F489580

General Info

Members Datasets Scaffolds Average Seq Length
1076 471 2152 217

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10197273|Ga0075365_101972732
Length 244
Sequence MLRPILRGAQERAPQDDAECVGPQMKFFSFWRSLASFRVRIALNLKGLPAEIVFVDLDADAHRADAYRKVNPQMALPALVLDDGTTLFQSLAILEYLDETHPAPPLLPADPRGRARVRALALMVACEGHPLLVPRVRRYLDHELNLRDTQQAAWRRHWTVETLAALEAHLADHKETGRFCHGDAPTLADICMVGHVTVAITQQINLAPYPTVQRIFDAAMALPAFATAHPLAQPDTPEAMRKKG

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
151 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
223 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
229 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
230 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
231 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
232 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
235 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
236 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
237 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
256 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
257 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
258 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
279 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
280 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
281 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
282 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
283 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
284 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
285 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
286 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
287 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
288 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
289 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
290 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
291 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
292 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
293 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
300 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
301 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
302 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
306 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
309 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
310 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
319 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
320 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
321 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
334 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
335 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
336 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
337 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
338 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
339 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
340 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
341 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
342 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
343 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
344 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
345 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
348 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
349 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
350 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
351 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
352 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
353 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
363 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
366 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
367 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
382 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
387 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
390 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
391 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
392 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
393 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
394 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
399 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
410 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
411 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
412 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
413 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
414 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
415 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
416 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
417 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
418 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
419 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
420 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
421 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
422 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
423 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
424 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
425 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
426 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
427 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
428 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
429 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
430 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
431 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
432 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
433 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
434 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
435 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
436 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
437 2643221660 Methylibium sp. Root1272 Isolate Unclassified
438 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
439 2791355199
440 2857553236 Duganella sp. R-74557 Isolate Unclassified
441 2857558681 Duganella sp. R-74565 Isolate Unclassified
442 2857564685 Duganella sp. R-74599 Isolate Unclassified
443 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
444 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
445 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
446 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
447 2904699407
448 2906610324
449 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
450 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
451 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
452 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
453 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
454 2922425934
455 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
456 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
457 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
458 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
459 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
460 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
461 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
462 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
463 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
464 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
465 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
466 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
467 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
468 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
469 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
470 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
471 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.64
Metatranscriptomes 0
Isolates 3.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 8.46
Nodule 1.95
Rhizoplane 4.65
Rhizosphere 80.02
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10197273 3300006038 Bacteria 1410
2 JGI24751J29686_10022294 3300002459 Bacteria 1314
3 JGI25150J39212_1000628 3300002774 Bacteria 13387
4 JGI25406J46586_10023564 3300003203 Bacteria 2431
5 JGI25153J46596_10001338 3300003215 Bacteria 14733
6 rootL2_10033244 3300003322 Bacteria 2856
7 rootL2_10133234 3300003322 Bacteria 3079
8 Ga0055526_1000198 3300003771 Bacteria 51889
9 Ga0055526_1000218 3300003771 Bacteria 49706
10 Ga0055526_1003042 3300003771 Bacteria 10899
11 Ga0055537_1000790 3300003773 Bacteria 15874
12 Ga0055534_1000180 3300003784 Bacteria 46550
13 Ga0055528_1000262 3300003790 Bacteria 44658
14 Ga0055530_10009923 3300003791 Bacteria 3588
15 Ga0055530_10052351 3300003791 Bacteria 942
16 Ga0055530_10062741 3300003791 Bacteria 824
17 Ga0055540_1016176 3300003792 Bacteria 2135
18 Ga0055540_1023639 3300003792 Bacteria 1543
19 Ga0065715_10022737 3300005293 Bacteria 1639
20 Ga0065707_10288654 3300005295 Bacteria 1030
21 Ga0070658_10054218 3300005327 Bacteria 3256
22 Ga0070658_10066192 3300005327 Bacteria 2951
23 Ga0070658_10490996 3300005327 Bacteria 1060
24 Ga0070676_10086765 3300005328 Bacteria 1909
25 Ga0070676_10217250 3300005328 Bacteria 1261
26 Ga0070683_100134544 3300005329 Bacteria 2340
27 Ga0070683_100263427 3300005329 Bacteria 1640
28 Ga0070683_100874374 3300005329 Bacteria 862
29 Ga0070670_100120456 3300005331 Bacteria 2263
30 Ga0070670_100243204 3300005331 Bacteria 1567
31 Ga0070677_10002466 3300005333 Bacteria 5923
32 Ga0070677_10255665 3300005333 Bacteria 872
33 Ga0068869_100000108 3300005334 Bacteria 39249
34 Ga0068869_100020312 3300005334 Bacteria 4553
35 Ga0068869_100028565 3300005334 Bacteria 3899
36 Ga0068869_100049825 3300005334 Bacteria 3033
37 Ga0068869_100110247 3300005334 Bacteria 2093
38 Ga0070666_10038220 3300005335 Bacteria 3193
39 Ga0070666_10331269 3300005335 Bacteria 1087
40 Ga0070666_10563692 3300005335 Bacteria 829
41 Ga0070680_100247583 3300005336 Bacteria 1507
42 Ga0070680_100543169 3300005336 Bacteria 996
43 Ga0070682_100107660 3300005337 Bacteria 1852
44 Ga0070682_100135317 3300005337 Bacteria 1673
45 Ga0070682_100636601 3300005337 Bacteria 847
46 Ga0068868_100056259 3300005338 Bacteria 3106
47 Ga0068868_100063616 3300005338 Bacteria 2926
48 Ga0068868_100111191 3300005338 Bacteria 2226
49 Ga0068868_100148026 3300005338 Bacteria 1932
50 Ga0068868_100286347 3300005338 Bacteria 1396
51 Ga0070660_100005400 3300005339 Bacteria 8847
52 Ga0070660_100012123 3300005339 Bacteria 6154
53 Ga0070660_100178680 3300005339 Bacteria 1717
54 Ga0070689_100114572 3300005340 Bacteria 2148
55 Ga0070687_100413572 3300005343 Bacteria 887
56 Ga0070661_100006353 3300005344 Bacteria 8151
57 Ga0070661_100007131 3300005344 Bacteria 7706
58 Ga0070661_100057780 3300005344 Bacteria 2842
59 Ga0070661_100430512 3300005344 Bacteria 1047
60 Ga0070692_10060812 3300005345 Bacteria 1989
61 Ga0070692_10167276 3300005345 Bacteria 1265
62 Ga0070668_100016851 3300005347 Bacteria 5464
63 Ga0070668_100018823 3300005347 Bacteria 5187
64 Ga0070668_100025885 3300005347 Bacteria 4449
65 Ga0070668_100031665 3300005347 Bacteria 4024
66 Ga0070668_100090578 3300005347 Bacteria 2409
67 Ga0070668_100094000 3300005347 Bacteria 2366
68 Ga0070668_100120049 3300005347 Bacteria 2100
69 Ga0070668_100224242 3300005347 Bacteria 1551
70 Ga0070669_100013057 3300005353 Bacteria 5899
71 Ga0070669_100028863 3300005353 Bacteria 3996
72 Ga0070669_100088425 3300005353 Bacteria 2319
73 Ga0070669_100133174 3300005353 Bacteria 1909
74 Ga0070669_100222466 3300005353 Bacteria 1493
75 Ga0070669_100308067 3300005353 Bacteria 1276
76 Ga0070669_100391885 3300005353 Bacteria 1135
77 Ga0070669_100655948 3300005353 Bacteria 883
78 Ga0070675_100084625 3300005354 Bacteria 2649
79 Ga0070675_100234544 3300005354 Bacteria 1602
80 Ga0070675_100321954 3300005354 Bacteria 1366
81 Ga0070675_100344366 3300005354 Bacteria 1321
82 Ga0070675_100348051 3300005354 Bacteria 1314
83 Ga0070675_100420827 3300005354 Bacteria 1194
84 Ga0070671_100007885 3300005355 Bacteria 8513
85 Ga0070671_100385010 3300005355 Bacteria 1199
86 Ga0070671_100458067 3300005355 Bacteria 1094
87 Ga0070671_100524851 3300005355 Bacteria 1020
88 Ga0070674_100019883 3300005356 Bacteria 4276
89 Ga0070674_100021123 3300005356 Bacteria 4173
90 Ga0070674_100022113 3300005356 Bacteria 4097
91 Ga0070674_100030839 3300005356 Bacteria 3547
92 Ga0070674_100139236 3300005356 Bacteria 1819
93 Ga0070674_100193973 3300005356 Bacteria 1564
94 Ga0070673_100162386 3300005364 Bacteria 1901
95 Ga0070673_100239533 3300005364 Bacteria 1577
96 Ga0070673_100513294 3300005364 Bacteria 1085
97 Ga0070673_100747066 3300005364 Bacteria 901
98 Ga0070688_100020439 3300005365 Bacteria 3851
99 Ga0070688_100283626 3300005365 Bacteria 1191
100 Ga0070659_100001088 3300005366 Bacteria 19812
101 Ga0070659_100022667 3300005366 Bacteria 4795
102 Ga0070659_100092659 3300005366 Bacteria 2423
103 Ga0070659_100243227 3300005366 Bacteria 1490
104 Ga0070659_100320829 3300005366 Bacteria 1295
105 Ga0070659_100343157 3300005366 Bacteria 1252
106 Ga0070667_100041022 3300005367 Bacteria 3883
107 Ga0070667_100059966 3300005367 Bacteria 3220
108 Ga0070667_100174002 3300005367 Bacteria 1901
109 Ga0070667_100533825 3300005367 Unclassified 1077
110 Ga0070667_100819341 3300005367 Bacteria 864
111 Ga0070703_10164315 3300005406 Bacteria 845
112 Ga0070709_10189103 3300005434 Bacteria 1451
113 Ga0070714_100081392 3300005435 Bacteria 2819
114 Ga0070713_100824998 3300005436 Bacteria 890
115 Ga0070701_10059957 3300005438 Bacteria 2002
116 Ga0070701_10129129 3300005438 Bacteria 1434
117 Ga0070711_100088699 3300005439 Bacteria 2223
118 Ga0070711_100156253 3300005439 Bacteria 1725
119 Ga0070705_100050412 3300005440 Bacteria 2422
120 Ga0070705_100141440 3300005440 Bacteria 1584
121 Ga0070705_100649683 3300005440 Bacteria 822
122 Ga0070700_100003206 3300005441 Bacteria 8410
123 Ga0070700_100413556 3300005441 Bacteria 1017
124 Ga0070694_100011084 3300005444 Bacteria 5581
125 Ga0070694_100059684 3300005444 Bacteria 2599
126 Ga0070694_100452485 3300005444 Bacteria 1014
127 Ga0070708_100058166 3300005445 Bacteria 3444
128 Ga0070708_100248456 3300005445 Bacteria 1671
129 Ga0070663_100025065 3300005455 Bacteria 4023
130 Ga0070663_100040343 3300005455 Bacteria 3267
131 Ga0070663_100125775 3300005455 Bacteria 1942
132 Ga0070663_100189959 3300005455 Bacteria 1598
133 Ga0070663_100203418 3300005455 Bacteria 1546
134 Ga0070663_100387388 3300005455 Bacteria 1140
135 Ga0070663_100700897 3300005455 Bacteria 861
136 Ga0070678_100027111 3300005456 Bacteria 3885
137 Ga0070678_100171756 3300005456 Bacteria 1766
138 Ga0070678_100201052 3300005456 Bacteria 1645
139 Ga0070678_100335735 3300005456 Bacteria 1295
140 Ga0070662_100000134 3300005457 Bacteria 41711
141 Ga0070662_100095159 3300005457 Bacteria 2244
142 Ga0070681_10532994 3300005458 Bacteria 1088
143 Ga0068867_100000126 3300005459 Bacteria 49231
144 Ga0068867_100009464 3300005459 Bacteria 6871
145 Ga0068867_100121493 3300005459 Bacteria 2019
146 Ga0068867_100157700 3300005459 Bacteria 1788
147 Ga0068867_100175113 3300005459 Bacteria 1702
148 Ga0068867_100313851 3300005459 Bacteria 1296
149 Ga0068867_100432244 3300005459 Bacteria 1118
150 Ga0070685_10098733 3300005466 Bacteria 1780
151 Ga0070706_100030612 3300005467 Bacteria 4960
152 Ga0070707_100040082 3300005468 Bacteria 4479
153 Ga0070699_100003308 3300005518 Bacteria 14252
154 Ga0070699_100045054 3300005518 Bacteria 3818
155 Ga0070699_100687793 3300005518 Bacteria 934
156 Ga0070679_100012228 3300005530 Bacteria 8198
157 Ga0070679_100195222 3300005530 Bacteria 1992
158 Ga0070679_100348458 3300005530 Bacteria 1429
159 Ga0070684_100033871 3300005535 Bacteria 4364
160 Ga0070684_100138955 3300005535 Bacteria 2196
161 Ga0070697_100015469 3300005536 Bacteria 5990
162 Ga0068853_100000458 3300005539 Bacteria 27839
163 Ga0068853_100121596 3300005539 Bacteria 2330
164 Ga0068853_100688275 3300005539 Bacteria 975
165 Ga0070672_100045716 3300005543 Bacteria 3389
166 Ga0070672_100090790 3300005543 Bacteria 2464
167 Ga0070672_100106878 3300005543 Bacteria 2277
168 Ga0070672_100275045 3300005543 Bacteria 1423
169 Ga0070672_100296559 3300005543 Bacteria 1370
170 Ga0070686_100208741 3300005544 Bacteria 1404
171 Ga0070686_100527002 3300005544 Bacteria 921
172 Ga0070695_100002348 3300005545 Bacteria 10850
173 Ga0070695_100188331 3300005545 Bacteria 1467
174 Ga0070696_100001808 3300005546 Bacteria 14037
175 Ga0070693_100055156 3300005547 Bacteria 2289
176 Ga0070665_100018469 3300005548 Bacteria 6989
177 Ga0070665_100031980 3300005548 Bacteria 5296
178 Ga0070665_100063857 3300005548 Bacteria 3692
179 Ga0070665_100348152 3300005548 Bacteria 1487
180 Ga0070665_100504053 3300005548 Bacteria 1222
181 Ga0070704_100001833 3300005549 Bacteria 11711
182 Ga0070704_100073317 3300005549 Bacteria 2494
183 Ga0070704_100175710 3300005549 Bacteria 1708
184 Ga0070704_100385774 3300005549 Bacteria 1191
185 Ga0068855_100001419 3300005563 Bacteria 29756
186 Ga0068855_100127510 3300005563 Bacteria 2909
187 Ga0068855_100159333 3300005563 Bacteria 2563
188 Ga0068855_100187278 3300005563 Bacteria 2337
189 Ga0068855_100314928 3300005563 Bacteria 1731
190 Ga0068855_100834500 3300005563 Bacteria 977
191 Ga0070664_100022570 3300005564 Bacteria 5189
192 Ga0070664_100029120 3300005564 Bacteria 4602
193 Ga0070664_100045817 3300005564 Bacteria 3693
194 Ga0070664_100095464 3300005564 Bacteria 2579
195 Ga0070664_100250675 3300005564 Bacteria 1591
196 Ga0070664_100744052 3300005564 Bacteria 915
197 Ga0068857_100090614 3300005577 Bacteria 2736
198 Ga0068857_100114401 3300005577 Bacteria 2426
199 Ga0068857_101208364 3300005577 Bacteria 732
200 Ga0068854_100024108 3300005578 Bacteria 4163
201 Ga0068854_100276410 3300005578 Bacteria 1350
202 Ga0068854_100674803 3300005578 Bacteria 889
203 Ga0068856_100000265 3300005614 Bacteria 56919
204 Ga0068856_100208376 3300005614 Bacteria 1970
205 Ga0068856_100572465 3300005614 Bacteria 1151
206 Ga0070702_100021708 3300005615 Bacteria 3383
207 Ga0070702_100309967 3300005615 Bacteria 1095
208 Ga0070702_100476993 3300005615 Bacteria 911
209 Ga0068852_100197004 3300005616 Bacteria 1904
210 Ga0068852_100242791 3300005616 Bacteria 1722
211 Ga0068852_100297249 3300005616 Bacteria 1562
212 Ga0068852_100505901 3300005616 Bacteria 1203
213 Ga0068859_100087220 3300005617 Bacteria 3168
214 Ga0068859_100107772 3300005617 Bacteria 2847
215 Ga0068859_100241030 3300005617 Bacteria 1897
216 Ga0068859_100517306 3300005617 Bacteria 1288
217 Ga0068859_100582057 3300005617 Bacteria 1213
218 Ga0068864_100015296 3300005618 Bacteria 6381
219 Ga0068864_100102798 3300005618 Bacteria 2536
220 Ga0068864_100113505 3300005618 Bacteria 2415
221 Ga0068866_10033930 3300005718 Bacteria 2481
222 Ga0068866_10062661 3300005718 Bacteria 1935
223 Ga0068866_10109947 3300005718 Bacteria 1536
224 Ga0068866_10277517 3300005718 Bacteria 1037
225 Ga0068861_100000134 3300005719 Bacteria 38219
226 Ga0068861_100024453 3300005719 Bacteria 4369
227 Ga0068861_100026946 3300005719 Bacteria 4182
228 Ga0068861_100040936 3300005719 Bacteria 3468
229 Ga0068861_100073614 3300005719 Bacteria 2654
230 Ga0068861_100179829 3300005719 Bacteria 1760
231 Ga0068861_100245590 3300005719 Bacteria 1525
232 Ga0068861_100531090 3300005719 Bacteria 1069
233 Ga0068861_100676169 3300005719 Bacteria 956
234 Ga0068851_10009081 3300005834 Bacteria 4614
235 Ga0068851_10038811 3300005834 Bacteria 2390
236 Ga0068851_10043848 3300005834 Bacteria 2255
237 Ga0068863_100127597 3300005841 Bacteria 2427
238 Ga0068863_100509264 3300005841 Bacteria 1186
239 Ga0068863_100523160 3300005841 Bacteria 1170
240 Ga0068863_100684032 3300005841 Bacteria 1019
241 Ga0068858_100004830 3300005842 Bacteria 13204
242 Ga0068858_100033213 3300005842 Bacteria 4790
243 Ga0068858_100114315 3300005842 Bacteria 2521
244 Ga0068858_100360429 3300005842 Bacteria 1393
245 Ga0068858_100515963 3300005842 Bacteria 1155
246 Ga0068858_100561099 3300005842 Bacteria 1106
247 Ga0068860_100024360 3300005843 Bacteria 5848
248 Ga0068860_100056905 3300005843 Bacteria 3716
249 Ga0068860_100109845 3300005843 Bacteria 2635
250 Ga0068860_100313172 3300005843 Bacteria 1539
251 Ga0068860_100314642 3300005843 Bacteria 1536
252 Ga0068860_100323708 3300005843 Bacteria 1513
253 Ga0068860_100361394 3300005843 Bacteria 1430
254 Ga0068860_100457368 3300005843 Bacteria 1270
255 Ga0068860_101247787 3300005843 Bacteria 764
256 Ga0068862_100001111 3300005844 Bacteria 25519
257 Ga0068862_100031836 3300005844 Bacteria 4454
258 Ga0068862_100157649 3300005844 Bacteria 2024
259 Ga0068862_100486919 3300005844 Bacteria 1168
260 Ga0068862_100619419 3300005844 Bacteria 1041
261 Ga0068862_100806479 3300005844 Bacteria 917
262 Ga0068862_100962104 3300005844 Bacteria 842
263 Ga0081455_10011490 3300005937 Bacteria 8896
264 Ga0081455_10013541 3300005937 Bacteria 8042
265 Ga0081455_10160337 3300005937 Bacteria 1725
266 Ga0081540_1002758 3300005983 Bacteria 14257
267 Ga0081540_1011235 3300005983 Bacteria 6001
268 Ga0081540_1011459 3300005983 Bacteria 5923
269 Ga0081540_1027454 3300005983 Bacteria 3225
270 Ga0081540_1028410 3300005983 Bacteria 3142
271 Ga0081540_1035676 3300005983 Bacteria 2663
272 Ga0081540_1068810 3300005983 Bacteria 1648
273 Ga0081540_1071970 3300005983 Bacteria 1595
274 Ga0081540_1120933 3300005983 Bacteria 1087
275 Ga0081539_10000157 3300005985 Bacteria 158278
276 Ga0081539_10004364 3300005985 Bacteria 15760
277 Ga0081539_10013206 3300005985 Bacteria 6247
278 Ga0081539_10047257 3300005985 Bacteria 2460
279 Ga0075365_10035982 3300006038 Bacteria 3206
280 Ga0075365_10391628 3300006038 Bacteria 980
281 Ga0075368_10026128 3300006042 Bacteria 2245
282 Ga0075368_10066870 3300006042 Bacteria 1446
283 Ga0075368_10072890 3300006042 Bacteria 1389
284 Ga0075363_100005124 3300006048 Bacteria 5796
285 Ga0075363_100273555 3300006048 Bacteria 976
286 Ga0075364_10039828 3300006051 Bacteria 3047
287 Ga0075364_10255648 3300006051 Bacteria 1191
288 Ga0070712_100242081 3300006175 Bacteria 1437
289 Ga0075367_10021040 3300006178 Bacteria 3641
290 Ga0075367_10039085 3300006178 Bacteria 2765
291 Ga0075367_10148621 3300006178 Bacteria 1453
292 Ga0075367_10169285 3300006178 Bacteria 1360
293 Ga0075367_10202034 3300006178 Bacteria 1242
294 Ga0075367_10360377 3300006178 Bacteria 918
295 Ga0075367_10390709 3300006178 Bacteria 879
296 Ga0075369_10210627 3300006186 Bacteria 898
297 Ga0075366_10072746 3300006195 Bacteria 2049
298 Ga0097621_100104530 3300006237 Bacteria 2387
299 Ga0097621_100373255 3300006237 Bacteria 1273
300 Ga0075370_10050352 3300006353 Bacteria 2362
301 Ga0075370_10402949 3300006353 Bacteria 821
302 Ga0068871_100449357 3300006358 Bacteria 1155
303 Ga0075428_100017818 3300006844 Bacteria 7847
304 Ga0075428_100211597 3300006844 Bacteria 2095
305 Ga0075428_100354924 3300006844 Bacteria 1573
306 Ga0075430_100084363 3300006846 Bacteria 2660
307 Ga0075430_100670677 3300006846 Bacteria 855
308 Ga0075431_100018399 3300006847 Bacteria 7114
309 Ga0075431_100131935 3300006847 Bacteria 2576
310 Ga0075434_100201802 3300006871 Bacteria 2009
311 Ga0075429_100010239 3300006880 Bacteria 8118
312 Ga0075429_100110711 3300006880 Bacteria 2400
313 Ga0068865_100034493 3300006881 Bacteria 3395
314 Ga0068865_100183572 3300006881 Bacteria 1612
315 Ga0075436_100000050 3300006914 Bacteria 71245
316 Ga0075436_100005257 3300006914 Bacteria 8909
317 Ga0075436_100007947 3300006914 Bacteria 7264
318 Ga0075436_100609756 3300006914 Bacteria 805
319 Ga0097620_100087224 3300006931 Bacteria 3168
320 Ga0097620_100107770 3300006931 Bacteria 2847
321 Ga0097620_100241038 3300006931 Bacteria 1897
322 Ga0097620_100517361 3300006931 Bacteria 1288
323 Ga0097620_100582117 3300006931 Bacteria 1213
324 Ga0075435_100041256 3300007076 Bacteria 3689
325 Ga0075435_100396203 3300007076 Bacteria 1187
326 Ga0075435_100495687 3300007076 Bacteria 1056
327 Ga0099794_10109280 3300007265 Bacteria 1384
328 Ga0099794_10142775 3300007265 Bacteria 1213
329 Ga0099794_10302669 3300007265 Bacteria 828
330 Ga0105251_10001824 3300009011 Bacteria 17609
331 Ga0105250_10167931 3300009092 Bacteria 918
332 Ga0105240_10118311 3300009093 Bacteria 3193
333 Ga0111539_10040711 3300009094 Bacteria 5591
334 Ga0111539_10055286 3300009094 Bacteria 4718
335 Ga0111539_10061749 3300009094 Bacteria 4439
336 Ga0111539_11050481 3300009094 Bacteria 947
337 Ga0111539_11304903 3300009094 Unclassified 842
338 Ga0105245_10054214 3300009098 Bacteria 3601
339 Ga0105245_10374427 3300009098 Bacteria 1416
340 Ga0105245_10447229 3300009098 Bacteria 1300
341 Ga0105245_10832374 3300009098 Bacteria 962
342 Ga0105247_10047736 3300009101 Bacteria 2630
343 Ga0105247_10470944 3300009101 Bacteria 910
344 Ga0114129_10044616 3300009147 Bacteria 6236
345 Ga0114129_10067343 3300009147 Bacteria 4994
346 Ga0114129_10238075 3300009147 Bacteria 2448
347 Ga0114129_10401408 3300009147 Bacteria 1806
348 Ga0114129_10578970 3300009147 Bacteria 1457
349 Ga0114129_11219193 3300009147 Bacteria 936
350 Ga0105243_10006474 3300009148 Bacteria 9057
351 Ga0105243_10345664 3300009148 Bacteria 1364
352 Ga0105243_10413347 3300009148 Bacteria 1256
353 Ga0105243_10443059 3300009148 Bacteria 1217
354 Ga0105243_10500450 3300009148 Bacteria 1151
355 Ga0105241_10587787 3300009174 Bacteria 1004
356 Ga0105242_10332109 3300009176 Bacteria 1398
357 Ga0105248_10002088 3300009177 Bacteria 22111
358 Ga0105248_10015422 3300009177 Bacteria 8423
359 Ga0105248_10458614 3300009177 Bacteria 1437
360 Ga0105248_10680063 3300009177 Bacteria 1161
361 Ga0105248_10822032 3300009177 Bacteria 1049
362 Ga0105237_10097698 3300009545 Bacteria 2927
363 Ga0105238_10016932 3300009551 Bacteria 7398
364 Ga0105238_10260559 3300009551 Bacteria 1713
365 Ga0105249_10002649 3300009553 Bacteria 15482
366 Ga0105249_10129691 3300009553 Bacteria 2405
367 Ga0105249_10221304 3300009553 Bacteria 1863
368 Ga0105249_10396731 3300009553 Bacteria 1409
369 Ga0105239_10099207 3300010375 Bacteria 3220
370 Ga0105239_10215173 3300010375 Bacteria 2154
371 Ga0105239_10393950 3300010375 Bacteria 1567
372 Ga0105246_10063209 3300011119 Bacteria 2581
373 Ga0105246_10105982 3300011119 Bacteria 2055
374 Ga0157373_10000321 3300013100 Bacteria 38735
375 Ga0157373_10267352 3300013100 Bacteria 1210
376 Ga0157371_10000470 3300013102 Bacteria 49205
377 Ga0157371_10286158 3300013102 Bacteria 1191
378 Ga0157370_10134702 3300013104 Bacteria 2303
379 Ga0157369_10005334 3300013105 Bacteria 14979
380 Ga0157369_10140396 3300013105 Bacteria 2557
381 Ga0157374_10044934 3300013296 Bacteria 4086
382 Ga0157374_10385845 3300013296 Bacteria 1396
383 Ga0157378_10112524 3300013297 Bacteria 2497
384 Ga0157378_10132465 3300013297 Bacteria 2309
385 Ga0157378_10454995 3300013297 Bacteria 1271
386 Ga0157378_10458435 3300013297 Bacteria 1266
387 Ga0157378_10659067 3300013297 Bacteria 1063
388 Ga0157378_11374209 3300013297 Bacteria 749
389 Ga0163162_10046096 3300013306 Bacteria 4370
390 Ga0163162_10086573 3300013306 Bacteria 3211
391 Ga0163162_10265511 3300013306 Bacteria 1848
392 Ga0163162_10289386 3300013306 Bacteria 1770
393 Ga0163162_10460020 3300013306 Bacteria 1404
394 Ga0163162_10616796 3300013306 Bacteria 1210
395 Ga0163162_10802183 3300013306 Bacteria 1059
396 Ga0163162_10840522 3300013306 Bacteria 1034
397 Ga0157372_10002397 3300013307 Bacteria 20296
398 Ga0157372_10095119 3300013307 Bacteria 3394
399 Ga0157372_10142657 3300013307 Bacteria 2761
400 Ga0157372_11439873 3300013307 Bacteria 794
401 Ga0157375_10036786 3300013308 Bacteria 4686
402 Ga0157375_10183962 3300013308 Bacteria 2242
403 Ga0157375_10326989 3300013308 Bacteria 1698
404 Ga0157375_10487970 3300013308 Bacteria 1397
405 Ga0157375_10982671 3300013308 Bacteria 985
406 Ga0157375_11110484 3300013308 Bacteria 926
407 Ga0157375_11184038 3300013308 Bacteria 896
408 Ga0163163_10017844 3300014325 Bacteria 6625
409 Ga0163163_10027486 3300014325 Bacteria 5450
410 Ga0163163_10044736 3300014325 Bacteria 4344
411 Ga0163163_10142783 3300014325 Bacteria 2437
412 Ga0163163_10734283 3300014325 Bacteria 1051
413 Ga0157380_10010659 3300014326 Bacteria 6618
414 Ga0157380_10047964 3300014326 Bacteria 3362
415 Ga0157380_10285848 3300014326 Bacteria 1512
416 Ga0157380_11050571 3300014326 Bacteria 851
417 Ga0182008_10029051 3300014497 Bacteria 2794
418 Ga0157377_10004959 3300014745 Bacteria 6205
419 Ga0157377_10267338 3300014745 Bacteria 1115
420 Ga0157379_10337136 3300014968 Bacteria 1379
421 Ga0157376_10222397 3300014969 Bacteria 1749
422 Ga0182006_1039545 3300015261 Bacteria 1861
423 Ga0163161_10122635 3300017792 Bacteria 1954
424 Ga0163161_10338769 3300017792 Bacteria 1193
425 Ga0213876_10029473 3300021384 Bacteria 2892
426 Ga0207425_1000522 3300025245 Bacteria 23469
427 Ga0209677_100599 3300025253 Bacteria 19507
428 Ga0209129_1000225 3300025258 Bacteria 63564
429 Ga0209233_1000907 3300025261 Bacteria 12948
430 Ga0209233_1003339 3300025261 Bacteria 5679
431 Ga0209565_1000037 3300025263 Bacteria 289371
432 Ga0207666_1003363 3300025271 Bacteria 1965
433 Ga0209455_1009913 3300025272 Bacteria 2461
434 Ga0209673_1000032 3300025273 Bacteria 339956
435 Ga0207673_1003898 3300025290 Bacteria 1760
436 Ga0209675_1000020 3300025291 Bacteria 335854
437 Ga0209564_1000009 3300025295 Bacteria 950196
438 Ga0209564_1000196 3300025295 Bacteria 141368
439 Ga0209564_1000951 3300025295 Bacteria 37038
440 Ga0209758_1000181 3300025297 Bacteria 140847
441 Ga0209758_1009611 3300025297 Bacteria 5971
442 Ga0209758_1020987 3300025297 Bacteria 3064
443 Ga0209050_1022660 3300025298 Bacteria 2243
444 Ga0209051_1006158 3300025303 Bacteria 6815
445 Ga0209051_1015429 3300025303 Bacteria 3513
446 Ga0209257_1000734 3300025304 Bacteria 49703
447 Ga0209257_1020408 3300025304 Bacteria 2451
448 Ga0207697_10000319 3300025315 Bacteria 26864
449 Ga0207656_10004660 3300025321 Bacteria 4807
450 Ga0207656_10037161 3300025321 Bacteria 2048
451 Ga0207656_10063131 3300025321 Bacteria 1630
452 Ga0207656_10107453 3300025321 Bacteria 1286
453 Ga0207682_10002499 3300025893 Bacteria 8216
454 Ga0207682_10068966 3300025893 Bacteria 1495
455 Ga0207692_10255021 3300025898 Bacteria 1053
456 Ga0207642_10005842 3300025899 Bacteria 4049
457 Ga0207642_10103452 3300025899 Bacteria 1435
458 Ga0207642_10181398 3300025899 Bacteria 1147
459 Ga0207710_10027753 3300025900 Bacteria 2454
460 Ga0207710_10095267 3300025900 Bacteria 1398
461 Ga0207688_10070330 3300025901 Bacteria 1984
462 Ga0207688_10080120 3300025901 Bacteria 1864
463 Ga0207688_10097818 3300025901 Bacteria 1691
464 Ga0207688_10382543 3300025901 Bacteria 871
465 Ga0207680_10048128 3300025903 Bacteria 2530
466 Ga0207647_10267701 3300025904 Bacteria 977
467 Ga0207645_10007023 3300025907 Bacteria 8017
468 Ga0207645_10012159 3300025907 Bacteria 5846
469 Ga0207645_10257223 3300025907 Bacteria 1156
470 Ga0207643_10000851 3300025908 Bacteria 18500
471 Ga0207643_10040929 3300025908 Bacteria 2610
472 Ga0207643_10229710 3300025908 Bacteria 1138
473 Ga0207684_10592652 3300025910 Bacteria 947
474 Ga0207671_10083591 3300025914 Bacteria 2397
475 Ga0207693_10141032 3300025915 Bacteria 1895
476 Ga0207660_10051862 3300025917 Bacteria 2918
477 Ga0207660_10172306 3300025917 Bacteria 1676
478 Ga0207660_10618110 3300025917 Bacteria 883
479 Ga0207660_10806114 3300025917 Bacteria 766
480 Ga0207662_10111056 3300025918 Bacteria 1709
481 Ga0207657_10006415 3300025919 Bacteria 12199
482 Ga0207657_10008703 3300025919 Bacteria 10274
483 Ga0207657_10022789 3300025919 Bacteria 5848
484 Ga0207657_10121263 3300025919 Bacteria 2151
485 Ga0207657_10219851 3300025919 Bacteria 1522
486 Ga0207649_10005458 3300025920 Bacteria 6883
487 Ga0207649_10006859 3300025920 Bacteria 6185
488 Ga0207649_10096792 3300025920 Bacteria 1945
489 Ga0207649_10114007 3300025920 Bacteria 1811
490 Ga0207649_10205770 3300025920 Bacteria 1393
491 Ga0207649_10227157 3300025920 Bacteria 1333
492 Ga0207652_10300551 3300025921 Bacteria 1449
493 Ga0207652_10674951 3300025921 Bacteria 923
494 Ga0207646_10054665 3300025922 Bacteria 3571
495 Ga0207681_10002154 3300025923 Bacteria 12555
496 Ga0207681_10041742 3300025923 Bacteria 3060
497 Ga0207681_10066301 3300025923 Bacteria 2499
498 Ga0207681_10101154 3300025923 Bacteria 2079
499 Ga0207681_10103646 3300025923 Bacteria 2056
500 Ga0207681_10169607 3300025923 Bacteria 1653
501 Ga0207681_10606554 3300025923 Bacteria 905
502 Ga0207681_10633660 3300025923 Bacteria 885
503 Ga0207694_10055347 3300025924 Bacteria 3080
504 Ga0207694_10131224 3300025924 Bacteria 2008
505 Ga0207650_10006975 3300025925 Bacteria 7702
506 Ga0207650_10010136 3300025925 Bacteria 6458
507 Ga0207650_10384759 3300025925 Bacteria 1159
508 Ga0207659_10003749 3300025926 Bacteria 9163
509 Ga0207659_10356410 3300025926 Bacteria 1215
510 Ga0207659_10988984 3300025926 Bacteria 724
511 Ga0207687_10017108 3300025927 Bacteria 4767
512 Ga0207687_10093590 3300025927 Bacteria 2198
513 Ga0207687_10185053 3300025927 Bacteria 1616
514 Ga0207700_11049110 3300025928 Bacteria 729
515 Ga0207644_10000862 3300025931 Bacteria 19192
516 Ga0207644_10055712 3300025931 Bacteria 2851
517 Ga0207644_10087820 3300025931 Bacteria 2311
518 Ga0207644_10098036 3300025931 Bacteria 2196
519 Ga0207644_10207115 3300025931 Bacteria 1549
520 Ga0207644_10477820 3300025931 Bacteria 1026
521 Ga0207690_10000395 3300025932 Bacteria 28806
522 Ga0207690_10167015 3300025932 Bacteria 1645
523 Ga0207690_10180307 3300025932 Bacteria 1590
524 Ga0207690_10328689 3300025932 Bacteria 1203
525 Ga0207706_10000002 3300025933 Bacteria 360309
526 Ga0207706_10007913 3300025933 Bacteria 9809
527 Ga0207706_10058409 3300025933 Bacteria 3397
528 Ga0207706_10105624 3300025933 Bacteria 2478
529 Ga0207706_10168439 3300025933 Bacteria 1925
530 Ga0207706_10287886 3300025933 Bacteria 1432
531 Ga0207709_10005402 3300025935 Bacteria 7267
532 Ga0207709_10036410 3300025935 Bacteria 2916
533 Ga0207709_10507525 3300025935 Bacteria 942
534 Ga0207670_10007127 3300025936 Bacteria 6229
535 Ga0207670_10131084 3300025936 Bacteria 1837
536 Ga0207670_10159586 3300025936 Bacteria 1682
537 Ga0207670_10164935 3300025936 Bacteria 1657
538 Ga0207669_10012524 3300025937 Bacteria 4174
539 Ga0207669_10045048 3300025937 Bacteria 2597
540 Ga0207669_10056736 3300025937 Bacteria 2380
541 Ga0207669_10082542 3300025937 Bacteria 2064
542 Ga0207704_10000660 3300025938 Bacteria 15241
543 Ga0207704_10138428 3300025938 Bacteria 1699
544 Ga0207704_10333405 3300025938 Bacteria 1175
545 Ga0207691_10009804 3300025940 Bacteria 9197
546 Ga0207691_10040936 3300025940 Bacteria 4280
547 Ga0207691_10051529 3300025940 Bacteria 3763
548 Ga0207691_10105080 3300025940 Bacteria 2516
549 Ga0207691_10175832 3300025940 Bacteria 1872
550 Ga0207691_10298495 3300025940 Bacteria 1384
551 Ga0207691_10376512 3300025940 Bacteria 1212
552 Ga0207691_10383367 3300025940 Bacteria 1200
553 Ga0207691_10857830 3300025940 Bacteria 761
554 Ga0207711_10339234 3300025941 Bacteria 1391
555 Ga0207711_10472558 3300025941 Bacteria 1168
556 Ga0207711_10543838 3300025941 Bacteria 1083
557 Ga0207689_10000030 3300025942 Bacteria 97584
558 Ga0207689_10002080 3300025942 Bacteria 18880
559 Ga0207689_10159972 3300025942 Bacteria 1856
560 Ga0207689_10189541 3300025942 Bacteria 1696
561 Ga0207689_10276225 3300025942 Bacteria 1391
562 Ga0207689_10314111 3300025942 Bacteria 1300
563 Ga0207661_10059462 3300025944 Bacteria 3080
564 Ga0207679_10001203 3300025945 Bacteria 16448
565 Ga0207679_10022620 3300025945 Bacteria 4283
566 Ga0207679_10024748 3300025945 Bacteria 4119
567 Ga0207679_10092208 3300025945 Bacteria 2346
568 Ga0207679_10315853 3300025945 Bacteria 1351
569 Ga0207679_11086428 3300025945 Bacteria 734
570 Ga0207667_10002263 3300025949 Bacteria 24190
571 Ga0207667_10088541 3300025949 Bacteria 3201
572 Ga0207667_10255304 3300025949 Bacteria 1793
573 Ga0207667_10718801 3300025949 Bacteria 1000
574 Ga0207651_10198027 3300025960 Bacteria 1607
575 Ga0207651_10422941 3300025960 Bacteria 1138
576 Ga0207651_10441340 3300025960 Bacteria 1115
577 Ga0207651_10461859 3300025960 Bacteria 1091
578 Ga0207712_10008122 3300025961 Bacteria 6640
579 Ga0207712_10051365 3300025961 Bacteria 2883
580 Ga0207712_10204244 3300025961 Bacteria 1569
581 Ga0207668_10006932 3300025972 Bacteria 6724
582 Ga0207668_10009884 3300025972 Bacteria 5734
583 Ga0207668_10043072 3300025972 Bacteria 3060
584 Ga0207668_10226871 3300025972 Bacteria 1503
585 Ga0207668_10226893 3300025972 Bacteria 1503
586 Ga0207668_10912214 3300025972 Bacteria 782
587 Ga0207640_10194537 3300025981 Bacteria 1531
588 Ga0207658_10033513 3300025986 Bacteria 3665
589 Ga0207658_10387850 3300025986 Bacteria 1225
590 Ga0207658_10411779 3300025986 Unclassified 1190
591 Ga0207677_10104872 3300026023 Bacteria 2091
592 Ga0207677_10337490 3300026023 Bacteria 1258
593 Ga0207703_10050608 3300026035 Bacteria 3363
594 Ga0207703_10252385 3300026035 Bacteria 1590
595 Ga0207703_10276159 3300026035 Bacteria 1524
596 Ga0207703_10294729 3300026035 Bacteria 1477
597 Ga0207703_10401911 3300026035 Bacteria 1271
598 Ga0207703_10777718 3300026035 Bacteria 913
599 Ga0207639_10001640 3300026041 Bacteria 15075
600 Ga0207639_10057159 3300026041 Bacteria 2994
601 Ga0207639_10458196 3300026041 Bacteria 1159
602 Ga0207678_10003781 3300026067 Bacteria 13610
603 Ga0207678_10004977 3300026067 Bacteria 11917
604 Ga0207678_10021290 3300026067 Bacteria 5685
605 Ga0207678_10242617 3300026067 Bacteria 1543
606 Ga0207678_10258972 3300026067 Bacteria 1491
607 Ga0207678_10263649 3300026067 Bacteria 1477
608 Ga0207678_10283781 3300026067 Bacteria 1421
609 Ga0207678_10685534 3300026067 Bacteria 901
610 Ga0207708_10000697 3300026075 Bacteria 25504
611 Ga0207708_10026820 3300026075 Bacteria 4361
612 Ga0207708_10215912 3300026075 Bacteria 1535
613 Ga0207702_10000655 3300026078 Bacteria 37671
614 Ga0207702_11281020 3300026078 Bacteria 727
615 Ga0207641_10048697 3300026088 Bacteria 3578
616 Ga0207641_10157508 3300026088 Bacteria 2062
617 Ga0207641_10277568 3300026088 Bacteria 1575
618 Ga0207641_10294788 3300026088 Bacteria 1530
619 Ga0207641_10397065 3300026088 Bacteria 1323
620 Ga0207641_10448763 3300026088 Bacteria 1246
621 Ga0207648_10000352 3300026089 Bacteria 50550
622 Ga0207648_10027992 3300026089 Bacteria 5000
623 Ga0207648_10131421 3300026089 Bacteria 2204
624 Ga0207648_10258943 3300026089 Bacteria 1552
625 Ga0207648_10533572 3300026089 Bacteria 1076
626 Ga0207676_10005417 3300026095 Bacteria 9032
627 Ga0207676_10364956 3300026095 Bacteria 1339
628 Ga0207674_10012924 3300026116 Bacteria 9311
629 Ga0207674_10028634 3300026116 Bacteria 5876
630 Ga0207674_10777963 3300026116 Bacteria 924
631 Ga0207674_10803606 3300026116 Bacteria 908
632 Ga0207674_10882548 3300026116 Bacteria 862
633 Ga0207675_100000223 3300026118 Bacteria 53251
634 Ga0207675_100003107 3300026118 Bacteria 16280
635 Ga0207675_100016261 3300026118 Bacteria 6946
636 Ga0207675_100024751 3300026118 Bacteria 5584
637 Ga0207675_100069177 3300026118 Bacteria 3300
638 Ga0207675_100187129 3300026118 Bacteria 1985
639 Ga0207675_100281538 3300026118 Bacteria 1616
640 Ga0207675_100403596 3300026118 Bacteria 1347
641 Ga0207675_100727209 3300026118 Bacteria 1003
642 Ga0207683_10044769 3300026121 Bacteria 3869
643 Ga0207683_10094746 3300026121 Bacteria 2661
644 Ga0207683_10172924 3300026121 Bacteria 1957
645 Ga0207683_10236554 3300026121 Bacteria 1666
646 Ga0207683_10341694 3300026121 Bacteria 1373
647 Ga0207698_10024592 3300026142 Bacteria 4230
648 Ga0207698_10137660 3300026142 Bacteria 2098
649 Ga0207698_10320950 3300026142 Bacteria 1450
650 Ga0209969_1025042 3300027360 Bacteria 899
651 Ga0209967_1012407 3300027364 Bacteria 1204
652 Ga0209981_1002385 3300027378 Bacteria 2387
653 Ga0210000_1008319 3300027462 Bacteria 1521
654 Ga0209995_1003102 3300027471 Bacteria 2638
655 Ga0209970_1039549 3300027614 Bacteria 837
656 Ga0209971_1005095 3300027682 Bacteria 3122
657 Ga0209971_1008432 3300027682 Bacteria 2444
658 Ga0209998_10002446 3300027717 Bacteria 4257
659 Ga0209813_10094153 3300027866 Bacteria 1010
660 Ga0209974_10004640 3300027876 Bacteria 4886
661 Ga0209974_10009535 3300027876 Bacteria 3296
662 Ga0207428_10024684 3300027907 Bacteria 5046
663 Ga0268266_10001575 3300028379 Bacteria 26658
664 Ga0268266_10014129 3300028379 Bacteria 6874
665 Ga0268266_10015559 3300028379 Bacteria 6522
666 Ga0268266_10141998 3300028379 Bacteria 2155
667 Ga0268266_10157946 3300028379 Bacteria 2050
668 Ga0268265_10000579 3300028380 Bacteria 37090
669 Ga0268265_10047066 3300028380 Bacteria 3229
670 Ga0268265_10152948 3300028380 Bacteria 1948
671 Ga0268265_10208359 3300028380 Bacteria 1701
672 Ga0268265_10564550 3300028380 Bacteria 1082
673 Ga0268265_10909750 3300028380 Bacteria 864
674 Ga0268265_11048201 3300028380 Bacteria 807
675 Ga0268264_10003459 3300028381 Bacteria 13616
676 Ga0268264_10062225 3300028381 Bacteria 3133
677 Ga0268264_10103649 3300028381 Bacteria 2478
678 Ga0268264_10178470 3300028381 Bacteria 1927
679 Ga0265334_10007172 3300028573 Bacteria 4783
680 Ga0265318_10025204 3300028577 Bacteria 2350
681 Ga0265323_10001672 3300028653 Bacteria 10624
682 Ga0265336_10001896 3300028666 Bacteria 9038
683 Ga0307517_10001423 3300028786 Bacteria 40213
684 Ga0307515_10184990 3300028794 Bacteria 2017
685 Ga0307515_10278535 3300028794 Bacteria 1383
686 Ga0265338_10000081 3300028800 Bacteria 176402
687 Ga0316177_1022593 3300030731 Bacteria 2912
688 Ga0316177_1036321 3300030731 Bacteria 1609
689 Ga0316180_1076004 3300030736 Bacteria 2212
690 Ga0316182_1048253 3300030745 Bacteria 3883
691 Ga0307513_10059822 3300031456 Bacteria 4042
692 Ga0307509_10237260 3300031507 Bacteria 1620
693 Ga0307408_100000576 3300031548 Bacteria 31629
694 Ga0307408_100015800 3300031548 Bacteria 5030
695 Ga0307408_100594374 3300031548 Bacteria 982
696 Ga0307408_100912180 3300031548 Bacteria 805
697 Ga0307508_10037831 3300031616 Bacteria 4338
698 Ga0316576_10054741 3300031727 Bacteria 2910
699 Ga0307516_10111440 3300031730 Bacteria 2538
700 Ga0307516_10341913 3300031730 Bacteria 1163
701 Ga0307405_10002481 3300031731 Bacteria 8146
702 Ga0307405_10570027 3300031731 Bacteria 919
703 Ga0307413_10005033 3300031824 Bacteria 5837
704 Ga0307410_10023495 3300031852 Bacteria 3833
705 Ga0307406_10165607 3300031901 Bacteria 1594
706 Ga0307406_10571489 3300031901 Bacteria 928
707 Ga0307406_10619817 3300031901 Bacteria 894
708 Ga0307407_10000698 3300031903 Bacteria 10903
709 Ga0307407_10135361 3300031903 Bacteria 1582
710 Ga0307407_10318928 3300031903 Bacteria 1090
711 Ga0307412_10031144 3300031911 Bacteria 3365
712 Ga0307409_100005474 3300031995 Bacteria 7317
713 Ga0307409_100428575 3300031995 Bacteria 1271
714 Ga0307409_100496760 3300031995 Bacteria 1187
715 Ga0307416_100002971 3300032002 Bacteria 9883
716 Ga0307416_100108293 3300032002 Bacteria 2441
717 Ga0307416_100587278 3300032002 Bacteria 1192
718 Ga0307416_100638359 3300032002 Bacteria 1148
719 Ga0307416_101580272 3300032002 Bacteria 761
720 Ga0307414_10015320 3300032004 Bacteria 4628
721 Ga0307411_10000867 3300032005 Bacteria 11397
722 Ga0307411_10089726 3300032005 Bacteria 2142
723 Ga0307415_100003950 3300032126 Bacteria 7623
724 Ga0307415_100566620 3300032126 Bacteria 1005
725 Ga0307510_10002798 3300033180 Bacteria 20009
726 Ga0307510_10372225 3300033180 Bacteria 875
727 Ga0315911_1000005 3300033442 Bacteria 426255
728 Ga0373926_0131676 3300035083 Bacteria 947
729 Ga0373923_0119002 3300035111 Bacteria 1179
730 Ga0373936_0023646 3300035113 Bacteria 2396
731 Ga0373939_0005902 3300035114 Bacteria 2931
732 Ga0373954_0149765 3300035118 Bacteria 1140
733 Ga0373943_0143052 3300035170 Bacteria 1290
734 Ga0373943_0159929 3300035170 Bacteria 1226
735 Ga0373946_0082024 3300035171 Bacteria 1414
736 Ga0373927_0222414 3300035695 Bacteria 1240
737 Ga0373933_0083335 3300035724 Bacteria 1964
738 Ga0373937_0026451 3300036401 Bacteria 5244
739 Ga0373937_0033401 3300036401 Bacteria 4672
740 Ga0373937_0267659 3300036401 Bacteria 1612
741 Ga0373937_1132319 3300036401 Bacteria 731
742 Ga0316584_0377521 3300036712 Bacteria 1014
743 Ga0373925_0041802 3300037068 Bacteria 3400
744 Ga0395899_0051379 3300037312 Bacteria 3059
745 Ga0395899_0091067 3300037312 Bacteria 2210
746 Ga0395900_0004048 3300037418 Bacteria 15637
747 Ga0395900_0016331 3300037418 Bacteria 7568
748 Ga0395898_0151981 3300037466 Bacteria 2214
749 Ga0395898_0152485 3300037466 Bacteria 2211
750 Ga0395905_0001257 3300037471 Bacteria 31335
751 Ga0395905_0074999 3300037471 Bacteria 3170
752 Ga0395905_0858559 3300037471 Bacteria 811
753 Ga0395901_0197417 3300038443 Bacteria 2109
754 Ga0395901_0525920 3300038443 Bacteria 1201
755 Ga0242420_007102 3300038996 Bacteria 1791
756 Ga0436365_1234622 3300039437 Bacteria 117941
757 Ga0436365_1679225 3300039437 Bacteria 3459
758 Ga0436360_0547434 3300039438 Bacteria 2196
759 Ga0436361_0801307 3300039447 Bacteria 4305
760 Ga0436361_1163181 3300039447 Bacteria 14246
761 Ga0439465_0038957 3300041413 Bacteria 1533
762 Ga0439465_0055851 3300041413 Bacteria 1301
763 Ga0451789_0629811 3300041443 Bacteria 798
764 Ga0451797_1353463 3300041453 Bacteria 646
765 Ga0451798_0069368 3300041458 Bacteria 907
766 Ga0451807_0902416 3300041486 Bacteria 1051
767 Ga0451851_0114126 3300041507 Bacteria 852
768 Ga0451853_3174467 3300041512 Bacteria 1241
769 Ga0439431_0000841 3300041997 Bacteria 6623
770 Ga0439432_018117 3300042006 Bacteria 2357
771 Ga0439432_040088 3300042006 Bacteria 1486
772 Ga0450898_014475 3300042134 Bacteria 1326
773 Ga0439446_0106998 3300042156 Bacteria 889
774 Ga0439434_0144558 3300042435 Bacteria 785
775 Ga0466966_0000475 3300044684 Bacteria 25816
776 Ga0466966_0061644 3300044684 Bacteria 2365
777 Ga0466963_0124046 3300044694 Bacteria 1779
778 Ga0466963_0625696 3300044694 Bacteria 760
779 Ga0453684_0666023 3300044712 Bacteria 1134
780 Ga0466968_0043092 3300044735 Bacteria 1909
781 Ga0466957_0047741 3300044842 Bacteria 2602
782 Ga0466959_0153908 3300045049 Bacteria 1619
783 Ga0451576_0001042 3300045051 Bacteria 51034
784 Ga0451576_0088783 3300045051 Bacteria 3215
785 Ga0466958_0108292 3300045836 Bacteria 1733
786 Ga0466958_0329069 3300045836 Bacteria 982
787 Ga0466967_0046160 3300045976 Bacteria 3791
788 Ga0466967_0676265 3300045976 Bacteria 1022
789 Ga0495617_103906 3300046452 Bacteria 922
790 Ga0495592_0008544 3300046454 Bacteria 7688
791 Ga0495603_0103882 3300046455 Bacteria 1658
792 Ga0495603_0108862 3300046455 Bacteria 1617
793 Ga0495590_0023918 3300046457 Bacteria 2154
794 Ga0495590_0158092 3300046457 Bacteria 823
795 Ga0495629_0278114 3300046459 Bacteria 1149
796 Ga0495638_0308680 3300046460 Bacteria 850
797 Ga0495638_0447268 3300046460 Bacteria 660
798 Ga0495650_0000477 3300046471 Bacteria 61376
799 Ga0495650_0078436 3300046471 Bacteria 1279
800 Ga0495650_0216154 3300046471 Bacteria 662
801 Ga0495605_0000044 3300046474 Bacteria 182513
802 Ga0495605_0156443 3300046474 Bacteria 1013
803 Ga0495585_0005634 3300046492 Bacteria 7865
804 Ga0495585_0026097 3300046492 Bacteria 3339
805 Ga0495585_0077078 3300046492 Bacteria 1810
806 Ga0495585_0105655 3300046492 Bacteria 1502
807 Ga0495585_0221216 3300046492 Bacteria 955
808 Ga0495594_0279137 3300046499 Bacteria 952
809 Ga0495607_0000848 3300046501 Bacteria 28875
810 Ga0495607_0009421 3300046501 Bacteria 6610
811 Ga0495583_0000088 3300046506 Bacteria 164073
812 Ga0495583_0089874 3300046506 Bacteria 1324
813 Ga0495606_0000229 3300046507 Bacteria 98732
814 Ga0495606_0006591 3300046507 Bacteria 10672
815 Ga0495606_0069770 3300046507 Bacteria 2219
816 Ga0495610_0002508 3300046512 Bacteria 15338
817 Ga0495610_0006414 3300046512 Bacteria 8099
818 Ga0495610_0016863 3300046512 Bacteria 4185
819 Ga0495610_0027737 3300046512 Bacteria 3004
820 Ga0495610_0104615 3300046512 Bacteria 1263
821 Ga0495616_0077295 3300046513 Bacteria 1598
822 Ga0495616_0158945 3300046513 Bacteria 1018
823 Ga0495620_0001648 3300046515 Bacteria 13208
824 Ga0495620_0092301 3300046515 Bacteria 1214
825 Ga0495630_0354963 3300046517 Bacteria 1122
826 Ga0495631_0000034 3300046518 Bacteria 84600
827 Ga0495643_0004238 3300046522 Bacteria 10140
828 Ga0495643_0006252 3300046522 Bacteria 7891
829 Ga0495643_0152848 3300046522 Bacteria 1141
830 Ga0495643_0238440 3300046522 Bacteria 854
831 Ga0495643_0240185 3300046522 Bacteria 850
832 Ga0495648_0002013 3300046524 Bacteria 19260
833 Ga0495666_0026830 3300046526 Bacteria 2836
834 Ga0495642_0052569 3300046528 Bacteria 1678
835 Ga0495598_0034946 3300046537 Bacteria 1436
836 Ga0495621_0026373 3300046539 Bacteria 1960
837 Ga0495621_0029975 3300046539 Bacteria 1857
838 Ga0495621_0135537 3300046539 Bacteria 960
839 Ga0495622_0013020 3300046557 Bacteria 3860
840 Ga0495633_0004820 3300046558 Bacteria 8461
841 Ga0495656_0032634 3300046615 Bacteria 2120
842 Ga0495668_0000118 3300046616 Bacteria 119439
843 Ga0495668_0006680 3300046616 Bacteria 7510
844 Ga0495668_0053682 3300046616 Bacteria 2228
845 Ga0495668_0141183 3300046616 Bacteria 1318
846 Ga0495611_0000017 3300046648 Bacteria 128087
847 Ga0495625_0079431 3300046660 Bacteria 2287
848 Ga0495625_0372139 3300046660 Bacteria 898
849 Ga0495625_0538709 3300046660 Bacteria 708
850 Ga0495635_0254938 3300046663 Bacteria 1182
851 Ga0495659_0090722 3300046664 Bacteria 1173
852 Ga0495588_0000099 3300046674 Bacteria 164015
853 Ga0495669_0002213 3300046684 Bacteria 7982
854 Ga0495624_0461184 3300046690 Bacteria 761
855 Ga0495670_0031106 3300046691 Bacteria 2652
856 Ga0495671_0029695 3300046692 Bacteria 2804
857 Ga0495660_0078932 3300046810 Bacteria 1729
858 Ga0495581_0245392 3300047315 Bacteria 1047
859 Ga0495636_0013436 3300047318 Bacteria 3250
860 Ga0495636_0045863 3300047318 Bacteria 1822
861 Ga0495672_0000021 3300047320 Bacteria 422795
862 Ga0495672_0000079 3300047320 Bacteria 161885
863 Ga0495672_0021922 3300047320 Bacteria 4160
864 Ga0495672_0087013 3300047320 Bacteria 1726
865 Ga0495672_0106030 3300047320 Bacteria 1516
866 Ga0495672_0258478 3300047320 Bacteria 842
867 Ga0495683_0090294 3300047323 Bacteria 1485
868 Ga0495683_0139742 3300047323 Bacteria 1136
869 Ga0495679_091342 3300047446 Bacteria 854
870 Ga0495685_109045 3300047447 Bacteria 912
871 Ga0495673_0000024 3300047469 Bacteria 521349
872 Ga0495673_0000030 3300047469 Bacteria 468915
873 Ga0495673_0116076 3300047469 Bacteria 1064
874 Ga0495673_0142974 3300047469 Bacteria 931
875 Ga0495686_0007958 3300047472 Bacteria 7865
876 Ga0495686_0041753 3300047472 Bacteria 2919
877 Ga0495686_0366195 3300047472 Bacteria 780
878 Ga0495626_0001155 3300048091 Bacteria 22059
879 Ga0495626_0263885 3300048091 Bacteria 688
880 Ga0496100_0021799 3300048903 Bacteria 3865
881 Ga0496101_0514377 3300048904 Bacteria 946
882 Ga0496102_0001905 3300048905 Bacteria 17998
883 Ga0496102_0010957 3300048905 Bacteria 7811
884 Ga0496102_0116475 3300048905 Bacteria 2494
885 Ga0496102_0383054 3300048905 Bacteria 1323
886 Ga0496102_0572921 3300048905 Bacteria 1052
887 Ga0496102_0866934 3300048905 Bacteria 825
888 Ga0496103_0009452 3300048906 Bacteria 5773
889 Ga0496104_0014540 3300048907 Bacteria 7109
890 Ga0496104_0120097 3300048907 Bacteria 2523
891 Ga0496104_0526604 3300048907 Bacteria 1093
892 Ga0496105_0013537 3300048908 Bacteria 6480
893 Ga0496105_0764166 3300048908 Bacteria 737
894 Ga0496105_0777309 3300048908 Bacteria 730
895 Ga0496106_0009896 3300048909 Bacteria 7039
896 Ga0496106_0061640 3300048909 Bacteria 2846
897 Ga0496106_0471881 3300048909 Bacteria 1008
898 Ga0496107_0020354 3300048910 Bacteria 4685
899 Ga0496107_0040743 3300048910 Bacteria 3335
900 Ga0496107_0064878 3300048910 Bacteria 2647
901 Ga0496107_0309233 3300048910 Bacteria 1176
902 Ga0496107_0329060 3300048910 Bacteria 1137
903 Ga0496108_0034386 3300048911 Bacteria 4211
904 Ga0496108_0047915 3300048911 Bacteria 3573
905 Ga0496108_0050962 3300048911 Bacteria 3467
906 Ga0496108_0372899 3300048911 Bacteria 1246
907 Ga0496108_0835152 3300048911 Bacteria 793
908 Ga0496109_0082698 3300048912 Bacteria 2959
909 Ga0496109_0120495 3300048912 Bacteria 2444
910 Ga0496109_0177110 3300048912 Bacteria 2002
911 Ga0496110_0211017 3300048913 Bacteria 1765
912 Ga0496111_0067136 3300048914 Bacteria 2605
913 Ga0496111_0101823 3300048914 Bacteria 2110
914 Ga0496111_0309633 3300048914 Bacteria 1170
915 Ga0496112_0001802 3300048915 Bacteria 16862
916 Ga0496112_0052086 3300048915 Bacteria 4016
917 Ga0496112_0432707 3300048915 Bacteria 1254
918 Ga0496113_0086146 3300048916 Bacteria 2414
919 Ga0496113_0102149 3300048916 Bacteria 2223
920 Ga0496113_0753936 3300048916 Bacteria 775
921 Ga0496114_0138207 3300048917 Bacteria 2107
922 Ga0496114_0280104 3300048917 Bacteria 1470
923 Ga0496115_0000295 3300048918 Bacteria 42998
924 Ga0496115_0203872 3300048918 Bacteria 1634
925 Ga0496117_0130115 3300048920 Bacteria 1527
926 Ga0496117_0300098 3300048920 Bacteria 851
927 Ga0496118_0131491 3300048921 Bacteria 1606
928 Ga0496118_0139362 3300048921 Bacteria 1541
929 Ga0496121_0003702 3300048924 Bacteria 21459
930 Ga0496121_0082694 3300048924 Bacteria 2537
931 Ga0496121_0302974 3300048924 Bacteria 1083
932 Ga0496121_0462383 3300048924 Bacteria 815
933 Ga0496122_0140949 3300048925 Bacteria 1508
934 Ga0496123_0158430 3300048926 Bacteria 1210
935 Ga0496124_0033172 3300048927 Bacteria 4545
936 Ga0496124_0035157 3300048927 Bacteria 4387
937 Ga0496124_0091593 3300048927 Bacteria 2477
938 Ga0496124_0133963 3300048927 Bacteria 1964
939 Ga0496125_0213885 3300048928 Bacteria 1249
940 Ga0496125_0277585 3300048928 Bacteria 1040
941 Ga0496126_0056218 3300048929 Bacteria 3558
942 Ga0496126_0396373 3300048929 Bacteria 1120
943 Ga0496126_0507797 3300048929 Bacteria 962
944 Ga0495678_000304 3300049459 Bacteria 53274
945 Ga0495678_086855 3300049459 Bacteria 1111
946 Ga0501034_0805293 3300049571 Bacteria 832
947 Ga0501036_0214528 3300049572 Bacteria 1617
948 Ga0501038_0125782 3300049574 Bacteria 2110
949 Ga0501039_0172792 3300049575 Bacteria 1699
950 Ga0501039_0401824 3300049575 Bacteria 1076
951 Ga0501040_0004633 3300049576 Bacteria 8922
952 Ga0501042_0050476 3300049578 Bacteria 2967
953 Ga0501042_0295689 3300049578 Bacteria 1170
954 Ga0501043_0554782 3300049579 Bacteria 853
955 Ga0501048_0014061 3300049582 Bacteria 5932
956 Ga0501067_0058336 3300049583 Bacteria 2138
957 Ga0501068_0110697 3300049584 Bacteria 1707
958 Ga0501071_0045517 3300049587 Bacteria 3150
959 Ga0501071_0434968 3300049587 Bacteria 1003
960 Ga0501072_0406133 3300049588 Bacteria 1080
961 Ga0501074_0283667 3300049590 Bacteria 1177
962 Ga0501075_0557659 3300049591 Bacteria 874
963 Ga0501076_0932464 3300049592 Bacteria 716
964 Ga0501216_038105 3300049660 Bacteria 911
965 Ga0501229_013874 3300049706 Bacteria 1036
966 Ga0501079_0120218 3300049741 Bacteria 2043
967 Ga0501080_0016546 3300049742 Bacteria 6814
968 Ga0501081_0067829 3300049743 Bacteria 2483
969 Ga0501262_016230 3300049759 Bacteria 984
970 Ga0501265_010433 3300049762 Bacteria 1134
971 Ga0501044_0775254 3300049823 Bacteria 840
972 nmdc:mga03683_114812_c1 3300050489 Bacteria 1193
973 nmdc:mga03n38_215760_c1 3300050490 Bacteria 999
974 nmdc:mga03n38_7482_c1 3300050490 Bacteria 3868
975 nmdc:mga00v17_340881_c1 3300050491 Bacteria 974
976 nmdc:mga00v17_445548_c1 3300050491 Bacteria 841
977 nmdc:mga0yw44_116949_c1 3300050492 Bacteria 1714
978 nmdc:mga0yw44_177427_c1 3300050492 Bacteria 1401
979 nmdc:mga0yw44_311267_c1 3300050492 Bacteria 1056
980 nmdc:mga06z11_298060_c1 3300050494 Bacteria 958
981 nmdc:mga06z11_328741_c1 3300050494 Bacteria 913
982 nmdc:mga06z11_72334_c1 3300050494 Bacteria 1828
983 nmdc:mga04h51_55663_c1 3300050495 Bacteria 1340
984 nmdc:mga07m45_156605_c1 3300050496 Bacteria 1322
985 nmdc:mga05p37_134216_c1 3300050507 Bacteria 3036
986 nmdc:mga05p37_191374_c1 3300050507 Bacteria 2483
987 nmdc:mga05p37_209_c1 3300050507 Bacteria 59030
988 nmdc:mga05p37_38529_c1 3300050507 Bacteria 5863
989 nmdc:mga05p37_615236_c1 3300050507 Bacteria 1223
990 nmdc:mga09592_150_c1 3300050508 Bacteria 47613
991 nmdc:mga09592_163437_c1 3300050508 Bacteria 1924
992 nmdc:mga09592_4737_c1 3300050508 Bacteria 11019
993 nmdc:mga09592_581494_c1 3300050508 Bacteria 960
994 nmdc:mga0qj67_131328_c1 3300050509 Bacteria 2029
995 nmdc:mga0qj67_135084_c1 3300050509 Bacteria 1999
996 nmdc:mga0qj67_452189_c1 3300050509 Bacteria 1035
997 nmdc:mga06r32_14895_c1 3300050510 Bacteria 7056
998 nmdc:mga06r32_252374_c1 3300050510 Bacteria 1752
999 nmdc:mga08y16_135314_c1 3300050511 Bacteria 2561
1000 nmdc:mga08y16_38103_c1 3300050511 Bacteria 5048
1001 nmdc:mga08y16_66743_c1 3300050511 Bacteria 3755
1002 nmdc:mga08y16_7676_c1 3300050511 Bacteria 11291
1003 nmdc:mga0n895_156526_c1 3300050512 Bacteria 2309
1004 nmdc:mga0n895_923700_c1 3300050512 Bacteria 857
1005 nmdc:mga0rr50_80679_c1 3300050513 Bacteria 2509
1006 nmdc:mga0rr50_818697_c1 3300050513 Bacteria 794
1007 nmdc:mga08x19_22166_c1 3300050514 Bacteria 3931
1008 nmdc:mga08x19_39288_c1 3300050514 Bacteria 3008
1009 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
1010 nmdc:mga08x19_610179_c1 3300050514 Bacteria 773
1011 nmdc:mga0sz30_292640_c1 3300050516 Bacteria 726
1012 Ga0500643_062941 3300053087 Bacteria 1039
1013 Ga0500583_0127671 3300053092 Bacteria 1260
1014 Ga0500566_0278844 3300053094 Bacteria 797
1015 Ga0500641_0127854 3300053096 Bacteria 1096
1016 Ga0500554_035556 3300053102 Bacteria 1499
1017 Ga0500572_017424 3300053111 Bacteria 1845
1018 Ga0500572_072164 3300053111 Bacteria 1069
1019 Ga0500595_002541 3300053119 Bacteria 8942
1020 Ga0500595_012296 3300053119 Bacteria 3316
1021 Ga0500595_111956 3300053119 Bacteria 775
1022 Ga0500608_233487 3300053122 Bacteria 732
1023 Ga0500655_016684 3300053133 Bacteria 1354
1024 Ga0500559_0004336 3300053136 Bacteria 6764
1025 Ga0500574_081549 3300053141 Bacteria 954
1026 Ga0500586_011368 3300053145 Bacteria 2547
1027 Ga0500603_029207 3300053150 Bacteria 1412
1028 Ga0500620_011225 3300053155 Bacteria 2394
1029 Ga0500638_155261 3300053162 Bacteria 1013
1030 Ga0500639_033994 3300053163 Bacteria 2694
1031 Ga0500636_0007802 3300053177 Bacteria 6190
1032 Ga0500637_0088589 3300053178 Bacteria 1790
1033 Ga0500661_040282 3300055283 Bacteria 827
1034 Ga0590071_011723 3300059421 Bacteria 2051
1035 Ga0466962_0017422 3300061719 Bacteria 3458
1036 Ga0530510_0771974 3300061734 Bacteria 733
1037 2513657470 2513237096 Bacteria 8722461
1038 2513861202 2513237137 Bacteria 9558895
1039 2513916723 2513237145 Bacteria 8979722
1040 2517889630 2517572143 Bacteria 9484767
1041 2524533200 2524023228 Bacteria 10118060
1042 2644337844 2643221660 Bacteria 4208257
1043 2671119482 2667528175 Bacteria 7532676
1044 2793084093
1045 2857554220 2857553236 Bacteria 6166726
1046 2857559826 2857558681 Bacteria 6617694
1047 2857564991 2857564685 Bacteria 6290584
1048 2876811102 2876808645 Bacteria 8824342
1049 2879116994 2879110137 Bacteria 8907982
1050 2889036407 2889033259 Bacteria 9099371
1051 2903756083 2903748898 Bacteria 9972761
1052 2904707614
1053 2906614608
1054 2906642087 2906635258 Bacteria 8601019
1055 2906666467 2906660503 Bacteria 8595048
1056 2908746570 2908739725 Bacteria 8628932
1057 2922366717 2922361189 Bacteria 7436256
1058 2922389379 2922386360 Bacteria 7017218
1059 2922426469
1060 2935632810 2935630451 Bacteria 8169952
1061 2939592420 2939589442 Bacteria 4214238
1062 2939636090 2939631187 Bacteria 6118131
1063 2941508526 2941507105 Bacteria 8166816
1064 2941516356 2941515067 Bacteria 8166720
1065 2941524628 2941523033 Bacteria 8169134
1066 2974310226 2974307012 Bacteria 4172388
1067 2977250952 2977247770 Bacteria 4160543
1068 2984514554 2984514374 Bacteria 4172479
1069 3005475811 3005474847 Bacteria 9259049
1070 8006937128 8006933436 Bacteria 10410654
1071 8006977138 8006973647 Bacteria 10679141
1072 8006993125 8006984368 Bacteria 9651211
1073 8019561531 8019555841 Bacteria 9642137
1074 8019571607 8019565922 Bacteria 9639779
1075 8056678165 8056673599 Bacteria 7871253
1076 8056683444 8056681323 Bacteria 8472857
1077 Ga0075365_10197273
1078 JGI24751J29686_10022294
1079 JGI25150J39212_1000628
1080 JGI25406J46586_10023564
1081 JGI25153J46596_10001338
1082 rootL2_10033244
1083 rootL2_10133234
1084 Ga0055526_1000198
1085 Ga0055526_1000218
1086 Ga0055526_1003042
1087 Ga0055537_1000790
1088 Ga0055534_1000180
1089 Ga0055528_1000262
1090 Ga0055530_10009923
1091 Ga0055530_10052351
1092 Ga0055530_10062741
1093 Ga0055540_1016176
1094 Ga0055540_1023639
1095 Ga0065715_10022737
1096 Ga0065707_10288654
1097 Ga0070658_10054218
1098 Ga0070658_10066192
1099 Ga0070658_10490996
1100 Ga0070676_10086765
1101 Ga0070676_10217250
1102 Ga0070683_100134544
1103 Ga0070683_100263427
1104 Ga0070683_100874374
1105 Ga0070670_100120456
1106 Ga0070670_100243204
1107 Ga0070677_10002466
1108 Ga0070677_10255665
1109 Ga0068869_100000108
1110 Ga0068869_100020312
1111 Ga0068869_100028565
1112 Ga0068869_100049825
1113 Ga0068869_100110247
1114 Ga0070666_10038220
1115 Ga0070666_10331269
1116 Ga0070666_10563692
1117 Ga0070680_100247583
1118 Ga0070680_100543169
1119 Ga0070682_100107660
1120 Ga0070682_100135317
1121 Ga0070682_100636601
1122 Ga0068868_100056259
1123 Ga0068868_100063616
1124 Ga0068868_100111191
1125 Ga0068868_100148026
1126 Ga0068868_100286347
1127 Ga0070660_100005400
1128 Ga0070660_100012123
1129 Ga0070660_100178680
1130 Ga0070689_100114572
1131 Ga0070687_100413572
1132 Ga0070661_100006353
1133 Ga0070661_100007131
1134 Ga0070661_100057780
1135 Ga0070661_100430512
1136 Ga0070692_10060812
1137 Ga0070692_10167276
1138 Ga0070668_100016851
1139 Ga0070668_100018823
1140 Ga0070668_100025885
1141 Ga0070668_100031665
1142 Ga0070668_100090578
1143 Ga0070668_100094000
1144 Ga0070668_100120049
1145 Ga0070668_100224242
1146 Ga0070669_100013057
1147 Ga0070669_100028863
1148 Ga0070669_100088425
1149 Ga0070669_100133174
1150 Ga0070669_100222466
1151 Ga0070669_100308067
1152 Ga0070669_100391885
1153 Ga0070669_100655948
1154 Ga0070675_100084625
1155 Ga0070675_100234544
1156 Ga0070675_100321954
1157 Ga0070675_100344366
1158 Ga0070675_100348051
1159 Ga0070675_100420827
1160 Ga0070671_100007885
1161 Ga0070671_100385010
1162 Ga0070671_100458067
1163 Ga0070671_100524851
1164 Ga0070674_100019883
1165 Ga0070674_100021123
1166 Ga0070674_100022113
1167 Ga0070674_100030839
1168 Ga0070674_100139236
1169 Ga0070674_100193973
1170 Ga0070673_100162386
1171 Ga0070673_100239533
1172 Ga0070673_100513294
1173 Ga0070673_100747066
1174 Ga0070688_100020439
1175 Ga0070688_100283626
1176 Ga0070659_100001088
1177 Ga0070659_100022667
1178 Ga0070659_100092659
1179 Ga0070659_100243227
1180 Ga0070659_100320829
1181 Ga0070659_100343157
1182 Ga0070667_100041022
1183 Ga0070667_100059966
1184 Ga0070667_100174002
1185 Ga0070667_100533825
1186 Ga0070667_100819341
1187 Ga0070703_10164315
1188 Ga0070709_10189103
1189 Ga0070714_100081392
1190 Ga0070713_100824998
1191 Ga0070701_10059957
1192 Ga0070701_10129129
1193 Ga0070711_100088699
1194 Ga0070711_100156253
1195 Ga0070705_100050412
1196 Ga0070705_100141440
1197 Ga0070705_100649683
1198 Ga0070700_100003206
1199 Ga0070700_100413556
1200 Ga0070694_100011084
1201 Ga0070694_100059684
1202 Ga0070694_100452485
1203 Ga0070708_100058166
1204 Ga0070708_100248456
1205 Ga0070663_100025065
1206 Ga0070663_100040343
1207 Ga0070663_100125775
1208 Ga0070663_100189959
1209 Ga0070663_100203418
1210 Ga0070663_100387388
1211 Ga0070663_100700897
1212 Ga0070678_100027111
1213 Ga0070678_100171756
1214 Ga0070678_100201052
1215 Ga0070678_100335735
1216 Ga0070662_100000134
1217 Ga0070662_100095159
1218 Ga0070681_10532994
1219 Ga0068867_100000126
1220 Ga0068867_100009464
1221 Ga0068867_100121493
1222 Ga0068867_100157700
1223 Ga0068867_100175113
1224 Ga0068867_100313851
1225 Ga0068867_100432244
1226 Ga0070685_10098733
1227 Ga0070706_100030612
1228 Ga0070707_100040082
1229 Ga0070699_100003308
1230 Ga0070699_100045054
1231 Ga0070699_100687793
1232 Ga0070679_100012228
1233 Ga0070679_100195222
1234 Ga0070679_100348458
1235 Ga0070684_100033871
1236 Ga0070684_100138955
1237 Ga0070697_100015469
1238 Ga0068853_100000458
1239 Ga0068853_100121596
1240 Ga0068853_100688275
1241 Ga0070672_100045716
1242 Ga0070672_100090790
1243 Ga0070672_100106878
1244 Ga0070672_100275045
1245 Ga0070672_100296559
1246 Ga0070686_100208741
1247 Ga0070686_100527002
1248 Ga0070695_100002348
1249 Ga0070695_100188331
1250 Ga0070696_100001808
1251 Ga0070693_100055156
1252 Ga0070665_100018469
1253 Ga0070665_100031980
1254 Ga0070665_100063857
1255 Ga0070665_100348152
1256 Ga0070665_100504053
1257 Ga0070704_100001833
1258 Ga0070704_100073317
1259 Ga0070704_100175710
1260 Ga0070704_100385774
1261 Ga0068855_100001419
1262 Ga0068855_100127510
1263 Ga0068855_100159333
1264 Ga0068855_100187278
1265 Ga0068855_100314928
1266 Ga0068855_100834500
1267 Ga0070664_100022570
1268 Ga0070664_100029120
1269 Ga0070664_100045817
1270 Ga0070664_100095464
1271 Ga0070664_100250675
1272 Ga0070664_100744052
1273 Ga0068857_100090614
1274 Ga0068857_100114401
1275 Ga0068857_101208364
1276 Ga0068854_100024108
1277 Ga0068854_100276410
1278 Ga0068854_100674803
1279 Ga0068856_100000265
1280 Ga0068856_100208376
1281 Ga0068856_100572465
1282 Ga0070702_100021708
1283 Ga0070702_100309967
1284 Ga0070702_100476993
1285 Ga0068852_100197004
1286 Ga0068852_100242791
1287 Ga0068852_100297249
1288 Ga0068852_100505901
1289 Ga0068859_100087220
1290 Ga0068859_100107772
1291 Ga0068859_100241030
1292 Ga0068859_100517306
1293 Ga0068859_100582057
1294 Ga0068864_100015296
1295 Ga0068864_100102798
1296 Ga0068864_100113505
1297 Ga0068866_10033930
1298 Ga0068866_10062661
1299 Ga0068866_10109947
1300 Ga0068866_10277517
1301 Ga0068861_100000134
1302 Ga0068861_100024453
1303 Ga0068861_100026946
1304 Ga0068861_100040936
1305 Ga0068861_100073614
1306 Ga0068861_100179829
1307 Ga0068861_100245590
1308 Ga0068861_100531090
1309 Ga0068861_100676169
1310 Ga0068851_10009081
1311 Ga0068851_10038811
1312 Ga0068851_10043848
1313 Ga0068863_100127597
1314 Ga0068863_100509264
1315 Ga0068863_100523160
1316 Ga0068863_100684032
1317 Ga0068858_100004830
1318 Ga0068858_100033213
1319 Ga0068858_100114315
1320 Ga0068858_100360429
1321 Ga0068858_100515963
1322 Ga0068858_100561099
1323 Ga0068860_100024360
1324 Ga0068860_100056905
1325 Ga0068860_100109845
1326 Ga0068860_100313172
1327 Ga0068860_100314642
1328 Ga0068860_100323708
1329 Ga0068860_100361394
1330 Ga0068860_100457368
1331 Ga0068860_101247787
1332 Ga0068862_100001111
1333 Ga0068862_100031836
1334 Ga0068862_100157649
1335 Ga0068862_100486919
1336 Ga0068862_100619419
1337 Ga0068862_100806479
1338 Ga0068862_100962104
1339 Ga0081455_10011490
1340 Ga0081455_10013541
1341 Ga0081455_10160337
1342 Ga0081540_1002758
1343 Ga0081540_1011235
1344 Ga0081540_1011459
1345 Ga0081540_1027454
1346 Ga0081540_1028410
1347 Ga0081540_1035676
1348 Ga0081540_1068810
1349 Ga0081540_1071970
1350 Ga0081540_1120933
1351 Ga0081539_10000157
1352 Ga0081539_10004364
1353 Ga0081539_10013206
1354 Ga0081539_10047257
1355 Ga0075365_10035982
1356 Ga0075365_10391628
1357 Ga0075368_10026128
1358 Ga0075368_10066870
1359 Ga0075368_10072890
1360 Ga0075363_100005124
1361 Ga0075363_100273555
1362 Ga0075364_10039828
1363 Ga0075364_10255648
1364 Ga0070712_100242081
1365 Ga0075367_10021040
1366 Ga0075367_10039085
1367 Ga0075367_10148621
1368 Ga0075367_10169285
1369 Ga0075367_10202034
1370 Ga0075367_10360377
1371 Ga0075367_10390709
1372 Ga0075369_10210627
1373 Ga0075366_10072746
1374 Ga0097621_100104530
1375 Ga0097621_100373255
1376 Ga0075370_10050352
1377 Ga0075370_10402949
1378 Ga0068871_100449357
1379 Ga0075428_100017818
1380 Ga0075428_100211597
1381 Ga0075428_100354924
1382 Ga0075430_100084363
1383 Ga0075430_100670677
1384 Ga0075431_100018399
1385 Ga0075431_100131935
1386 Ga0075434_100201802
1387 Ga0075429_100010239
1388 Ga0075429_100110711
1389 Ga0068865_100034493
1390 Ga0068865_100183572
1391 Ga0075436_100000050
1392 Ga0075436_100005257
1393 Ga0075436_100007947
1394 Ga0075436_100609756
1395 Ga0097620_100087224
1396 Ga0097620_100107770
1397 Ga0097620_100241038
1398 Ga0097620_100517361
1399 Ga0097620_100582117
1400 Ga0075435_100041256
1401 Ga0075435_100396203
1402 Ga0075435_100495687
1403 Ga0099794_10109280
1404 Ga0099794_10142775
1405 Ga0099794_10302669
1406 Ga0105251_10001824
1407 Ga0105250_10167931
1408 Ga0105240_10118311
1409 Ga0111539_10040711
1410 Ga0111539_10055286
1411 Ga0111539_10061749
1412 Ga0111539_11050481
1413 Ga0111539_11304903
1414 Ga0105245_10054214
1415 Ga0105245_10374427
1416 Ga0105245_10447229
1417 Ga0105245_10832374
1418 Ga0105247_10047736
1419 Ga0105247_10470944
1420 Ga0114129_10044616
1421 Ga0114129_10067343
1422 Ga0114129_10238075
1423 Ga0114129_10401408
1424 Ga0114129_10578970
1425 Ga0114129_11219193
1426 Ga0105243_10006474
1427 Ga0105243_10345664
1428 Ga0105243_10413347
1429 Ga0105243_10443059
1430 Ga0105243_10500450
1431 Ga0105241_10587787
1432 Ga0105242_10332109
1433 Ga0105248_10002088
1434 Ga0105248_10015422
1435 Ga0105248_10458614
1436 Ga0105248_10680063
1437 Ga0105248_10822032
1438 Ga0105237_10097698
1439 Ga0105238_10016932
1440 Ga0105238_10260559
1441 Ga0105249_10002649
1442 Ga0105249_10129691
1443 Ga0105249_10221304
1444 Ga0105249_10396731
1445 Ga0105239_10099207
1446 Ga0105239_10215173
1447 Ga0105239_10393950
1448 Ga0105246_10063209
1449 Ga0105246_10105982
1450 Ga0157373_10000321
1451 Ga0157373_10267352
1452 Ga0157371_10000470
1453 Ga0157371_10286158
1454 Ga0157370_10134702
1455 Ga0157369_10005334
1456 Ga0157369_10140396
1457 Ga0157374_10044934
1458 Ga0157374_10385845
1459 Ga0157378_10112524
1460 Ga0157378_10132465
1461 Ga0157378_10454995
1462 Ga0157378_10458435
1463 Ga0157378_10659067
1464 Ga0157378_11374209
1465 Ga0163162_10046096
1466 Ga0163162_10086573
1467 Ga0163162_10265511
1468 Ga0163162_10289386
1469 Ga0163162_10460020
1470 Ga0163162_10616796
1471 Ga0163162_10802183
1472 Ga0163162_10840522
1473 Ga0157372_10002397
1474 Ga0157372_10095119
1475 Ga0157372_10142657
1476 Ga0157372_11439873
1477 Ga0157375_10036786
1478 Ga0157375_10183962
1479 Ga0157375_10326989
1480 Ga0157375_10487970
1481 Ga0157375_10982671
1482 Ga0157375_11110484
1483 Ga0157375_11184038
1484 Ga0163163_10017844
1485 Ga0163163_10027486
1486 Ga0163163_10044736
1487 Ga0163163_10142783
1488 Ga0163163_10734283
1489 Ga0157380_10010659
1490 Ga0157380_10047964
1491 Ga0157380_10285848
1492 Ga0157380_11050571
1493 Ga0182008_10029051
1494 Ga0157377_10004959
1495 Ga0157377_10267338
1496 Ga0157379_10337136
1497 Ga0157376_10222397
1498 Ga0182006_1039545
1499 Ga0163161_10122635
1500 Ga0163161_10338769
1501 Ga0213876_10029473
1502 Ga0207425_1000522
1503 Ga0209677_100599
1504 Ga0209129_1000225
1505 Ga0209233_1000907
1506 Ga0209233_1003339
1507 Ga0209565_1000037
1508 Ga0207666_1003363
1509 Ga0209455_1009913
1510 Ga0209673_1000032
1511 Ga0207673_1003898
1512 Ga0209675_1000020
1513 Ga0209564_1000009
1514 Ga0209564_1000196
1515 Ga0209564_1000951
1516 Ga0209758_1000181
1517 Ga0209758_1009611
1518 Ga0209758_1020987
1519 Ga0209050_1022660
1520 Ga0209051_1006158
1521 Ga0209051_1015429
1522 Ga0209257_1000734
1523 Ga0209257_1020408
1524 Ga0207697_10000319
1525 Ga0207656_10004660
1526 Ga0207656_10037161
1527 Ga0207656_10063131
1528 Ga0207656_10107453
1529 Ga0207682_10002499
1530 Ga0207682_10068966
1531 Ga0207692_10255021
1532 Ga0207642_10005842
1533 Ga0207642_10103452
1534 Ga0207642_10181398
1535 Ga0207710_10027753
1536 Ga0207710_10095267
1537 Ga0207688_10070330
1538 Ga0207688_10080120
1539 Ga0207688_10097818
1540 Ga0207688_10382543
1541 Ga0207680_10048128
1542 Ga0207647_10267701
1543 Ga0207645_10007023
1544 Ga0207645_10012159
1545 Ga0207645_10257223
1546 Ga0207643_10000851
1547 Ga0207643_10040929
1548 Ga0207643_10229710
1549 Ga0207684_10592652
1550 Ga0207671_10083591
1551 Ga0207693_10141032
1552 Ga0207660_10051862
1553 Ga0207660_10172306
1554 Ga0207660_10618110
1555 Ga0207660_10806114
1556 Ga0207662_10111056
1557 Ga0207657_10006415
1558 Ga0207657_10008703
1559 Ga0207657_10022789
1560 Ga0207657_10121263
1561 Ga0207657_10219851
1562 Ga0207649_10005458
1563 Ga0207649_10006859
1564 Ga0207649_10096792
1565 Ga0207649_10114007
1566 Ga0207649_10205770
1567 Ga0207649_10227157
1568 Ga0207652_10300551
1569 Ga0207652_10674951
1570 Ga0207646_10054665
1571 Ga0207681_10002154
1572 Ga0207681_10041742
1573 Ga0207681_10066301
1574 Ga0207681_10101154
1575 Ga0207681_10103646
1576 Ga0207681_10169607
1577 Ga0207681_10606554
1578 Ga0207681_10633660
1579 Ga0207694_10055347
1580 Ga0207694_10131224
1581 Ga0207650_10006975
1582 Ga0207650_10010136
1583 Ga0207650_10384759
1584 Ga0207659_10003749
1585 Ga0207659_10356410
1586 Ga0207659_10988984
1587 Ga0207687_10017108
1588 Ga0207687_10093590
1589 Ga0207687_10185053
1590 Ga0207700_11049110
1591 Ga0207644_10000862
1592 Ga0207644_10055712
1593 Ga0207644_10087820
1594 Ga0207644_10098036
1595 Ga0207644_10207115
1596 Ga0207644_10477820
1597 Ga0207690_10000395
1598 Ga0207690_10167015
1599 Ga0207690_10180307
1600 Ga0207690_10328689
1601 Ga0207706_10000002
1602 Ga0207706_10007913
1603 Ga0207706_10058409
1604 Ga0207706_10105624
1605 Ga0207706_10168439
1606 Ga0207706_10287886
1607 Ga0207709_10005402
1608 Ga0207709_10036410
1609 Ga0207709_10507525
1610 Ga0207670_10007127
1611 Ga0207670_10131084
1612 Ga0207670_10159586
1613 Ga0207670_10164935
1614 Ga0207669_10012524
1615 Ga0207669_10045048
1616 Ga0207669_10056736
1617 Ga0207669_10082542
1618 Ga0207704_10000660
1619 Ga0207704_10138428
1620 Ga0207704_10333405
1621 Ga0207691_10009804
1622 Ga0207691_10040936
1623 Ga0207691_10051529
1624 Ga0207691_10105080
1625 Ga0207691_10175832
1626 Ga0207691_10298495
1627 Ga0207691_10376512
1628 Ga0207691_10383367
1629 Ga0207691_10857830
1630 Ga0207711_10339234
1631 Ga0207711_10472558
1632 Ga0207711_10543838
1633 Ga0207689_10000030
1634 Ga0207689_10002080
1635 Ga0207689_10159972
1636 Ga0207689_10189541
1637 Ga0207689_10276225
1638 Ga0207689_10314111
1639 Ga0207661_10059462
1640 Ga0207679_10001203
1641 Ga0207679_10022620
1642 Ga0207679_10024748
1643 Ga0207679_10092208
1644 Ga0207679_10315853
1645 Ga0207679_11086428
1646 Ga0207667_10002263
1647 Ga0207667_10088541
1648 Ga0207667_10255304
1649 Ga0207667_10718801
1650 Ga0207651_10198027
1651 Ga0207651_10422941
1652 Ga0207651_10441340
1653 Ga0207651_10461859
1654 Ga0207712_10008122
1655 Ga0207712_10051365
1656 Ga0207712_10204244
1657 Ga0207668_10006932
1658 Ga0207668_10009884
1659 Ga0207668_10043072
1660 Ga0207668_10226871
1661 Ga0207668_10226893
1662 Ga0207668_10912214
1663 Ga0207640_10194537
1664 Ga0207658_10033513
1665 Ga0207658_10387850
1666 Ga0207658_10411779
1667 Ga0207677_10104872
1668 Ga0207677_10337490
1669 Ga0207703_10050608
1670 Ga0207703_10252385
1671 Ga0207703_10276159
1672 Ga0207703_10294729
1673 Ga0207703_10401911
1674 Ga0207703_10777718
1675 Ga0207639_10001640
1676 Ga0207639_10057159
1677 Ga0207639_10458196
1678 Ga0207678_10003781
1679 Ga0207678_10004977
1680 Ga0207678_10021290
1681 Ga0207678_10242617
1682 Ga0207678_10258972
1683 Ga0207678_10263649
1684 Ga0207678_10283781
1685 Ga0207678_10685534
1686 Ga0207708_10000697
1687 Ga0207708_10026820
1688 Ga0207708_10215912
1689 Ga0207702_10000655
1690 Ga0207702_11281020
1691 Ga0207641_10048697
1692 Ga0207641_10157508
1693 Ga0207641_10277568
1694 Ga0207641_10294788
1695 Ga0207641_10397065
1696 Ga0207641_10448763
1697 Ga0207648_10000352
1698 Ga0207648_10027992
1699 Ga0207648_10131421
1700 Ga0207648_10258943
1701 Ga0207648_10533572
1702 Ga0207676_10005417
1703 Ga0207676_10364956
1704 Ga0207674_10012924
1705 Ga0207674_10028634
1706 Ga0207674_10777963
1707 Ga0207674_10803606
1708 Ga0207674_10882548
1709 Ga0207675_100000223
1710 Ga0207675_100003107
1711 Ga0207675_100016261
1712 Ga0207675_100024751
1713 Ga0207675_100069177
1714 Ga0207675_100187129
1715 Ga0207675_100281538
1716 Ga0207675_100403596
1717 Ga0207675_100727209
1718 Ga0207683_10044769
1719 Ga0207683_10094746
1720 Ga0207683_10172924
1721 Ga0207683_10236554
1722 Ga0207683_10341694
1723 Ga0207698_10024592
1724 Ga0207698_10137660
1725 Ga0207698_10320950
1726 Ga0209969_1025042
1727 Ga0209967_1012407
1728 Ga0209981_1002385
1729 Ga0210000_1008319
1730 Ga0209995_1003102
1731 Ga0209970_1039549
1732 Ga0209971_1005095
1733 Ga0209971_1008432
1734 Ga0209998_10002446
1735 Ga0209813_10094153
1736 Ga0209974_10004640
1737 Ga0209974_10009535
1738 Ga0207428_10024684
1739 Ga0268266_10001575
1740 Ga0268266_10014129
1741 Ga0268266_10015559
1742 Ga0268266_10141998
1743 Ga0268266_10157946
1744 Ga0268265_10000579
1745 Ga0268265_10047066
1746 Ga0268265_10152948
1747 Ga0268265_10208359
1748 Ga0268265_10564550
1749 Ga0268265_10909750
1750 Ga0268265_11048201
1751 Ga0268264_10003459
1752 Ga0268264_10062225
1753 Ga0268264_10103649
1754 Ga0268264_10178470
1755 Ga0265334_10007172
1756 Ga0265318_10025204
1757 Ga0265323_10001672
1758 Ga0265336_10001896
1759 Ga0307517_10001423
1760 Ga0307515_10184990
1761 Ga0307515_10278535
1762 Ga0265338_10000081
1763 Ga0316177_1022593
1764 Ga0316177_1036321
1765 Ga0316180_1076004
1766 Ga0316182_1048253
1767 Ga0307513_10059822
1768 Ga0307509_10237260
1769 Ga0307408_100000576
1770 Ga0307408_100015800
1771 Ga0307408_100594374
1772 Ga0307408_100912180
1773 Ga0307508_10037831
1774 Ga0316576_10054741
1775 Ga0307516_10111440
1776 Ga0307516_10341913
1777 Ga0307405_10002481
1778 Ga0307405_10570027
1779 Ga0307413_10005033
1780 Ga0307410_10023495
1781 Ga0307406_10165607
1782 Ga0307406_10571489
1783 Ga0307406_10619817
1784 Ga0307407_10000698
1785 Ga0307407_10135361
1786 Ga0307407_10318928
1787 Ga0307412_10031144
1788 Ga0307409_100005474
1789 Ga0307409_100428575
1790 Ga0307409_100496760
1791 Ga0307416_100002971
1792 Ga0307416_100108293
1793 Ga0307416_100587278
1794 Ga0307416_100638359
1795 Ga0307416_101580272
1796 Ga0307414_10015320
1797 Ga0307411_10000867
1798 Ga0307411_10089726
1799 Ga0307415_100003950
1800 Ga0307415_100566620
1801 Ga0307510_10002798
1802 Ga0307510_10372225
1803 Ga0315911_1000005
1804 Ga0373926_0131676
1805 Ga0373923_0119002
1806 Ga0373936_0023646
1807 Ga0373939_0005902
1808 Ga0373954_0149765
1809 Ga0373943_0143052
1810 Ga0373943_0159929
1811 Ga0373946_0082024
1812 Ga0373927_0222414
1813 Ga0373933_0083335
1814 Ga0373937_0026451
1815 Ga0373937_0033401
1816 Ga0373937_0267659
1817 Ga0373937_1132319
1818 Ga0316584_0377521
1819 Ga0373925_0041802
1820 Ga0395899_0051379
1821 Ga0395899_0091067
1822 Ga0395900_0004048
1823 Ga0395900_0016331
1824 Ga0395898_0151981
1825 Ga0395898_0152485
1826 Ga0395905_0001257
1827 Ga0395905_0074999
1828 Ga0395905_0858559
1829 Ga0395901_0197417
1830 Ga0395901_0525920
1831 Ga0242420_007102
1832 Ga0436365_1234622
1833 Ga0436365_1679225
1834 Ga0436360_0547434
1835 Ga0436361_0801307
1836 Ga0436361_1163181
1837 Ga0439465_0038957
1838 Ga0439465_0055851
1839 Ga0451789_0629811
1840 Ga0451797_1353463
1841 Ga0451798_0069368
1842 Ga0451807_0902416
1843 Ga0451851_0114126
1844 Ga0451853_3174467
1845 Ga0439431_0000841
1846 Ga0439432_018117
1847 Ga0439432_040088
1848 Ga0450898_014475
1849 Ga0439446_0106998
1850 Ga0439434_0144558
1851 Ga0466966_0000475
1852 Ga0466966_0061644
1853 Ga0466963_0124046
1854 Ga0466963_0625696
1855 Ga0453684_0666023
1856 Ga0466968_0043092
1857 Ga0466957_0047741
1858 Ga0466959_0153908
1859 Ga0451576_0001042
1860 Ga0451576_0088783
1861 Ga0466958_0108292
1862 Ga0466958_0329069
1863 Ga0466967_0046160
1864 Ga0466967_0676265
1865 Ga0495617_103906
1866 Ga0495592_0008544
1867 Ga0495603_0103882
1868 Ga0495603_0108862
1869 Ga0495590_0023918
1870 Ga0495590_0158092
1871 Ga0495629_0278114
1872 Ga0495638_0308680
1873 Ga0495638_0447268
1874 Ga0495650_0000477
1875 Ga0495650_0078436
1876 Ga0495650_0216154
1877 Ga0495605_0000044
1878 Ga0495605_0156443
1879 Ga0495585_0005634
1880 Ga0495585_0026097
1881 Ga0495585_0077078
1882 Ga0495585_0105655
1883 Ga0495585_0221216
1884 Ga0495594_0279137
1885 Ga0495607_0000848
1886 Ga0495607_0009421
1887 Ga0495583_0000088
1888 Ga0495583_0089874
1889 Ga0495606_0000229
1890 Ga0495606_0006591
1891 Ga0495606_0069770
1892 Ga0495610_0002508
1893 Ga0495610_0006414
1894 Ga0495610_0016863
1895 Ga0495610_0027737
1896 Ga0495610_0104615
1897 Ga0495616_0077295
1898 Ga0495616_0158945
1899 Ga0495620_0001648
1900 Ga0495620_0092301
1901 Ga0495630_0354963
1902 Ga0495631_0000034
1903 Ga0495643_0004238
1904 Ga0495643_0006252
1905 Ga0495643_0152848
1906 Ga0495643_0238440
1907 Ga0495643_0240185
1908 Ga0495648_0002013
1909 Ga0495666_0026830
1910 Ga0495642_0052569
1911 Ga0495598_0034946
1912 Ga0495621_0026373
1913 Ga0495621_0029975
1914 Ga0495621_0135537
1915 Ga0495622_0013020
1916 Ga0495633_0004820
1917 Ga0495656_0032634
1918 Ga0495668_0000118
1919 Ga0495668_0006680
1920 Ga0495668_0053682
1921 Ga0495668_0141183
1922 Ga0495611_0000017
1923 Ga0495625_0079431
1924 Ga0495625_0372139
1925 Ga0495625_0538709
1926 Ga0495635_0254938
1927 Ga0495659_0090722
1928 Ga0495588_0000099
1929 Ga0495669_0002213
1930 Ga0495624_0461184
1931 Ga0495670_0031106
1932 Ga0495671_0029695
1933 Ga0495660_0078932
1934 Ga0495581_0245392
1935 Ga0495636_0013436
1936 Ga0495636_0045863
1937 Ga0495672_0000021
1938 Ga0495672_0000079
1939 Ga0495672_0021922
1940 Ga0495672_0087013
1941 Ga0495672_0106030
1942 Ga0495672_0258478
1943 Ga0495683_0090294
1944 Ga0495683_0139742
1945 Ga0495679_091342
1946 Ga0495685_109045
1947 Ga0495673_0000024
1948 Ga0495673_0000030
1949 Ga0495673_0116076
1950 Ga0495673_0142974
1951 Ga0495686_0007958
1952 Ga0495686_0041753
1953 Ga0495686_0366195
1954 Ga0495626_0001155
1955 Ga0495626_0263885
1956 Ga0496100_0021799
1957 Ga0496101_0514377
1958 Ga0496102_0001905
1959 Ga0496102_0010957
1960 Ga0496102_0116475
1961 Ga0496102_0383054
1962 Ga0496102_0572921
1963 Ga0496102_0866934
1964 Ga0496103_0009452
1965 Ga0496104_0014540
1966 Ga0496104_0120097
1967 Ga0496104_0526604
1968 Ga0496105_0013537
1969 Ga0496105_0764166
1970 Ga0496105_0777309
1971 Ga0496106_0009896
1972 Ga0496106_0061640
1973 Ga0496106_0471881
1974 Ga0496107_0020354
1975 Ga0496107_0040743
1976 Ga0496107_0064878
1977 Ga0496107_0309233
1978 Ga0496107_0329060
1979 Ga0496108_0034386
1980 Ga0496108_0047915
1981 Ga0496108_0050962
1982 Ga0496108_0372899
1983 Ga0496108_0835152
1984 Ga0496109_0082698
1985 Ga0496109_0120495
1986 Ga0496109_0177110
1987 Ga0496110_0211017
1988 Ga0496111_0067136
1989 Ga0496111_0101823
1990 Ga0496111_0309633
1991 Ga0496112_0001802
1992 Ga0496112_0052086
1993 Ga0496112_0432707
1994 Ga0496113_0086146
1995 Ga0496113_0102149
1996 Ga0496113_0753936
1997 Ga0496114_0138207
1998 Ga0496114_0280104
1999 Ga0496115_0000295
2000 Ga0496115_0203872
2001 Ga0496117_0130115
2002 Ga0496117_0300098
2003 Ga0496118_0131491
2004 Ga0496118_0139362
2005 Ga0496121_0003702
2006 Ga0496121_0082694
2007 Ga0496121_0302974
2008 Ga0496121_0462383
2009 Ga0496122_0140949
2010 Ga0496123_0158430
2011 Ga0496124_0033172
2012 Ga0496124_0035157
2013 Ga0496124_0091593
2014 Ga0496124_0133963
2015 Ga0496125_0213885
2016 Ga0496125_0277585
2017 Ga0496126_0056218
2018 Ga0496126_0396373
2019 Ga0496126_0507797
2020 Ga0495678_000304
2021 Ga0495678_086855
2022 Ga0501034_0805293
2023 Ga0501036_0214528
2024 Ga0501038_0125782
2025 Ga0501039_0172792
2026 Ga0501039_0401824
2027 Ga0501040_0004633
2028 Ga0501042_0050476
2029 Ga0501042_0295689
2030 Ga0501043_0554782
2031 Ga0501048_0014061
2032 Ga0501067_0058336
2033 Ga0501068_0110697
2034 Ga0501071_0045517
2035 Ga0501071_0434968
2036 Ga0501072_0406133
2037 Ga0501074_0283667
2038 Ga0501075_0557659
2039 Ga0501076_0932464
2040 Ga0501216_038105
2041 Ga0501229_013874
2042 Ga0501079_0120218
2043 Ga0501080_0016546
2044 Ga0501081_0067829
2045 Ga0501262_016230
2046 Ga0501265_010433
2047 Ga0501044_0775254
2048 nmdc:mga03683_114812_c1
2049 nmdc:mga03n38_215760_c1
2050 nmdc:mga03n38_7482_c1
2051 nmdc:mga00v17_340881_c1
2052 nmdc:mga00v17_445548_c1
2053 nmdc:mga0yw44_116949_c1
2054 nmdc:mga0yw44_177427_c1
2055 nmdc:mga0yw44_311267_c1
2056 nmdc:mga06z11_298060_c1
2057 nmdc:mga06z11_328741_c1
2058 nmdc:mga06z11_72334_c1
2059 nmdc:mga04h51_55663_c1
2060 nmdc:mga07m45_156605_c1
2061 nmdc:mga05p37_134216_c1
2062 nmdc:mga05p37_191374_c1
2063 nmdc:mga05p37_209_c1
2064 nmdc:mga05p37_38529_c1
2065 nmdc:mga05p37_615236_c1
2066 nmdc:mga09592_150_c1
2067 nmdc:mga09592_163437_c1
2068 nmdc:mga09592_4737_c1
2069 nmdc:mga09592_581494_c1
2070 nmdc:mga0qj67_131328_c1
2071 nmdc:mga0qj67_135084_c1
2072 nmdc:mga0qj67_452189_c1
2073 nmdc:mga06r32_14895_c1
2074 nmdc:mga06r32_252374_c1
2075 nmdc:mga08y16_135314_c1
2076 nmdc:mga08y16_38103_c1
2077 nmdc:mga08y16_66743_c1
2078 nmdc:mga08y16_7676_c1
2079 nmdc:mga0n895_156526_c1
2080 nmdc:mga0n895_923700_c1
2081 nmdc:mga0rr50_80679_c1
2082 nmdc:mga0rr50_818697_c1
2083 nmdc:mga08x19_22166_c1
2084 nmdc:mga08x19_39288_c1
2085 nmdc:mga08x19_55_c1
2086 nmdc:mga08x19_610179_c1
2087 nmdc:mga0sz30_292640_c1
2088 Ga0500643_062941
2089 Ga0500583_0127671
2090 Ga0500566_0278844
2091 Ga0500641_0127854
2092 Ga0500554_035556
2093 Ga0500572_017424
2094 Ga0500572_072164
2095 Ga0500595_002541
2096 Ga0500595_012296
2097 Ga0500595_111956
2098 Ga0500608_233487
2099 Ga0500655_016684
2100 Ga0500559_0004336
2101 Ga0500574_081549
2102 Ga0500586_011368
2103 Ga0500603_029207
2104 Ga0500620_011225
2105 Ga0500638_155261
2106 Ga0500639_033994
2107 Ga0500636_0007802
2108 Ga0500637_0088589
2109 Ga0500661_040282
2110 Ga0590071_011723
2111 Ga0466962_0017422
2112 Ga0530510_0771974
2113 2513657470
2114 2513861202
2115 2513916723
2116 2517889630
2117 2524533200
2118 2644337844
2119 2671119482
2120 2793084093
2121 2857554220
2122 2857559826
2123 2857564991
2124 2876811102
2125 2879116994
2126 2889036407
2127 2903756083
2128 2904707614
2129 2906614608
2130 2906642087
2131 2906666467
2132 2908746570
2133 2922366717
2134 2922389379
2135 2922426469
2136 2935632810
2137 2939592420
2138 2939636090
2139 2941508526
2140 2941516356
2141 2941524628
2142 2974310226
2143 2977250952
2144 2984514554
2145 3005475811
2146 8006937128
2147 8006977138
2148 8006993125
2149 8019561531
2150 8019571607
2151 8056678165
2152 8056683444

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

23

99

0.96

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

32

100

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

27

105

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9798 14 226
4pxo-assembly1.cif.gz_B crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) 0.9766 14 226
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9707 14 226
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.9678 12 226
4pxo-assembly1.cif.gz_B crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) 0.9632 14 226
ID Description Score Start End Superfamily
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.976 97 226 1.20.1050.10
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9687 97 226 1.20.1050.10
4px1A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9662 97 226 1.20.1050.10
6jwkB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9639 97 226 1.20.1050.10
6jwkA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9621 97 226 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A7W6S279-F1-model_v4 Maleylacetoacetate isomerase/maleylpyruvate isomerase (EC 5.2.1.2, EC 5.2.1.4) 0.993 14 226 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
GO:0050077
AF-A1AYE6-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9928 13 226 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A5C5SJU5-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9926 14 226 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A3S1I756-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9921 45 226 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A529HQD3-F1-model_v4 Maleylacetoacetate isomerase 0.9914 97 226 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Map