F489577

General Info

Members Datasets Scaffolds Average Seq Length
1076 486 2152 327

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10034778|Ga0070676_100347783
Length 327
Sequence MSADVTSFGKVAVLMGGTSAERQISIMSGTGVLAALRSQGVDAHAFDPAERELVELKREGFARCFIALHGRHGEDGSVQGALELLGIPYTGSGVLASAIAMDKVMTKRVWIAEGLPTPRYQWLSPEQRRAENLREHLRAVPDALGLPLIVKPPREGSSIGITKVAGYSDMQAAVELAAKYDADVLCEEFIDGDEVTCPVLGEGEQAQALPVIRIVAPEGAYDYQNKYFTDDVKYQCPSGLPEAEEREIQRIVVQAYRTLGCRGWGRADLMIRASDRKPFLLEMNTSPGMTTHSLVPMSAKAAGLSYEALCVQILGAAALDAPALATP

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
137 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
147 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
148 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
149 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
220 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
223 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
232 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
233 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
234 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
235 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
236 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
237 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
238 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
239 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
240 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
241 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
242 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
243 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
244 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
249 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
250 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
251 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
277 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
278 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
279 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
280 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
281 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
282 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
283 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
284 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
285 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
286 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
287 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
290 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
291 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
292 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
293 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
294 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
295 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
296 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
297 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
298 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
299 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
300 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
301 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
302 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
303 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
304 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
305 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
306 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
309 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
310 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
311 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
312 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
313 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
318 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
319 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
320 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
329 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
330 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
333 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
334 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
335 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
336 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
337 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
338 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
339 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
346 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
347 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
348 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
349 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
350 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
351 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
352 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
353 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
377 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
378 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
379 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
380 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
381 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
390 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
391 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
392 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
394 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
397 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
398 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
399 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
400 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
401 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
402 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
405 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
406 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
407 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
408 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
409 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
410 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
411 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
412 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
413 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
414 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
415 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
416 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
417 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
419 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
420 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
421 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
422 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
423 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
424 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
425 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
426 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
427 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
428 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
429 2547132374 Acidovorax radicis N35 Isolate Unclassified
430 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
431 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
432 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
433 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
434 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
435 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
436 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
437 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
438 2643221570 Acidovorax sp. Root568 Isolate Unclassified
439 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
440 2643221596 Acidovorax sp. Root70 Isolate Unclassified
441 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
442 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
443 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
444 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
445 2643221652 Acidovorax sp. Root402 Isolate Unclassified
446 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
447 2643221658 Variovorax sp. Root411 Isolate Unclassified
448 2643221660 Methylibium sp. Root1272 Isolate Unclassified
449 2643221672 Variovorax sp. Root434 Isolate Unclassified
450 2643221683 Variovorax sp. Root473 Isolate Unclassified
451 2643221717 Acidovorax sp. Root267 Isolate Unclassified
452 2738541277 Variovorax sp. GV051 Isolate Unclassified
453 2738541307 Variovorax sp. GV008 Isolate Unclassified
454 2738543013 Variovorax sp. BT01 Isolate Unclassified
455 2738543019 Variovorax sp. GV040 Isolate Unclassified
456 2818991436 Collimonas arenae 515 Isolate Unclassified
457 2818991446 Variovorax sp. 1180 Isolate Unclassified
458 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
459 2831864461 Roseateles noduli HZ7 Isolate Nodule
460 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
461 2842677519 Variovorax sp. R-72495 Isolate Unclassified
462 2842733646 Variovorax sp. R-72446 Isolate Unclassified
463 2842747753 Variovorax sp. R-72060 Isolate Unclassified
464 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
465 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
466 2885198086 Variovorax sp. 679 Isolate Unclassified
467 2885211737 Variovorax sp. 553 Isolate Unclassified
468 2899924645 Variovorax sp. 369 Isolate Unclassified
469 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
470 2904456579 Variovorax sp. 2002 Isolate Unclassified
471 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
472 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
473 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
474 2928037797 Variovorax sp. 1126 Isolate Unclassified
475 2928044640 Variovorax sp. 1128 Isolate Unclassified
476 2928051484 Variovorax sp. 1133 Isolate Unclassified
477 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
478 2928070936 Variovorax gossypii 1167 Isolate Unclassified
479 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
480 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
481 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
482 2929520902 Variovorax beijingensis 502 Isolate Unclassified
483 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
484 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
485 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
486 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.05
Metatranscriptomes 0.46
Isolates 5.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.89
Nodule 0.74
Rhizoplane 2.88
Rhizosphere 64.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10034778 3300005328 Bacteria 2894
2 JGI24740J21852_10002227 3300001979 Bacteria 8855
3 JGI25156J39149_1001782 3300002705 Bacteria 8509
4 JGI25156J39149_1007524 3300002705 Bacteria 2846
5 JGI25162J39368_1000063 3300002737 Bacteria 134747
6 JGI25154J39366_1001302 3300002738 Bacteria 9272
7 JGI25154J39366_1004037 3300002738 Bacteria 2783
8 JGI25157J39369_1000148 3300002741 Bacteria 58782
9 JGI25163J39215_1001308 3300002771 Bacteria 4398
10 JGI25164J39214_1004328 3300002772 Bacteria 1652
11 JGI25152J39213_1010277 3300002773 Bacteria 2156
12 JGI25150J39212_1006072 3300002774 Bacteria 2526
13 JGI25165J46597_1000069 3300003214 Bacteria 195460
14 JGI25153J46596_10003671 3300003215 Bacteria 8496
15 JGI25153J46596_10004835 3300003215 Bacteria 7177
16 rootH1_10010206 3300003316 Bacteria 1833
17 rootH1_10015203 3300003316 Bacteria 4095
18 rootL2_10000966 3300003322 Bacteria 57184
19 rootH1_10000830 3300003323 Bacteria 4608
20 rootH1_10114267 3300003323 Bacteria 1418
21 Ga0007409J51694_1045597 3300003575 Bacteria 1557
22 Ga0006562J51391_1013325 3300003578 Bacteria 17825
23 Ga0006562J51391_1013332 3300003578 Bacteria 3530
24 Ga0006562J51391_1029542 3300003578 Bacteria 12747
25 Ga0006562J51391_1029546 3300003578 Bacteria 2420
26 Ga0055538_1000034 3300003751 Bacteria 195460
27 Ga0055539_1000044 3300003752 Bacteria 195460
28 Ga0055539_1000763 3300003752 Bacteria 7795
29 Ga0055539_1002964 3300003752 Bacteria 2454
30 Ga0055533_1000016 3300003756 Bacteria 396179
31 Ga0055533_1000055 3300003756 Bacteria 195460
32 Ga0055525_1000066 3300003759 Bacteria 195460
33 Ga0055525_1001386 3300003759 Bacteria 4586
34 Ga0055535_1000934 3300003761 Bacteria 19510
35 Ga0055535_1002036 3300003761 Bacteria 8207
36 Ga0055542_1000051 3300003762 Bacteria 175242
37 Ga0055529_1000333 3300003763 Bacteria 52783
38 Ga0055526_1000826 3300003771 Bacteria 23122
39 Ga0055526_1001991 3300003771 Bacteria 14078
40 Ga0055524_1000052 3300003775 Bacteria 144959
41 Ga0055536_1012919 3300003781 Bacteria 3055
42 Ga0055536_1018427 3300003781 Bacteria 2238
43 Ga0055534_1001847 3300003784 Bacteria 7905
44 Ga0055534_1002526 3300003784 Bacteria 6276
45 Ga0055534_1005182 3300003784 Bacteria 3566
46 Ga0055528_1013683 3300003790 Bacteria 3057
47 Ga0055528_1022218 3300003790 Bacteria 1982
48 Ga0055530_10006857 3300003791 Bacteria 4941
49 Ga0055530_10008783 3300003791 Bacteria 3989
50 Ga0055530_10015568 3300003791 Bacteria 2474
51 Ga0055540_1000019 3300003792 Bacteria 210593
52 Ga0055540_1001799 3300003792 Bacteria 12186
53 Ga0055540_1006211 3300003792 Bacteria 4800
54 Ga0055540_1007850 3300003792 Bacteria 3948
55 Ga0055540_1008402 3300003792 Bacteria 3724
56 Ga0055540_1011021 3300003792 Bacteria 2954
57 Ga0055540_1031797 3300003792 Bacteria 1210
58 Ga0055531_10000360 3300003794 Bacteria 44186
59 Ga0055531_10001074 3300003794 Bacteria 21465
60 Ga0055531_10003311 3300003794 Bacteria 10311
61 Ga0055531_10009158 3300003794 Bacteria 5102
62 Ga0055531_10012618 3300003794 Bacteria 3963
63 Ga0055531_10020656 3300003794 Bacteria 2593
64 Ga0055541_1000032 3300003841 Bacteria 195460
65 Ga0055543_1005706 3300004625 Bacteria 3134
66 Ga0065165_1000080 3300005262 Bacteria 159638
67 Ga0065165_1000101 3300005262 Bacteria 141486
68 Ga0065165_1003865 3300005262 Bacteria 9941
69 Ga0065165_1043062 3300005262 Bacteria 1328
70 Ga0065707_10100423 3300005295 Bacteria 2930
71 Ga0070658_10100789 3300005327 Bacteria 2387
72 Ga0070658_10227236 3300005327 Bacteria 1580
73 Ga0070676_10011159 3300005328 Bacteria 4881
74 Ga0070676_10012151 3300005328 Bacteria 4695
75 Ga0070676_10127828 3300005328 Bacteria 1603
76 Ga0070683_100029368 3300005329 Bacteria 4977
77 Ga0070683_100087729 3300005329 Bacteria 2919
78 Ga0070690_100022459 3300005330 Bacteria 3859
79 Ga0070690_100055811 3300005330 Bacteria 2530
80 Ga0070670_100086045 3300005331 Bacteria 2701
81 Ga0070670_100115775 3300005331 Bacteria 2311
82 Ga0070670_100138057 3300005331 Bacteria 2107
83 Ga0070670_100199404 3300005331 Bacteria 1739
84 Ga0070670_100209046 3300005331 Bacteria 1697
85 Ga0070670_100252130 3300005331 Bacteria 1538
86 Ga0070677_10032005 3300005333 Bacteria 2014
87 Ga0070677_10140655 3300005333 Bacteria 1113
88 Ga0068869_100010879 3300005334 Bacteria 5951
89 Ga0068869_100027914 3300005334 Bacteria 3939
90 Ga0068869_100061795 3300005334 Bacteria 2748
91 Ga0068869_100065097 3300005334 Bacteria 2683
92 Ga0070666_10050920 3300005335 Bacteria 2787
93 Ga0070666_10128748 3300005335 Bacteria 1758
94 Ga0070682_100085166 3300005337 Bacteria 2056
95 Ga0068868_100014027 3300005338 Bacteria 5896
96 Ga0068868_100025884 3300005338 Bacteria 4467
97 Ga0068868_100057346 3300005338 Bacteria 3077
98 Ga0068868_100073336 3300005338 Bacteria 2733
99 Ga0070660_100013524 3300005339 Bacteria 5856
100 Ga0070660_100034480 3300005339 Bacteria 3825
101 Ga0070660_100128252 3300005339 Bacteria 2028
102 Ga0070689_100328387 3300005340 Bacteria 1279
103 Ga0070687_100030101 3300005343 Bacteria 2651
104 Ga0070661_100001817 3300005344 Bacteria 14798
105 Ga0070661_100100058 3300005344 Bacteria 2155
106 Ga0070668_100024251 3300005347 Bacteria 4594
107 Ga0070668_100117189 3300005347 Bacteria 2125
108 Ga0070668_100119935 3300005347 Bacteria 2101
109 Ga0070669_100034251 3300005353 Bacteria 3677
110 Ga0070669_100071168 3300005353 Bacteria 2572
111 Ga0070669_100072824 3300005353 Bacteria 2544
112 Ga0070675_100027434 3300005354 Bacteria 4574
113 Ga0070675_100064813 3300005354 Bacteria 3020
114 Ga0070675_100076311 3300005354 Bacteria 2787
115 Ga0070675_100318094 3300005354 Bacteria 1374
116 Ga0070671_100011406 3300005355 Bacteria 7146
117 Ga0070671_100021838 3300005355 Bacteria 5228
118 Ga0070671_100076886 3300005355 Bacteria 2789
119 Ga0070671_100095343 3300005355 Bacteria 2494
120 Ga0070671_100216587 3300005355 Bacteria 1624
121 Ga0070674_100020660 3300005356 Bacteria 4213
122 Ga0070674_100136341 3300005356 Bacteria 1836
123 Ga0070674_100146065 3300005356 Bacteria 1780
124 Ga0070673_100010575 3300005364 Bacteria 6251
125 Ga0070673_100029046 3300005364 Bacteria 4120
126 Ga0070673_100060598 3300005364 Bacteria 2999
127 Ga0070659_100000579 3300005366 Bacteria 26725
128 Ga0070659_100138085 3300005366 Bacteria 1983
129 Ga0070659_100141084 3300005366 Bacteria 1962
130 Ga0070667_100017022 3300005367 Bacteria 6019
131 Ga0070667_100048321 3300005367 Bacteria 3581
132 Ga0070667_100063689 3300005367 Bacteria 3125
133 Ga0070708_100143642 3300005445 Bacteria 2215
134 Ga0070663_100001569 3300005455 Bacteria 12571
135 Ga0070663_100005909 3300005455 Bacteria 7323
136 Ga0070663_100416172 3300005455 Bacteria 1102
137 Ga0070678_100013580 3300005456 Bacteria 5113
138 Ga0070678_100086673 3300005456 Bacteria 2389
139 Ga0070678_100164593 3300005456 Bacteria 1800
140 Ga0070678_100172516 3300005456 Bacteria 1763
141 Ga0070678_100185324 3300005456 Bacteria 1707
142 Ga0070678_100408253 3300005456 Bacteria 1181
143 Ga0070662_100034033 3300005457 Bacteria 3591
144 Ga0070662_100054096 3300005457 Bacteria 2908
145 Ga0070662_100055624 3300005457 Bacteria 2871
146 Ga0070662_100158535 3300005457 Bacteria 1768
147 Ga0070681_10232499 3300005458 Bacteria 1758
148 Ga0068867_100000072 3300005459 Bacteria 61663
149 Ga0068867_100014337 3300005459 Bacteria 5614
150 Ga0068867_100014505 3300005459 Bacteria 5585
151 Ga0068867_100025831 3300005459 Bacteria 4213
152 Ga0068867_100039511 3300005459 Bacteria 3440
153 Ga0068867_100084146 3300005459 Bacteria 2402
154 Ga0068867_100160344 3300005459 Bacteria 1773
155 Ga0070706_100003148 3300005467 Bacteria 16310
156 Ga0070679_100016827 3300005530 Bacteria 7067
157 Ga0070679_100458852 3300005530 Bacteria 1219
158 Ga0070684_100233184 3300005535 Bacteria 1681
159 Ga0068853_100022735 3300005539 Bacteria 5240
160 Ga0068853_100080199 3300005539 Bacteria 2855
161 Ga0070672_100027758 3300005543 Bacteria 4225
162 Ga0070672_100053209 3300005543 Bacteria 3164
163 Ga0070672_100100519 3300005543 Bacteria 2345
164 Ga0070672_100161318 3300005543 Bacteria 1860
165 Ga0070672_100228763 3300005543 Bacteria 1562
166 Ga0070693_100011646 3300005547 Bacteria 4432
167 Ga0070665_100050202 3300005548 Bacteria 4186
168 Ga0070665_100093595 3300005548 Bacteria 3010
169 Ga0070665_100304456 3300005548 Bacteria 1597
170 Ga0068855_100013525 3300005563 Bacteria 9840
171 Ga0068855_100020802 3300005563 Bacteria 7867
172 Ga0068855_100050047 3300005563 Bacteria 4925
173 Ga0068855_100176827 3300005563 Bacteria 2415
174 Ga0068855_100450372 3300005563 Bacteria 1405
175 Ga0070664_100003888 3300005564 Bacteria 12054
176 Ga0070664_100017203 3300005564 Bacteria 5936
177 Ga0070664_100026915 3300005564 Bacteria 4776
178 Ga0070664_100095364 3300005564 Bacteria 2580
179 Ga0070664_100308447 3300005564 Bacteria 1432
180 Ga0070664_100480371 3300005564 Bacteria 1143
181 Ga0068857_100068892 3300005577 Bacteria 3149
182 Ga0068857_100088867 3300005577 Bacteria 2764
183 Ga0068857_100112626 3300005577 Bacteria 2446
184 Ga0068854_100023360 3300005578 Bacteria 4222
185 Ga0068856_100012944 3300005614 Bacteria 8076
186 Ga0068856_100059328 3300005614 Bacteria 3780
187 Ga0068856_100059918 3300005614 Bacteria 3760
188 Ga0068856_100443477 3300005614 Bacteria 1319
189 Ga0068852_100028494 3300005616 Bacteria 4572
190 Ga0068852_100031065 3300005616 Bacteria 4402
191 Ga0068852_100085784 3300005616 Bacteria 2805
192 Ga0068852_100095692 3300005616 Bacteria 2667
193 Ga0068852_100114168 3300005616 Bacteria 2461
194 Ga0068852_100198506 3300005616 Bacteria 1897
195 Ga0068852_100208459 3300005616 Bacteria 1853
196 Ga0068859_100010805 3300005617 Bacteria 9191
197 Ga0068859_100033863 3300005617 Bacteria 5129
198 Ga0068859_100208397 3300005617 Bacteria 2041
199 Ga0068859_100231075 3300005617 Bacteria 1938
200 Ga0068859_100327980 3300005617 Bacteria 1625
201 Ga0068864_100002362 3300005618 Bacteria 15612
202 Ga0068864_100049681 3300005618 Bacteria 3609
203 Ga0068864_100056292 3300005618 Bacteria 3397
204 Ga0068864_100082398 3300005618 Bacteria 2822
205 Ga0068864_100157482 3300005618 Bacteria 2062
206 Ga0068866_10033347 3300005718 Bacteria 2497
207 Ga0068866_10180079 3300005718 Bacteria 1248
208 Ga0068861_100001649 3300005719 Bacteria 14258
209 Ga0068861_100022805 3300005719 Bacteria 4513
210 Ga0068861_100024567 3300005719 Bacteria 4359
211 Ga0068861_100146023 3300005719 Bacteria 1936
212 Ga0068851_10035063 3300005834 Bacteria 2507
213 Ga0068851_10115492 3300005834 Bacteria 1438
214 Ga0068870_10025942 3300005840 Bacteria 2915
215 Ga0068870_10054833 3300005840 Bacteria 2122
216 Ga0068870_10115178 3300005840 Bacteria 1541
217 Ga0068863_100031768 3300005841 Bacteria 5037
218 Ga0068863_100038412 3300005841 Bacteria 4554
219 Ga0068863_100040765 3300005841 Bacteria 4415
220 Ga0068863_100051637 3300005841 Bacteria 3896
221 Ga0068863_100083801 3300005841 Bacteria 3021
222 Ga0068863_100189569 3300005841 Bacteria 1976
223 Ga0068858_100000947 3300005842 Bacteria 30015
224 Ga0068858_100028870 3300005842 Bacteria 5151
225 Ga0068858_100188292 3300005842 Bacteria 1950
226 Ga0068860_100000590 3300005843 Bacteria 43453
227 Ga0068860_100013253 3300005843 Bacteria 8089
228 Ga0068860_100156493 3300005843 Bacteria 2196
229 Ga0068860_100197279 3300005843 Bacteria 1950
230 Ga0068860_100204213 3300005843 Bacteria 1916
231 Ga0068862_100028602 3300005844 Bacteria 4695
232 Ga0068862_100056931 3300005844 Bacteria 3351
233 Ga0068862_100058125 3300005844 Bacteria 3317
234 Ga0075365_10001679 3300006038 Bacteria 10232
235 Ga0075365_10034744 3300006038 Bacteria 3257
236 Ga0075363_100012906 3300006048 Bacteria 4034
237 Ga0075363_100053453 3300006048 Bacteria 2158
238 Ga0075364_10023395 3300006051 Bacteria 3912
239 Ga0075364_10194821 3300006051 Bacteria 1373
240 Ga0075362_10006614 3300006177 Bacteria 4327
241 Ga0075367_10013667 3300006178 Bacteria 4372
242 Ga0075367_10030265 3300006178 Bacteria 3102
243 Ga0075367_10065816 3300006178 Bacteria 2171
244 Ga0075367_10085205 3300006178 Bacteria 1917
245 Ga0075367_10125705 3300006178 Bacteria 1582
246 Ga0075369_10038509 3300006186 Bacteria 2040
247 Ga0075366_10032419 3300006195 Bacteria 3075
248 Ga0075366_10040155 3300006195 Bacteria 2767
249 Ga0075366_10051496 3300006195 Bacteria 2446
250 Ga0075366_10075317 3300006195 Bacteria 2013
251 Ga0075366_10103866 3300006195 Bacteria 1707
252 Ga0097621_100064293 3300006237 Bacteria 3017
253 Ga0097621_100081669 3300006237 Bacteria 2690
254 Ga0097621_100159403 3300006237 Bacteria 1939
255 Ga0075370_10000547 3300006353 Bacteria 14418
256 Ga0075370_10002604 3300006353 Bacteria 8412
257 Ga0075370_10007775 3300006353 Bacteria 5477
258 Ga0075370_10011725 3300006353 Bacteria 4614
259 Ga0075370_10021986 3300006353 Bacteria 3497
260 Ga0075370_10037246 3300006353 Bacteria 2734
261 Ga0075370_10040108 3300006353 Bacteria 2640
262 Ga0075370_10075281 3300006353 Bacteria 1935
263 Ga0068871_100074554 3300006358 Bacteria 2799
264 Ga0068871_100093767 3300006358 Bacteria 2505
265 Ga0068871_100130241 3300006358 Bacteria 2132
266 Ga0075430_100078142 3300006846 Bacteria 2774
267 Ga0075429_100000199 3300006880 Bacteria 39995
268 Ga0068865_100079132 3300006881 Bacteria 2353
269 Ga0068865_100145558 3300006881 Bacteria 1792
270 Ga0097620_100010805 3300006931 Bacteria 9191
271 Ga0097620_100033861 3300006931 Bacteria 5129
272 Ga0097620_100208406 3300006931 Bacteria 2041
273 Ga0097620_100231087 3300006931 Bacteria 1938
274 Ga0097620_100327959 3300006931 Bacteria 1625
275 Ga0079104_1000206 3300006946 Bacteria 82424
276 Ga0079104_1017870 3300006946 Bacteria 2026
277 Ga0099826_10041983 3300006948 Bacteria 3167
278 Ga0099826_10085707 3300006948 Bacteria 1944
279 Ga0105244_10007138 3300009036 Bacteria 7139
280 Ga0105240_10024611 3300009093 Bacteria 7930
281 Ga0105240_10062071 3300009093 Bacteria 4654
282 Ga0105245_10102204 3300009098 Bacteria 2654
283 Ga0105245_10442779 3300009098 Bacteria 1306
284 Ga0114129_10149580 3300009147 Bacteria 3196
285 Ga0105243_10001108 3300009148 Bacteria 24452
286 Ga0105243_10010327 3300009148 Bacteria 7091
287 Ga0105243_10019712 3300009148 Bacteria 5114
288 Ga0105242_10018229 3300009176 Bacteria 5486
289 Ga0105242_10079059 3300009176 Bacteria 2746
290 Ga0105242_10615719 3300009176 Bacteria 1051
291 Ga0105248_10000507 3300009177 Bacteria 44310
292 Ga0105248_10123485 3300009177 Bacteria 2921
293 Ga0105248_10154142 3300009177 Bacteria 2592
294 Ga0105248_10333990 3300009177 Bacteria 1707
295 Ga0105237_10367620 3300009545 Bacteria 1443
296 Ga0105238_10020663 3300009551 Bacteria 6707
297 Ga0105238_10081997 3300009551 Bacteria 3215
298 Ga0105238_10227899 3300009551 Bacteria 1840
299 Ga0105249_10010561 3300009553 Bacteria 8116
300 Ga0105249_10022308 3300009553 Bacteria 5671
301 Ga0105239_10072072 3300010375 Bacteria 3797
302 Ga0105239_10166314 3300010375 Bacteria 2466
303 Ga0157319_1000008 3300012497 Bacteria 315600
304 Ga0157373_10022910 3300013100 Bacteria 4530
305 Ga0157373_10037740 3300013100 Bacteria 3462
306 Ga0157373_10178132 3300013100 Bacteria 1497
307 Ga0157371_10102629 3300013102 Bacteria 2029
308 Ga0157370_10117019 3300013104 Bacteria 2490
309 Ga0157369_10013318 3300013105 Bacteria 9299
310 Ga0157369_10059000 3300013105 Bacteria 4139
311 Ga0157374_10097347 3300013296 Bacteria 2815
312 Ga0157374_10170314 3300013296 Bacteria 2124
313 Ga0157378_10008627 3300013297 Bacteria 8870
314 Ga0163162_10002118 3300013306 Bacteria 18641
315 Ga0163162_10007695 3300013306 Bacteria 10495
316 Ga0163162_10026342 3300013306 Bacteria 5747
317 Ga0157372_10051925 3300013307 Bacteria 4564
318 Ga0157375_10046187 3300013308 Bacteria 4244
319 Ga0157375_10064111 3300013308 Bacteria 3657
320 Ga0157375_10095187 3300013308 Bacteria 3048
321 Ga0157375_10099385 3300013308 Bacteria 2989
322 Ga0157375_10112718 3300013308 Bacteria 2820
323 Ga0157375_10130614 3300013308 Bacteria 2631
324 Ga0157375_10318209 3300013308 Bacteria 1721
325 Ga0163163_10007361 3300014325 Bacteria 9711
326 Ga0163163_10165401 3300014325 Bacteria 2258
327 Ga0163163_10251023 3300014325 Bacteria 1820
328 Ga0163163_10580674 3300014325 Bacteria 1184
329 Ga0157380_10015463 3300014326 Bacteria 5610
330 Ga0157380_10056674 3300014326 Bacteria 3118
331 Ga0157380_10102260 3300014326 Bacteria 2389
332 Ga0157380_10112388 3300014326 Bacteria 2292
333 Ga0157380_10281039 3300014326 Bacteria 1523
334 Ga0157380_10548396 3300014326 Bacteria 1134
335 Ga0182008_10001156 3300014497 Bacteria 18204
336 Ga0182008_10004095 3300014497 Bacteria 8593
337 Ga0182008_10008484 3300014497 Bacteria 5610
338 Ga0182008_10116007 3300014497 Bacteria 1328
339 Ga0157377_10000075 3300014745 Bacteria 76405
340 Ga0157377_10023652 3300014745 Bacteria 3259
341 Ga0157379_10025992 3300014968 Bacteria 5207
342 Ga0157379_10030374 3300014968 Bacteria 4809
343 Ga0157379_10034913 3300014968 Bacteria 4483
344 Ga0157379_10061361 3300014968 Bacteria 3362
345 Ga0157379_10069401 3300014968 Bacteria 3152
346 Ga0157379_10093358 3300014968 Bacteria 2700
347 Ga0157379_10097801 3300014968 Bacteria 2635
348 Ga0157379_10122709 3300014968 Bacteria 2338
349 Ga0157379_10266193 3300014968 Bacteria 1558
350 Ga0157376_10017920 3300014969 Bacteria 5415
351 Ga0157376_10142978 3300014969 Bacteria 2149
352 Ga0157376_10206022 3300014969 Bacteria 1813
353 Ga0157376_10227786 3300014969 Bacteria 1730
354 Ga0182006_1003275 3300015261 Bacteria 8372
355 Ga0182007_10002915 3300015262 Bacteria 8314
356 Ga0182007_10031538 3300015262 Bacteria 1804
357 Ga0182005_1000283 3300015265 Bacteria 31970
358 Ga0182005_1017831 3300015265 Bacteria 1964
359 Ga0183362_10003 3300015683 Bacteria 977584
360 Ga0163161_10039684 3300017792 Bacteria 3381
361 Ga0163161_10053752 3300017792 Bacteria 2921
362 Ga0163161_10090355 3300017792 Bacteria 2266
363 Ga0213872_10000382 3300021361 Bacteria 37031
364 Ga0209435_101147 3300025206 Bacteria 3652
365 Ga0209784_100049 3300025224 Bacteria 195512
366 Ga0209566_100061 3300025225 Bacteria 195512
367 Ga0209674_100041 3300025226 Bacteria 396231
368 Ga0209674_100069 3300025226 Bacteria 243948
369 Ga0209672_100538 3300025228 Bacteria 20576
370 Ga0209672_102207 3300025228 Bacteria 5083
371 Ga0209147_102676 3300025229 Bacteria 4127
372 Ga0209563_100043 3300025230 Bacteria 397271
373 Ga0209563_100083 3300025230 Bacteria 195512
374 Ga0207427_100345 3300025231 Bacteria 30030
375 Ga0207427_100646 3300025231 Bacteria 16896
376 Ga0209437_100091 3300025233 Bacteria 243344
377 Ga0209258_100132 3300025242 Bacteria 175292
378 Ga0209258_100344 3300025242 Bacteria 68131
379 Ga0209258_100785 3300025242 Bacteria 19212
380 Ga0207425_1000226 3300025245 Bacteria 44291
381 Ga0207425_1007249 3300025245 Bacteria 2948
382 Ga0209646_1000069 3300025246 Bacteria 230340
383 Ga0209646_1002496 3300025246 Bacteria 4043
384 Ga0209026_1000006 3300025250 Bacteria 677225
385 Ga0209677_100039 3300025253 Bacteria 243974
386 Ga0209677_100096 3300025253 Bacteria 99089
387 Ga0209677_101194 3300025253 Bacteria 11889
388 Ga0209148_1000007 3300025254 Bacteria 1592273
389 Ga0209148_1008882 3300025254 Bacteria 1993
390 Ga0209759_1000075 3300025256 Bacteria 176235
391 Ga0209759_1001215 3300025256 Bacteria 15837
392 Ga0209759_1001295 3300025256 Bacteria 14863
393 Ga0209759_1003631 3300025256 Bacteria 6070
394 Ga0209759_1012969 3300025256 Bacteria 2279
395 Ga0209759_1014554 3300025256 Bacteria 2074
396 Ga0209129_1000012 3300025258 Bacteria 541516
397 Ga0209129_1000084 3300025258 Bacteria 182554
398 Ga0209233_1000115 3300025261 Bacteria 243344
399 Ga0209565_1000169 3300025263 Bacteria 84839
400 Ga0209565_1000364 3300025263 Bacteria 38944
401 Ga0209565_1015528 3300025263 Bacteria 1715
402 Ga0209455_1000242 3300025272 Bacteria 68131
403 Ga0209673_1000114 3300025273 Bacteria 178557
404 Ga0209673_1000916 3300025273 Bacteria 37512
405 Ga0209673_1001117 3300025273 Bacteria 29869
406 Ga0209673_1009349 3300025273 Bacteria 4258
407 Ga0209673_1018628 3300025273 Bacteria 2517
408 Ga0209673_1019820 3300025273 Bacteria 2403
409 Ga0209673_1023627 3300025273 Bacteria 2088
410 Ga0209673_1032796 3300025273 Bacteria 1595
411 Ga0209130_1000571 3300025284 Bacteria 36074
412 Ga0209130_1004615 3300025284 Bacteria 5136
413 Ga0209675_1000062 3300025291 Bacteria 178557
414 Ga0209675_1006399 3300025291 Bacteria 4731
415 Ga0209676_1000817 3300025292 Bacteria 40674
416 Ga0209676_1003376 3300025292 Bacteria 9919
417 Ga0209676_1006433 3300025292 Bacteria 5803
418 Ga0209676_1006821 3300025292 Bacteria 5537
419 Ga0209025_1000719 3300025294 Bacteria 56292
420 Ga0209025_1000861 3300025294 Bacteria 47942
421 Ga0209025_1018573 3300025294 Bacteria 3927
422 Ga0209025_1045276 3300025294 Bacteria 1826
423 Ga0209564_1000008 3300025295 Bacteria 953227
424 Ga0209564_1000022 3300025295 Bacteria 555109
425 Ga0209564_1000414 3300025295 Bacteria 75224
426 Ga0209564_1000613 3300025295 Bacteria 55031
427 Ga0209758_1000099 3300025297 Bacteria 230054
428 Ga0209758_1002249 3300025297 Bacteria 20036
429 Ga0209050_1000052 3300025298 Bacteria 351785
430 Ga0209050_1001635 3300025298 Bacteria 22939
431 Ga0209050_1001761 3300025298 Bacteria 21453
432 Ga0209050_1001765 3300025298 Bacteria 21356
433 Ga0209256_1000036 3300025299 Bacteria 386664
434 Ga0209256_1000206 3300025299 Bacteria 111425
435 Ga0209256_1000239 3300025299 Bacteria 97580
436 Ga0207426_1000049 3300025302 Bacteria 401954
437 Ga0207426_1000086 3300025302 Bacteria 292089
438 Ga0207426_1000346 3300025302 Bacteria 85832
439 Ga0209051_1000015 3300025303 Bacteria 546798
440 Ga0209051_1000025 3300025303 Bacteria 415397
441 Ga0209051_1000071 3300025303 Bacteria 210843
442 Ga0209051_1000420 3300025303 Bacteria 58383
443 Ga0209051_1000492 3300025303 Bacteria 51006
444 Ga0209051_1001081 3300025303 Bacteria 25280
445 Ga0209051_1001503 3300025303 Bacteria 19479
446 Ga0209051_1002112 3300025303 Bacteria 14864
447 Ga0209257_1000037 3300025304 Bacteria 612915
448 Ga0209257_1000039 3300025304 Bacteria 591694
449 Ga0209257_1000367 3300025304 Bacteria 91077
450 Ga0209257_1003430 3300025304 Bacteria 13611
451 Ga0209257_1005624 3300025304 Bacteria 8678
452 Ga0207656_10042172 3300025321 Bacteria 1941
453 Ga0207656_10062157 3300025321 Bacteria 1641
454 Ga0207656_10080253 3300025321 Bacteria 1465
455 Ga0207655_1000477 3300025728 Bacteria 51677
456 Ga0207682_10040791 3300025893 Bacteria 1892
457 Ga0207682_10042315 3300025893 Bacteria 1861
458 Ga0207642_10010253 3300025899 Bacteria 3294
459 Ga0207642_10182304 3300025899 Bacteria 1145
460 Ga0207680_10143169 3300025903 Bacteria 1586
461 Ga0207680_10145423 3300025903 Bacteria 1575
462 Ga0207680_10168886 3300025903 Bacteria 1472
463 Ga0207680_10224614 3300025903 Bacteria 1289
464 Ga0207647_10089114 3300025904 Bacteria 1842
465 Ga0207645_10008088 3300025907 Bacteria 7379
466 Ga0207645_10037909 3300025907 Bacteria 3093
467 Ga0207645_10064845 3300025907 Bacteria 2334
468 Ga0207645_10102595 3300025907 Bacteria 1846
469 Ga0207643_10029897 3300025908 Bacteria 3031
470 Ga0207643_10067632 3300025908 Bacteria 2051
471 Ga0207705_10017381 3300025909 Bacteria 5151
472 Ga0207705_10061682 3300025909 Bacteria 2708
473 Ga0207705_10121110 3300025909 Bacteria 1942
474 Ga0207695_10019040 3300025913 Bacteria 7918
475 Ga0207695_10092973 3300025913 Bacteria 3026
476 Ga0207695_10108240 3300025913 Bacteria 2764
477 Ga0207695_10116955 3300025913 Bacteria 2640
478 Ga0207662_10029185 3300025918 Bacteria 3194
479 Ga0207657_10021426 3300025919 Bacteria 6082
480 Ga0207657_10065236 3300025919 Bacteria 3105
481 Ga0207657_10081075 3300025919 Bacteria 2726
482 Ga0207657_10113479 3300025919 Bacteria 2236
483 Ga0207657_10156024 3300025919 Bacteria 1856
484 Ga0207649_10001310 3300025920 Bacteria 14847
485 Ga0207649_10022011 3300025920 Bacteria 3679
486 Ga0207649_10176533 3300025920 Bacteria 1492
487 Ga0207652_10018335 3300025921 Bacteria 5739
488 Ga0207652_10130236 3300025921 Bacteria 2243
489 Ga0207652_10194118 3300025921 Bacteria 1826
490 Ga0207681_10000593 3300025923 Bacteria 24630
491 Ga0207681_10016551 3300025923 Bacteria 4615
492 Ga0207681_10052469 3300025923 Bacteria 2765
493 Ga0207681_10112309 3300025923 Bacteria 1984
494 Ga0207694_10036617 3300025924 Bacteria 3766
495 Ga0207694_10056930 3300025924 Bacteria 3038
496 Ga0207650_10001668 3300025925 Bacteria 15808
497 Ga0207650_10007368 3300025925 Bacteria 7487
498 Ga0207650_10008263 3300025925 Bacteria 7106
499 Ga0207650_10077646 3300025925 Bacteria 2511
500 Ga0207650_10343548 3300025925 Bacteria 1226
501 Ga0207659_10002674 3300025926 Bacteria 10616
502 Ga0207659_10016256 3300025926 Bacteria 4839
503 Ga0207659_10021228 3300025926 Bacteria 4307
504 Ga0207659_10025527 3300025926 Bacteria 3972
505 Ga0207659_10105397 3300025926 Bacteria 2133
506 Ga0207687_10014488 3300025927 Bacteria 5159
507 Ga0207644_10001504 3300025931 Bacteria 15026
508 Ga0207644_10001724 3300025931 Bacteria 14137
509 Ga0207644_10022871 3300025931 Bacteria 4274
510 Ga0207690_10012412 3300025932 Bacteria 5094
511 Ga0207690_10117694 3300025932 Bacteria 1924
512 Ga0207690_10150421 3300025932 Bacteria 1725
513 Ga0207706_10001677 3300025933 Bacteria 21872
514 Ga0207706_10011352 3300025933 Bacteria 8118
515 Ga0207706_10095958 3300025933 Bacteria 2608
516 Ga0207686_10010318 3300025934 Bacteria 5083
517 Ga0207686_10038467 3300025934 Bacteria 2895
518 Ga0207709_10000625 3300025935 Bacteria 29011
519 Ga0207709_10008688 3300025935 Bacteria 5605
520 Ga0207709_10085744 3300025935 Bacteria 2043
521 Ga0207670_10062873 3300025936 Bacteria 2538
522 Ga0207669_10022100 3300025937 Bacteria 3373
523 Ga0207669_10093576 3300025937 Bacteria 1964
524 Ga0207704_10001522 3300025938 Bacteria 10396
525 Ga0207704_10190598 3300025938 Bacteria 1491
526 Ga0207691_10002901 3300025940 Bacteria 16713
527 Ga0207691_10012766 3300025940 Bacteria 8042
528 Ga0207691_10016738 3300025940 Bacteria 6961
529 Ga0207691_10043548 3300025940 Bacteria 4136
530 Ga0207691_10080536 3300025940 Bacteria 2929
531 Ga0207691_10093842 3300025940 Bacteria 2686
532 Ga0207691_10239744 3300025940 Bacteria 1568
533 Ga0207711_10007584 3300025941 Bacteria 9078
534 Ga0207711_10041907 3300025941 Bacteria 3899
535 Ga0207711_10076292 3300025941 Bacteria 2919
536 Ga0207711_10146699 3300025941 Bacteria 2126
537 Ga0207711_10256121 3300025941 Bacteria 1608
538 Ga0207689_10009850 3300025942 Bacteria 8237
539 Ga0207689_10022702 3300025942 Bacteria 5271
540 Ga0207689_10034031 3300025942 Bacteria 4232
541 Ga0207689_10061308 3300025942 Bacteria 3093
542 Ga0207689_10063571 3300025942 Bacteria 3036
543 Ga0207689_10118101 3300025942 Bacteria 2181
544 Ga0207689_10277214 3300025942 Bacteria 1388
545 Ga0207661_10135339 3300025944 Bacteria 2115
546 Ga0207661_10142760 3300025944 Bacteria 2062
547 Ga0207679_10000730 3300025945 Bacteria 21864
548 Ga0207679_10010415 3300025945 Bacteria 5985
549 Ga0207679_10011896 3300025945 Bacteria 5656
550 Ga0207679_10131331 3300025945 Bacteria 2010
551 Ga0207679_10205195 3300025945 Bacteria 1649
552 Ga0207667_10024656 3300025949 Bacteria 6599
553 Ga0207667_10026800 3300025949 Bacteria 6289
554 Ga0207667_10030273 3300025949 Bacteria 5858
555 Ga0207667_10087544 3300025949 Bacteria 3222
556 Ga0207667_10154567 3300025949 Bacteria 2361
557 Ga0207651_10003471 3300025960 Bacteria 7745
558 Ga0207651_10028358 3300025960 Bacteria 3530
559 Ga0207651_10069685 3300025960 Bacteria 2484
560 Ga0207651_10252192 3300025960 Bacteria 1444
561 Ga0207712_10067108 3300025961 Bacteria 2566
562 Ga0207668_10004390 3300025972 Bacteria 8286
563 Ga0207668_10053015 3300025972 Bacteria 2809
564 Ga0207640_10023034 3300025981 Bacteria 3738
565 Ga0207640_10082383 3300025981 Bacteria 2203
566 Ga0207658_10005270 3300025986 Bacteria 8895
567 Ga0207658_10007685 3300025986 Bacteria 7342
568 Ga0207658_10015971 3300025986 Bacteria 5157
569 Ga0207658_10021533 3300025986 Bacteria 4478
570 Ga0207658_10021561 3300025986 Bacteria 4476
571 Ga0207658_10167556 3300025986 Bacteria 1806
572 Ga0207677_10002324 3300026023 Bacteria 9980
573 Ga0207677_10023530 3300026023 Bacteria 3808
574 Ga0207677_10043382 3300026023 Bacteria 2989
575 Ga0207703_10003131 3300026035 Bacteria 13968
576 Ga0207703_10005198 3300026035 Bacteria 10519
577 Ga0207703_10033516 3300026035 Bacteria 4072
578 Ga0207703_10163573 3300026035 Bacteria 1951
579 Ga0207639_10010457 3300026041 Bacteria 6429
580 Ga0207639_10035863 3300026041 Bacteria 3672
581 Ga0207639_10106409 3300026041 Bacteria 2277
582 Ga0207639_10122505 3300026041 Bacteria 2139
583 Ga0207639_10227734 3300026041 Bacteria 1614
584 Ga0207639_10279091 3300026041 Bacteria 1469
585 Ga0207678_10002200 3300026067 Bacteria 17609
586 Ga0207678_10053222 3300026067 Bacteria 3489
587 Ga0207678_10147260 3300026067 Bacteria 2010
588 Ga0207708_10044032 3300026075 Bacteria 3401
589 Ga0207702_10000305 3300026078 Bacteria 56491
590 Ga0207702_10032304 3300026078 Bacteria 4368
591 Ga0207702_10058880 3300026078 Bacteria 3270
592 Ga0207641_10006528 3300026088 Bacteria 9811
593 Ga0207641_10012012 3300026088 Bacteria 7106
594 Ga0207641_10124207 3300026088 Bacteria 2308
595 Ga0207641_10322836 3300026088 Bacteria 1464
596 Ga0207648_10000286 3300026089 Bacteria 54985
597 Ga0207648_10000878 3300026089 Bacteria 33868
598 Ga0207648_10008332 3300026089 Bacteria 10058
599 Ga0207648_10024038 3300026089 Bacteria 5446
600 Ga0207648_10042896 3300026089 Bacteria 3972
601 Ga0207648_10066867 3300026089 Bacteria 3134
602 Ga0207648_10105019 3300026089 Bacteria 2478
603 Ga0207676_10001457 3300026095 Bacteria 17601
604 Ga0207676_10021802 3300026095 Bacteria 4704
605 Ga0207676_10036150 3300026095 Bacteria 3755
606 Ga0207676_10114179 3300026095 Bacteria 2265
607 Ga0207676_10218332 3300026095 Bacteria 1696
608 Ga0207676_10258686 3300026095 Bacteria 1570
609 Ga0207674_10067815 3300026116 Bacteria 3591
610 Ga0207674_10091078 3300026116 Bacteria 3040
611 Ga0207674_10102936 3300026116 Bacteria 2835
612 Ga0207675_100001900 3300026118 Bacteria 20834
613 Ga0207675_100008217 3300026118 Bacteria 9835
614 Ga0207675_100037604 3300026118 Bacteria 4514
615 Ga0207683_10016577 3300026121 Bacteria 6273
616 Ga0207683_10028752 3300026121 Bacteria 4808
617 Ga0207683_10092116 3300026121 Bacteria 2701
618 Ga0207683_10116820 3300026121 Bacteria 2392
619 Ga0207683_10164423 3300026121 Bacteria 2007
620 Ga0207698_10004685 3300026142 Bacteria 8360
621 Ga0207698_10009520 3300026142 Bacteria 6200
622 Ga0207698_10045582 3300026142 Bacteria 3305
623 Ga0207698_10055995 3300026142 Bacteria 3042
624 Ga0207698_10059137 3300026142 Bacteria 2974
625 Ga0207698_10062309 3300026142 Bacteria 2912
626 Ga0207698_10086423 3300026142 Bacteria 2550
627 Ga0207698_10118010 3300026142 Bacteria 2240
628 Ga0209281_1000259 3300027111 Bacteria 101905
629 Ga0209968_1000129 3300027526 Bacteria 13402
630 Ga0209999_1002190 3300027543 Bacteria 3420
631 Ga0209282_1001433 3300027666 Bacteria 13109
632 Ga0209966_1000035 3300027695 Bacteria 56067
633 Ga0207428_10035993 3300027907 Bacteria 4041
634 Ga0268266_10117070 3300028379 Bacteria 2368
635 Ga0268266_10559763 3300028379 Bacteria 1096
636 Ga0268265_10114311 3300028380 Bacteria 2210
637 Ga0268264_10000991 3300028381 Bacteria 28937
638 Ga0268264_10062766 3300028381 Bacteria 3121
639 Ga0268264_10112149 3300028381 Bacteria 2390
640 Ga0268264_10115229 3300028381 Bacteria 2361
641 Ga0265336_10000013 3300028666 Bacteria 252156
642 Ga0307517_10000131 3300028786 Bacteria 113233
643 Ga0307517_10069239 3300028786 Bacteria 3201
644 Ga0307517_10155715 3300028786 Bacteria 1551
645 Ga0307515_10000011 3300028794 Bacteria 633903
646 Ga0307515_10000278 3300028794 Bacteria 125493
647 Ga0307515_10006352 3300028794 Bacteria 23656
648 Ga0307515_10009653 3300028794 Bacteria 18622
649 Ga0307515_10028588 3300028794 Bacteria 9473
650 Ga0307515_10035182 3300028794 Bacteria 8160
651 Ga0307515_10037795 3300028794 Bacteria 7745
652 Ga0307515_10040145 3300028794 Bacteria 7410
653 Ga0307515_10066582 3300028794 Bacteria 4987
654 Ga0307515_10089622 3300028794 Bacteria 3870
655 Ga0307515_10120653 3300028794 Bacteria 2972
656 Ga0307515_10165132 3300028794 Bacteria 2236
657 Ga0265324_10000193 3300029957 Bacteria 46981
658 Ga0265324_10007057 3300029957 Bacteria 4607
659 Ga0316177_1175648 3300030731 Bacteria 4726
660 Ga0316176_1195019 3300030732 Bacteria 2474
661 Ga0314311_1020317 3300030733 Bacteria 3252
662 Ga0316179_1040040 3300030734 Bacteria 2406
663 Ga0316178_1025743 3300030735 Bacteria 6114
664 Ga0316180_1050502 3300030736 Bacteria 4264
665 Ga0316183_1188254 3300030742 Bacteria 3217
666 Ga0316183_1202539 3300030742 Bacteria 1790
667 Ga0316181_1041597 3300030744 Bacteria 3900
668 Ga0316182_1104984 3300030745 Bacteria 4450
669 Ga0316182_1417019 3300030745 Bacteria 3598
670 Ga0265330_10000453 3300031235 Bacteria 27395
671 Ga0265332_10000012 3300031238 Bacteria 272641
672 Ga0265325_10017431 3300031241 Bacteria 3990
673 Ga0265327_10001807 3300031251 Bacteria 25067
674 Ga0307513_10043473 3300031456 Bacteria 4933
675 Ga0307513_10051134 3300031456 Bacteria 4461
676 Ga0307513_10069012 3300031456 Bacteria 3700
677 Ga0307513_10155369 3300031456 Bacteria 2189
678 Ga0307509_10000871 3300031507 Bacteria 52060
679 Ga0307509_10009460 3300031507 Bacteria 12180
680 Ga0307509_10062290 3300031507 Bacteria 3934
681 Ga0307509_10071281 3300031507 Bacteria 3625
682 Ga0307509_10072259 3300031507 Bacteria 3595
683 Ga0307509_10086638 3300031507 Bacteria 3220
684 Ga0307509_10158271 3300031507 Bacteria 2167
685 Ga0307509_10271113 3300031507 Bacteria 1465
686 Ga0307408_100000274 3300031548 Bacteria 51724
687 Ga0307408_100104590 3300031548 Bacteria 2163
688 Ga0307408_100106258 3300031548 Bacteria 2147
689 Ga0307508_10000123 3300031616 Bacteria 92439
690 Ga0307508_10000349 3300031616 Bacteria 56002
691 Ga0307508_10046060 3300031616 Bacteria 3894
692 Ga0307508_10061411 3300031616 Bacteria 3321
693 Ga0307508_10189187 3300031616 Bacteria 1660
694 Ga0307508_10245087 3300031616 Bacteria 1389
695 Ga0307514_10000355 3300031649 Bacteria 106758
696 Ga0307514_10001708 3300031649 Bacteria 25207
697 Ga0307514_10010918 3300031649 Bacteria 7584
698 Ga0307514_10024565 3300031649 Bacteria 4876
699 Ga0307514_10057518 3300031649 Bacteria 2978
700 Ga0265314_10000029 3300031711 Bacteria 272506
701 Ga0307516_10001568 3300031730 Bacteria 31474
702 Ga0307516_10001850 3300031730 Bacteria 29022
703 Ga0307516_10004605 3300031730 Bacteria 16911
704 Ga0307516_10044066 3300031730 Bacteria 4417
705 Ga0307516_10146531 3300031730 Bacteria 2126
706 Ga0307405_10014665 3300031731 Bacteria 4222
707 Ga0307405_10014975 3300031731 Bacteria 4186
708 Ga0307405_10369473 3300031731 Bacteria 1113
709 Ga0307413_10026524 3300031824 Bacteria 3194
710 Ga0307410_10185676 3300031852 Bacteria 1578
711 Ga0307406_10001131 3300031901 Bacteria 14904
712 Ga0307406_10001699 3300031901 Bacteria 12095
713 Ga0307406_10027882 3300031901 Bacteria 3407
714 Ga0307406_10042058 3300031901 Bacteria 2851
715 Ga0307412_10054471 3300031911 Bacteria 2656
716 Ga0307412_10097082 3300031911 Bacteria 2075
717 Ga0307412_10117802 3300031911 Bacteria 1907
718 Ga0307412_10125216 3300031911 Bacteria 1857
719 Ga0307412_10353632 3300031911 Bacteria 1180
720 Ga0307409_100000926 3300031995 Bacteria 13646
721 Ga0307416_100003028 3300032002 Bacteria 9820
722 Ga0307416_100168892 3300032002 Bacteria 2033
723 Ga0307416_100179728 3300032002 Bacteria 1981
724 Ga0307416_100502519 3300032002 Bacteria 1277
725 Ga0307414_10026215 3300032004 Bacteria 3748
726 Ga0307414_10064209 3300032004 Bacteria 2613
727 Ga0307414_10159590 3300032004 Bacteria 1789
728 Ga0307411_10041081 3300032005 Bacteria 2940
729 Ga0307415_100003743 3300032126 Bacteria 7793
730 Ga0307510_10008226 3300033180 Bacteria 12423
731 Ga0307510_10069826 3300033180 Bacteria 3514
732 Ga0307510_10201778 3300033180 Bacteria 1522
733 Ga0373959_0006082 3300034820 Bacteria 1994
734 Ga0373955_0184150 3300035172 Bacteria 1240
735 Ga0373962_0011061 3300035242 Bacteria 2257
736 Ga0373931_0058186 3300035691 Bacteria 2075
737 Ga0373931_0122546 3300035691 Bacteria 1487
738 Ga0373947_0070940 3300035725 Bacteria 2136
739 Ga0373925_0435975 3300037068 Bacteria 1072
740 Ga0395899_0000586 3300037312 Bacteria 38344
741 Ga0395899_0001071 3300037312 Bacteria 24692
742 Ga0395899_0074231 3300037312 Bacteria 2485
743 Ga0395900_0000058 3300037418 Bacteria 206785
744 Ga0395900_0005380 3300037418 Bacteria 13414
745 Ga0395900_0039728 3300037418 Bacteria 4847
746 Ga0395900_0054509 3300037418 Bacteria 4117
747 Ga0395898_0000283 3300037466 Bacteria 122630
748 Ga0395898_0004069 3300037466 Bacteria 16053
749 Ga0395898_0006225 3300037466 Bacteria 12784
750 Ga0395905_0000474 3300037471 Bacteria 55503
751 Ga0395905_0006877 3300037471 Bacteria 11371
752 Ga0395905_0013432 3300037471 Bacteria 7846
753 Ga0395905_0022875 3300037471 Bacteria 5908
754 Ga0395905_0023384 3300037471 Bacteria 5840
755 Ga0395905_0023805 3300037471 Bacteria 5782
756 Ga0395905_0060047 3300037471 Bacteria 3555
757 Ga0395905_0070264 3300037471 Bacteria 3280
758 Ga0395905_0113331 3300037471 Bacteria 2547
759 Ga0395905_0232081 3300037471 Bacteria 1725
760 Ga0395905_0373377 3300037471 Bacteria 1319
761 Ga0395901_0001676 3300038443 Bacteria 22857
762 Ga0395901_0002111 3300038443 Bacteria 20385
763 Ga0395901_0010431 3300038443 Bacteria 9413
764 Ga0395901_0130823 3300038443 Bacteria 2637
765 Ga0436365_0730477 3300039437 Bacteria 2085
766 Ga0436361_0566522 3300039447 Bacteria 37173
767 Ga0436361_0591904 3300039447 Bacteria 6639
768 Ga0436361_0627254 3300039447 Bacteria 2153
769 Ga0436361_1134487 3300039447 Bacteria 5287
770 Ga0439436_0002079 3300041404 Bacteria 5974
771 Ga0439439_0017596 3300041406 Bacteria 1759
772 Ga0439465_0001094 3300041413 Bacteria 8687
773 Ga0451795_0816552 3300041456 Bacteria 1931
774 Ga0451802_0878914 3300041460 Bacteria 1396
775 Ga0451839_1446416 3300041496 Bacteria 2231
776 Ga0451853_2222586 3300041512 Bacteria 1257
777 Ga0439431_0011396 3300041997 Bacteria 2031
778 Ga0439432_006841 3300042006 Bacteria 4061
779 Ga0439432_013501 3300042006 Bacteria 2777
780 Ga0439449_0000840 3300042007 Bacteria 11913
781 Ga0439449_0004494 3300042007 Bacteria 5388
782 Ga0439449_0016763 3300042007 Bacteria 2752
783 Ga0439449_0053043 3300042007 Bacteria 1499
784 Ga0439452_013992 3300042010 Bacteria 2239
785 Ga0439457_020415 3300042014 Bacteria 1470
786 Ga0439462_0013086 3300042015 Bacteria 2125
787 Ga0439462_0015525 3300042015 Bacteria 1963
788 Ga0450911_001146 3300042115 Bacteria 6532
789 Ga0450919_000198 3300042121 Bacteria 6591
790 Ga0450920_012224 3300042122 Bacteria 1608
791 Ga0450890_006419 3300042127 Bacteria 1504
792 Ga0450897_001948 3300042128 Bacteria 1484
793 Ga0439446_0012002 3300042156 Bacteria 2362
794 Ga0450908_011281 3300042184 Bacteria 1637
795 Ga0439434_0004081 3300042435 Bacteria 4264
796 Ga0439434_0043675 3300042435 Bacteria 1380
797 Ga0439459_0006802 3300042438 Bacteria 1916
798 Ga0450918_000047 3300042531 Bacteria 24725
799 Ga0450918_000609 3300042531 Bacteria 7669
800 Ga0451577_0010228 3300042876 Bacteria 8985
801 Ga0451577_0013180 3300042876 Bacteria 7747
802 Ga0451577_0019182 3300042876 Bacteria 6290
803 Ga0466969_0000013 3300044656 Bacteria 111537
804 Ga0466969_0001902 3300044656 Bacteria 11167
805 Ga0466969_0038002 3300044656 Bacteria 2425
806 Ga0466969_0098117 3300044656 Bacteria 1381
807 Ga0466972_0074601 3300044658 Bacteria 1616
808 Ga0466972_0078819 3300044658 Bacteria 1569
809 Ga0466965_0072665 3300044683 Bacteria 1731
810 Ga0466966_0007367 3300044684 Bacteria 7299
811 Ga0466966_0009518 3300044684 Bacteria 6435
812 Ga0466966_0019848 3300044684 Bacteria 4420
813 Ga0466966_0063907 3300044684 Bacteria 2318
814 Ga0466963_0006190 3300044694 Bacteria 7066
815 Ga0466964_0023321 3300044706 Bacteria 2406
816 Ga0466964_0049836 3300044706 Bacteria 1715
817 Ga0453684_0027299 3300044712 Bacteria 8193
818 Ga0466971_0003284 3300044719 Bacteria 6900
819 Ga0466970_0041588 3300044765 Bacteria 2442
820 Ga0466957_0028042 3300044842 Bacteria 3350
821 Ga0466957_0068411 3300044842 Bacteria 2192
822 Ga0466959_0012078 3300045049 Bacteria 6231
823 Ga0466959_0086352 3300045049 Bacteria 2257
824 Ga0466958_0007549 3300045836 Bacteria 5986
825 Ga0466967_0159737 3300045976 Bacteria 2114
826 Ga0495627_008213 3300046453 Bacteria 3928
827 Ga0495627_019457 3300046453 Bacteria 2276
828 Ga0495592_0000394 3300046454 Bacteria 33973
829 Ga0495592_0125944 3300046454 Bacteria 1797
830 Ga0495590_0005173 3300046457 Bacteria 5190
831 Ga0495638_0139249 3300046460 Bacteria 1418
832 Ga0495651_0019143 3300046462 Bacteria 5304
833 Ga0495651_0025317 3300046462 Bacteria 4618
834 Ga0495651_0040232 3300046462 Bacteria 3636
835 Ga0495653_0047008 3300046463 Bacteria 3339
836 Ga0495650_0019463 3300046471 Bacteria 3340
837 Ga0495583_0000081 3300046506 Bacteria 168304
838 Ga0495606_0001086 3300046507 Bacteria 38950
839 Ga0495608_0013966 3300046511 Bacteria 5571
840 Ga0495608_0056440 3300046511 Bacteria 2593
841 Ga0495610_0025702 3300046512 Bacteria 3155
842 Ga0495610_0056162 3300046512 Bacteria 1894
843 Ga0495610_0061924 3300046512 Bacteria 1776
844 Ga0495616_0011779 3300046513 Bacteria 4993
845 Ga0495618_0154218 3300046514 Bacteria 1466
846 Ga0495628_0001687 3300046516 Bacteria 20156
847 Ga0495628_0013853 3300046516 Bacteria 6773
848 Ga0495628_0322765 3300046516 Bacteria 1139
849 Ga0495630_0154828 3300046517 Bacteria 1745
850 Ga0495631_0001417 3300046518 Bacteria 14572
851 Ga0495632_0010162 3300046519 Bacteria 5598
852 Ga0495637_0008174 3300046520 Bacteria 5150
853 Ga0495643_0067736 3300046522 Bacteria 1880
854 Ga0495643_0149048 3300046522 Bacteria 1160
855 Ga0495652_0008424 3300046529 Bacteria 9412
856 Ga0495586_0054921 3300046535 Bacteria 2159
857 Ga0495621_0018955 3300046539 Bacteria 2241
858 Ga0495621_0024847 3300046539 Bacteria 2006
859 Ga0495645_0062491 3300046543 Bacteria 2697
860 Ga0495656_0000093 3300046615 Bacteria 38558
861 Ga0495656_0019941 3300046615 Bacteria 2594
862 Ga0495656_0093610 3300046615 Bacteria 1378
863 Ga0495668_0046750 3300046616 Bacteria 2404
864 Ga0495611_0087562 3300046648 Bacteria 1437
865 Ga0495625_0001179 3300046660 Bacteria 33575
866 Ga0495625_0006045 3300046660 Bacteria 10869
867 Ga0495625_0034941 3300046660 Bacteria 3707
868 Ga0495635_0064709 3300046663 Bacteria 2510
869 Ga0495588_0049426 3300046674 Bacteria 2162
870 Ga0495657_0064886 3300046675 Bacteria 2403
871 Ga0495623_0006819 3300046679 Bacteria 7430
872 Ga0495646_0002576 3300046680 Bacteria 11150
873 Ga0495646_0031501 3300046680 Bacteria 3304
874 Ga0495646_0141327 3300046680 Bacteria 1346
875 Ga0495658_0035262 3300046683 Bacteria 2751
876 Ga0495658_0037493 3300046683 Bacteria 2680
877 Ga0495658_0046686 3300046683 Bacteria 2436
878 Ga0495658_0214289 3300046683 Bacteria 1204
879 Ga0495669_0012571 3300046684 Bacteria 3605
880 Ga0495613_0165418 3300046689 Bacteria 1572
881 Ga0495624_0062388 3300046690 Bacteria 2332
882 Ga0495670_0034634 3300046691 Bacteria 2516
883 Ga0495671_0021694 3300046692 Bacteria 3370
884 Ga0495649_0000287 3300046694 Bacteria 44649
885 Ga0495649_0015647 3300046694 Bacteria 4313
886 Ga0495589_0008991 3300046794 Bacteria 5197
887 Ga0495604_0044585 3300047317 Bacteria 3463
888 Ga0495604_0096919 3300047317 Bacteria 2176
889 Ga0495676_0107019 3300047321 Bacteria 2059
890 Ga0495687_000582 3300047443 Bacteria 42863
891 Ga0495687_003988 3300047443 Bacteria 10280
892 Ga0495684_0157686 3300047471 Bacteria 1695
893 Ga0495686_0012435 3300047472 Bacteria 5953
894 Ga0495686_0075315 3300047472 Bacteria 2069
895 Ga0495593_0101135 3300047673 Bacteria 1478
896 Ga0495602_0019713 3300048088 Bacteria 6684
897 Ga0495602_0089757 3300048088 Bacteria 2555
898 Ga0495602_0135349 3300048088 Bacteria 1958
899 Ga0495615_0007340 3300048090 Bacteria 2088
900 Ga0496100_0043054 3300048903 Bacteria 2886
901 Ga0496100_0092730 3300048903 Bacteria 2065
902 Ga0496101_0034545 3300048904 Bacteria 3571
903 Ga0496101_0342128 3300048904 Bacteria 1175
904 Ga0496102_0025715 3300048905 Bacteria 5243
905 Ga0496103_0050295 3300048906 Bacteria 2578
906 Ga0496104_0008511 3300048907 Bacteria 9120
907 Ga0496105_0024726 3300048908 Bacteria 4882
908 Ga0496105_0078475 3300048908 Bacteria 2726
909 Ga0496106_0022941 3300048909 Bacteria 4635
910 Ga0496106_0048622 3300048909 Bacteria 3194
911 Ga0496106_0053548 3300048909 Bacteria 3048
912 Ga0496107_0006316 3300048910 Bacteria 8145
913 Ga0496108_0236330 3300048911 Bacteria 1589
914 Ga0496109_0073499 3300048912 Bacteria 3142
915 Ga0496110_0079805 3300048913 Bacteria 2914
916 Ga0496110_0358531 3300048913 Bacteria 1329
917 Ga0496111_0067545 3300048914 Bacteria 2597
918 Ga0496111_0078010 3300048914 Bacteria 2415
919 Ga0496112_0011308 3300048915 Bacteria 8144
920 Ga0496112_0460602 3300048915 Bacteria 1209
921 Ga0496114_0003046 3300048917 Bacteria 12833
922 Ga0496114_0056306 3300048917 Bacteria 3281
923 Ga0496114_0124210 3300048917 Bacteria 2223
924 Ga0496114_0159508 3300048917 Bacteria 1960
925 Ga0496115_0067578 3300048918 Bacteria 2891
926 Ga0496117_0044192 3300048920 Bacteria 3229
927 Ga0496117_0081894 3300048920 Bacteria 2116
928 Ga0496118_0007613 3300048921 Bacteria 11409
929 Ga0496121_0035310 3300048924 Bacteria 4482
930 Ga0496121_0061186 3300048924 Bacteria 3091
931 Ga0496121_0065545 3300048924 Bacteria 2954
932 Ga0496121_0083876 3300048924 Bacteria 2514
933 Ga0496122_0000383 3300048925 Bacteria 94797
934 Ga0496123_0000249 3300048926 Bacteria 108969
935 Ga0496124_0002378 3300048927 Bacteria 24780
936 Ga0496124_0016354 3300048927 Bacteria 7058
937 Ga0496124_0097272 3300048927 Bacteria 2390
938 Ga0496125_0000785 3300048928 Bacteria 51744
939 Ga0496125_0013437 3300048928 Bacteria 8046
940 Ga0496125_0049441 3300048928 Bacteria 3494
941 Ga0496125_0070483 3300048928 Bacteria 2736
942 Ga0501034_0239499 3300049571 Bacteria 1761
943 Ga0501038_0058954 3300049574 Bacteria 3290
944 Ga0501043_0000009 3300049579 Bacteria 214823
945 Ga0501046_0000022 3300049580 Bacteria 215451
946 Ga0501046_0063108 3300049580 Bacteria 2893
947 Ga0501047_0000021 3300049581 Bacteria 254841
948 Ga0501048_0006915 3300049582 Bacteria 8623
949 Ga0501252_001618 3300049682 Bacteria 2115
950 Ga0501225_0007622 3300049705 Bacteria 3135
951 Ga0501262_001452 3300049759 Bacteria 2660
952 Ga0501035_0238000 3300049822 Bacteria 1549
953 Ga0501045_0020284 3300049824 Bacteria 4747
954 nmdc:mga03683_26256_c1 3300050489 Bacteria 2296
955 nmdc:mga03683_32284_c1 3300050489 Bacteria 2106
956 nmdc:mga03683_52391_c1 3300050489 Bacteria 1706
957 nmdc:mga03n38_21542_c1 3300050490 Bacteria 2596
958 nmdc:mga0yw44_14380_c1 3300050492 Bacteria 4202
959 nmdc:mga0yw44_38057_c1 3300050492 Bacteria 2844
960 nmdc:mga0k408_14868_c1 3300050493 Bacteria 4297
961 nmdc:mga0k408_28083_c1 3300050493 Bacteria 3198
962 nmdc:mga0k408_47081_c1 3300050493 Bacteria 2492
963 nmdc:mga0k408_51063_c1 3300050493 Bacteria 2395
964 nmdc:mga0k408_55984_c1 3300050493 Bacteria 2287
965 nmdc:mga0k408_8358_c1 3300050493 Bacteria 5553
966 nmdc:mga0k408_86717_c1 3300050493 Bacteria 1838
967 nmdc:mga06z11_115211_c1 3300050494 Bacteria 1493
968 nmdc:mga06z11_190863_c1 3300050494 Bacteria 1186
969 nmdc:mga06z11_42479_c1 3300050494 Bacteria 2281
970 nmdc:mga06z11_52833_c1 3300050494 Bacteria 2087
971 nmdc:mga07m45_12201_c1 3300050496 Bacteria 4535
972 nmdc:mga07m45_221111_c1 3300050496 Bacteria 1102
973 nmdc:mga07m45_29688_c1 3300050496 Bacteria 3026
974 nmdc:mga07m45_36397_c1 3300050496 Bacteria 2741
975 nmdc:mga07m45_43867_c1 3300050496 Bacteria 2508
976 nmdc:mga07m45_81_c1 3300050496 Bacteria 35778
977 nmdc:mga09592_14596_c1 3300050508 Bacteria 6411
978 nmdc:mga0qj67_69170_c1 3300050509 Bacteria 2815
979 nmdc:mga0sz30_21551_c1 3300050516 Bacteria 2609
980 Ga0495601_0044290 3300053077 Bacteria 2797
981 Ga0500578_0000652 3300053086 Bacteria 41736
982 Ga0500643_018305 3300053087 Bacteria 2328
983 Ga0500646_0020168 3300053090 Bacteria 1769
984 Ga0500651_0000067 3300053093 Bacteria 67673
985 Ga0500651_0008514 3300053093 Bacteria 6043
986 Ga0500562_016498 3300053108 Bacteria 1900
987 Ga0500571_000952 3300053110 Bacteria 12727
988 Ga0500572_065181 3300053111 Bacteria 1115
989 Ga0500593_001535 3300053117 Bacteria 8290
990 Ga0500593_005315 3300053117 Bacteria 5060
991 Ga0500594_0005643 3300053118 Bacteria 2778
992 Ga0500595_013753 3300053119 Bacteria 3094
993 Ga0500628_002238 3300053129 Bacteria 3228
994 Ga0500652_005856 3300053131 Bacteria 3910
995 Ga0500652_089169 3300053131 Bacteria 1287
996 Ga0500658_0019270 3300053134 Bacteria 2566
997 Ga0500658_0022824 3300053134 Bacteria 2383
998 Ga0500658_0106674 3300053134 Bacteria 1228
999 Ga0500559_0000446 3300053136 Bacteria 29360
1000 Ga0500559_0009437 3300053136 Bacteria 4222
1001 Ga0500559_0022035 3300053136 Bacteria 2702
1002 Ga0500568_0009510 3300053139 Bacteria 4608
1003 Ga0500568_0033306 3300053139 Bacteria 2115
1004 Ga0500574_000749 3300053141 Bacteria 4334
1005 Ga0500590_002813 3300053148 Bacteria 7859
1006 Ga0500616_0012717 3300053153 Bacteria 4918
1007 Ga0500619_000568 3300053154 Bacteria 6293
1008 Ga0500619_004153 3300053154 Bacteria 3075
1009 Ga0500622_0000124 3300053156 Bacteria 81245
1010 Ga0500622_0004516 3300053156 Bacteria 8701
1011 Ga0500622_0009123 3300053156 Bacteria 5505
1012 Ga0500627_0012737 3300053158 Bacteria 3163
1013 Ga0500587_000477 3300053739 Bacteria 4798
1014 Ga0590075_010416 3300059424 Bacteria 2237
1015 Ga0466962_0003944 3300061719 Bacteria 7100
1016 Ga0466962_0049703 3300061719 Bacteria 2004
1017 Ga0466962_0098610 3300061719 Bacteria 1402
1018 2513228784 2513020051 Bacteria 6053213
1019 2548499213 2547132374 Bacteria 5530232
1020 2587728306 2585428057 Bacteria 6737412
1021 2587734486 2585428058 Bacteria 6853932
1022 2587759369 2585428062 Bacteria 6842168
1023 2588295024 2588253510 Bacteria 6901809
1024 2599620875 2599185214 Bacteria 8209958
1025 2599674319 2599185226 Bacteria 8233575
1026 2599678509 2599185227 Bacteria 8246414
1027 2599690386 2599185229 Bacteria 8216126
1028 2643866047 2643221570 Bacteria 5103772
1029 2643971301 2643221592 Bacteria 6608788
1030 2643994044 2643221596 Bacteria 5006805
1031 2644142057 2643221625 Bacteria 6512927
1032 2644161338 2643221628 Bacteria 5745828
1033 2644243366 2643221644 Bacteria 6865017
1034 2644275464 2643221648 Bacteria 6521465
1035 2644292858 2643221652 Bacteria 5140275
1036 2644303038 2643221654 Bacteria 5273570
1037 2644324055 2643221658 Bacteria 6064537
1038 2644340825 2643221660 Bacteria 4208257
1039 2644400761 2643221672 Bacteria 6322190
1040 2644466000 2643221683 Bacteria 5749203
1041 2644647876 2643221717 Bacteria 5676132
1042 2738720723 2738541277 Bacteria 7458140
1043 2738882323 2738541307 Bacteria 8606193
1044 2739251909 2738543013 Bacteria 5618633
1045 2739279922 2738543019 Bacteria 7459457
1046 2819543489 2818991436 Bacteria 5376622
1047 2819601998 2818991446 Bacteria 7757362
1048 2831269827 2831265667 Bacteria 7184833
1049 2831869140 2831864461 Bacteria 6502356
1050 2838055155 2838054893 Bacteria 7451788
1051 2842680911 2842677519 Bacteria 5615038
1052 2842737619 2842733646 Bacteria 5716726
1053 2842749718 2842747753 Bacteria 5578255
1054 2881103523 2881101125 Bacteria 4590519
1055 2885196698 2885192300 Bacteria 5882526
1056 2885201848 2885198086 Bacteria 7212419
1057 2885215442 2885211737 Bacteria 7212420
1058 2899927245 2899924645 Bacteria 7487985
1059 2904453999 2904449895 Bacteria 6927402
1060 2904459463 2904456579 Bacteria 6819253
1061 2904479540 2904479285 Bacteria 5073931
1062 2904546117 2904541872 Bacteria 8915136
1063 2919465421 2919462493 Bacteria 5817112
1064 2928042840 2928037797 Bacteria 7273642
1065 2928048733 2928044640 Bacteria 7271509
1066 2928055065 2928051484 Bacteria 7773759
1067 2928068491 2928064002 Bacteria 7419480
1068 2928073603 2928070936 Bacteria 8062541
1069 2928089694 2928084124 Bacteria 7159212
1070 2928117250 2928115317 Bacteria 6477646
1071 2929161314 2929160207 Bacteria 9075316
1072 2929521577 2929520902 Bacteria 6765052
1073 2945949787 2945945610 Bacteria 5951079
1074 2945973810 2945972063 Bacteria 6086495
1075 2954770597 2954767861 Bacteria 5535784
1076 2990714101 2990710928 Bacteria 5002431
1077 Ga0070676_10034778
1078 JGI24740J21852_10002227
1079 JGI25156J39149_1001782
1080 JGI25156J39149_1007524
1081 JGI25162J39368_1000063
1082 JGI25154J39366_1001302
1083 JGI25154J39366_1004037
1084 JGI25157J39369_1000148
1085 JGI25163J39215_1001308
1086 JGI25164J39214_1004328
1087 JGI25152J39213_1010277
1088 JGI25150J39212_1006072
1089 JGI25165J46597_1000069
1090 JGI25153J46596_10003671
1091 JGI25153J46596_10004835
1092 rootH1_10010206
1093 rootH1_10015203
1094 rootL2_10000966
1095 rootH1_10000830
1096 rootH1_10114267
1097 Ga0007409J51694_1045597
1098 Ga0006562J51391_1013325
1099 Ga0006562J51391_1013332
1100 Ga0006562J51391_1029542
1101 Ga0006562J51391_1029546
1102 Ga0055538_1000034
1103 Ga0055539_1000044
1104 Ga0055539_1000763
1105 Ga0055539_1002964
1106 Ga0055533_1000016
1107 Ga0055533_1000055
1108 Ga0055525_1000066
1109 Ga0055525_1001386
1110 Ga0055535_1000934
1111 Ga0055535_1002036
1112 Ga0055542_1000051
1113 Ga0055529_1000333
1114 Ga0055526_1000826
1115 Ga0055526_1001991
1116 Ga0055524_1000052
1117 Ga0055536_1012919
1118 Ga0055536_1018427
1119 Ga0055534_1001847
1120 Ga0055534_1002526
1121 Ga0055534_1005182
1122 Ga0055528_1013683
1123 Ga0055528_1022218
1124 Ga0055530_10006857
1125 Ga0055530_10008783
1126 Ga0055530_10015568
1127 Ga0055540_1000019
1128 Ga0055540_1001799
1129 Ga0055540_1006211
1130 Ga0055540_1007850
1131 Ga0055540_1008402
1132 Ga0055540_1011021
1133 Ga0055540_1031797
1134 Ga0055531_10000360
1135 Ga0055531_10001074
1136 Ga0055531_10003311
1137 Ga0055531_10009158
1138 Ga0055531_10012618
1139 Ga0055531_10020656
1140 Ga0055541_1000032
1141 Ga0055543_1005706
1142 Ga0065165_1000080
1143 Ga0065165_1000101
1144 Ga0065165_1003865
1145 Ga0065165_1043062
1146 Ga0065707_10100423
1147 Ga0070658_10100789
1148 Ga0070658_10227236
1149 Ga0070676_10011159
1150 Ga0070676_10012151
1151 Ga0070676_10127828
1152 Ga0070683_100029368
1153 Ga0070683_100087729
1154 Ga0070690_100022459
1155 Ga0070690_100055811
1156 Ga0070670_100086045
1157 Ga0070670_100115775
1158 Ga0070670_100138057
1159 Ga0070670_100199404
1160 Ga0070670_100209046
1161 Ga0070670_100252130
1162 Ga0070677_10032005
1163 Ga0070677_10140655
1164 Ga0068869_100010879
1165 Ga0068869_100027914
1166 Ga0068869_100061795
1167 Ga0068869_100065097
1168 Ga0070666_10050920
1169 Ga0070666_10128748
1170 Ga0070682_100085166
1171 Ga0068868_100014027
1172 Ga0068868_100025884
1173 Ga0068868_100057346
1174 Ga0068868_100073336
1175 Ga0070660_100013524
1176 Ga0070660_100034480
1177 Ga0070660_100128252
1178 Ga0070689_100328387
1179 Ga0070687_100030101
1180 Ga0070661_100001817
1181 Ga0070661_100100058
1182 Ga0070668_100024251
1183 Ga0070668_100117189
1184 Ga0070668_100119935
1185 Ga0070669_100034251
1186 Ga0070669_100071168
1187 Ga0070669_100072824
1188 Ga0070675_100027434
1189 Ga0070675_100064813
1190 Ga0070675_100076311
1191 Ga0070675_100318094
1192 Ga0070671_100011406
1193 Ga0070671_100021838
1194 Ga0070671_100076886
1195 Ga0070671_100095343
1196 Ga0070671_100216587
1197 Ga0070674_100020660
1198 Ga0070674_100136341
1199 Ga0070674_100146065
1200 Ga0070673_100010575
1201 Ga0070673_100029046
1202 Ga0070673_100060598
1203 Ga0070659_100000579
1204 Ga0070659_100138085
1205 Ga0070659_100141084
1206 Ga0070667_100017022
1207 Ga0070667_100048321
1208 Ga0070667_100063689
1209 Ga0070708_100143642
1210 Ga0070663_100001569
1211 Ga0070663_100005909
1212 Ga0070663_100416172
1213 Ga0070678_100013580
1214 Ga0070678_100086673
1215 Ga0070678_100164593
1216 Ga0070678_100172516
1217 Ga0070678_100185324
1218 Ga0070678_100408253
1219 Ga0070662_100034033
1220 Ga0070662_100054096
1221 Ga0070662_100055624
1222 Ga0070662_100158535
1223 Ga0070681_10232499
1224 Ga0068867_100000072
1225 Ga0068867_100014337
1226 Ga0068867_100014505
1227 Ga0068867_100025831
1228 Ga0068867_100039511
1229 Ga0068867_100084146
1230 Ga0068867_100160344
1231 Ga0070706_100003148
1232 Ga0070679_100016827
1233 Ga0070679_100458852
1234 Ga0070684_100233184
1235 Ga0068853_100022735
1236 Ga0068853_100080199
1237 Ga0070672_100027758
1238 Ga0070672_100053209
1239 Ga0070672_100100519
1240 Ga0070672_100161318
1241 Ga0070672_100228763
1242 Ga0070693_100011646
1243 Ga0070665_100050202
1244 Ga0070665_100093595
1245 Ga0070665_100304456
1246 Ga0068855_100013525
1247 Ga0068855_100020802
1248 Ga0068855_100050047
1249 Ga0068855_100176827
1250 Ga0068855_100450372
1251 Ga0070664_100003888
1252 Ga0070664_100017203
1253 Ga0070664_100026915
1254 Ga0070664_100095364
1255 Ga0070664_100308447
1256 Ga0070664_100480371
1257 Ga0068857_100068892
1258 Ga0068857_100088867
1259 Ga0068857_100112626
1260 Ga0068854_100023360
1261 Ga0068856_100012944
1262 Ga0068856_100059328
1263 Ga0068856_100059918
1264 Ga0068856_100443477
1265 Ga0068852_100028494
1266 Ga0068852_100031065
1267 Ga0068852_100085784
1268 Ga0068852_100095692
1269 Ga0068852_100114168
1270 Ga0068852_100198506
1271 Ga0068852_100208459
1272 Ga0068859_100010805
1273 Ga0068859_100033863
1274 Ga0068859_100208397
1275 Ga0068859_100231075
1276 Ga0068859_100327980
1277 Ga0068864_100002362
1278 Ga0068864_100049681
1279 Ga0068864_100056292
1280 Ga0068864_100082398
1281 Ga0068864_100157482
1282 Ga0068866_10033347
1283 Ga0068866_10180079
1284 Ga0068861_100001649
1285 Ga0068861_100022805
1286 Ga0068861_100024567
1287 Ga0068861_100146023
1288 Ga0068851_10035063
1289 Ga0068851_10115492
1290 Ga0068870_10025942
1291 Ga0068870_10054833
1292 Ga0068870_10115178
1293 Ga0068863_100031768
1294 Ga0068863_100038412
1295 Ga0068863_100040765
1296 Ga0068863_100051637
1297 Ga0068863_100083801
1298 Ga0068863_100189569
1299 Ga0068858_100000947
1300 Ga0068858_100028870
1301 Ga0068858_100188292
1302 Ga0068860_100000590
1303 Ga0068860_100013253
1304 Ga0068860_100156493
1305 Ga0068860_100197279
1306 Ga0068860_100204213
1307 Ga0068862_100028602
1308 Ga0068862_100056931
1309 Ga0068862_100058125
1310 Ga0075365_10001679
1311 Ga0075365_10034744
1312 Ga0075363_100012906
1313 Ga0075363_100053453
1314 Ga0075364_10023395
1315 Ga0075364_10194821
1316 Ga0075362_10006614
1317 Ga0075367_10013667
1318 Ga0075367_10030265
1319 Ga0075367_10065816
1320 Ga0075367_10085205
1321 Ga0075367_10125705
1322 Ga0075369_10038509
1323 Ga0075366_10032419
1324 Ga0075366_10040155
1325 Ga0075366_10051496
1326 Ga0075366_10075317
1327 Ga0075366_10103866
1328 Ga0097621_100064293
1329 Ga0097621_100081669
1330 Ga0097621_100159403
1331 Ga0075370_10000547
1332 Ga0075370_10002604
1333 Ga0075370_10007775
1334 Ga0075370_10011725
1335 Ga0075370_10021986
1336 Ga0075370_10037246
1337 Ga0075370_10040108
1338 Ga0075370_10075281
1339 Ga0068871_100074554
1340 Ga0068871_100093767
1341 Ga0068871_100130241
1342 Ga0075430_100078142
1343 Ga0075429_100000199
1344 Ga0068865_100079132
1345 Ga0068865_100145558
1346 Ga0097620_100010805
1347 Ga0097620_100033861
1348 Ga0097620_100208406
1349 Ga0097620_100231087
1350 Ga0097620_100327959
1351 Ga0079104_1000206
1352 Ga0079104_1017870
1353 Ga0099826_10041983
1354 Ga0099826_10085707
1355 Ga0105244_10007138
1356 Ga0105240_10024611
1357 Ga0105240_10062071
1358 Ga0105245_10102204
1359 Ga0105245_10442779
1360 Ga0114129_10149580
1361 Ga0105243_10001108
1362 Ga0105243_10010327
1363 Ga0105243_10019712
1364 Ga0105242_10018229
1365 Ga0105242_10079059
1366 Ga0105242_10615719
1367 Ga0105248_10000507
1368 Ga0105248_10123485
1369 Ga0105248_10154142
1370 Ga0105248_10333990
1371 Ga0105237_10367620
1372 Ga0105238_10020663
1373 Ga0105238_10081997
1374 Ga0105238_10227899
1375 Ga0105249_10010561
1376 Ga0105249_10022308
1377 Ga0105239_10072072
1378 Ga0105239_10166314
1379 Ga0157319_1000008
1380 Ga0157373_10022910
1381 Ga0157373_10037740
1382 Ga0157373_10178132
1383 Ga0157371_10102629
1384 Ga0157370_10117019
1385 Ga0157369_10013318
1386 Ga0157369_10059000
1387 Ga0157374_10097347
1388 Ga0157374_10170314
1389 Ga0157378_10008627
1390 Ga0163162_10002118
1391 Ga0163162_10007695
1392 Ga0163162_10026342
1393 Ga0157372_10051925
1394 Ga0157375_10046187
1395 Ga0157375_10064111
1396 Ga0157375_10095187
1397 Ga0157375_10099385
1398 Ga0157375_10112718
1399 Ga0157375_10130614
1400 Ga0157375_10318209
1401 Ga0163163_10007361
1402 Ga0163163_10165401
1403 Ga0163163_10251023
1404 Ga0163163_10580674
1405 Ga0157380_10015463
1406 Ga0157380_10056674
1407 Ga0157380_10102260
1408 Ga0157380_10112388
1409 Ga0157380_10281039
1410 Ga0157380_10548396
1411 Ga0182008_10001156
1412 Ga0182008_10004095
1413 Ga0182008_10008484
1414 Ga0182008_10116007
1415 Ga0157377_10000075
1416 Ga0157377_10023652
1417 Ga0157379_10025992
1418 Ga0157379_10030374
1419 Ga0157379_10034913
1420 Ga0157379_10061361
1421 Ga0157379_10069401
1422 Ga0157379_10093358
1423 Ga0157379_10097801
1424 Ga0157379_10122709
1425 Ga0157379_10266193
1426 Ga0157376_10017920
1427 Ga0157376_10142978
1428 Ga0157376_10206022
1429 Ga0157376_10227786
1430 Ga0182006_1003275
1431 Ga0182007_10002915
1432 Ga0182007_10031538
1433 Ga0182005_1000283
1434 Ga0182005_1017831
1435 Ga0183362_10003
1436 Ga0163161_10039684
1437 Ga0163161_10053752
1438 Ga0163161_10090355
1439 Ga0213872_10000382
1440 Ga0209435_101147
1441 Ga0209784_100049
1442 Ga0209566_100061
1443 Ga0209674_100041
1444 Ga0209674_100069
1445 Ga0209672_100538
1446 Ga0209672_102207
1447 Ga0209147_102676
1448 Ga0209563_100043
1449 Ga0209563_100083
1450 Ga0207427_100345
1451 Ga0207427_100646
1452 Ga0209437_100091
1453 Ga0209258_100132
1454 Ga0209258_100344
1455 Ga0209258_100785
1456 Ga0207425_1000226
1457 Ga0207425_1007249
1458 Ga0209646_1000069
1459 Ga0209646_1002496
1460 Ga0209026_1000006
1461 Ga0209677_100039
1462 Ga0209677_100096
1463 Ga0209677_101194
1464 Ga0209148_1000007
1465 Ga0209148_1008882
1466 Ga0209759_1000075
1467 Ga0209759_1001215
1468 Ga0209759_1001295
1469 Ga0209759_1003631
1470 Ga0209759_1012969
1471 Ga0209759_1014554
1472 Ga0209129_1000012
1473 Ga0209129_1000084
1474 Ga0209233_1000115
1475 Ga0209565_1000169
1476 Ga0209565_1000364
1477 Ga0209565_1015528
1478 Ga0209455_1000242
1479 Ga0209673_1000114
1480 Ga0209673_1000916
1481 Ga0209673_1001117
1482 Ga0209673_1009349
1483 Ga0209673_1018628
1484 Ga0209673_1019820
1485 Ga0209673_1023627
1486 Ga0209673_1032796
1487 Ga0209130_1000571
1488 Ga0209130_1004615
1489 Ga0209675_1000062
1490 Ga0209675_1006399
1491 Ga0209676_1000817
1492 Ga0209676_1003376
1493 Ga0209676_1006433
1494 Ga0209676_1006821
1495 Ga0209025_1000719
1496 Ga0209025_1000861
1497 Ga0209025_1018573
1498 Ga0209025_1045276
1499 Ga0209564_1000008
1500 Ga0209564_1000022
1501 Ga0209564_1000414
1502 Ga0209564_1000613
1503 Ga0209758_1000099
1504 Ga0209758_1002249
1505 Ga0209050_1000052
1506 Ga0209050_1001635
1507 Ga0209050_1001761
1508 Ga0209050_1001765
1509 Ga0209256_1000036
1510 Ga0209256_1000206
1511 Ga0209256_1000239
1512 Ga0207426_1000049
1513 Ga0207426_1000086
1514 Ga0207426_1000346
1515 Ga0209051_1000015
1516 Ga0209051_1000025
1517 Ga0209051_1000071
1518 Ga0209051_1000420
1519 Ga0209051_1000492
1520 Ga0209051_1001081
1521 Ga0209051_1001503
1522 Ga0209051_1002112
1523 Ga0209257_1000037
1524 Ga0209257_1000039
1525 Ga0209257_1000367
1526 Ga0209257_1003430
1527 Ga0209257_1005624
1528 Ga0207656_10042172
1529 Ga0207656_10062157
1530 Ga0207656_10080253
1531 Ga0207655_1000477
1532 Ga0207682_10040791
1533 Ga0207682_10042315
1534 Ga0207642_10010253
1535 Ga0207642_10182304
1536 Ga0207680_10143169
1537 Ga0207680_10145423
1538 Ga0207680_10168886
1539 Ga0207680_10224614
1540 Ga0207647_10089114
1541 Ga0207645_10008088
1542 Ga0207645_10037909
1543 Ga0207645_10064845
1544 Ga0207645_10102595
1545 Ga0207643_10029897
1546 Ga0207643_10067632
1547 Ga0207705_10017381
1548 Ga0207705_10061682
1549 Ga0207705_10121110
1550 Ga0207695_10019040
1551 Ga0207695_10092973
1552 Ga0207695_10108240
1553 Ga0207695_10116955
1554 Ga0207662_10029185
1555 Ga0207657_10021426
1556 Ga0207657_10065236
1557 Ga0207657_10081075
1558 Ga0207657_10113479
1559 Ga0207657_10156024
1560 Ga0207649_10001310
1561 Ga0207649_10022011
1562 Ga0207649_10176533
1563 Ga0207652_10018335
1564 Ga0207652_10130236
1565 Ga0207652_10194118
1566 Ga0207681_10000593
1567 Ga0207681_10016551
1568 Ga0207681_10052469
1569 Ga0207681_10112309
1570 Ga0207694_10036617
1571 Ga0207694_10056930
1572 Ga0207650_10001668
1573 Ga0207650_10007368
1574 Ga0207650_10008263
1575 Ga0207650_10077646
1576 Ga0207650_10343548
1577 Ga0207659_10002674
1578 Ga0207659_10016256
1579 Ga0207659_10021228
1580 Ga0207659_10025527
1581 Ga0207659_10105397
1582 Ga0207687_10014488
1583 Ga0207644_10001504
1584 Ga0207644_10001724
1585 Ga0207644_10022871
1586 Ga0207690_10012412
1587 Ga0207690_10117694
1588 Ga0207690_10150421
1589 Ga0207706_10001677
1590 Ga0207706_10011352
1591 Ga0207706_10095958
1592 Ga0207686_10010318
1593 Ga0207686_10038467
1594 Ga0207709_10000625
1595 Ga0207709_10008688
1596 Ga0207709_10085744
1597 Ga0207670_10062873
1598 Ga0207669_10022100
1599 Ga0207669_10093576
1600 Ga0207704_10001522
1601 Ga0207704_10190598
1602 Ga0207691_10002901
1603 Ga0207691_10012766
1604 Ga0207691_10016738
1605 Ga0207691_10043548
1606 Ga0207691_10080536
1607 Ga0207691_10093842
1608 Ga0207691_10239744
1609 Ga0207711_10007584
1610 Ga0207711_10041907
1611 Ga0207711_10076292
1612 Ga0207711_10146699
1613 Ga0207711_10256121
1614 Ga0207689_10009850
1615 Ga0207689_10022702
1616 Ga0207689_10034031
1617 Ga0207689_10061308
1618 Ga0207689_10063571
1619 Ga0207689_10118101
1620 Ga0207689_10277214
1621 Ga0207661_10135339
1622 Ga0207661_10142760
1623 Ga0207679_10000730
1624 Ga0207679_10010415
1625 Ga0207679_10011896
1626 Ga0207679_10131331
1627 Ga0207679_10205195
1628 Ga0207667_10024656
1629 Ga0207667_10026800
1630 Ga0207667_10030273
1631 Ga0207667_10087544
1632 Ga0207667_10154567
1633 Ga0207651_10003471
1634 Ga0207651_10028358
1635 Ga0207651_10069685
1636 Ga0207651_10252192
1637 Ga0207712_10067108
1638 Ga0207668_10004390
1639 Ga0207668_10053015
1640 Ga0207640_10023034
1641 Ga0207640_10082383
1642 Ga0207658_10005270
1643 Ga0207658_10007685
1644 Ga0207658_10015971
1645 Ga0207658_10021533
1646 Ga0207658_10021561
1647 Ga0207658_10167556
1648 Ga0207677_10002324
1649 Ga0207677_10023530
1650 Ga0207677_10043382
1651 Ga0207703_10003131
1652 Ga0207703_10005198
1653 Ga0207703_10033516
1654 Ga0207703_10163573
1655 Ga0207639_10010457
1656 Ga0207639_10035863
1657 Ga0207639_10106409
1658 Ga0207639_10122505
1659 Ga0207639_10227734
1660 Ga0207639_10279091
1661 Ga0207678_10002200
1662 Ga0207678_10053222
1663 Ga0207678_10147260
1664 Ga0207708_10044032
1665 Ga0207702_10000305
1666 Ga0207702_10032304
1667 Ga0207702_10058880
1668 Ga0207641_10006528
1669 Ga0207641_10012012
1670 Ga0207641_10124207
1671 Ga0207641_10322836
1672 Ga0207648_10000286
1673 Ga0207648_10000878
1674 Ga0207648_10008332
1675 Ga0207648_10024038
1676 Ga0207648_10042896
1677 Ga0207648_10066867
1678 Ga0207648_10105019
1679 Ga0207676_10001457
1680 Ga0207676_10021802
1681 Ga0207676_10036150
1682 Ga0207676_10114179
1683 Ga0207676_10218332
1684 Ga0207676_10258686
1685 Ga0207674_10067815
1686 Ga0207674_10091078
1687 Ga0207674_10102936
1688 Ga0207675_100001900
1689 Ga0207675_100008217
1690 Ga0207675_100037604
1691 Ga0207683_10016577
1692 Ga0207683_10028752
1693 Ga0207683_10092116
1694 Ga0207683_10116820
1695 Ga0207683_10164423
1696 Ga0207698_10004685
1697 Ga0207698_10009520
1698 Ga0207698_10045582
1699 Ga0207698_10055995
1700 Ga0207698_10059137
1701 Ga0207698_10062309
1702 Ga0207698_10086423
1703 Ga0207698_10118010
1704 Ga0209281_1000259
1705 Ga0209968_1000129
1706 Ga0209999_1002190
1707 Ga0209282_1001433
1708 Ga0209966_1000035
1709 Ga0207428_10035993
1710 Ga0268266_10117070
1711 Ga0268266_10559763
1712 Ga0268265_10114311
1713 Ga0268264_10000991
1714 Ga0268264_10062766
1715 Ga0268264_10112149
1716 Ga0268264_10115229
1717 Ga0265336_10000013
1718 Ga0307517_10000131
1719 Ga0307517_10069239
1720 Ga0307517_10155715
1721 Ga0307515_10000011
1722 Ga0307515_10000278
1723 Ga0307515_10006352
1724 Ga0307515_10009653
1725 Ga0307515_10028588
1726 Ga0307515_10035182
1727 Ga0307515_10037795
1728 Ga0307515_10040145
1729 Ga0307515_10066582
1730 Ga0307515_10089622
1731 Ga0307515_10120653
1732 Ga0307515_10165132
1733 Ga0265324_10000193
1734 Ga0265324_10007057
1735 Ga0316177_1175648
1736 Ga0316176_1195019
1737 Ga0314311_1020317
1738 Ga0316179_1040040
1739 Ga0316178_1025743
1740 Ga0316180_1050502
1741 Ga0316183_1188254
1742 Ga0316183_1202539
1743 Ga0316181_1041597
1744 Ga0316182_1104984
1745 Ga0316182_1417019
1746 Ga0265330_10000453
1747 Ga0265332_10000012
1748 Ga0265325_10017431
1749 Ga0265327_10001807
1750 Ga0307513_10043473
1751 Ga0307513_10051134
1752 Ga0307513_10069012
1753 Ga0307513_10155369
1754 Ga0307509_10000871
1755 Ga0307509_10009460
1756 Ga0307509_10062290
1757 Ga0307509_10071281
1758 Ga0307509_10072259
1759 Ga0307509_10086638
1760 Ga0307509_10158271
1761 Ga0307509_10271113
1762 Ga0307408_100000274
1763 Ga0307408_100104590
1764 Ga0307408_100106258
1765 Ga0307508_10000123
1766 Ga0307508_10000349
1767 Ga0307508_10046060
1768 Ga0307508_10061411
1769 Ga0307508_10189187
1770 Ga0307508_10245087
1771 Ga0307514_10000355
1772 Ga0307514_10001708
1773 Ga0307514_10010918
1774 Ga0307514_10024565
1775 Ga0307514_10057518
1776 Ga0265314_10000029
1777 Ga0307516_10001568
1778 Ga0307516_10001850
1779 Ga0307516_10004605
1780 Ga0307516_10044066
1781 Ga0307516_10146531
1782 Ga0307405_10014665
1783 Ga0307405_10014975
1784 Ga0307405_10369473
1785 Ga0307413_10026524
1786 Ga0307410_10185676
1787 Ga0307406_10001131
1788 Ga0307406_10001699
1789 Ga0307406_10027882
1790 Ga0307406_10042058
1791 Ga0307412_10054471
1792 Ga0307412_10097082
1793 Ga0307412_10117802
1794 Ga0307412_10125216
1795 Ga0307412_10353632
1796 Ga0307409_100000926
1797 Ga0307416_100003028
1798 Ga0307416_100168892
1799 Ga0307416_100179728
1800 Ga0307416_100502519
1801 Ga0307414_10026215
1802 Ga0307414_10064209
1803 Ga0307414_10159590
1804 Ga0307411_10041081
1805 Ga0307415_100003743
1806 Ga0307510_10008226
1807 Ga0307510_10069826
1808 Ga0307510_10201778
1809 Ga0373959_0006082
1810 Ga0373955_0184150
1811 Ga0373962_0011061
1812 Ga0373931_0058186
1813 Ga0373931_0122546
1814 Ga0373947_0070940
1815 Ga0373925_0435975
1816 Ga0395899_0000586
1817 Ga0395899_0001071
1818 Ga0395899_0074231
1819 Ga0395900_0000058
1820 Ga0395900_0005380
1821 Ga0395900_0039728
1822 Ga0395900_0054509
1823 Ga0395898_0000283
1824 Ga0395898_0004069
1825 Ga0395898_0006225
1826 Ga0395905_0000474
1827 Ga0395905_0006877
1828 Ga0395905_0013432
1829 Ga0395905_0022875
1830 Ga0395905_0023384
1831 Ga0395905_0023805
1832 Ga0395905_0060047
1833 Ga0395905_0070264
1834 Ga0395905_0113331
1835 Ga0395905_0232081
1836 Ga0395905_0373377
1837 Ga0395901_0001676
1838 Ga0395901_0002111
1839 Ga0395901_0010431
1840 Ga0395901_0130823
1841 Ga0436365_0730477
1842 Ga0436361_0566522
1843 Ga0436361_0591904
1844 Ga0436361_0627254
1845 Ga0436361_1134487
1846 Ga0439436_0002079
1847 Ga0439439_0017596
1848 Ga0439465_0001094
1849 Ga0451795_0816552
1850 Ga0451802_0878914
1851 Ga0451839_1446416
1852 Ga0451853_2222586
1853 Ga0439431_0011396
1854 Ga0439432_006841
1855 Ga0439432_013501
1856 Ga0439449_0000840
1857 Ga0439449_0004494
1858 Ga0439449_0016763
1859 Ga0439449_0053043
1860 Ga0439452_013992
1861 Ga0439457_020415
1862 Ga0439462_0013086
1863 Ga0439462_0015525
1864 Ga0450911_001146
1865 Ga0450919_000198
1866 Ga0450920_012224
1867 Ga0450890_006419
1868 Ga0450897_001948
1869 Ga0439446_0012002
1870 Ga0450908_011281
1871 Ga0439434_0004081
1872 Ga0439434_0043675
1873 Ga0439459_0006802
1874 Ga0450918_000047
1875 Ga0450918_000609
1876 Ga0451577_0010228
1877 Ga0451577_0013180
1878 Ga0451577_0019182
1879 Ga0466969_0000013
1880 Ga0466969_0001902
1881 Ga0466969_0038002
1882 Ga0466969_0098117
1883 Ga0466972_0074601
1884 Ga0466972_0078819
1885 Ga0466965_0072665
1886 Ga0466966_0007367
1887 Ga0466966_0009518
1888 Ga0466966_0019848
1889 Ga0466966_0063907
1890 Ga0466963_0006190
1891 Ga0466964_0023321
1892 Ga0466964_0049836
1893 Ga0453684_0027299
1894 Ga0466971_0003284
1895 Ga0466970_0041588
1896 Ga0466957_0028042
1897 Ga0466957_0068411
1898 Ga0466959_0012078
1899 Ga0466959_0086352
1900 Ga0466958_0007549
1901 Ga0466967_0159737
1902 Ga0495627_008213
1903 Ga0495627_019457
1904 Ga0495592_0000394
1905 Ga0495592_0125944
1906 Ga0495590_0005173
1907 Ga0495638_0139249
1908 Ga0495651_0019143
1909 Ga0495651_0025317
1910 Ga0495651_0040232
1911 Ga0495653_0047008
1912 Ga0495650_0019463
1913 Ga0495583_0000081
1914 Ga0495606_0001086
1915 Ga0495608_0013966
1916 Ga0495608_0056440
1917 Ga0495610_0025702
1918 Ga0495610_0056162
1919 Ga0495610_0061924
1920 Ga0495616_0011779
1921 Ga0495618_0154218
1922 Ga0495628_0001687
1923 Ga0495628_0013853
1924 Ga0495628_0322765
1925 Ga0495630_0154828
1926 Ga0495631_0001417
1927 Ga0495632_0010162
1928 Ga0495637_0008174
1929 Ga0495643_0067736
1930 Ga0495643_0149048
1931 Ga0495652_0008424
1932 Ga0495586_0054921
1933 Ga0495621_0018955
1934 Ga0495621_0024847
1935 Ga0495645_0062491
1936 Ga0495656_0000093
1937 Ga0495656_0019941
1938 Ga0495656_0093610
1939 Ga0495668_0046750
1940 Ga0495611_0087562
1941 Ga0495625_0001179
1942 Ga0495625_0006045
1943 Ga0495625_0034941
1944 Ga0495635_0064709
1945 Ga0495588_0049426
1946 Ga0495657_0064886
1947 Ga0495623_0006819
1948 Ga0495646_0002576
1949 Ga0495646_0031501
1950 Ga0495646_0141327
1951 Ga0495658_0035262
1952 Ga0495658_0037493
1953 Ga0495658_0046686
1954 Ga0495658_0214289
1955 Ga0495669_0012571
1956 Ga0495613_0165418
1957 Ga0495624_0062388
1958 Ga0495670_0034634
1959 Ga0495671_0021694
1960 Ga0495649_0000287
1961 Ga0495649_0015647
1962 Ga0495589_0008991
1963 Ga0495604_0044585
1964 Ga0495604_0096919
1965 Ga0495676_0107019
1966 Ga0495687_000582
1967 Ga0495687_003988
1968 Ga0495684_0157686
1969 Ga0495686_0012435
1970 Ga0495686_0075315
1971 Ga0495593_0101135
1972 Ga0495602_0019713
1973 Ga0495602_0089757
1974 Ga0495602_0135349
1975 Ga0495615_0007340
1976 Ga0496100_0043054
1977 Ga0496100_0092730
1978 Ga0496101_0034545
1979 Ga0496101_0342128
1980 Ga0496102_0025715
1981 Ga0496103_0050295
1982 Ga0496104_0008511
1983 Ga0496105_0024726
1984 Ga0496105_0078475
1985 Ga0496106_0022941
1986 Ga0496106_0048622
1987 Ga0496106_0053548
1988 Ga0496107_0006316
1989 Ga0496108_0236330
1990 Ga0496109_0073499
1991 Ga0496110_0079805
1992 Ga0496110_0358531
1993 Ga0496111_0067545
1994 Ga0496111_0078010
1995 Ga0496112_0011308
1996 Ga0496112_0460602
1997 Ga0496114_0003046
1998 Ga0496114_0056306
1999 Ga0496114_0124210
2000 Ga0496114_0159508
2001 Ga0496115_0067578
2002 Ga0496117_0044192
2003 Ga0496117_0081894
2004 Ga0496118_0007613
2005 Ga0496121_0035310
2006 Ga0496121_0061186
2007 Ga0496121_0065545
2008 Ga0496121_0083876
2009 Ga0496122_0000383
2010 Ga0496123_0000249
2011 Ga0496124_0002378
2012 Ga0496124_0016354
2013 Ga0496124_0097272
2014 Ga0496125_0000785
2015 Ga0496125_0013437
2016 Ga0496125_0049441
2017 Ga0496125_0070483
2018 Ga0501034_0239499
2019 Ga0501038_0058954
2020 Ga0501043_0000009
2021 Ga0501046_0000022
2022 Ga0501046_0063108
2023 Ga0501047_0000021
2024 Ga0501048_0006915
2025 Ga0501252_001618
2026 Ga0501225_0007622
2027 Ga0501262_001452
2028 Ga0501035_0238000
2029 Ga0501045_0020284
2030 nmdc:mga03683_26256_c1
2031 nmdc:mga03683_32284_c1
2032 nmdc:mga03683_52391_c1
2033 nmdc:mga03n38_21542_c1
2034 nmdc:mga0yw44_14380_c1
2035 nmdc:mga0yw44_38057_c1
2036 nmdc:mga0k408_14868_c1
2037 nmdc:mga0k408_28083_c1
2038 nmdc:mga0k408_47081_c1
2039 nmdc:mga0k408_51063_c1
2040 nmdc:mga0k408_55984_c1
2041 nmdc:mga0k408_8358_c1
2042 nmdc:mga0k408_86717_c1
2043 nmdc:mga06z11_115211_c1
2044 nmdc:mga06z11_190863_c1
2045 nmdc:mga06z11_42479_c1
2046 nmdc:mga06z11_52833_c1
2047 nmdc:mga07m45_12201_c1
2048 nmdc:mga07m45_221111_c1
2049 nmdc:mga07m45_29688_c1
2050 nmdc:mga07m45_36397_c1
2051 nmdc:mga07m45_43867_c1
2052 nmdc:mga07m45_81_c1
2053 nmdc:mga09592_14596_c1
2054 nmdc:mga0qj67_69170_c1
2055 nmdc:mga0sz30_21551_c1
2056 Ga0495601_0044290
2057 Ga0500578_0000652
2058 Ga0500643_018305
2059 Ga0500646_0020168
2060 Ga0500651_0000067
2061 Ga0500651_0008514
2062 Ga0500562_016498
2063 Ga0500571_000952
2064 Ga0500572_065181
2065 Ga0500593_001535
2066 Ga0500593_005315
2067 Ga0500594_0005643
2068 Ga0500595_013753
2069 Ga0500628_002238
2070 Ga0500652_005856
2071 Ga0500652_089169
2072 Ga0500658_0019270
2073 Ga0500658_0022824
2074 Ga0500658_0106674
2075 Ga0500559_0000446
2076 Ga0500559_0009437
2077 Ga0500559_0022035
2078 Ga0500568_0009510
2079 Ga0500568_0033306
2080 Ga0500574_000749
2081 Ga0500590_002813
2082 Ga0500616_0012717
2083 Ga0500619_000568
2084 Ga0500619_004153
2085 Ga0500622_0000124
2086 Ga0500622_0004516
2087 Ga0500622_0009123
2088 Ga0500627_0012737
2089 Ga0500587_000477
2090 Ga0590075_010416
2091 Ga0466962_0003944
2092 Ga0466962_0049703
2093 Ga0466962_0098610
2094 2513228784
2095 2548499213
2096 2587728306
2097 2587734486
2098 2587759369
2099 2588295024
2100 2599620875
2101 2599674319
2102 2599678509
2103 2599690386
2104 2643866047
2105 2643971301
2106 2643994044
2107 2644142057
2108 2644161338
2109 2644243366
2110 2644275464
2111 2644292858
2112 2644303038
2113 2644324055
2114 2644340825
2115 2644400761
2116 2644466000
2117 2644647876
2118 2738720723
2119 2738882323
2120 2739251909
2121 2739279922
2122 2819543489
2123 2819601998
2124 2831269827
2125 2831869140
2126 2838055155
2127 2842680911
2128 2842737619
2129 2842749718
2130 2881103523
2131 2885196698
2132 2885201848
2133 2885215442
2134 2899927245
2135 2904453999
2136 2904459463
2137 2904479540
2138 2904546117
2139 2919465421
2140 2928042840
2141 2928048733
2142 2928055065
2143 2928068491
2144 2928073603
2145 2928089694
2146 2928117250
2147 2929161314
2148 2929521577
2149 2945949787
2150 2945973810
2151 2954770597
2152 2990714101

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

109

315

0.95

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

46

92

0.87

PF02655

ATP-grasp_3

ATP-grasp domain

100

291

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4egj-assembly5.cif.gz_A crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans 0.9574 5 311
4zqi-assembly2.cif.gz_C crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.9535 11 314
5d8d-assembly3.cif.gz_D crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii 0.9534 6 311
5dmx-assembly2.cif.gz_D crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii, space group p212121 0.9525 9 314
4zqi-assembly1.cif.gz_B crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.9524 11 314
ID Description Score Start End Superfamily
4egjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9933 5 90 3.40.50.20
4egjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.96 5 90 3.40.50.20
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9491 91 312 3.30.470.20
5d8dD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9441 91 311 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9429 91 312 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A520H4J1-F1-model_v4 D-alanine--D-alanine ligase 0.9919 5 119 GO:0005829
GO:0008716
GO:0009252
AF-A0A7X8SRQ2-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) 0.9802 11 99 GO:0005829
GO:0008716
GO:0009252
AF-A0A258MF12-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9765 5 311 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A059WVN9-F1-model_v4 D-ala D-ala ligase C-terminus 0.9765 147 320 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
AF-A0A6L4B9S6-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.975 16 316 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555

Map