558 | Ga0265336_10000051 | 3300028666 | Bacteria | 114796 |
| 559 | Ga0307515_10000176 | 3300028794 | Bacteria | 157429 |
| 560 | Ga0307515_10000208 | 3300028794 | Bacteria | 144484 |
| 561 | Ga0307515_10063698 | 3300028794 | Bacteria | 5171 |
| 562 | Ga0307515_10070475 | 3300028794 | Bacteria | 4757 |
| 563 | Ga0265338_10000886 | 3300028800 | Bacteria | 50490 |
| 564 | Ga0265324_10001963 | 3300029957 | Bacteria | 11029 |
| 565 | Ga0268256_1000026 | 3300030500 | Bacteria | 477260 |
| 566 | Ga0307511_10053635 | 3300030521 | Bacteria | 3192 |
| 567 | Ga0314311_1179254 | 3300030733 | Bacteria | 16235 |
| 568 | Ga0316183_1001985 | 3300030742 | Bacteria | 1876 |
| 569 | Ga0316181_1151309 | 3300030744 | Bacteria | 4744 |
| 570 | Ga0265332_10079524 | 3300031238 | Bacteria | 1391 |
| 571 | Ga0265327_10000293 | 3300031251 | Bacteria | 96862 |
| 572 | Ga0307513_10000014 | 3300031456 | Bacteria | 303157 |
| 573 | Ga0307513_10000019 | 3300031456 | Bacteria | 231194 |
| 574 | Ga0307513_10016405 | 3300031456 | Bacteria | 8934 |
| 575 | Ga0307513_10174396 | 3300031456 | Bacteria | 2023 |
| 576 | Ga0307509_10014457 | 3300031507 | Bacteria | 9278 |
| 577 | Ga0307408_100013762 | 3300031548 | Bacteria | 5370 |
| 578 | Ga0307408_100042391 | 3300031548 | Bacteria | 3232 |
| 579 | Ga0307408_100049207 | 3300031548 | Bacteria | 3026 |
| 580 | Ga0307408_100094446 | 3300031548 | Bacteria | 2264 |
| 581 | Ga0307514_10061998 | 3300031649 | Bacteria | 2846 |
| 582 | Ga0265314_10001602 | 3300031711 | Bacteria | 24888 |
| 583 | Ga0307516_10000038 | 3300031730 | Bacteria | 147103 |
| 584 | Ga0307516_10000991 | 3300031730 | Bacteria | 39211 |
| 585 | Ga0307516_10003242 | 3300031730 | Bacteria | 21112 |
| 586 | Ga0307516_10006162 | 3300031730 | Bacteria | 14127 |
| 587 | Ga0307516_10007930 | 3300031730 | Bacteria | 12092 |
| 588 | Ga0307405_10015874 | 3300031731 | Bacteria | 4091 |
| 589 | Ga0307405_10039134 | 3300031731 | Bacteria | 2863 |
| 590 | Ga0307413_10026530 | 3300031824 | Bacteria | 3194 |
| 591 | Ga0307410_10002488 | 3300031852 | Bacteria | 8904 |
| 592 | Ga0307406_10009219 | 3300031901 | Bacteria | 5529 |
| 593 | Ga0307406_10033616 | 3300031901 | Bacteria | 3140 |
| 594 | Ga0307412_10004172 | 3300031911 | Bacteria | 8057 |
| 595 | Ga0307412_10020309 | 3300031911 | Bacteria | 4041 |
| 596 | Ga0307412_10046994 | 3300031911 | Bacteria | 2832 |
| 597 | Ga0307412_10096528 | 3300031911 | Bacteria | 2080 |
| 598 | Ga0307412_10221529 | 3300031911 | Bacteria | 1450 |
| 599 | Ga0307409_100010095 | 3300031995 | Bacteria | 5845 |
| 600 | Ga0307416_100040963 | 3300032002 | Bacteria | 3604 |
| 601 | Ga0307416_100049597 | 3300032002 | Bacteria | 3339 |
| 602 | Ga0307414_10121277 | 3300032004 | Bacteria | 2010 |
| 603 | Ga0307414_10216194 | 3300032004 | Bacteria | 1570 |
| 604 | Ga0307411_10083090 | 3300032005 | Bacteria | 2211 |
| 605 | Ga0307510_10001123 | 3300033180 | Bacteria | 28660 |
| 606 | Ga0307510_10017254 | 3300033180 | Bacteria | 8519 |
| 607 | Ga0307510_10040632 | 3300033180 | Bacteria | 5103 |
| 608 | Ga0373934_0009439 | 3300035086 | Bacteria | 3656 |
| 609 | Ga0373931_0009122 | 3300035691 | Bacteria | 4734 |
| 610 | Ga0373947_0128073 | 3300035725 | Bacteria | 1618 |
| 611 | Ga0373925_0002844 | 3300037068 | Bacteria | 13661 |
| 612 | Ga0395899_0006950 | 3300037312 | Bacteria | 8766 |
| 613 | Ga0395899_0007132 | 3300037312 | Bacteria | 8647 |
| 614 | Ga0395899_0028515 | 3300037312 | Bacteria | 4203 |
| 615 | Ga0395900_0000133 | 3300037418 | Bacteria | 124692 |
| 616 | Ga0395900_0000149 | 3300037418 | Bacteria | 117114 |
| 617 | Ga0395900_0002435 | 3300037418 | Bacteria | 20495 |
| 618 | Ga0395900_0004365 | 3300037418 | Bacteria | 14999 |
| 619 | Ga0395900_0006302 | 3300037418 | Bacteria | 12376 |
| 620 | Ga0395900_0031630 | 3300037418 | Bacteria | 5439 |
| 621 | Ga0395900_0034295 | 3300037418 | Bacteria | 5225 |
| 622 | Ga0395900_0235613 | 3300037418 | Bacteria | 1838 |
| 623 | Ga0395900_0245901 | 3300037418 | Bacteria | 1792 |
| 624 | Ga0395898_0000337 | 3300037466 | Bacteria | 106044 |
| 625 | Ga0395898_0020151 | 3300037466 | Bacteria | 6775 |
| 626 | Ga0395898_0034130 | 3300037466 | Bacteria | 5073 |
| 627 | Ga0395898_0035162 | 3300037466 | Bacteria | 4986 |
| 628 | Ga0395898_0042577 | 3300037466 | Bacteria | 4479 |
| 629 | Ga0395905_0000106 | 3300037471 | Bacteria | 140180 |
| 630 | Ga0395905_0001392 | 3300037471 | Bacteria | 29351 |
| 631 | Ga0395905_0002252 | 3300037471 | Bacteria | 21683 |
| 632 | Ga0395905_0005981 | 3300037471 | Bacteria | 12321 |
| 633 | Ga0395905_0016439 | 3300037471 | Bacteria | 7033 |
| 634 | Ga0395905_0017636 | 3300037471 | Bacteria | 6776 |
| 635 | Ga0395905_0018080 | 3300037471 | Bacteria | 6691 |
| 636 | Ga0395905_0029529 | 3300037471 | Bacteria | 5165 |
| 637 | Ga0395905_0039884 | 3300037471 | Bacteria | 4405 |
| 638 | Ga0395905_0051530 | 3300037471 | Bacteria | 3856 |
| 639 | Ga0395905_0074491 | 3300037471 | Bacteria | 3181 |
| 640 | Ga0395905_0085495 | 3300037471 | Bacteria | 2955 |
| 641 | Ga0395905_0099383 | 3300037471 | Bacteria | 2733 |
| 642 | Ga0395905_0371981 | 3300037471 | Bacteria | 1322 |
| 643 | Ga0395901_0000025 | 3300038443 | Bacteria | 263463 |
| 644 | Ga0395901_0000642 | 3300038443 | Bacteria | 40498 |
| 645 | Ga0395901_0009185 | 3300038443 | Bacteria | 10017 |
| 646 | Ga0395901_0045024 | 3300038443 | Bacteria | 4578 |
| 647 | Ga0395901_0049222 | 3300038443 | Bacteria | 4378 |
| 648 | Ga0395901_0067327 | 3300038443 | Bacteria | 3729 |
| 649 | Ga0395901_0184677 | 3300038443 | Bacteria | 2187 |
| 650 | Ga0395901_0193220 | 3300038443 | Bacteria | 2134 |
| 651 | Ga0395901_0239099 | 3300038443 | Bacteria | 1894 |
| 652 | Ga0436361_0269778 | 3300039447 | Bacteria | 4202 |
| 653 | Ga0436361_0598496 | 3300039447 | Bacteria | 3929 |
| 654 | Ga0436361_0927296 | 3300039447 | Bacteria | 36814 |
| 655 | Ga0436361_0983078 | 3300039447 | Bacteria | 65033 |
| 656 | Ga0436363_1141908 | 3300039450 | Bacteria | 1150 |
| 657 | Ga0439436_0001977 | 3300041404 | Bacteria | 6082 |
| 658 | Ga0439436_0005987 | 3300041404 | Bacteria | 3728 |
| 659 | Ga0439447_007671 | 3300041407 | Bacteria | 3399 |
| 660 | Ga0439466_0009605 | 3300041411 | Bacteria | 3615 |
| 661 | Ga0439465_0002491 | 3300041413 | Bacteria | 6012 |
| 662 | Ga0451793_0918201 | 3300041452 | Bacteria | 1978 |
| 663 | Ga0439431_0002490 | 3300041997 | Bacteria | 4076 |
| 664 | Ga0439442_001712 | 3300042002 | Bacteria | 4306 |
| 665 | Ga0439442_017395 | 3300042002 | Bacteria | 1483 |
| 666 | Ga0439448_0017000 | 3300042005 | Bacteria | 2218 |
| 667 | Ga0439448_0024808 | 3300042005 | Bacteria | 1877 |
| 668 | Ga0439432_007707 | 3300042006 | Bacteria | 3808 |
| 669 | Ga0439432_013461 | 3300042006 | Bacteria | 2782 |
| 670 | Ga0439449_0001308 | 3300042007 | Bacteria | 9751 |
| 671 | Ga0439449_0015038 | 3300042007 | Bacteria | 2908 |
| 672 | Ga0439452_000862 | 3300042010 | Bacteria | 14047 |
| 673 | Ga0439455_0011014 | 3300042012 | Bacteria | 2001 |
| 674 | Ga0439457_003229 | 3300042014 | Bacteria | 4480 |
| 675 | Ga0450898_001424 | 3300042134 | Bacteria | 3151 |
| 676 | Ga0450904_003320 | 3300042139 | Bacteria | 1758 |
| 677 | Ga0450906_004454 | 3300042145 | Bacteria | 2939 |
| 678 | Ga0450907_011080 | 3300042146 | Bacteria | 1497 |
| 679 | Ga0439458_0006666 | 3300042157 | Bacteria | 2574 |
| 680 | Ga0439434_0001479 | 3300042435 | Bacteria | 6764 |
| 681 | Ga0439434_0001932 | 3300042435 | Bacteria | 5999 |
| 682 | Ga0439434_0005809 | 3300042435 | Bacteria | 3604 |
| 683 | Ga0439464_0039030 | 3300042439 | Bacteria | 1349 |
| 684 | Ga0450918_007734 | 3300042531 | Bacteria | 1895 |
| 685 | Ga0450893_0003457 | 3300042532 | Bacteria | 2488 |
| 686 | Ga0451577_0000297 | 3300042876 | Bacteria | 96727 |
| 687 | Ga0451577_0008662 | 3300042876 | Bacteria | 9879 |
| 688 | Ga0451577_0117534 | 3300042876 | Bacteria | 2382 |
| 689 | Ga0451577_0241888 | 3300042876 | Bacteria | 1633 |
| 690 | Ga0451577_0269987 | 3300042876 | Bacteria | 1540 |
| 691 | Ga0466969_0000037 | 3300044656 | Bacteria | 75663 |
| 692 | Ga0466969_0004528 | 3300044656 | Bacteria | 7398 |
| 693 | Ga0466969_0031793 | 3300044656 | Bacteria | 2685 |
| 694 | Ga0466969_0032766 | 3300044656 | Bacteria | 2641 |
| 695 | Ga0466969_0050869 | 3300044656 | Bacteria | 2041 |
| 696 | Ga0466972_0003017 | 3300044658 | Bacteria | 8342 |
| 697 | Ga0466972_0003281 | 3300044658 | Bacteria | 8018 |
| 698 | Ga0466972_0008997 | 3300044658 | Bacteria | 5013 |
| 699 | Ga0466972_0098291 | 3300044658 | Bacteria | 1386 |
| 700 | Ga0466965_0000584 | 3300044683 | Bacteria | 13248 |
| 701 | Ga0466965_0004880 | 3300044683 | Bacteria | 5989 |
| 702 | Ga0466965_0029534 | 3300044683 | Bacteria | 2668 |
| 703 | Ga0466966_0005235 | 3300044684 | Bacteria | 8527 |
| 704 | Ga0466966_0006849 | 3300044684 | Bacteria | 7547 |
| 705 | Ga0466966_0078955 | 3300044684 | Bacteria | 2052 |
| 706 | Ga0466966_0157452 | 3300044684 | Bacteria | 1383 |
| 707 | Ga0466961_0036216 | 3300044693 | Bacteria | 3167 |
| 708 | Ga0466961_0040230 | 3300044693 | Bacteria | 2997 |
| 709 | Ga0466961_0055341 | 3300044693 | Bacteria | 2529 |
| 710 | Ga0466963_0097288 | 3300044694 | Bacteria | 2011 |
| 711 | Ga0466964_0001090 | 3300044706 | Bacteria | 9091 |
| 712 | Ga0466964_0014482 | 3300044706 | Bacteria | 3000 |
| 713 | Ga0466964_0146560 | 3300044706 | Bacteria | 1090 |
| 714 | Ga0453684_0001350 | 3300044712 | Bacteria | 71680 |
| 715 | Ga0453684_0034029 | 3300044712 | Bacteria | 7086 |
| 716 | Ga0453684_0156600 | 3300044712 | Bacteria | 2700 |
| 717 | Ga0453684_0180964 | 3300044712 | Bacteria | 2475 |
| 718 | Ga0453684_0323749 | 3300044712 | Bacteria | 1745 |
| 719 | Ga0466968_0000616 | 3300044735 | Bacteria | 12152 |
| 720 | Ga0466970_0033717 | 3300044765 | Bacteria | 2707 |
| 721 | Ga0466970_0074021 | 3300044765 | Bacteria | 1833 |
| 722 | Ga0466957_0002832 | 3300044842 | Bacteria | 9380 |
| 723 | Ga0466957_0024178 | 3300044842 | Bacteria | 3594 |
| 724 | Ga0466957_0043523 | 3300044842 | Bacteria | 2719 |
| 725 | Ga0466957_0182616 | 3300044842 | Bacteria | 1371 |
| 726 | Ga0466960_0005116 | 3300044901 | Bacteria | 5187 |
| 727 | Ga0466960_0051914 | 3300044901 | Bacteria | 1982 |
| 728 | Ga0466960_0056313 | 3300044901 | Bacteria | 1914 |
| 729 | Ga0466960_0095495 | 3300044901 | Bacteria | 1522 |
| 730 | Ga0466959_0004947 | 3300045049 | Bacteria | 9027 |
| 731 | Ga0466959_0004984 | 3300045049 | Bacteria | 9004 |
| 732 | Ga0466959_0034076 | 3300045049 | Bacteria | 3767 |
| 733 | Ga0466959_0064400 | 3300045049 | Bacteria | 2661 |
| 734 | Ga0466959_0117360 | 3300045049 | Bacteria | 1894 |
| 735 | Ga0451576_0045374 | 3300045051 | Bacteria | 4629 |
| 736 | Ga0451576_0049001 | 3300045051 | Bacteria | 4433 |
| 737 | Ga0451576_0195343 | 3300045051 | Bacteria | 2113 |
| 738 | Ga0466958_0004695 | 3300045836 | Bacteria | 7252 |
| 739 | Ga0466967_0007605 | 3300045976 | Bacteria | 7835 |
| 740 | Ga0466967_0147630 | 3300045976 | Bacteria | 2194 |
| 741 | Ga0495617_000060 | 3300046452 | Bacteria | 97123 |
| 742 | Ga0495592_0054617 | 3300046454 | Bacteria | 2959 |
| 743 | Ga0495590_0000469 | 3300046457 | Bacteria | 19973 |
| 744 | Ga0495590_0016155 | 3300046457 | Bacteria | 2697 |
| 745 | Ga0495590_0036469 | 3300046457 | Bacteria | 1715 |
| 746 | Ga0495629_0079480 | 3300046459 | Bacteria | 2290 |
| 747 | Ga0495638_0088844 | 3300046460 | Bacteria | 1865 |
| 748 | Ga0495651_0010041 | 3300046462 | Bacteria | 7277 |
| 749 | Ga0495653_0027174 | 3300046463 | Bacteria | 4580 |
| 750 | Ga0495650_0004422 | 3300046471 | Bacteria | 9635 |
| 751 | Ga0495650_0005380 | 3300046471 | Bacteria | 8329 |
| 752 | Ga0495650_0041716 | 3300046471 | Bacteria | 1960 |
| 753 | Ga0495580_0058047 | 3300046472 | Bacteria | 2723 |
| 754 | Ga0495582_0003728 | 3300046473 | Bacteria | 8585 |
| 755 | Ga0495605_0000049 | 3300046474 | Bacteria | 166669 |
| 756 | Ga0495605_0000179 | 3300046474 | Bacteria | 80278 |
| 757 | Ga0495605_0003347 | 3300046474 | Bacteria | 9584 |
| 758 | Ga0495584_0003026 | 3300046491 | Bacteria | 9328 |
| 759 | Ga0495584_0015708 | 3300046491 | Bacteria | 3860 |
| 760 | Ga0495584_0055303 | 3300046491 | Bacteria | 1997 |
| 761 | Ga0495585_0011959 | 3300046492 | Bacteria | 5125 |
| 762 | Ga0495594_0054169 | 3300046499 | Bacteria | 2210 |
| 763 | Ga0495596_0004693 | 3300046500 | Bacteria | 6610 |
| 764 | Ga0495596_0010059 | 3300046500 | Bacteria | 4135 |
| 765 | Ga0495607_0004477 | 3300046501 | Bacteria | 10250 |
| 766 | Ga0495607_0011765 | 3300046501 | Bacteria | 5803 |
| 767 | Ga0495607_0021811 | 3300046501 | Bacteria | 4027 |
| 768 | Ga0495607_0037071 | 3300046501 | Bacteria | 2931 |
| 769 | Ga0495607_0038404 | 3300046501 | Bacteria | 2868 |
| 770 | Ga0495607_0102588 | 3300046501 | Bacteria | 1529 |
| 771 | Ga0495583_0000433 | 3300046506 | Bacteria | 63058 |
| 772 | Ga0495583_0004420 | 3300046506 | Bacteria | 10069 |
| 773 | Ga0495606_0000087 | 3300046507 | Bacteria | 156407 |
| 774 | Ga0495606_0017575 | 3300046507 | Bacteria | 5399 |
| 775 | Ga0495606_0018193 | 3300046507 | Bacteria | 5280 |
| 776 | Ga0495610_0012490 | 3300046512 | Bacteria | 5108 |
| 777 | Ga0495610_0044721 | 3300046512 | Bacteria | 2196 |
| 778 | Ga0495616_0000426 | 3300046513 | Bacteria | 32236 |
| 779 | Ga0495616_0004175 | 3300046513 | Bacteria | 9155 |
| 780 | Ga0495616_0006481 | 3300046513 | Bacteria | 7081 |
| 781 | Ga0495616_0009329 | 3300046513 | Bacteria | 5750 |
| 782 | Ga0495616_0023347 | 3300046513 | Bacteria | 3327 |
| 783 | Ga0495616_0040625 | 3300046513 | Bacteria | 2375 |
| 784 | Ga0495616_0052239 | 3300046513 | Bacteria | 2035 |
| 785 | Ga0495618_0050801 | 3300046514 | Bacteria | 2620 |
| 786 | Ga0495620_0052397 | 3300046515 | Bacteria | 1733 |
| 787 | Ga0495628_0003181 | 3300046516 | Bacteria | 14713 |
| 788 | Ga0495630_0077778 | 3300046517 | Bacteria | 2501 |
| 789 | Ga0495631_0001031 | 3300046518 | Bacteria | 17308 |
| 790 | Ga0495632_0012365 | 3300046519 | Bacteria | 4926 |
| 791 | Ga0495632_0013218 | 3300046519 | Bacteria | 4720 |
| 792 | Ga0495637_0000813 | 3300046520 | Bacteria | 20603 |
| 793 | Ga0495637_0051307 | 3300046520 | Bacteria | 1727 |
| 794 | Ga0495643_0002868 | 3300046522 | Bacteria | 13097 |
| 795 | Ga0495643_0003958 | 3300046522 | Bacteria | 10595 |
| 796 | Ga0495643_0020035 | 3300046522 | Bacteria | 3863 |
| 797 | Ga0495643_0101468 | 3300046522 | Bacteria | 1474 |
| 798 | Ga0495644_0017329 | 3300046523 | Bacteria | 2754 |
| 799 | Ga0495648_0001084 | 3300046524 | Bacteria | 27665 |
| 800 | Ga0495648_0002496 | 3300046524 | Bacteria | 16889 |
| 801 | Ga0495666_0001684 | 3300046526 | Bacteria | 10917 |
| 802 | Ga0495642_0000083 | 3300046528 | Bacteria | 55163 |
| 803 | Ga0495642_0000757 | 3300046528 | Bacteria | 15886 |
| 804 | Ga0495642_0008038 | 3300046528 | Bacteria | 4035 |
| 805 | Ga0495642_0017521 | 3300046528 | Bacteria | 2799 |
| 806 | Ga0495652_0030206 | 3300046529 | Bacteria | 4755 |
| 807 | Ga0495652_0107795 | 3300046529 | Bacteria | 2247 |
| 808 | Ga0495654_0027511 | 3300046530 | Bacteria | 2915 |
| 809 | Ga0495654_0037661 | 3300046530 | Bacteria | 2423 |
| 810 | Ga0495665_0023329 | 3300046531 | Bacteria | 3322 |
| 811 | Ga0495587_0026612 | 3300046536 | Bacteria | 3526 |
| 812 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 813 | Ga0495609_0035223 | 3300046538 | Bacteria | 2266 |
| 814 | Ga0495621_0019541 | 3300046539 | Bacteria | 2214 |
| 815 | Ga0495621_0042031 | 3300046539 | Bacteria | 1608 |
| 816 | Ga0495597_0000879 | 3300046542 | Bacteria | 23385 |
| 817 | Ga0495597_0011196 | 3300046542 | Bacteria | 4352 |
| 818 | Ga0495597_0036237 | 3300046542 | Bacteria | 2222 |
| 819 | Ga0495633_0065688 | 3300046558 | Bacteria | 1695 |
| 820 | Ga0495656_0000076 | 3300046615 | Bacteria | 44185 |
| 821 | Ga0495668_0000350 | 3300046616 | Bacteria | 61356 |
| 822 | Ga0495668_0004844 | 3300046616 | Bacteria | 9364 |
| 823 | Ga0495668_0147491 | 3300046616 | Bacteria | 1288 |
| 824 | Ga0495634_0008870 | 3300046642 | Bacteria | 7455 |
| 825 | Ga0495625_0000436 | 3300046660 | Bacteria | 62756 |
| 826 | Ga0495625_0005633 | 3300046660 | Bacteria | 11356 |
| 827 | Ga0495625_0018265 | 3300046660 | Bacteria | 5479 |
| 828 | Ga0495661_0000206 | 3300046665 | Bacteria | 68072 |
| 829 | Ga0495661_0001903 | 3300046665 | Bacteria | 16635 |
| 830 | Ga0495661_0026153 | 3300046665 | Bacteria | 3760 |
| 831 | Ga0495661_0121234 | 3300046665 | Bacteria | 1444 |
| 832 | Ga0495588_0000041 | 3300046674 | Bacteria | 377896 |
| 833 | Ga0495588_0029447 | 3300046674 | Bacteria | 2754 |
| 834 | Ga0495588_0091417 | 3300046674 | Bacteria | 1594 |
| 835 | Ga0495623_0025518 | 3300046679 | Bacteria | 3807 |
| 836 | Ga0495623_0049650 | 3300046679 | Bacteria | 2658 |
| 837 | Ga0495658_0011945 | 3300046683 | Bacteria | 4383 |
| 838 | Ga0495669_0007042 | 3300046684 | Bacteria | 4708 |
| 839 | Ga0495669_0042485 | 3300046684 | Bacteria | 2021 |
| 840 | Ga0495670_0055196 | 3300046691 | Bacteria | 1992 |
| 841 | Ga0495670_0070115 | 3300046691 | Bacteria | 1773 |
| 842 | Ga0495671_0004464 | 3300046692 | Bacteria | 8361 |
| 843 | Ga0495671_0006548 | 3300046692 | Bacteria | 6718 |
| 844 | Ga0495649_0001533 | 3300046694 | Bacteria | 17354 |
| 845 | Ga0495589_0000152 | 3300046794 | Bacteria | 64153 |
| 846 | Ga0495589_0000250 | 3300046794 | Bacteria | 43941 |
| 847 | Ga0495589_0023435 | 3300046794 | Bacteria | 3145 |
| 848 | Ga0495589_0047401 | 3300046794 | Bacteria | 2130 |
| 849 | Ga0495600_0090718 | 3300046809 | Bacteria | 1993 |
| 850 | Ga0495660_0000288 | 3300046810 | Bacteria | 46688 |
| 851 | Ga0495660_0022910 | 3300046810 | Bacteria | 3564 |
| 852 | Ga0495660_0043850 | 3300046810 | Bacteria | 2464 |
| 853 | Ga0495672_0000290 | 3300047320 | Bacteria | 69104 |
| 854 | Ga0495672_0003480 | 3300047320 | Bacteria | 13465 |
| 855 | Ga0495672_0028853 | 3300047320 | Bacteria | 3503 |
| 856 | Ga0495672_0030962 | 3300047320 | Bacteria | 3346 |
| 857 | Ga0495676_0006422 | 3300047321 | Bacteria | 10830 |
| 858 | Ga0495676_0160374 | 3300047321 | Bacteria | 1592 |
| 859 | Ga0495683_0069918 | 3300047323 | Bacteria | 1724 |
| 860 | Ga0495683_0096576 | 3300047323 | Bacteria | 1425 |
| 861 | Ga0495687_000023 | 3300047443 | Bacteria | 317750 |
| 862 | Ga0495687_000027 | 3300047443 | Bacteria | 299689 |
| 863 | Ga0495687_000576 | 3300047443 | Bacteria | 43087 |
| 864 | Ga0495687_035872 | 3300047443 | Bacteria | 2224 |
| 865 | Ga0495687_038404 | 3300047443 | Bacteria | 2125 |
| 866 | Ga0495675_0013071 | 3300047444 | Bacteria | 5236 |
| 867 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 868 | Ga0495677_0001805 | 3300047445 | Bacteria | 8559 |
| 869 | Ga0495677_0008447 | 3300047445 | Bacteria | 3823 |
| 870 | Ga0495686_0000222 | 3300047472 | Bacteria | 104411 |
| 871 | Ga0495686_0006302 | 3300047472 | Bacteria | 9116 |
| 872 | Ga0495686_0099767 | 3300047472 | Bacteria | 1752 |
| 873 | Ga0495686_0150721 | 3300047472 | Bacteria | 1365 |
| 874 | Ga0495602_0037073 | 3300048088 | Bacteria | 4530 |
| 875 | Ga0495614_0001247 | 3300048089 | Bacteria | 10942 |
| 876 | Ga0495626_0000037 | 3300048091 | Bacteria | 178573 |
| 877 | Ga0495626_0000520 | 3300048091 | Bacteria | 38584 |
| 878 | Ga0495626_0009773 | 3300048091 | Bacteria | 5164 |
| 879 | Ga0496100_0013999 | 3300048903 | Bacteria | 4645 |
| 880 | Ga0496101_0003842 | 3300048904 | Bacteria | 9392 |
| 881 | Ga0496101_0093699 | 3300048904 | Bacteria | 2237 |
| 882 | Ga0496102_0011197 | 3300048905 | Bacteria | 7725 |
| 883 | Ga0496102_0015225 | 3300048905 | Bacteria | 6695 |
| 884 | Ga0496102_0136122 | 3300048905 | Bacteria | 2302 |
| 885 | Ga0496104_0000625 | 3300048907 | Bacteria | 30296 |
| 886 | Ga0496104_0220223 | 3300048907 | Bacteria | 1810 |
| 887 | Ga0496105_0000638 | 3300048908 | Bacteria | 23463 |
| 888 | Ga0496106_0119092 | 3300048909 | Bacteria | 2062 |
| 889 | Ga0496107_0025622 | 3300048910 | Bacteria | 4176 |
| 890 | Ga0496108_0309349 | 3300048911 | Bacteria | 1377 |
| 891 | Ga0496108_0334502 | 3300048911 | Bacteria | 1321 |
| 892 | Ga0496109_0038690 | 3300048912 | Bacteria | 4313 |
| 893 | Ga0496109_0351051 | 3300048912 | Bacteria | 1393 |
| 894 | Ga0496110_0068024 | 3300048913 | Bacteria | 3152 |
| 895 | Ga0496110_0069420 | 3300048913 | Bacteria | 3120 |
| 896 | Ga0496110_0193355 | 3300048913 | Bacteria | 1847 |
| 897 | Ga0496114_0198788 | 3300048917 | Bacteria | 1755 |
| 898 | Ga0496115_0193859 | 3300048918 | Bacteria | 1679 |
| 899 | Ga0496116_0009153 | 3300048919 | Bacteria | 8484 |
| 900 | Ga0496117_0013047 | 3300048920 | Bacteria | 7275 |
| 901 | Ga0496117_0146500 | 3300048920 | Bacteria | 1405 |
| 902 | Ga0496118_0044479 | 3300048921 | Bacteria | 3477 |
| 903 | Ga0496121_0014532 | 3300048924 | Bacteria | 8347 |
| 904 | Ga0496121_0024441 | 3300048924 | Bacteria | 5776 |
| 905 | Ga0496121_0089658 | 3300048924 | Bacteria | 2406 |
| 906 | Ga0496122_0000103 | 3300048925 | Bacteria | 196819 |
| 907 | Ga0496122_0010319 | 3300048925 | Bacteria | 9661 |
| 908 | Ga0496122_0011628 | 3300048925 | Bacteria | 8880 |
| 909 | Ga0496123_0000261 | 3300048926 | Bacteria | 106547 |
| 910 | Ga0496123_0001777 | 3300048926 | Bacteria | 28404 |
| 911 | Ga0496123_0016312 | 3300048926 | Bacteria | 6042 |
| 912 | Ga0496123_0043105 | 3300048926 | Bacteria | 3104 |
| 913 | Ga0496124_0000919 | 3300048927 | Bacteria | 47561 |
| 914 | Ga0496124_0005843 | 3300048927 | Bacteria | 13656 |
| 915 | Ga0496124_0016567 | 3300048927 | Bacteria | 6996 |
| 916 | Ga0496124_0038513 | 3300048927 | Bacteria | 4151 |
| 917 | Ga0496124_0045738 | 3300048927 | Bacteria | 3752 |
| 918 | Ga0496124_0055493 | 3300048927 | Bacteria | 3348 |
| 919 | Ga0496125_0009347 | 3300048928 | Bacteria | 10100 |
| 920 | Ga0496125_0025933 | 3300048928 | Bacteria | 5355 |
| 921 | Ga0496125_0036972 | 3300048928 | Bacteria | 4252 |
| 922 | Ga0496125_0051204 | 3300048928 | Bacteria | 3408 |
| 923 | Ga0496125_0070582 | 3300048928 | Bacteria | 2734 |
| 924 | Ga0496126_0126193 | 3300048929 | Bacteria | 2215 |
| 925 | Ga0495678_014512 | 3300049459 | Bacteria | 3660 |
| 926 | Ga0501033_0086909 | 3300049570 | Bacteria | 2289 |
| 927 | Ga0501037_0244940 | 3300049573 | Bacteria | 1256 |
| 928 | Ga0501043_0000013 | 3300049579 | Bacteria | 185639 |
| 929 | Ga0501046_0000125 | 3300049580 | Bacteria | 81656 |
| 930 | Ga0501047_0000040 | 3300049581 | Bacteria | 185677 |
| 931 | Ga0501047_0081898 | 3300049581 | Bacteria | 3102 |
| 932 | Ga0501048_0002958 | 3300049582 | Bacteria | 12974 |
| 933 | Ga0501048_0234800 | 3300049582 | Bacteria | 1301 |
| 934 | Ga0501067_0066636 | 3300049583 | Bacteria | 1993 |
| 935 | Ga0501198_000006 | 3300049649 | Bacteria | 129954 |
| 936 | Ga0501222_000007 | 3300049662 | Bacteria | 126703 |
| 937 | Ga0501249_001056 | 3300049679 | Bacteria | 5870 |
| 938 | Ga0501252_003423 | 3300049682 | Bacteria | 1635 |
| 939 | Ga0501035_0000544 | 3300049822 | Bacteria | 41893 |
| 940 | Ga0501035_0000619 | 3300049822 | Bacteria | 39116 |
| 941 | Ga0501035_0038533 | 3300049822 | Bacteria | 4327 |
| 942 | Ga0501035_0199270 | 3300049822 | Bacteria | 1718 |
| 943 | Ga0501045_0007309 | 3300049824 | Bacteria | 7674 |
| 944 | nmdc:mga03683_72044_c1 | 3300050489 | Bacteria | 1479 |
| 945 | nmdc:mga03n38_12421_c1 | 3300050490 | Bacteria | 3204 |
| 946 | nmdc:mga00v17_43474_c1 | 3300050491 | Bacteria | 2706 |
| 947 | nmdc:mga0yw44_8064_c1 | 3300050492 | Bacteria | 5225 |
| 948 | nmdc:mga0k408_14479_c1 | 3300050493 | Bacteria | 4347 |
| 949 | nmdc:mga0k408_24141_c1 | 3300050493 | Bacteria | 3435 |
| 950 | nmdc:mga0k408_28275_c1 | 3300050493 | Bacteria | 3187 |
| 951 | nmdc:mga0k408_3121_c1 | 3300050493 | Bacteria | 8784 |
| 952 | nmdc:mga0k408_57296_c1 | 3300050493 | Bacteria | 2262 |
| 953 | nmdc:mga0k408_7091_c1 | 3300050493 | Bacteria | 5987 |
| 954 | nmdc:mga0k408_82161_c1 | 3300050493 | Bacteria | 1887 |
| 955 | nmdc:mga07m45_1225_c1 | 3300050496 | Bacteria | 11621 |
| 956 | nmdc:mga07m45_6523_c1 | 3300050496 | Bacteria | 5904 |
| 957 | nmdc:mga07m45_716_c1 | 3300050496 | Bacteria | 14102 |
| 958 | nmdc:mga07m45_73290_c1 | 3300050496 | Bacteria | 1949 |
| 959 | nmdc:mga05p37_39567_c1 | 3300050507 | Bacteria | 5789 |
| 960 | nmdc:mga09592_34033_c1 | 3300050508 | Bacteria | 4259 |
| 961 | nmdc:mga08y16_108239_c1 | 3300050511 | Bacteria | 2893 |
| 962 | Ga0500635_0000145 | 3300053080 | Bacteria | 40070 |
| 963 | Ga0500635_0034076 | 3300053080 | Bacteria | 1665 |
| 964 | Ga0500578_0000263 | 3300053086 | Bacteria | 65524 |
| 965 | Ga0500646_0011157 | 3300053090 | Bacteria | 2307 |
| 966 | Ga0500651_0000042 | 3300053093 | Bacteria | 87895 |
| 967 | Ga0500571_000385 | 3300053110 | Bacteria | 17471 |
| 968 | Ga0500593_000087 | 3300053117 | Bacteria | 33673 |
| 969 | Ga0500593_000436 | 3300053117 | Bacteria | 16451 |
| 970 | Ga0500593_016958 | 3300053117 | Bacteria | 3162 |
| 971 | Ga0500607_001690 | 3300053121 | Bacteria | 19265 |
| 972 | Ga0500607_010259 | 3300053121 | Bacteria | 5593 |
| 973 | Ga0500608_015146 | 3300053122 | Bacteria | 3458 |
| 974 | Ga0500626_009829 | 3300053128 | Bacteria | 3993 |
| 975 | Ga0500628_001481 | 3300053129 | Bacteria | 4015 |
| 976 | Ga0500652_001450 | 3300053131 | Bacteria | 7359 |
| 977 | Ga0500655_001604 | 3300053133 | Bacteria | 4268 |
| 978 | Ga0500658_0002529 | 3300053134 | Bacteria | 7084 |
| 979 | Ga0500658_0005455 | 3300053134 | Bacteria | 4729 |
| 980 | Ga0500559_0001528 | 3300053136 | Bacteria | 12968 |
| 981 | Ga0500559_0014366 | 3300053136 | Bacteria | 3347 |
| 982 | Ga0500559_0063266 | 3300053136 | Bacteria | 1653 |
| 983 | Ga0500564_004037 | 3300053138 | Bacteria | 5804 |
| 984 | Ga0500568_0016364 | 3300053139 | Bacteria | 3299 |
| 985 | Ga0500568_0050876 | 3300053139 | Bacteria | 1631 |
| 986 | Ga0500574_001626 | 3300053141 | Bacteria | 3424 |
| 987 | Ga0500619_000055 | 3300053154 | Bacteria | 34804 |
| 988 | Ga0500622_0000106 | 3300053156 | Bacteria | 85750 |
| 989 | Ga0500622_0005905 | 3300053156 | Bacteria | 7221 |
| 990 | Ga0500634_0037894 | 3300053161 | Bacteria | 2622 |
| 991 | Ga0500636_0015185 | 3300053177 | Bacteria | 4534 |
| 992 | Ga0500636_0021939 | 3300053177 | Bacteria | 3779 |
| 993 | Ga0500636_0037982 | 3300053177 | Bacteria | 2848 |
| 994 | Ga0500645_000100 | 3300053730 | Bacteria | 68299 |
| 995 | Ga0500645_005164 | 3300053730 | Bacteria | 4864 |
| 996 | Ga0500661_008746 | 3300055283 | Bacteria | 1862 |
| 997 | Ga0500661_016312 | 3300055283 | Bacteria | 1328 |
| 998 | Ga0590071_001534 | 3300059421 | Bacteria | 6044 |
| 999 | Ga0587079_002337 | 3300059647 | Bacteria | 2305 |
| 1000 | Ga0466962_0004778 | 3300061719 | Bacteria | 6515 |
| 1001 | Ga0466962_0051617 | 3300061719 | Bacteria | 1966 |
| 1002 | 2511245751 | 2511231002 | Bacteria | 5042903 |
| 1003 | 2513226692 | 2513020051 | Bacteria | 6053213 |
| 1004 | 2550693309 | 2548876994 | Bacteria | 4904866 |
| 1005 | 2552747549 | 2551306352 | Bacteria | 3873115 |
| 1006 | 2587726789 | 2585428057 | Bacteria | 6737412 |
| 1007 | 2587732270 | 2585428058 | Bacteria | 6853932 |
| 1008 | 2588295723 | 2588253510 | Bacteria | 6901809 |
| 1009 | 2599625023 | 2599185214 | Bacteria | 8209958 |
| 1010 | 2599673035 | 2599185226 | Bacteria | 8233575 |
| 1011 | 2599682515 | 2599185227 | Bacteria | 8246414 |
| 1012 | 2599694643 | 2599185229 | Bacteria | 8216126 |
| 1013 | 2640735813 | 2639762793 | Bacteria | 3943681 |
| 1014 | 2643799065 | 2643221556 | Bacteria | 7251154 |
| 1015 | 2643971875 | 2643221592 | Bacteria | 6608788 |
| 1016 | 2644030726 | 2643221603 | Bacteria | 6147767 |
| 1017 | 2644139364 | 2643221625 | Bacteria | 6512927 |
| 1018 | 2644159401 | 2643221628 | Bacteria | 5745828 |
| 1019 | 2644274974 | 2643221648 | Bacteria | 6521465 |
| 1020 | 2644329328 | 2643221658 | Bacteria | 6064537 |
| 1021 | 2644337976 | 2643221660 | Bacteria | 4208257 |
| 1022 | 2644361934 | 2643221665 | Bacteria | 4699229 |
| 1023 | 2644401202 | 2643221672 | Bacteria | 6322190 |
| 1024 | 2644467953 | 2643221683 | Bacteria | 5749203 |
| 1025 | 2644473604 | 2643221684 | Bacteria | 7145183 |
| 1026 | 2678229076 | 2675903507 | Bacteria | 3737791 |
| 1027 | 2738717466 | 2738541277 | Bacteria | 7458140 |
| 1028 | 2738879068 | 2738541307 | Bacteria | 8606193 |
| 1029 | 2739248863 | 2738543013 | Bacteria | 5618633 |
| 1030 | 2739278152 | 2738543019 | Bacteria | 7459457 |
| 1031 | 2745159963 | 2744054655 | Bacteria | 3552603 |
| 1032 | 2774390380 | 2773857761 | Bacteria | 3837365 |
| 1033 | 2774437765 | 2773857770 | Bacteria | 3911866 |
| 1034 | 2809143043 | 2808606418 | Bacteria | 6724496 |
| 1035 | 2819540851 | 2818991436 | Bacteria | 5376622 |
| 1036 | 2819593473 | 2818991445 | Bacteria | 4955017 |
| 1037 | 2819596977 | 2818991446 | Bacteria | 7757362 |
| 1038 | 2831266059 | 2831265667 | Bacteria | 7184833 |
| 1039 | 2838057812 | 2838054893 | Bacteria | 7451788 |
| 1040 | 2842679080 | 2842677519 | Bacteria | 5615038 |
| 1041 | 2842735972 | 2842733646 | Bacteria | 5716726 |
| 1042 | 2842748329 | 2842747753 | Bacteria | 5578255 |
| 1043 | 2881102193 | 2881101125 | Bacteria | 4590519 |
| 1044 | 2884814810 | 2884811622 | Bacteria | 5552861 |
| 1045 | 2884840005 | 2884836552 | Bacteria | 5219991 |
| 1046 | 2884857227 | 2884852848 | Bacteria | 5221161 |
| 1047 | 2885197487 | 2885192300 | Bacteria | 5882526 |
| 1048 | 2885203720 | 2885198086 | Bacteria | 7212419 |
| 1049 | 2885216930 | 2885211737 | Bacteria | 7212420 |
| 1050 | 2896157814 | 2896154374 | Bacteria | 5221518 |
| 1051 | 2899930281 | 2899924645 | Bacteria | 7487985 |
| 1052 | 2904456245 | 2904449895 | Bacteria | 6927402 |
| 1053 | 2904457601 | 2904456579 | Bacteria | 6819253 |
| 1054 | 2904482914 | 2904479285 | Bacteria | 5073931 |
| 1055 | 2904543644 | 2904541872 | Bacteria | 8915136 |
| 1056 | 2916700238 | 2916699645 | Bacteria | 3568996 |
| 1057 | 2919184734 | 2919182534 | Bacteria | 3907101 |
| 1058 | 2919466956 | 2919462493 | Bacteria | 5817112 |
| 1059 | 2919507544 | 2919506607 | Bacteria | 3392955 |
| 1060 | 2919704861 | 2919704043 | Bacteria | 5560311 |
| 1061 | 2928039394 | 2928037797 | Bacteria | 7273642 |
| 1062 | 2928045001 | 2928044640 | Bacteria | 7271509 |
| 1063 | 2928052802 | 2928051484 | Bacteria | 7773759 |
| 1064 | 2928064525 | 2928064002 | Bacteria | 7419480 |
| 1065 | 2928075060 | 2928070936 | Bacteria | 8062541 |
| 1066 | 2928088238 | 2928084124 | Bacteria | 7159212 |
| 1067 | 2928116312 | 2928115317 | Bacteria | 6477646 |
| 1068 | 2928517453 | 2928515477 | Bacteria | 4448421 |
| 1069 | 2929162805 | 2929160207 | Bacteria | 9075316 |
| 1070 | 2929527354 | 2929520902 | Bacteria | 6765052 |
| 1071 | 2945911317 | 2945909444 | Bacteria | 7065066 |
| 1072 | 2945947330 | 2945945610 | Bacteria | 5951079 |
| 1073 | 2945977651 | 2945972063 | Bacteria | 6086495 |
| 1074 | 2945986395 | 2945984333 | Bacteria | 7358892 |
| 1075 | 2954772632 | 2954767861 | Bacteria | 5535784 |
| 1076 | 2984571889 | 2984568884 | Bacteria | 3884413 |
| 1077 | 8033234137 | 8033232454 | Bacteria | 3202805 |
| 1078 | 8047679337 | 8047673197 | Bacteria | 7395230 |
| 1079 | Ga0055531_10013544 | |||
| 1080 | JGI24740J21852_10001948 | |||
| 1081 | JGI24740J21852_10030573 | |||
| 1082 | JGI25155J39150_1000002 | |||
| 1083 | JGI25155J39150_1000691 | |||
| 1084 | JGI25156J39149_1000003 | |||
| 1085 | JGI25156J39149_1000114 | |||
| 1086 | JGI25156J39149_1000892 | |||
| 1087 | JGI25156J39149_1006515 | |||
| 1088 | JGI25154J39366_1000009 | |||
| 1089 | JGI25154J39366_1000411 | |||
| 1090 | JGI25154J39366_1001903 | |||
| 1091 | JGI25158J39367_1010631 | |||
| 1092 | JGI25157J39369_1000002 | |||
| 1093 | JGI25157J39369_1000015 | |||
| 1094 | JGI25157J39369_1000382 | |||
| 1095 | JGI25152J39213_1003863 | |||
| 1096 | JGI25152J39213_1004531 | |||
| 1097 | JGI25152J39213_1005460 | |||
| 1098 | JGI25150J39212_1000565 | |||
| 1099 | JGI25150J39212_1000739 | |||
| 1100 | JGI25150J39212_1001528 | |||
| 1101 | JGI25150J39212_1004000 | |||
| 1102 | JGI25150J39212_1009619 | |||
| 1103 | JGI25159J45721_1002000 | |||
| 1104 | JGI25159J45721_1002011 | |||
| 1105 | JGI25159J45721_1003775 | |||
| 1106 | JGI25159J45721_1005761 | |||
| 1107 | JGI25151J46595_10000913 | |||
| 1108 | JGI25151J46595_10007569 | |||
| 1109 | JGI25151J46595_10012667 | |||
| 1110 | JGI25151J46595_10013335 | |||
| 1111 | JGI25153J46596_10001949 | |||
| 1112 | JGI25153J46596_10004931 | |||
| 1113 | JGI25153J46596_10008323 | |||
| 1114 | JGI25153J46596_10012325 | |||
| 1115 | rootH1_10005490 | |||
| 1116 | rootH1_10028592 | |||
| 1117 | rootH1_10066715 | |||
| 1118 | rootH2_10021047 | |||
| 1119 | rootL2_10024592 | |||
| 1120 | rootL2_10059824 | |||
| 1121 | rootL2_10151440 | |||
| 1122 | rootL2_10151441 | |||
| 1123 | rootH1_10082267 | |||
| 1124 | rootH1_10127265 | |||
| 1125 | JGI25160J50197_1000305 | |||
| 1126 | JGI25160J50197_1009151 | |||
| 1127 | JGI25160J50197_1009161 | |||
| 1128 | JGI25161J50226_1000018 | |||
| 1129 | JGI25161J50226_1001955 | |||
| 1130 | JGI25161J50226_1002370 | |||
| 1131 | Ga0006562J51391_1079656 | |||
| 1132 | Ga0032354_1026629 | |||
| 1133 | Ga0055539_1000170 | |||
| 1134 | Ga0055533_1000010 | |||
| 1135 | Ga0055532_1000050 | |||
| 1136 | Ga0055525_1000025 | |||
| 1137 | Ga0055535_1000272 | |||
| 1138 | Ga0055535_1001094 | |||
| 1139 | Ga0055542_1000027 | |||
| 1140 | Ga0055529_1000303 | |||
| 1141 | Ga0055526_1003334 | |||
| 1142 | Ga0055526_1007206 | |||
| 1143 | Ga0055526_1009048 | |||
| 1144 | Ga0055526_1010409 | |||
| 1145 | Ga0055537_1000008 | |||
| 1146 | Ga0055537_1001609 | |||
| 1147 | Ga0055537_1004710 | |||
| 1148 | Ga0055537_1008970 | |||
| 1149 | Ga0055524_1000083 | |||
| 1150 | Ga0055524_1008285 | |||
| 1151 | Ga0055524_1008318 | |||
| 1152 | Ga0055536_1001279 | |||
| 1153 | Ga0055536_1003548 | |||
| 1154 | Ga0055536_1008349 | |||
| 1155 | Ga0055536_1009960 | |||
| 1156 | Ga0055536_1017236 | |||
| 1157 | Ga0055534_1001020 | |||
| 1158 | Ga0055534_1001670 | |||
| 1159 | Ga0055534_1002378 | |||
| 1160 | Ga0055534_1004960 | |||
| 1161 | Ga0055534_1007216 | |||
| 1162 | Ga0055528_1000803 | |||
| 1163 | Ga0055528_1003113 | |||
| 1164 | Ga0055528_1008869 | |||
| 1165 | Ga0055528_1019437 | |||
| 1166 | Ga0055530_10000211 | |||
| 1167 | Ga0055530_10001348 | |||
| 1168 | Ga0055540_1000012 | |||
| 1169 | Ga0055540_1002608 | |||
| 1170 | Ga0055540_1003019 | |||
| 1171 | Ga0055540_1007006 | |||
| 1172 | Ga0055540_1012261 | |||
| 1173 | Ga0055531_10001052 | |||
| 1174 | Ga0055531_10003480 | |||
| 1175 | Ga0055531_10006241 | |||
| 1176 | Ga0055541_1000819 | |||
| 1177 | Ga0058692_1000048 | |||
| 1178 | Ga0055543_1000542 | |||
| 1179 | Ga0055543_1002593 | |||
| 1180 | Ga0055543_1004978 | |||
| 1181 | Ga0065165_1009407 | |||
| 1182 | Ga0065165_1013299 | |||
| 1183 | Ga0065165_1013384 | |||
| 1184 | Ga0065165_1018335 | |||
| 1185 | Ga0065703_1000509 | |||
| 1186 | Ga0065714_10069896 | |||
| 1187 | Ga0065704_10121033 | |||
| 1188 | Ga0065707_10087372 | |||
| 1189 | Ga0070658_10018493 | |||
| 1190 | Ga0070658_10038314 | |||
| 1191 | Ga0070658_10040315 | |||
| 1192 | Ga0070658_10171620 | |||
| 1193 | Ga0070676_10015051 | |||
| 1194 | Ga0070670_100033286 | |||
| 1195 | Ga0070670_100039435 | |||
| 1196 | Ga0068869_100010918 | |||
| 1197 | Ga0068869_100130324 | |||
| 1198 | Ga0070666_10027485 | |||
| 1199 | Ga0070680_100020784 | |||
| 1200 | Ga0070680_100059021 | |||
| 1201 | Ga0068868_100031542 | |||
| 1202 | Ga0068868_100045313 | |||
| 1203 | Ga0068868_100096815 | |||
| 1204 | Ga0070660_100025701 | |||
| 1205 | Ga0070660_100030405 | |||
| 1206 | Ga0070660_100068993 | |||
| 1207 | Ga0070687_100019322 | |||
| 1208 | Ga0070661_100079125 | |||
| 1209 | Ga0070668_100026977 | |||
| 1210 | Ga0070669_100000505 | |||
| 1211 | Ga0070669_100026320 | |||
| 1212 | Ga0070669_100049534 | |||
| 1213 | Ga0070675_100037029 | |||
| 1214 | Ga0070675_100197203 | |||
| 1215 | Ga0070671_100010843 | |||
| 1216 | Ga0070671_100193314 | |||
| 1217 | Ga0070674_100105629 | |||
| 1218 | Ga0070674_100242453 | |||
| 1219 | Ga0070673_100013275 | |||
| 1220 | Ga0070673_100157786 | |||
| 1221 | Ga0070659_100030067 | |||
| 1222 | Ga0070659_100041871 | |||
| 1223 | Ga0070667_100014015 | |||
| 1224 | Ga0070667_100069592 | |||
| 1225 | Ga0070700_100033487 | |||
| 1226 | Ga0070708_100226695 | |||
| 1227 | Ga0070708_100402903 | |||
| 1228 | Ga0070663_100001487 | |||
| 1229 | Ga0070678_100056477 | |||
| 1230 | Ga0070678_100062218 | |||
| 1231 | Ga0070678_100304656 | |||
| 1232 | Ga0070662_100002137 | |||
| 1233 | Ga0070662_100062258 | |||
| 1234 | Ga0070662_100064353 | |||
| 1235 | Ga0070662_100074332 | |||
| 1236 | Ga0070662_100121964 | |||
| 1237 | Ga0068867_100000068 | |||
| 1238 | Ga0068867_100002788 | |||
| 1239 | Ga0068867_100080469 | |||
| 1240 | Ga0070706_100000546 | |||
| 1241 | Ga0070707_100020993 | |||
| 1242 | Ga0070698_100056391 | |||
| 1243 | Ga0070699_100157087 | |||
| 1244 | Ga0070679_100016791 | |||
| 1245 | Ga0070679_100092470 | |||
| 1246 | Ga0068853_100006411 | |||
| 1247 | Ga0068853_100135846 | |||
| 1248 | Ga0068853_100290528 | |||
| 1249 | Ga0068853_100298045 | |||
| 1250 | Ga0070672_100031212 | |||
| 1251 | Ga0070672_100046346 | |||
| 1252 | Ga0070672_100052964 | |||
| 1253 | Ga0070672_100058235 | |||
| 1254 | Ga0070686_100123044 | |||
| 1255 | Ga0070665_100057573 | |||
| 1256 | Ga0070665_100305252 | |||
| 1257 | Ga0068855_100016796 | |||
| 1258 | Ga0068855_100054224 | |||
| 1259 | Ga0068855_100078830 | |||
| 1260 | Ga0068855_100093120 | |||
| 1261 | Ga0070664_100034408 | |||
| 1262 | Ga0070664_100073880 | |||
| 1263 | Ga0068857_100120816 | |||
| 1264 | Ga0068854_100114687 | |||
| 1265 | Ga0068856_100094383 | |||
| 1266 | Ga0068852_100072580 | |||
| 1267 | Ga0068852_100135184 | |||
| 1268 | Ga0068852_100145677 | |||
| 1269 | Ga0068859_100132548 | |||
| 1270 | Ga0068864_100168139 | |||
| 1271 | Ga0068866_10019208 | |||
| 1272 | Ga0068861_100007929 | |||
| 1273 | Ga0068870_10041881 | |||
| 1274 | Ga0068863_100025781 | |||
| 1275 | Ga0068863_100233463 | |||
| 1276 | Ga0068858_100081232 | |||
| 1277 | Ga0068860_100001531 | |||
| 1278 | Ga0068860_100024244 | |||
| 1279 | Ga0068860_100092512 | |||
| 1280 | Ga0068860_100110616 | |||
| 1281 | Ga0068862_100014947 | |||
| 1282 | Ga0068862_100173655 | |||
| 1283 | Ga0068862_100177323 | |||
| 1284 | Ga0075365_10001836 | |||
| 1285 | Ga0075365_10008898 | |||
| 1286 | Ga0075368_10040997 | |||
| 1287 | Ga0075363_100001597 | |||
| 1288 | Ga0075363_100005158 | |||
| 1289 | Ga0075364_10013716 | |||
| 1290 | Ga0075432_10000616 | |||
| 1291 | Ga0075432_10015499 | |||
| 1292 | Ga0075362_10009027 | |||
| 1293 | Ga0075366_10006250 | |||
| 1294 | Ga0075366_10019182 | |||
| 1295 | Ga0075366_10032602 | |||
| 1296 | Ga0075366_10039702 | |||
| 1297 | Ga0075366_10052693 | |||
| 1298 | Ga0075366_10138517 | |||
| 1299 | Ga0097621_100182539 | |||
| 1300 | Ga0075370_10000587 | |||
| 1301 | Ga0075370_10001047 | |||
| 1302 | Ga0075370_10001173 | |||
| 1303 | Ga0075370_10006112 | |||
| 1304 | Ga0075370_10007691 | |||
| 1305 | Ga0075370_10008959 | |||
| 1306 | Ga0075370_10024844 | |||
| 1307 | Ga0075370_10035531 | |||
| 1308 | Ga0068871_100099219 | |||
| 1309 | Ga0068871_100112165 | |||
| 1310 | Ga0075429_100001338 | |||
| 1311 | Ga0068865_100021324 | |||
| 1312 | Ga0097620_100132552 | |||
| 1313 | Ga0099826_10004770 | |||
| 1314 | Ga0105251_10020910 | |||
| 1315 | Ga0105244_10013824 | |||
| 1316 | Ga0105244_10014112 | |||
| 1317 | Ga0105244_10042806 | |||
| 1318 | Ga0105244_10103317 | |||
| 1319 | Ga0105240_10009231 | |||
| 1320 | Ga0105240_10010696 | |||
| 1321 | Ga0105240_10021627 | |||
| 1322 | Ga0105240_10502748 | |||
| 1323 | Ga0105247_10000594 | |||
| 1324 | Ga0105247_10009842 | |||
| 1325 | Ga0105243_10001337 | |||
| 1326 | Ga0105243_10001406 | |||
| 1327 | Ga0105243_10001511 | |||
| 1328 | Ga0105243_10005195 | |||
| 1329 | Ga0105243_10113599 | |||
| 1330 | Ga0105243_10130169 | |||
| 1331 | Ga0105241_10007529 | |||
| 1332 | Ga0105241_10015401 | |||
| 1333 | Ga0105242_10049900 | |||
| 1334 | Ga0105242_10171471 | |||
| 1335 | Ga0105248_10055655 | |||
| 1336 | Ga0105248_10228257 | |||
| 1337 | Ga0105248_10228943 | |||
| 1338 | Ga0105248_10274930 | |||
| 1339 | Ga0105248_10377590 | |||
| 1340 | Ga0105237_10007228 | |||
| 1341 | Ga0105238_10152057 | |||
| 1342 | Ga0105249_10001295 | |||
| 1343 | Ga0105249_10178571 | |||
| 1344 | Ga0105239_10008196 | |||
| 1345 | Ga0105239_10028770 | |||
| 1346 | Ga0105239_10326941 | |||
| 1347 | Ga0157326_1003845 | |||
| 1348 | Ga0157373_10028793 | |||
| 1349 | Ga0157373_10053200 | |||
| 1350 | Ga0157371_10000026 | |||
| 1351 | Ga0157371_10003698 | |||
| 1352 | Ga0157371_10038683 | |||
| 1353 | Ga0157370_10024246 | |||
| 1354 | Ga0157369_10012180 | |||
| 1355 | Ga0157374_10029219 | |||
| 1356 | Ga0157378_10003676 | |||
| 1357 | Ga0157378_10121800 | |||
| 1358 | Ga0163162_10000997 | |||
| 1359 | Ga0163162_10037247 | |||
| 1360 | Ga0157375_10027584 | |||
| 1361 | Ga0157375_10057010 | |||
| 1362 | Ga0157375_10324453 | |||
| 1363 | Ga0157375_10420560 | |||
| 1364 | Ga0182008_10000838 | |||
| 1365 | Ga0182008_10005897 | |||
| 1366 | Ga0182008_10007674 | |||
| 1367 | Ga0182008_10034289 | |||
| 1368 | Ga0182008_10041559 | |||
| 1369 | Ga0157377_10000082 | |||
| 1370 | Ga0157379_10034173 | |||
| 1371 | Ga0157376_10003154 | |||
| 1372 | Ga0157376_10191638 | |||
| 1373 | Ga0182006_1001492 | |||
| 1374 | Ga0182007_10001563 | |||
| 1375 | Ga0182007_10001757 | |||
| 1376 | Ga0182007_10004781 | |||
| 1377 | Ga0182007_10010798 | |||
| 1378 | Ga0182005_1005148 | |||
| 1379 | Ga0183362_10001 | |||
| 1380 | Ga0163161_10000065 | |||
| 1381 | Ga0163161_10012915 | |||
| 1382 | Ga0163161_10032482 | |||
| 1383 | Ga0163161_10049481 | |||
| 1384 | Ga0213872_10000160 | |||
| 1385 | Ga0213872_10002596 | |||
| 1386 | Ga0213872_10045361 | |||
| 1387 | Ga0213872_10066727 | |||
| 1388 | Ga0209435_100001 | |||
| 1389 | Ga0209435_100029 | |||
| 1390 | Ga0209436_105483 | |||
| 1391 | Ga0209436_108819 | |||
| 1392 | Ga0209674_100003 | |||
| 1393 | Ga0209672_100563 | |||
| 1394 | Ga0209147_100004 | |||
| 1395 | Ga0209563_100003 | |||
| 1396 | Ga0209563_100010 | |||
| 1397 | Ga0207427_100468 | |||
| 1398 | Ga0209258_100048 | |||
| 1399 | Ga0209258_100163 | |||
| 1400 | Ga0209258_100903 | |||
| 1401 | Ga0207425_1000204 | |||
| 1402 | Ga0207425_1000275 | |||
| 1403 | Ga0207425_1001012 | |||
| 1404 | Ga0207425_1003668 | |||
| 1405 | Ga0207425_1005152 | |||
| 1406 | Ga0209646_1000001 | |||
| 1407 | Ga0209646_1000109 | |||
| 1408 | Ga0209646_1000226 | |||
| 1409 | Ga0209026_1000003 | |||
| 1410 | Ga0209026_1000021 | |||
| 1411 | Ga0209026_1000467 | |||
| 1412 | Ga0209677_100106 | |||
| 1413 | Ga0209677_100480 | |||
| 1414 | Ga0209677_103060 | |||
| 1415 | Ga0209677_106594 | |||
| 1416 | Ga0209148_1000040 | |||
| 1417 | Ga0209148_1000811 | |||
| 1418 | Ga0209148_1004695 | |||
| 1419 | Ga0209759_1000001 | |||
| 1420 | Ga0209759_1000025 | |||
| 1421 | Ga0209759_1000698 | |||
| 1422 | Ga0209759_1000939 | |||
| 1423 | Ga0209759_1011786 | |||
| 1424 | Ga0209129_1000007 | |||
| 1425 | Ga0209129_1000025 | |||
| 1426 | Ga0209129_1001079 | |||
| 1427 | Ga0209129_1004771 | |||
| 1428 | Ga0209129_1011044 | |||
| 1429 | Ga0209565_1000004 | |||
| 1430 | Ga0209565_1000105 | |||
| 1431 | Ga0209565_1000153 | |||
| 1432 | Ga0209565_1000974 | |||
| 1433 | Ga0209565_1002008 | |||
| 1434 | Ga0209455_1000059 | |||
| 1435 | Ga0209673_1000074 | |||
| 1436 | Ga0209673_1000794 | |||
| 1437 | Ga0209673_1001641 | |||
| 1438 | Ga0209673_1001648 | |||
| 1439 | Ga0209673_1002152 | |||
| 1440 | Ga0209130_1000050 | |||
| 1441 | Ga0209130_1000172 | |||
| 1442 | Ga0209130_1000329 | |||
| 1443 | Ga0209130_1000584 | |||
| 1444 | Ga0209130_1001746 | |||
| 1445 | Ga0209675_1000044 | |||
| 1446 | Ga0209675_1000150 | |||
| 1447 | Ga0209675_1001275 | |||
| 1448 | Ga0209675_1001400 | |||
| 1449 | Ga0209675_1001905 | |||
| 1450 | Ga0209675_1003456 | |||
| 1451 | Ga0209676_1000004 | |||
| 1452 | Ga0209676_1000029 | |||
| 1453 | Ga0209676_1001207 | |||
| 1454 | Ga0209676_1001472 | |||
| 1455 | Ga0209676_1002733 | |||
| 1456 | Ga0209676_1002909 | |||
| 1457 | Ga0209676_1010857 | |||
| 1458 | Ga0209025_1000111 | |||
| 1459 | Ga0209025_1000217 | |||
| 1460 | Ga0209025_1000624 | |||
| 1461 | Ga0209025_1001851 | |||
| 1462 | Ga0209025_1003136 | |||
| 1463 | Ga0209025_1033805 | |||
| 1464 | Ga0209025_1052123 | |||
| 1465 | Ga0209564_1000039 | |||
| 1466 | Ga0209564_1000153 | |||
| 1467 | Ga0209564_1000337 | |||
| 1468 | Ga0209564_1000470 | |||
| 1469 | Ga0209564_1002160 | |||
| 1470 | Ga0209564_1029015 | |||
| 1471 | Ga0209758_1000025 | |||
| 1472 | Ga0209758_1000163 | |||
| 1473 | Ga0209758_1000287 | |||
| 1474 | Ga0209758_1003748 | |||
| 1475 | Ga0209758_1007561 | |||
| 1476 | Ga0209050_1000002 | |||
| 1477 | Ga0209050_1000003 | |||
| 1478 | Ga0209050_1000325 | |||
| 1479 | Ga0209050_1000412 | |||
| 1480 | Ga0209050_1004195 | |||
| 1481 | Ga0209050_1004259 | |||
| 1482 | Ga0209050_1005909 | |||
| 1483 | Ga0209050_1013114 | |||
| 1484 | Ga0209050_1030822 | |||
| 1485 | Ga0209256_1000001 | |||
| 1486 | Ga0209256_1000425 | |||
| 1487 | Ga0209256_1001308 | |||
| 1488 | Ga0207426_1000001 | |||
| 1489 | Ga0207426_1000028 | |||
| 1490 | Ga0207426_1000071 | |||
| 1491 | Ga0207426_1000692 | |||
| 1492 | Ga0209051_1000002 | |||
| 1493 | Ga0209051_1000003 | |||
| 1494 | Ga0209051_1000150 | |||
| 1495 | Ga0209051_1000268 | |||
| 1496 | Ga0209051_1002642 | |||
| 1497 | Ga0209051_1003236 | |||
| 1498 | Ga0209051_1005495 | |||
| 1499 | Ga0209051_1010554 | |||
| 1500 | Ga0209257_1000002 | |||
| 1501 | Ga0209257_1000012 | |||
| 1502 | Ga0209257_1000018 | |||
| 1503 | Ga0209257_1000275 | |||
| 1504 | Ga0209257_1003064 | |||
| 1505 | Ga0209257_1005491 | |||
| 1506 | Ga0209257_1019944 | |||
| 1507 | Ga0207655_1001363 | |||
| 1508 | Ga0207655_1006525 | |||
| 1509 | Ga0207655_1015011 | |||
| 1510 | Ga0207655_1023715 | |||
| 1511 | Ga0207655_1023716 | |||
| 1512 | Ga0207713_1001071 | |||
| 1513 | Ga0207710_10000101 | |||
| 1514 | Ga0207645_10013979 | |||
| 1515 | Ga0207645_10014211 | |||
| 1516 | Ga0207643_10047783 | |||
| 1517 | Ga0207705_10002959 | |||
| 1518 | Ga0207705_10074242 | |||
| 1519 | Ga0207705_10136840 | |||
| 1520 | Ga0207705_10152743 | |||
| 1521 | Ga0207684_10001739 | |||
| 1522 | Ga0207654_10022538 | |||
| 1523 | Ga0207707_10107137 | |||
| 1524 | Ga0207695_10011560 | |||
| 1525 | Ga0207695_10030297 | |||
| 1526 | Ga0207695_10042490 | |||
| 1527 | Ga0207695_10059896 | |||
| 1528 | Ga0207671_10001984 | |||
| 1529 | Ga0207671_10119321 | |||
| 1530 | Ga0207660_10042800 | |||
| 1531 | Ga0207660_10060346 | |||
| 1532 | Ga0207662_10059590 | |||
| 1533 | Ga0207657_10009739 | |||
| 1534 | Ga0207657_10009825 | |||
| 1535 | Ga0207657_10010523 | |||
| 1536 | Ga0207657_10080655 | |||
| 1537 | Ga0207657_10134212 | |||
| 1538 | Ga0207649_10109335 | |||
| 1539 | Ga0207652_10015197 | |||
| 1540 | Ga0207652_10029783 | |||
| 1541 | Ga0207652_10173747 | |||
| 1542 | Ga0207646_10097052 | |||
| 1543 | Ga0207681_10000574 | |||
| 1544 | Ga0207681_10028233 | |||
| 1545 | Ga0207659_10053796 | |||
| 1546 | Ga0207659_10080380 | |||
| 1547 | Ga0207659_10247898 | |||
| 1548 | Ga0207687_10233512 | |||
| 1549 | Ga0207644_10002692 | |||
| 1550 | Ga0207644_10249281 | |||
| 1551 | Ga0207690_10014813 | |||
| 1552 | Ga0207690_10058414 | |||
| 1553 | Ga0207690_10099836 | |||
| 1554 | Ga0207706_10000870 | |||
| 1555 | Ga0207706_10054396 | |||
| 1556 | Ga0207706_10157795 | |||
| 1557 | Ga0207706_10212156 | |||
| 1558 | Ga0207709_10000016 | |||
| 1559 | Ga0207709_10000708 | |||
| 1560 | Ga0207709_10000935 | |||
| 1561 | Ga0207709_10001525 | |||
| 1562 | Ga0207709_10146834 | |||
| 1563 | Ga0207669_10198134 | |||
| 1564 | Ga0207704_10002077 | |||
| 1565 | Ga0207704_10078247 | |||
| 1566 | Ga0207691_10032616 | |||
| 1567 | Ga0207691_10039953 | |||
| 1568 | Ga0207691_10050244 | |||
| 1569 | Ga0207691_10139534 | |||
| 1570 | Ga0207691_10201782 | |||
| 1571 | Ga0207691_10215654 | |||
| 1572 | Ga0207711_10032486 | |||
| 1573 | Ga0207711_10147324 | |||
| 1574 | Ga0207689_10010345 | |||
| 1575 | Ga0207679_10002869 | |||
| 1576 | Ga0207679_10023704 | |||
| 1577 | Ga0207667_10021039 | |||
| 1578 | Ga0207667_10021230 | |||
| 1579 | Ga0207667_10031970 | |||
| 1580 | Ga0207667_10042317 | |||
| 1581 | Ga0207651_10012132 | |||
| 1582 | Ga0207651_10043131 | |||
| 1583 | Ga0207651_10219706 | |||
| 1584 | Ga0207712_10000551 | |||
| 1585 | Ga0207712_10086714 | |||
| 1586 | Ga0207640_10016500 | |||
| 1587 | Ga0207640_10086743 | |||
| 1588 | Ga0207677_10011035 | |||
| 1589 | Ga0207677_10097689 | |||
| 1590 | Ga0207677_10121761 | |||
| 1591 | Ga0207703_10044201 | |||
| 1592 | Ga0207639_10027119 | |||
| 1593 | Ga0207639_10165375 | |||
| 1594 | Ga0207639_10253920 | |||
| 1595 | Ga0207678_10000695 | |||
| 1596 | Ga0207678_10026748 | |||
| 1597 | Ga0207708_10023165 | |||
| 1598 | Ga0207702_10000777 | |||
| 1599 | Ga0207641_10016728 | |||
| 1600 | Ga0207641_10039534 | |||
| 1601 | Ga0207648_10000942 | |||
| 1602 | Ga0207648_10018717 | |||
| 1603 | Ga0207648_10029808 | |||
| 1604 | Ga0207648_10057254 | |||
| 1605 | Ga0207648_10072233 | |||
| 1606 | Ga0207648_10240105 | |||
| 1607 | Ga0207648_10352833 | |||
| 1608 | Ga0207676_10226500 | |||
| 1609 | Ga0207676_10229631 | |||
| 1610 | Ga0207674_10119637 | |||
| 1611 | Ga0207675_100016211 | |||
| 1612 | Ga0207675_100074804 | |||
| 1613 | Ga0207683_10018876 | |||
| 1614 | Ga0207683_10058740 | |||
| 1615 | Ga0207683_10062093 | |||
| 1616 | Ga0207683_10189828 | |||
| 1617 | Ga0207683_10208442 | |||
| 1618 | Ga0207683_10217150 | |||
| 1619 | Ga0207698_10081964 | |||
| 1620 | Ga0207698_10130412 | |||
| 1621 | Ga0209371_1000024 | |||
| 1622 | Ga0209968_1000143 | |||
| 1623 | Ga0209970_1000316 | |||
| 1624 | Ga0209282_1003855 | |||
| 1625 | Ga0209966_1000207 | |||
| 1626 | Ga0209974_10000633 | |||
| 1627 | Ga0268266_10060787 | |||
| 1628 | Ga0268265_10016091 | |||
| 1629 | Ga0268265_10027322 | |||
| 1630 | Ga0268265_10056711 | |||
| 1631 | Ga0268264_10025605 | |||
| 1632 | Ga0268264_10030263 | |||
| 1633 | Ga0268264_10161478 | |||
| 1634 | Ga0265336_10000051 | |||
| 1635 | Ga0307515_10000176 | |||
| 1636 | Ga0307515_10000208 | |||
| 1637 | Ga0307515_10063698 | |||
| 1638 | Ga0307515_10070475 | |||
| 1639 | Ga0265338_10000886 | |||
| 1640 | Ga0265324_10001963 | |||
| 1641 | Ga0268256_1000026 | |||
| 1642 | Ga0307511_10053635 | |||
| 1643 | Ga0314311_1179254 | |||
| 1644 | Ga0316183_1001985 | |||
| 1645 | Ga0316181_1151309 | |||
| 1646 | Ga0265332_10079524 | |||
| 1647 | Ga0265327_10000293 | |||
| 1648 | Ga0307513_10000014 | |||
| 1649 | Ga0307513_10000019 | |||
| 1650 | Ga0307513_10016405 | |||
| 1651 | Ga0307513_10174396 | |||
| 1652 | Ga0307509_10014457 | |||
| 1653 | Ga0307408_100013762 | |||
| 1654 | Ga0307408_100042391 | |||
| 1655 | Ga0307408_100049207 | |||
| 1656 | Ga0307408_100094446 | |||
| 1657 | Ga0307514_10061998 | |||
| 1658 | Ga0265314_10001602 | |||
| 1659 | Ga0307516_10000038 | |||
| 1660 | Ga0307516_10000991 | |||
| 1661 | Ga0307516_10003242 | |||
| 1662 | Ga0307516_10006162 | |||
| 1663 | Ga0307516_10007930 | |||
| 1664 | Ga0307405_10015874 | |||
| 1665 | Ga0307405_10039134 | |||
| 1666 | Ga0307413_10026530 | |||
| 1667 | Ga0307410_10002488 | |||
| 1668 | Ga0307406_10009219 | |||
| 1669 | Ga0307406_10033616 | |||
| 1670 | Ga0307412_10004172 | |||
| 1671 | Ga0307412_10020309 | |||
| 1672 | Ga0307412_10046994 | |||
| 1673 | Ga0307412_10096528 | |||
| 1674 | Ga0307412_10221529 | |||
| 1675 | Ga0307409_100010095 | |||
| 1676 | Ga0307416_100040963 | |||
| 1677 | Ga0307416_100049597 | |||
| 1678 | Ga0307414_10121277 | |||
| 1679 | Ga0307414_10216194 | |||
| 1680 | Ga0307411_10083090 | |||
| 1681 | Ga0307510_10001123 | |||
| 1682 | Ga0307510_10017254 | |||
| 1683 | Ga0307510_10040632 | |||
| 1684 | Ga0373934_0009439 | |||
| 1685 | Ga0373931_0009122 | |||
| 1686 | Ga0373947_0128073 | |||
| 1687 | Ga0373925_0002844 | |||
| 1688 | Ga0395899_0006950 | |||
| 1689 | Ga0395899_0007132 | |||
| 1690 | Ga0395899_0028515 | |||
| 1691 | Ga0395900_0000133 | |||
| 1692 | Ga0395900_0000149 | |||
| 1693 | Ga0395900_0002435 | |||
| 1694 | Ga0395900_0004365 | |||
| 1695 | Ga0395900_0006302 | |||
| 1696 | Ga0395900_0031630 | |||
| 1697 | Ga0395900_0034295 | |||
| 1698 | Ga0395900_0235613 | |||
| 1699 | Ga0395900_0245901 | |||
| 1700 | Ga0395898_0000337 | |||
| 1701 | Ga0395898_0020151 | |||
| 1702 | Ga0395898_0034130 | |||
| 1703 | Ga0395898_0035162 | |||
| 1704 | Ga0395898_0042577 | |||
| 1705 | Ga0395905_0000106 | |||
| 1706 | Ga0395905_0001392 | |||
| 1707 | Ga0395905_0002252 | |||
| 1708 | Ga0395905_0005981 | |||
| 1709 | Ga0395905_0016439 | |||
| 1710 | Ga0395905_0017636 | |||
| 1711 | Ga0395905_0018080 | |||
| 1712 | Ga0395905_0029529 | |||
| 1713 | Ga0395905_0039884 | |||
| 1714 | Ga0395905_0051530 | |||
| 1715 | Ga0395905_0074491 | |||
| 1716 | Ga0395905_0085495 | |||
| 1717 | Ga0395905_0099383 | |||
| 1718 | Ga0395905_0371981 | |||
| 1719 | Ga0395901_0000025 | |||
| 1720 | Ga0395901_0000642 | |||
| 1721 | Ga0395901_0009185 | |||
| 1722 | Ga0395901_0045024 | |||
| 1723 | Ga0395901_0049222 | |||
| 1724 | Ga0395901_0067327 | |||
| 1725 | Ga0395901_0184677 | |||
| 1726 | Ga0395901_0193220 | |||
| 1727 | Ga0395901_0239099 | |||
| 1728 | Ga0436361_0269778 | |||
| 1729 | Ga0436361_0598496 | |||
| 1730 | Ga0436361_0927296 | |||
| 1731 | Ga0436361_0983078 | |||
| 1732 | Ga0436363_1141908 | |||
| 1733 | Ga0439436_0001977 | |||
| 1734 | Ga0439436_0005987 | |||
| 1735 | Ga0439447_007671 | |||
| 1736 | Ga0439466_0009605 | |||
| 1737 | Ga0439465_0002491 | |||
| 1738 | Ga0451793_0918201 | |||
| 1739 | Ga0439431_0002490 | |||
| 1740 | Ga0439442_001712 | |||
| 1741 | Ga0439442_017395 | |||
| 1742 | Ga0439448_0017000 | |||
| 1743 | Ga0439448_0024808 | |||
| 1744 | Ga0439432_007707 | |||
| 1745 | Ga0439432_013461 | |||
| 1746 | Ga0439449_0001308 | |||
| 1747 | Ga0439449_0015038 | |||
| 1748 | Ga0439452_000862 | |||
| 1749 | Ga0439455_0011014 | |||
| 1750 | Ga0439457_003229 | |||
| 1751 | Ga0450898_001424 | |||
| 1752 | Ga0450904_003320 | |||
| 1753 | Ga0450906_004454 | |||
| 1754 | Ga0450907_011080 | |||
| 1755 | Ga0439458_0006666 | |||
| 1756 | Ga0439434_0001479 | |||
| 1757 | Ga0439434_0001932 | |||
| 1758 | Ga0439434_0005809 | |||
| 1759 | Ga0439464_0039030 | |||
| 1760 | Ga0450918_007734 | |||
| 1761 | Ga0450893_0003457 | |||
| 1762 | Ga0451577_0000297 | |||
| 1763 | Ga0451577_0008662 | |||
| 1764 | Ga0451577_0117534 | |||
| 1765 | Ga0451577_0241888 | |||
| 1766 | Ga0451577_0269987 | |||
| 1767 | Ga0466969_0000037 | |||
| 1768 | Ga0466969_0004528 | |||
| 1769 | Ga0466969_0031793 | |||
| 1770 | Ga0466969_0032766 | |||
| 1771 | Ga0466969_0050869 | |||
| 1772 | Ga0466972_0003017 | |||
| 1773 | Ga0466972_0003281 | |||
| 1774 | Ga0466972_0008997 | |||
| 1775 | Ga0466972_0098291 | |||
| 1776 | Ga0466965_0000584 | |||
| 1777 | Ga0466965_0004880 | |||
| 1778 | Ga0466965_0029534 | |||
| 1779 | Ga0466966_0005235 | |||
| 1780 | Ga0466966_0006849 | |||
| 1781 | Ga0466966_0078955 | |||
| 1782 | Ga0466966_0157452 | |||
| 1783 | Ga0466961_0036216 | |||
| 1784 | Ga0466961_0040230 | |||
| 1785 | Ga0466961_0055341 | |||
| 1786 | Ga0466963_0097288 | |||
| 1787 | Ga0466964_0001090 | |||
| 1788 | Ga0466964_0014482 | |||
| 1789 | Ga0466964_0146560 | |||
| 1790 | Ga0453684_0001350 | |||
| 1791 | Ga0453684_0034029 | |||
| 1792 | Ga0453684_0156600 | |||
| 1793 | Ga0453684_0180964 | |||
| 1794 | Ga0453684_0323749 | |||
| 1795 | Ga0466968_0000616 | |||
| 1796 | Ga0466970_0033717 | |||
| 1797 | Ga0466970_0074021 | |||
| 1798 | Ga0466957_0002832 | |||
| 1799 | Ga0466957_0024178 | |||
| 1800 | Ga0466957_0043523 | |||
| 1801 | Ga0466957_0182616 | |||
| 1802 | Ga0466960_0005116 | |||
| 1803 | Ga0466960_0051914 | |||
| 1804 | Ga0466960_0056313 | |||
| 1805 | Ga0466960_0095495 | |||
| 1806 | Ga0466959_0004947 | |||
| 1807 | Ga0466959_0004984 | |||
| 1808 | Ga0466959_0034076 | |||
| 1809 | Ga0466959_0064400 | |||
| 1810 | Ga0466959_0117360 | |||
| 1811 | Ga0451576_0045374 | |||
| 1812 | Ga0451576_0049001 | |||
| 1813 | Ga0451576_0195343 | |||
| 1814 | Ga0466958_0004695 | |||
| 1815 | Ga0466967_0007605 | |||
| 1816 | Ga0466967_0147630 | |||
| 1817 | Ga0495617_000060 | |||
| 1818 | Ga0495592_0054617 | |||
| 1819 | Ga0495590_0000469 | |||
| 1820 | Ga0495590_0016155 | |||
| 1821 | Ga0495590_0036469 | |||
| 1822 | Ga0495629_0079480 | |||
| 1823 | Ga0495638_0088844 | |||
| 1824 | Ga0495651_0010041 | |||
| 1825 | Ga0495653_0027174 | |||
| 1826 | Ga0495650_0004422 | |||
| 1827 | Ga0495650_0005380 | |||
| 1828 | Ga0495650_0041716 | |||
| 1829 | Ga0495580_0058047 | |||
| 1830 | Ga0495582_0003728 | |||
| 1831 | Ga0495605_0000049 | |||
| 1832 | Ga0495605_0000179 | |||
| 1833 | Ga0495605_0003347 | |||
| 1834 | Ga0495584_0003026 | |||
| 1835 | Ga0495584_0015708 | |||
| 1836 | Ga0495584_0055303 | |||
| 1837 | Ga0495585_0011959 | |||
| 1838 | Ga0495594_0054169 | |||
| 1839 | Ga0495596_0004693 | |||
| 1840 | Ga0495596_0010059 | |||
| 1841 | Ga0495607_0004477 | |||
| 1842 | Ga0495607_0011765 | |||
| 1843 | Ga0495607_0021811 | |||
| 1844 | Ga0495607_0037071 | |||
| 1845 | Ga0495607_0038404 | |||
| 1846 | Ga0495607_0102588 | |||
| 1847 | Ga0495583_0000433 | |||
| 1848 | Ga0495583_0004420 | |||
| 1849 | Ga0495606_0000087 | |||
| 1850 | Ga0495606_0017575 | |||
| 1851 | Ga0495606_0018193 | |||
| 1852 | Ga0495610_0012490 | |||
| 1853 | Ga0495610_0044721 | |||
| 1854 | Ga0495616_0000426 | |||
| 1855 | Ga0495616_0004175 | |||
| 1856 | Ga0495616_0006481 | |||
| 1857 | Ga0495616_0009329 | |||
| 1858 | Ga0495616_0023347 | |||
| 1859 | Ga0495616_0040625 | |||
| 1860 | Ga0495616_0052239 | |||
| 1861 | Ga0495618_0050801 | |||
| 1862 | Ga0495620_0052397 | |||
| 1863 | Ga0495628_0003181 | |||
| 1864 | Ga0495630_0077778 | |||
| 1865 | Ga0495631_0001031 | |||
| 1866 | Ga0495632_0012365 | |||
| 1867 | Ga0495632_0013218 | |||
| 1868 | Ga0495637_0000813 | |||
| 1869 | Ga0495637_0051307 | |||
| 1870 | Ga0495643_0002868 | |||
| 1871 | Ga0495643_0003958 | |||
| 1872 | Ga0495643_0020035 | |||
| 1873 | Ga0495643_0101468 | |||
| 1874 | Ga0495644_0017329 | |||
| 1875 | Ga0495648_0001084 | |||
| 1876 | Ga0495648_0002496 | |||
| 1877 | Ga0495666_0001684 | |||
| 1878 | Ga0495642_0000083 | |||
| 1879 | Ga0495642_0000757 | |||
| 1880 | Ga0495642_0008038 | |||
| 1881 | Ga0495642_0017521 | |||
| 1882 | Ga0495652_0030206 | |||
| 1883 | Ga0495652_0107795 | |||
| 1884 | Ga0495654_0027511 | |||
| 1885 | Ga0495654_0037661 | |||
| 1886 | Ga0495665_0023329 | |||
| 1887 | Ga0495587_0026612 | |||
| 1888 | Ga0495609_0000001 | |||
| 1889 | Ga0495609_0035223 | |||
| 1890 | Ga0495621_0019541 | |||
| 1891 | Ga0495621_0042031 | |||
| 1892 | Ga0495597_0000879 | |||
| 1893 | Ga0495597_0011196 | |||
| 1894 | Ga0495597_0036237 | |||
| 1895 | Ga0495633_0065688 | |||
| 1896 | Ga0495656_0000076 | |||
| 1897 | Ga0495668_0000350 | |||
| 1898 | Ga0495668_0004844 | |||
| 1899 | Ga0495668_0147491 | |||
| 1900 | Ga0495634_0008870 | |||
| 1901 | Ga0495625_0000436 | |||
| 1902 | Ga0495625_0005633 | |||
| 1903 | Ga0495625_0018265 | |||
| 1904 | Ga0495661_0000206 | |||
| 1905 | Ga0495661_0001903 | |||
| 1906 | Ga0495661_0026153 | |||
| 1907 | Ga0495661_0121234 | |||
| 1908 | Ga0495588_0000041 | |||
| 1909 | Ga0495588_0029447 | |||
| 1910 | Ga0495588_0091417 | |||
| 1911 | Ga0495623_0025518 | |||
| 1912 | Ga0495623_0049650 | |||
| 1913 | Ga0495658_0011945 | |||
| 1914 | Ga0495669_0007042 | |||
| 1915 | Ga0495669_0042485 | |||
| 1916 | Ga0495670_0055196 | |||
| 1917 | Ga0495670_0070115 | |||
| 1918 | Ga0495671_0004464 | |||
| 1919 | Ga0495671_0006548 | |||
| 1920 | Ga0495649_0001533 | |||
| 1921 | Ga0495589_0000152 | |||
| 1922 | Ga0495589_0000250 | |||
| 1923 | Ga0495589_0023435 | |||
| 1924 | Ga0495589_0047401 | |||
| 1925 | Ga0495600_0090718 | |||
| 1926 | Ga0495660_0000288 | |||
| 1927 | Ga0495660_0022910 | |||
| 1928 | Ga0495660_0043850 | |||
| 1929 | Ga0495672_0000290 | |||
| 1930 | Ga0495672_0003480 | |||
| 1931 | Ga0495672_0028853 | |||
| 1932 | Ga0495672_0030962 | |||
| 1933 | Ga0495676_0006422 | |||
| 1934 | Ga0495676_0160374 | |||
| 1935 | Ga0495683_0069918 | |||
| 1936 | Ga0495683_0096576 | |||
| 1937 | Ga0495687_000023 | |||
| 1938 | Ga0495687_000027 | |||
| 1939 | Ga0495687_000576 | |||
| 1940 | Ga0495687_035872 | |||
| 1941 | Ga0495687_038404 | |||
| 1942 | Ga0495675_0013071 | |||
| 1943 | Ga0495677_0000001 | |||
| 1944 | Ga0495677_0001805 | |||
| 1945 | Ga0495677_0008447 | |||
| 1946 | Ga0495686_0000222 | |||
| 1947 | Ga0495686_0006302 | |||
| 1948 | Ga0495686_0099767 | |||
| 1949 | Ga0495686_0150721 | |||
| 1950 | Ga0495602_0037073 | |||
| 1951 | Ga0495614_0001247 | |||
| 1952 | Ga0495626_0000037 | |||
| 1953 | Ga0495626_0000520 | |||
| 1954 | Ga0495626_0009773 | |||
| 1955 | Ga0496100_0013999 | |||
| 1956 | Ga0496101_0003842 | |||
| 1957 | Ga0496101_0093699 | |||
| 1958 | Ga0496102_0011197 | |||
| 1959 | Ga0496102_0015225 | |||
| 1960 | Ga0496102_0136122 | |||
| 1961 | Ga0496104_0000625 | |||
| 1962 | Ga0496104_0220223 | |||
| 1963 | Ga0496105_0000638 | |||
| 1964 | Ga0496106_0119092 | |||
| 1965 | Ga0496107_0025622 | |||
| 1966 | Ga0496108_0309349 | |||
| 1967 | Ga0496108_0334502 | |||
| 1968 | Ga0496109_0038690 | |||
| 1969 | Ga0496109_0351051 | |||
| 1970 | Ga0496110_0068024 | |||
| 1971 | Ga0496110_0069420 | |||
| 1972 | Ga0496110_0193355 | |||
| 1973 | Ga0496114_0198788 | |||
| 1974 | Ga0496115_0193859 | |||
| 1975 | Ga0496116_0009153 | |||
| 1976 | Ga0496117_0013047 | |||
| 1977 | Ga0496117_0146500 | |||
| 1978 | Ga0496118_0044479 | |||
| 1979 | Ga0496121_0014532 | |||
| 1980 | Ga0496121_0024441 | |||
| 1981 | Ga0496121_0089658 | |||
| 1982 | Ga0496122_0000103 | |||
| 1983 | Ga0496122_0010319 | |||
| 1984 | Ga0496122_0011628 | |||
| 1985 | Ga0496123_0000261 | |||
| 1986 | Ga0496123_0001777 | |||
| 1987 | Ga0496123_0016312 | |||
| 1988 | Ga0496123_0043105 | |||
| 1989 | Ga0496124_0000919 | |||
| 1990 | Ga0496124_0005843 | |||
| 1991 | Ga0496124_0016567 | |||
| 1992 | Ga0496124_0038513 | |||
| 1993 | Ga0496124_0045738 | |||
| 1994 | Ga0496124_0055493 | |||
| 1995 | Ga0496125_0009347 | |||
| 1996 | Ga0496125_0025933 | |||
| 1997 | Ga0496125_0036972 | |||
| 1998 | Ga0496125_0051204 | |||
| 1999 | Ga0496125_0070582 | |||
| 2000 | Ga0496126_0126193 | |||
| 2001 | Ga0495678_014512 | |||
| 2002 | Ga0501033_0086909 | |||
| 2003 | Ga0501037_0244940 | |||
| 2004 | Ga0501043_0000013 | |||
| 2005 | Ga0501046_0000125 | |||
| 2006 | Ga0501047_0000040 | |||
| 2007 | Ga0501047_0081898 | |||
| 2008 | Ga0501048_0002958 | |||
| 2009 | Ga0501048_0234800 | |||
| 2010 | Ga0501067_0066636 | |||
| 2011 | Ga0501198_000006 | |||
| 2012 | Ga0501222_000007 | |||
| 2013 | Ga0501249_001056 | |||
| 2014 | Ga0501252_003423 | |||
| 2015 | Ga0501035_0000544 | |||
| 2016 | Ga0501035_0000619 | |||
| 2017 | Ga0501035_0038533 | |||
| 2018 | Ga0501035_0199270 | |||
| 2019 | Ga0501045_0007309 | |||
| 2020 | nmdc:mga03683_72044_c1 | |||
| 2021 | nmdc:mga03n38_12421_c1 | |||
| 2022 | nmdc:mga00v17_43474_c1 | |||
| 2023 | nmdc:mga0yw44_8064_c1 | |||
| 2024 | nmdc:mga0k408_14479_c1 | |||
| 2025 | nmdc:mga0k408_24141_c1 | |||
| 2026 | nmdc:mga0k408_28275_c1 | |||
| 2027 | nmdc:mga0k408_3121_c1 | |||
| 2028 | nmdc:mga0k408_57296_c1 | |||
| 2029 | nmdc:mga0k408_7091_c1 | |||
| 2030 | nmdc:mga0k408_82161_c1 | |||
| 2031 | nmdc:mga07m45_1225_c1 | |||
| 2032 | nmdc:mga07m45_6523_c1 | |||
| 2033 | nmdc:mga07m45_716_c1 | |||
| 2034 | nmdc:mga07m45_73290_c1 | |||
| 2035 | nmdc:mga05p37_39567_c1 | |||
| 2036 | nmdc:mga09592_34033_c1 | |||
| 2037 | nmdc:mga08y16_108239_c1 | |||
| 2038 | Ga0500635_0000145 | |||
| 2039 | Ga0500635_0034076 | |||
| 2040 | Ga0500578_0000263 | |||
| 2041 | Ga0500646_0011157 | |||
| 2042 | Ga0500651_0000042 | |||
| 2043 | Ga0500571_000385 | |||
| 2044 | Ga0500593_000087 | |||
| 2045 | Ga0500593_000436 | |||
| 2046 | Ga0500593_016958 | |||
| 2047 | Ga0500607_001690 | |||
| 2048 | Ga0500607_010259 | |||
| 2049 | Ga0500608_015146 | |||
| 2050 | Ga0500626_009829 | |||
| 2051 | Ga0500628_001481 | |||
| 2052 | Ga0500652_001450 | |||
| 2053 | Ga0500655_001604 | |||
| 2054 | Ga0500658_0002529 | |||
| 2055 | Ga0500658_0005455 | |||
| 2056 | Ga0500559_0001528 | |||
| 2057 | Ga0500559_0014366 | |||
| 2058 | Ga0500559_0063266 | |||
| 2059 | Ga0500564_004037 | |||
| 2060 | Ga0500568_0016364 | |||
| 2061 | Ga0500568_0050876 | |||
| 2062 | Ga0500574_001626 | |||
| 2063 | Ga0500619_000055 | |||
| 2064 | Ga0500622_0000106 | |||
| 2065 | Ga0500622_0005905 | |||
| 2066 | Ga0500634_0037894 | |||
| 2067 | Ga0500636_0015185 | |||
| 2068 | Ga0500636_0021939 | |||
| 2069 | Ga0500636_0037982 | |||
| 2070 | Ga0500645_000100 | |||
| 2071 | Ga0500645_005164 | |||
| 2072 | Ga0500661_008746 | |||
| 2073 | Ga0500661_016312 | |||
| 2074 | Ga0590071_001534 | |||
| 2075 | Ga0587079_002337 | |||
| 2076 | Ga0466962_0004778 | |||
| 2077 | Ga0466962_0051617 | |||
| 2078 | 2511245751 | |||
| 2079 | 2513226692 | |||
| 2080 | 2550693309 | |||
| 2081 | 2552747549 | |||
| 2082 | 2587726789 | |||
| 2083 | 2587732270 | |||
| 2084 | 2588295723 | |||
| 2085 | 2599625023 | |||
| 2086 | 2599673035 | |||
| 2087 | 2599682515 | |||
| 2088 | 2599694643 | |||
| 2089 | 2640735813 | |||
| 2090 | 2643799065 | |||
| 2091 | 2643971875 | |||
| 2092 | 2644030726 | |||
| 2093 | 2644139364 | |||
| 2094 | 2644159401 | |||
| 2095 | 2644274974 | |||
| 2096 | 2644329328 | |||
| 2097 | 2644337976 | |||
| 2098 | 2644361934 | |||
| 2099 | 2644401202 | |||
| 2100 | 2644467953 | |||
| 2101 | 2644473604 | |||
| 2102 | 2678229076 | |||
| 2103 | 2738717466 | |||
| 2104 | 2738879068 | |||
| 2105 | 2739248863 | |||
| 2106 | 2739278152 | |||
| 2107 | 2745159963 | |||
| 2108 | 2774390380 | |||
| 2109 | 2774437765 | |||
| 2110 | 2809143043 | |||
| 2111 | 2819540851 | |||
| 2112 | 2819593473 | |||
| 2113 | 2819596977 | |||
| 2114 | 2831266059 | |||
| 2115 | 2838057812 | |||
| 2116 | 2842679080 | |||
| 2117 | 2842735972 | |||
| 2118 | 2842748329 | |||
| 2119 | 2881102193 | |||
| 2120 | 2884814810 | |||
| 2121 | 2884840005 | |||
| 2122 | 2884857227 | |||
| 2123 | 2885197487 | |||
| 2124 | 2885203720 | |||
| 2125 | 2885216930 | |||
| 2126 | 2896157814 | |||
| 2127 | 2899930281 | |||
| 2128 | 2904456245 | |||
| 2129 | 2904457601 | |||
| 2130 | 2904482914 | |||
| 2131 | 2904543644 | |||
| 2132 | 2916700238 | |||
| 2133 | 2919184734 | |||
| 2134 | 2919466956 | |||
| 2135 | 2919507544 | |||
| 2136 | 2919704861 | |||
| 2137 | 2928039394 | |||
| 2138 | 2928045001 | |||
| 2139 | 2928052802 | |||
| 2140 | 2928064525 | |||
| 2141 | 2928075060 | |||
| 2142 | 2928088238 | |||
| 2143 | 2928116312 | |||
| 2144 | 2928517453 | |||
| 2145 | 2929162805 | |||
| 2146 | 2929527354 | |||
| 2147 | 2945911317 | |||
| 2148 | 2945947330 | |||
| 2149 | 2945977651 | |||
| 2150 | 2945986395 | |||
| 2151 | 2954772632 | |||
| 2152 | 2984571889 | |||
| 2153 | 8033234137 | |||
| 2154 | 8047679337 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4l0o-assembly3.cif.gz_A | structure determination of cystathionine gamma-synthase from helicobacter pylori | 0.9526 | 65 | 399 |
| 4l0o-assembly2.cif.gz_O-2 | structure determination of cystathionine gamma-synthase from helicobacter pylori | 0.9393 | 58 | 398 |
| 6khq-assembly1.cif.gz_A-2 | bacterial cystathionine gamma-lyase mccb of staphylococcus aureus with cofactor plp | 0.9364 | 33 | 399 |
| 3qhx-assembly1.cif.gz_C | crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes | 0.9341 | 59 | 397 |
| 4u2h-assembly2.cif.gz_G | the crystal structure of apo cale6, a methionine gamma lyase from micromonospora echinospora | 0.9323 | 61 | 398 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I885_262_396_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9619 | 266 | 401 | 3.90.1150.10 |
| 1pffB01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9439 | 72 | 262 | 3.40.640.10 |
| af_Q5ACX5_11_251_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.929 | 29 | 260 | 3.40.640.10 |
| af_A4I885_262_396_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9275 | 266 | 401 | 3.90.1150.10 |
| af_A4IBL4_19_270_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9231 | 25 | 260 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K2LL61-F1-model_v4 | Cys/Met metabolism pyridoxal-phosphate-dependent protein | 0.9713 | 77 | 404 |
GO:0019346
GO:0019450 GO:0030170 GO:0047804 |
| AF-A0A7C7X156-F1-model_v4 | deleted | 0.9687 | 103 | 313 |
|
| AF-A0A529Y0P1-F1-model_v4 | Cystathionine beta-lyase (EC 4.4.1.8) | 0.9679 | 99 | 368 |
GO:0019346
GO:0019450 GO:0030170 GO:0047804 |
| AF-A0A3B9EKY8-F1-model_v4 | Cystathionine beta-lyase | 0.9672 | 74 | 398 |
GO:0009086
GO:0019346 GO:0019450 GO:0030170 GO:0047804 |
| AF-K2LL61-F1-model_v4 | Cys/Met metabolism pyridoxal-phosphate-dependent protein | 0.9654 | 77 | 404 |
GO:0019346
GO:0019450 GO:0030170 GO:0047804 |