F489580
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1076 | 471 | 2152 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10197273|Ga0075365_101972732 |
| Length | 244 |
| Sequence | MLRPILRGAQERAPQDDAECVGPQMKFFSFWRSLASFRVRIALNLKGLPAEIVFVDLDADAHRADAYRKVNPQMALPALVLDDGTTLFQSLAILEYLDETHPAPPLLPADPRGRARVRALALMVACEGHPLLVPRVRRYLDHELNLRDTQQAAWRRHWTVETLAALEAHLADHKETGRFCHGDAPTLADICMVGHVTVAITQQINLAPYPTVQRIFDAAMALPAFATAHPLAQPDTPEAMRKKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 236 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 237 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 242 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 256 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 257 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 258 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 261 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 279 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 284 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 285 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 286 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 287 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 288 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 289 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 290 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 293 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 349 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 352 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 353 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 363 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 387 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 388 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 392 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 393 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 410 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 411 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 412 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 415 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 418 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 419 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 420 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 422 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 424 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 426 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 428 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 429 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 430 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 431 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 432 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 433 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 434 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 435 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 436 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 437 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 438 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 439 | 2791355199 | |||
| 440 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 441 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 442 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 443 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 444 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 445 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 446 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 447 | 2904699407 | |||
| 448 | 2906610324 | |||
| 449 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 450 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 451 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 452 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 453 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 454 | 2922425934 | |||
| 455 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 456 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 457 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 458 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 459 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 460 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 461 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 462 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 463 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 464 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 465 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 466 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 467 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 468 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 469 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 470 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 471 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.64 |
| Metatranscriptomes | 0 |
| Isolates | 3.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 8.46 |
| Nodule | 1.95 |
| Rhizoplane | 4.65 |
| Rhizosphere | 80.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075365_10197273 | 3300006038 | Bacteria | 1410 |
| 2 | JGI24751J29686_10022294 | 3300002459 | Bacteria | 1314 |
| 3 | JGI25150J39212_1000628 | 3300002774 | Bacteria | 13387 |
| 4 | JGI25406J46586_10023564 | 3300003203 | Bacteria | 2431 |
| 5 | JGI25153J46596_10001338 | 3300003215 | Bacteria | 14733 |
| 6 | rootL2_10033244 | 3300003322 | Bacteria | 2856 |
| 7 | rootL2_10133234 | 3300003322 | Bacteria | 3079 |
| 8 | Ga0055526_1000198 | 3300003771 | Bacteria | 51889 |
| 9 | Ga0055526_1000218 | 3300003771 | Bacteria | 49706 |
| 10 | Ga0055526_1003042 | 3300003771 | Bacteria | 10899 |
| 11 | Ga0055537_1000790 | 3300003773 | Bacteria | 15874 |
| 12 | Ga0055534_1000180 | 3300003784 | Bacteria | 46550 |
| 13 | Ga0055528_1000262 | 3300003790 | Bacteria | 44658 |
| 14 | Ga0055530_10009923 | 3300003791 | Bacteria | 3588 |
| 15 | Ga0055530_10052351 | 3300003791 | Bacteria | 942 |
| 16 | Ga0055530_10062741 | 3300003791 | Bacteria | 824 |
| 17 | Ga0055540_1016176 | 3300003792 | Bacteria | 2135 |
| 18 | Ga0055540_1023639 | 3300003792 | Bacteria | 1543 |
| 19 | Ga0065715_10022737 | 3300005293 | Bacteria | 1639 |
| 20 | Ga0065707_10288654 | 3300005295 | Bacteria | 1030 |
| 21 | Ga0070658_10054218 | 3300005327 | Bacteria | 3256 |
| 22 | Ga0070658_10066192 | 3300005327 | Bacteria | 2951 |
| 23 | Ga0070658_10490996 | 3300005327 | Bacteria | 1060 |
| 24 | Ga0070676_10086765 | 3300005328 | Bacteria | 1909 |
| 25 | Ga0070676_10217250 | 3300005328 | Bacteria | 1261 |
| 26 | Ga0070683_100134544 | 3300005329 | Bacteria | 2340 |
| 27 | Ga0070683_100263427 | 3300005329 | Bacteria | 1640 |
| 28 | Ga0070683_100874374 | 3300005329 | Bacteria | 862 |
| 29 | Ga0070670_100120456 | 3300005331 | Bacteria | 2263 |
| 30 | Ga0070670_100243204 | 3300005331 | Bacteria | 1567 |
| 31 | Ga0070677_10002466 | 3300005333 | Bacteria | 5923 |
| 32 | Ga0070677_10255665 | 3300005333 | Bacteria | 872 |
| 33 | Ga0068869_100000108 | 3300005334 | Bacteria | 39249 |
| 34 | Ga0068869_100020312 | 3300005334 | Bacteria | 4553 |
| 35 | Ga0068869_100028565 | 3300005334 | Bacteria | 3899 |
| 36 | Ga0068869_100049825 | 3300005334 | Bacteria | 3033 |
| 37 | Ga0068869_100110247 | 3300005334 | Bacteria | 2093 |
| 38 | Ga0070666_10038220 | 3300005335 | Bacteria | 3193 |
| 39 | Ga0070666_10331269 | 3300005335 | Bacteria | 1087 |
| 40 | Ga0070666_10563692 | 3300005335 | Bacteria | 829 |
| 41 | Ga0070680_100247583 | 3300005336 | Bacteria | 1507 |
| 42 | Ga0070680_100543169 | 3300005336 | Bacteria | 996 |
| 43 | Ga0070682_100107660 | 3300005337 | Bacteria | 1852 |
| 44 | Ga0070682_100135317 | 3300005337 | Bacteria | 1673 |
| 45 | Ga0070682_100636601 | 3300005337 | Bacteria | 847 |
| 46 | Ga0068868_100056259 | 3300005338 | Bacteria | 3106 |
| 47 | Ga0068868_100063616 | 3300005338 | Bacteria | 2926 |
| 48 | Ga0068868_100111191 | 3300005338 | Bacteria | 2226 |
| 49 | Ga0068868_100148026 | 3300005338 | Bacteria | 1932 |
| 50 | Ga0068868_100286347 | 3300005338 | Bacteria | 1396 |
| 51 | Ga0070660_100005400 | 3300005339 | Bacteria | 8847 |
| 52 | Ga0070660_100012123 | 3300005339 | Bacteria | 6154 |
| 53 | Ga0070660_100178680 | 3300005339 | Bacteria | 1717 |
| 54 | Ga0070689_100114572 | 3300005340 | Bacteria | 2148 |
| 55 | Ga0070687_100413572 | 3300005343 | Bacteria | 887 |
| 56 | Ga0070661_100006353 | 3300005344 | Bacteria | 8151 |
| 57 | Ga0070661_100007131 | 3300005344 | Bacteria | 7706 |
| 58 | Ga0070661_100057780 | 3300005344 | Bacteria | 2842 |
| 59 | Ga0070661_100430512 | 3300005344 | Bacteria | 1047 |
| 60 | Ga0070692_10060812 | 3300005345 | Bacteria | 1989 |
| 61 | Ga0070692_10167276 | 3300005345 | Bacteria | 1265 |
| 62 | Ga0070668_100016851 | 3300005347 | Bacteria | 5464 |
| 63 | Ga0070668_100018823 | 3300005347 | Bacteria | 5187 |
| 64 | Ga0070668_100025885 | 3300005347 | Bacteria | 4449 |
| 65 | Ga0070668_100031665 | 3300005347 | Bacteria | 4024 |
| 66 | Ga0070668_100090578 | 3300005347 | Bacteria | 2409 |
| 67 | Ga0070668_100094000 | 3300005347 | Bacteria | 2366 |
| 68 | Ga0070668_100120049 | 3300005347 | Bacteria | 2100 |
| 69 | Ga0070668_100224242 | 3300005347 | Bacteria | 1551 |
| 70 | Ga0070669_100013057 | 3300005353 | Bacteria | 5899 |
| 71 | Ga0070669_100028863 | 3300005353 | Bacteria | 3996 |
| 72 | Ga0070669_100088425 | 3300005353 | Bacteria | 2319 |
| 73 | Ga0070669_100133174 | 3300005353 | Bacteria | 1909 |
| 74 | Ga0070669_100222466 | 3300005353 | Bacteria | 1493 |
| 75 | Ga0070669_100308067 | 3300005353 | Bacteria | 1276 |
| 76 | Ga0070669_100391885 | 3300005353 | Bacteria | 1135 |
| 77 | Ga0070669_100655948 | 3300005353 | Bacteria | 883 |
| 78 | Ga0070675_100084625 | 3300005354 | Bacteria | 2649 |
| 79 | Ga0070675_100234544 | 3300005354 | Bacteria | 1602 |
| 80 | Ga0070675_100321954 | 3300005354 | Bacteria | 1366 |
| 81 | Ga0070675_100344366 | 3300005354 | Bacteria | 1321 |
| 82 | Ga0070675_100348051 | 3300005354 | Bacteria | 1314 |
| 83 | Ga0070675_100420827 | 3300005354 | Bacteria | 1194 |
| 84 | Ga0070671_100007885 | 3300005355 | Bacteria | 8513 |
| 85 | Ga0070671_100385010 | 3300005355 | Bacteria | 1199 |
| 86 | Ga0070671_100458067 | 3300005355 | Bacteria | 1094 |
| 87 | Ga0070671_100524851 | 3300005355 | Bacteria | 1020 |
| 88 | Ga0070674_100019883 | 3300005356 | Bacteria | 4276 |
| 89 | Ga0070674_100021123 | 3300005356 | Bacteria | 4173 |
| 90 | Ga0070674_100022113 | 3300005356 | Bacteria | 4097 |
| 91 | Ga0070674_100030839 | 3300005356 | Bacteria | 3547 |
| 92 | Ga0070674_100139236 | 3300005356 | Bacteria | 1819 |
| 93 | Ga0070674_100193973 | 3300005356 | Bacteria | 1564 |
| 94 | Ga0070673_100162386 | 3300005364 | Bacteria | 1901 |
| 95 | Ga0070673_100239533 | 3300005364 | Bacteria | 1577 |
| 96 | Ga0070673_100513294 | 3300005364 | Bacteria | 1085 |
| 97 | Ga0070673_100747066 | 3300005364 | Bacteria | 901 |
| 98 | Ga0070688_100020439 | 3300005365 | Bacteria | 3851 |
| 99 | Ga0070688_100283626 | 3300005365 | Bacteria | 1191 |
| 100 | Ga0070659_100001088 | 3300005366 | Bacteria | 19812 |
| 101 | Ga0070659_100022667 | 3300005366 | Bacteria | 4795 |
| 102 | Ga0070659_100092659 | 3300005366 | Bacteria | 2423 |
| 103 | Ga0070659_100243227 | 3300005366 | Bacteria | 1490 |
| 104 | Ga0070659_100320829 | 3300005366 | Bacteria | 1295 |
| 105 | Ga0070659_100343157 | 3300005366 | Bacteria | 1252 |
| 106 | Ga0070667_100041022 | 3300005367 | Bacteria | 3883 |
| 107 | Ga0070667_100059966 | 3300005367 | Bacteria | 3220 |
| 108 | Ga0070667_100174002 | 3300005367 | Bacteria | 1901 |
| 109 | Ga0070667_100533825 | 3300005367 | Unclassified | 1077 |
| 110 | Ga0070667_100819341 | 3300005367 | Bacteria | 864 |
| 111 | Ga0070703_10164315 | 3300005406 | Bacteria | 845 |
| 112 | Ga0070709_10189103 | 3300005434 | Bacteria | 1451 |
| 113 | Ga0070714_100081392 | 3300005435 | Bacteria | 2819 |
| 114 | Ga0070713_100824998 | 3300005436 | Bacteria | 890 |
| 115 | Ga0070701_10059957 | 3300005438 | Bacteria | 2002 |
| 116 | Ga0070701_10129129 | 3300005438 | Bacteria | 1434 |
| 117 | Ga0070711_100088699 | 3300005439 | Bacteria | 2223 |
| 118 | Ga0070711_100156253 | 3300005439 | Bacteria | 1725 |
| 119 | Ga0070705_100050412 | 3300005440 | Bacteria | 2422 |
| 120 | Ga0070705_100141440 | 3300005440 | Bacteria | 1584 |
| 121 | Ga0070705_100649683 | 3300005440 | Bacteria | 822 |
| 122 | Ga0070700_100003206 | 3300005441 | Bacteria | 8410 |
| 123 | Ga0070700_100413556 | 3300005441 | Bacteria | 1017 |
| 124 | Ga0070694_100011084 | 3300005444 | Bacteria | 5581 |
| 125 | Ga0070694_100059684 | 3300005444 | Bacteria | 2599 |
| 126 | Ga0070694_100452485 | 3300005444 | Bacteria | 1014 |
| 127 | Ga0070708_100058166 | 3300005445 | Bacteria | 3444 |
| 128 | Ga0070708_100248456 | 3300005445 | Bacteria | 1671 |
| 129 | Ga0070663_100025065 | 3300005455 | Bacteria | 4023 |
| 130 | Ga0070663_100040343 | 3300005455 | Bacteria | 3267 |
| 131 | Ga0070663_100125775 | 3300005455 | Bacteria | 1942 |
| 132 | Ga0070663_100189959 | 3300005455 | Bacteria | 1598 |
| 133 | Ga0070663_100203418 | 3300005455 | Bacteria | 1546 |
| 134 | Ga0070663_100387388 | 3300005455 | Bacteria | 1140 |
| 135 | Ga0070663_100700897 | 3300005455 | Bacteria | 861 |
| 136 | Ga0070678_100027111 | 3300005456 | Bacteria | 3885 |
| 137 | Ga0070678_100171756 | 3300005456 | Bacteria | 1766 |
| 138 | Ga0070678_100201052 | 3300005456 | Bacteria | 1645 |
| 139 | Ga0070678_100335735 | 3300005456 | Bacteria | 1295 |
| 140 | Ga0070662_100000134 | 3300005457 | Bacteria | 41711 |
| 141 | Ga0070662_100095159 | 3300005457 | Bacteria | 2244 |
| 142 | Ga0070681_10532994 | 3300005458 | Bacteria | 1088 |
| 143 | Ga0068867_100000126 | 3300005459 | Bacteria | 49231 |
| 144 | Ga0068867_100009464 | 3300005459 | Bacteria | 6871 |
| 145 | Ga0068867_100121493 | 3300005459 | Bacteria | 2019 |
| 146 | Ga0068867_100157700 | 3300005459 | Bacteria | 1788 |
| 147 | Ga0068867_100175113 | 3300005459 | Bacteria | 1702 |
| 148 | Ga0068867_100313851 | 3300005459 | Bacteria | 1296 |
| 149 | Ga0068867_100432244 | 3300005459 | Bacteria | 1118 |
| 150 | Ga0070685_10098733 | 3300005466 | Bacteria | 1780 |
| 151 | Ga0070706_100030612 | 3300005467 | Bacteria | 4960 |
| 152 | Ga0070707_100040082 | 3300005468 | Bacteria | 4479 |
| 153 | Ga0070699_100003308 | 3300005518 | Bacteria | 14252 |
| 154 | Ga0070699_100045054 | 3300005518 | Bacteria | 3818 |
| 155 | Ga0070699_100687793 | 3300005518 | Bacteria | 934 |
| 156 | Ga0070679_100012228 | 3300005530 | Bacteria | 8198 |
| 157 | Ga0070679_100195222 | 3300005530 | Bacteria | 1992 |
| 158 | Ga0070679_100348458 | 3300005530 | Bacteria | 1429 |
| 159 | Ga0070684_100033871 | 3300005535 | Bacteria | 4364 |
| 160 | Ga0070684_100138955 | 3300005535 | Bacteria | 2196 |
| 161 | Ga0070697_100015469 | 3300005536 | Bacteria | 5990 |
| 162 | Ga0068853_100000458 | 3300005539 | Bacteria | 27839 |
| 163 | Ga0068853_100121596 | 3300005539 | Bacteria | 2330 |
| 164 | Ga0068853_100688275 | 3300005539 | Bacteria | 975 |
| 165 | Ga0070672_100045716 | 3300005543 | Bacteria | 3389 |
| 166 | Ga0070672_100090790 | 3300005543 | Bacteria | 2464 |
| 167 | Ga0070672_100106878 | 3300005543 | Bacteria | 2277 |
| 168 | Ga0070672_100275045 | 3300005543 | Bacteria | 1423 |
| 169 | Ga0070672_100296559 | 3300005543 | Bacteria | 1370 |
| 170 | Ga0070686_100208741 | 3300005544 | Bacteria | 1404 |
| 171 | Ga0070686_100527002 | 3300005544 | Bacteria | 921 |
| 172 | Ga0070695_100002348 | 3300005545 | Bacteria | 10850 |
| 173 | Ga0070695_100188331 | 3300005545 | Bacteria | 1467 |
| 174 | Ga0070696_100001808 | 3300005546 | Bacteria | 14037 |
| 175 | Ga0070693_100055156 | 3300005547 | Bacteria | 2289 |
| 176 | Ga0070665_100018469 | 3300005548 | Bacteria | 6989 |
| 177 | Ga0070665_100031980 | 3300005548 | Bacteria | 5296 |
| 178 | Ga0070665_100063857 | 3300005548 | Bacteria | 3692 |
| 179 | Ga0070665_100348152 | 3300005548 | Bacteria | 1487 |
| 180 | Ga0070665_100504053 | 3300005548 | Bacteria | 1222 |
| 181 | Ga0070704_100001833 | 3300005549 | Bacteria | 11711 |
| 182 | Ga0070704_100073317 | 3300005549 | Bacteria | 2494 |
| 183 | Ga0070704_100175710 | 3300005549 | Bacteria | 1708 |
| 184 | Ga0070704_100385774 | 3300005549 | Bacteria | 1191 |
| 185 | Ga0068855_100001419 | 3300005563 | Bacteria | 29756 |
| 186 | Ga0068855_100127510 | 3300005563 | Bacteria | 2909 |
| 187 | Ga0068855_100159333 | 3300005563 | Bacteria | 2563 |
| 188 | Ga0068855_100187278 | 3300005563 | Bacteria | 2337 |
| 189 | Ga0068855_100314928 | 3300005563 | Bacteria | 1731 |
| 190 | Ga0068855_100834500 | 3300005563 | Bacteria | 977 |
| 191 | Ga0070664_100022570 | 3300005564 | Bacteria | 5189 |
| 192 | Ga0070664_100029120 | 3300005564 | Bacteria | 4602 |
| 193 | Ga0070664_100045817 | 3300005564 | Bacteria | 3693 |
| 194 | Ga0070664_100095464 | 3300005564 | Bacteria | 2579 |
| 195 | Ga0070664_100250675 | 3300005564 | Bacteria | 1591 |
| 196 | Ga0070664_100744052 | 3300005564 | Bacteria | 915 |
| 197 | Ga0068857_100090614 | 3300005577 | Bacteria | 2736 |
| 198 | Ga0068857_100114401 | 3300005577 | Bacteria | 2426 |
| 199 | Ga0068857_101208364 | 3300005577 | Bacteria | 732 |
| 200 | Ga0068854_100024108 | 3300005578 | Bacteria | 4163 |
| 201 | Ga0068854_100276410 | 3300005578 | Bacteria | 1350 |
| 202 | Ga0068854_100674803 | 3300005578 | Bacteria | 889 |
| 203 | Ga0068856_100000265 | 3300005614 | Bacteria | 56919 |
| 204 | Ga0068856_100208376 | 3300005614 | Bacteria | 1970 |
| 205 | Ga0068856_100572465 | 3300005614 | Bacteria | 1151 |
| 206 | Ga0070702_100021708 | 3300005615 | Bacteria | 3383 |
| 207 | Ga0070702_100309967 | 3300005615 | Bacteria | 1095 |
| 208 | Ga0070702_100476993 | 3300005615 | Bacteria | 911 |
| 209 | Ga0068852_100197004 | 3300005616 | Bacteria | 1904 |
| 210 | Ga0068852_100242791 | 3300005616 | Bacteria | 1722 |
| 211 | Ga0068852_100297249 | 3300005616 | Bacteria | 1562 |
| 212 | Ga0068852_100505901 | 3300005616 | Bacteria | 1203 |
| 213 | Ga0068859_100087220 | 3300005617 | Bacteria | 3168 |
| 214 | Ga0068859_100107772 | 3300005617 | Bacteria | 2847 |
| 215 | Ga0068859_100241030 | 3300005617 | Bacteria | 1897 |
| 216 | Ga0068859_100517306 | 3300005617 | Bacteria | 1288 |
| 217 | Ga0068859_100582057 | 3300005617 | Bacteria | 1213 |
| 218 | Ga0068864_100015296 | 3300005618 | Bacteria | 6381 |
| 219 | Ga0068864_100102798 | 3300005618 | Bacteria | 2536 |
| 220 | Ga0068864_100113505 | 3300005618 | Bacteria | 2415 |
| 221 | Ga0068866_10033930 | 3300005718 | Bacteria | 2481 |
| 222 | Ga0068866_10062661 | 3300005718 | Bacteria | 1935 |
| 223 | Ga0068866_10109947 | 3300005718 | Bacteria | 1536 |
| 224 | Ga0068866_10277517 | 3300005718 | Bacteria | 1037 |
| 225 | Ga0068861_100000134 | 3300005719 | Bacteria | 38219 |
| 226 | Ga0068861_100024453 | 3300005719 | Bacteria | 4369 |
| 227 | Ga0068861_100026946 | 3300005719 | Bacteria | 4182 |
| 228 | Ga0068861_100040936 | 3300005719 | Bacteria | 3468 |
| 229 | Ga0068861_100073614 | 3300005719 | Bacteria | 2654 |
| 230 | Ga0068861_100179829 | 3300005719 | Bacteria | 1760 |
| 231 | Ga0068861_100245590 | 3300005719 | Bacteria | 1525 |
| 232 | Ga0068861_100531090 | 3300005719 | Bacteria | 1069 |
| 233 | Ga0068861_100676169 | 3300005719 | Bacteria | 956 |
| 234 | Ga0068851_10009081 | 3300005834 | Bacteria | 4614 |
| 235 | Ga0068851_10038811 | 3300005834 | Bacteria | 2390 |
| 236 | Ga0068851_10043848 | 3300005834 | Bacteria | 2255 |
| 237 | Ga0068863_100127597 | 3300005841 | Bacteria | 2427 |
| 238 | Ga0068863_100509264 | 3300005841 | Bacteria | 1186 |
| 239 | Ga0068863_100523160 | 3300005841 | Bacteria | 1170 |
| 240 | Ga0068863_100684032 | 3300005841 | Bacteria | 1019 |
| 241 | Ga0068858_100004830 | 3300005842 | Bacteria | 13204 |
| 242 | Ga0068858_100033213 | 3300005842 | Bacteria | 4790 |
| 243 | Ga0068858_100114315 | 3300005842 | Bacteria | 2521 |
| 244 | Ga0068858_100360429 | 3300005842 | Bacteria | 1393 |
| 245 | Ga0068858_100515963 | 3300005842 | Bacteria | 1155 |
| 246 | Ga0068858_100561099 | 3300005842 | Bacteria | 1106 |
| 247 | Ga0068860_100024360 | 3300005843 | Bacteria | 5848 |
| 248 | Ga0068860_100056905 | 3300005843 | Bacteria | 3716 |
| 249 | Ga0068860_100109845 | 3300005843 | Bacteria | 2635 |
| 250 | Ga0068860_100313172 | 3300005843 | Bacteria | 1539 |
| 251 | Ga0068860_100314642 | 3300005843 | Bacteria | 1536 |
| 252 | Ga0068860_100323708 | 3300005843 | Bacteria | 1513 |
| 253 | Ga0068860_100361394 | 3300005843 | Bacteria | 1430 |
| 254 | Ga0068860_100457368 | 3300005843 | Bacteria | 1270 |
| 255 | Ga0068860_101247787 | 3300005843 | Bacteria | 764 |
| 256 | Ga0068862_100001111 | 3300005844 | Bacteria | 25519 |
| 257 | Ga0068862_100031836 | 3300005844 | Bacteria | 4454 |
| 258 | Ga0068862_100157649 | 3300005844 | Bacteria | 2024 |
| 259 | Ga0068862_100486919 | 3300005844 | Bacteria | 1168 |
| 260 | Ga0068862_100619419 | 3300005844 | Bacteria | 1041 |
| 261 | Ga0068862_100806479 | 3300005844 | Bacteria | 917 |
| 262 | Ga0068862_100962104 | 3300005844 | Bacteria | 842 |
| 263 | Ga0081455_10011490 | 3300005937 | Bacteria | 8896 |
| 264 | Ga0081455_10013541 | 3300005937 | Bacteria | 8042 |
| 265 | Ga0081455_10160337 | 3300005937 | Bacteria | 1725 |
| 266 | Ga0081540_1002758 | 3300005983 | Bacteria | 14257 |
| 267 | Ga0081540_1011235 | 3300005983 | Bacteria | 6001 |
| 268 | Ga0081540_1011459 | 3300005983 | Bacteria | 5923 |
| 269 | Ga0081540_1027454 | 3300005983 | Bacteria | 3225 |
| 270 | Ga0081540_1028410 | 3300005983 | Bacteria | 3142 |
| 271 | Ga0081540_1035676 | 3300005983 | Bacteria | 2663 |
| 272 | Ga0081540_1068810 | 3300005983 | Bacteria | 1648 |
| 273 | Ga0081540_1071970 | 3300005983 | Bacteria | 1595 |
| 274 | Ga0081540_1120933 | 3300005983 | Bacteria | 1087 |
| 275 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 276 | Ga0081539_10004364 | 3300005985 | Bacteria | 15760 |
| 277 | Ga0081539_10013206 | 3300005985 | Bacteria | 6247 |
| 278 | Ga0081539_10047257 | 3300005985 | Bacteria | 2460 |
| 279 | Ga0075365_10035982 | 3300006038 | Bacteria | 3206 |
| 280 | Ga0075365_10391628 | 3300006038 | Bacteria | 980 |
| 281 | Ga0075368_10026128 | 3300006042 | Bacteria | 2245 |
| 282 | Ga0075368_10066870 | 3300006042 | Bacteria | 1446 |
| 283 | Ga0075368_10072890 | 3300006042 | Bacteria | 1389 |
| 284 | Ga0075363_100005124 | 3300006048 | Bacteria | 5796 |
| 285 | Ga0075363_100273555 | 3300006048 | Bacteria | 976 |
| 286 | Ga0075364_10039828 | 3300006051 | Bacteria | 3047 |
| 287 | Ga0075364_10255648 | 3300006051 | Bacteria | 1191 |
| 288 | Ga0070712_100242081 | 3300006175 | Bacteria | 1437 |
| 289 | Ga0075367_10021040 | 3300006178 | Bacteria | 3641 |
| 290 | Ga0075367_10039085 | 3300006178 | Bacteria | 2765 |
| 291 | Ga0075367_10148621 | 3300006178 | Bacteria | 1453 |
| 292 | Ga0075367_10169285 | 3300006178 | Bacteria | 1360 |
| 293 | Ga0075367_10202034 | 3300006178 | Bacteria | 1242 |
| 294 | Ga0075367_10360377 | 3300006178 | Bacteria | 918 |
| 295 | Ga0075367_10390709 | 3300006178 | Bacteria | 879 |
| 296 | Ga0075369_10210627 | 3300006186 | Bacteria | 898 |
| 297 | Ga0075366_10072746 | 3300006195 | Bacteria | 2049 |
| 298 | Ga0097621_100104530 | 3300006237 | Bacteria | 2387 |
| 299 | Ga0097621_100373255 | 3300006237 | Bacteria | 1273 |
| 300 | Ga0075370_10050352 | 3300006353 | Bacteria | 2362 |
| 301 | Ga0075370_10402949 | 3300006353 | Bacteria | 821 |
| 302 | Ga0068871_100449357 | 3300006358 | Bacteria | 1155 |
| 303 | Ga0075428_100017818 | 3300006844 | Bacteria | 7847 |
| 304 | Ga0075428_100211597 | 3300006844 | Bacteria | 2095 |
| 305 | Ga0075428_100354924 | 3300006844 | Bacteria | 1573 |
| 306 | Ga0075430_100084363 | 3300006846 | Bacteria | 2660 |
| 307 | Ga0075430_100670677 | 3300006846 | Bacteria | 855 |
| 308 | Ga0075431_100018399 | 3300006847 | Bacteria | 7114 |
| 309 | Ga0075431_100131935 | 3300006847 | Bacteria | 2576 |
| 310 | Ga0075434_100201802 | 3300006871 | Bacteria | 2009 |
| 311 | Ga0075429_100010239 | 3300006880 | Bacteria | 8118 |
| 312 | Ga0075429_100110711 | 3300006880 | Bacteria | 2400 |
| 313 | Ga0068865_100034493 | 3300006881 | Bacteria | 3395 |
| 314 | Ga0068865_100183572 | 3300006881 | Bacteria | 1612 |
| 315 | Ga0075436_100000050 | 3300006914 | Bacteria | 71245 |
| 316 | Ga0075436_100005257 | 3300006914 | Bacteria | 8909 |
| 317 | Ga0075436_100007947 | 3300006914 | Bacteria | 7264 |
| 318 | Ga0075436_100609756 | 3300006914 | Bacteria | 805 |
| 319 | Ga0097620_100087224 | 3300006931 | Bacteria | 3168 |
| 320 | Ga0097620_100107770 | 3300006931 | Bacteria | 2847 |
| 321 | Ga0097620_100241038 | 3300006931 | Bacteria | 1897 |
| 322 | Ga0097620_100517361 | 3300006931 | Bacteria | 1288 |
| 323 | Ga0097620_100582117 | 3300006931 | Bacteria | 1213 |
| 324 | Ga0075435_100041256 | 3300007076 | Bacteria | 3689 |
| 325 | Ga0075435_100396203 | 3300007076 | Bacteria | 1187 |
| 326 | Ga0075435_100495687 | 3300007076 | Bacteria | 1056 |
| 327 | Ga0099794_10109280 | 3300007265 | Bacteria | 1384 |
| 328 | Ga0099794_10142775 | 3300007265 | Bacteria | 1213 |
| 329 | Ga0099794_10302669 | 3300007265 | Bacteria | 828 |
| 330 | Ga0105251_10001824 | 3300009011 | Bacteria | 17609 |
| 331 | Ga0105250_10167931 | 3300009092 | Bacteria | 918 |
| 332 | Ga0105240_10118311 | 3300009093 | Bacteria | 3193 |
| 333 | Ga0111539_10040711 | 3300009094 | Bacteria | 5591 |
| 334 | Ga0111539_10055286 | 3300009094 | Bacteria | 4718 |
| 335 | Ga0111539_10061749 | 3300009094 | Bacteria | 4439 |
| 336 | Ga0111539_11050481 | 3300009094 | Bacteria | 947 |
| 337 | Ga0111539_11304903 | 3300009094 | Unclassified | 842 |
| 338 | Ga0105245_10054214 | 3300009098 | Bacteria | 3601 |
| 339 | Ga0105245_10374427 | 3300009098 | Bacteria | 1416 |
| 340 | Ga0105245_10447229 | 3300009098 | Bacteria | 1300 |
| 341 | Ga0105245_10832374 | 3300009098 | Bacteria | 962 |
| 342 | Ga0105247_10047736 | 3300009101 | Bacteria | 2630 |
| 343 | Ga0105247_10470944 | 3300009101 | Bacteria | 910 |
| 344 | Ga0114129_10044616 | 3300009147 | Bacteria | 6236 |
| 345 | Ga0114129_10067343 | 3300009147 | Bacteria | 4994 |
| 346 | Ga0114129_10238075 | 3300009147 | Bacteria | 2448 |
| 347 | Ga0114129_10401408 | 3300009147 | Bacteria | 1806 |
| 348 | Ga0114129_10578970 | 3300009147 | Bacteria | 1457 |
| 349 | Ga0114129_11219193 | 3300009147 | Bacteria | 936 |
| 350 | Ga0105243_10006474 | 3300009148 | Bacteria | 9057 |
| 351 | Ga0105243_10345664 | 3300009148 | Bacteria | 1364 |
| 352 | Ga0105243_10413347 | 3300009148 | Bacteria | 1256 |
| 353 | Ga0105243_10443059 | 3300009148 | Bacteria | 1217 |
| 354 | Ga0105243_10500450 | 3300009148 | Bacteria | 1151 |
| 355 | Ga0105241_10587787 | 3300009174 | Bacteria | 1004 |
| 356 | Ga0105242_10332109 | 3300009176 | Bacteria | 1398 |
| 357 | Ga0105248_10002088 | 3300009177 | Bacteria | 22111 |
| 358 | Ga0105248_10015422 | 3300009177 | Bacteria | 8423 |
| 359 | Ga0105248_10458614 | 3300009177 | Bacteria | 1437 |
| 360 | Ga0105248_10680063 | 3300009177 | Bacteria | 1161 |
| 361 | Ga0105248_10822032 | 3300009177 | Bacteria | 1049 |
| 362 | Ga0105237_10097698 | 3300009545 | Bacteria | 2927 |
| 363 | Ga0105238_10016932 | 3300009551 | Bacteria | 7398 |
| 364 | Ga0105238_10260559 | 3300009551 | Bacteria | 1713 |
| 365 | Ga0105249_10002649 | 3300009553 | Bacteria | 15482 |
| 366 | Ga0105249_10129691 | 3300009553 | Bacteria | 2405 |
| 367 | Ga0105249_10221304 | 3300009553 | Bacteria | 1863 |
| 368 | Ga0105249_10396731 | 3300009553 | Bacteria | 1409 |
| 369 | Ga0105239_10099207 | 3300010375 | Bacteria | 3220 |
| 370 | Ga0105239_10215173 | 3300010375 | Bacteria | 2154 |
| 371 | Ga0105239_10393950 | 3300010375 | Bacteria | 1567 |
| 372 | Ga0105246_10063209 | 3300011119 | Bacteria | 2581 |
| 373 | Ga0105246_10105982 | 3300011119 | Bacteria | 2055 |
| 374 | Ga0157373_10000321 | 3300013100 | Bacteria | 38735 |
| 375 | Ga0157373_10267352 | 3300013100 | Bacteria | 1210 |
| 376 | Ga0157371_10000470 | 3300013102 | Bacteria | 49205 |
| 377 | Ga0157371_10286158 | 3300013102 | Bacteria | 1191 |
| 378 | Ga0157370_10134702 | 3300013104 | Bacteria | 2303 |
| 379 | Ga0157369_10005334 | 3300013105 | Bacteria | 14979 |
| 380 | Ga0157369_10140396 | 3300013105 | Bacteria | 2557 |
| 381 | Ga0157374_10044934 | 3300013296 | Bacteria | 4086 |
| 382 | Ga0157374_10385845 | 3300013296 | Bacteria | 1396 |
| 383 | Ga0157378_10112524 | 3300013297 | Bacteria | 2497 |
| 384 | Ga0157378_10132465 | 3300013297 | Bacteria | 2309 |
| 385 | Ga0157378_10454995 | 3300013297 | Bacteria | 1271 |
| 386 | Ga0157378_10458435 | 3300013297 | Bacteria | 1266 |
| 387 | Ga0157378_10659067 | 3300013297 | Bacteria | 1063 |
| 388 | Ga0157378_11374209 | 3300013297 | Bacteria | 749 |
| 389 | Ga0163162_10046096 | 3300013306 | Bacteria | 4370 |
| 390 | Ga0163162_10086573 | 3300013306 | Bacteria | 3211 |
| 391 | Ga0163162_10265511 | 3300013306 | Bacteria | 1848 |
| 392 | Ga0163162_10289386 | 3300013306 | Bacteria | 1770 |
| 393 | Ga0163162_10460020 | 3300013306 | Bacteria | 1404 |
| 394 | Ga0163162_10616796 | 3300013306 | Bacteria | 1210 |
| 395 | Ga0163162_10802183 | 3300013306 | Bacteria | 1059 |
| 396 | Ga0163162_10840522 | 3300013306 | Bacteria | 1034 |
| 397 | Ga0157372_10002397 | 3300013307 | Bacteria | 20296 |
| 398 | Ga0157372_10095119 | 3300013307 | Bacteria | 3394 |
| 399 | Ga0157372_10142657 | 3300013307 | Bacteria | 2761 |
| 400 | Ga0157372_11439873 | 3300013307 | Bacteria | 794 |
| 401 | Ga0157375_10036786 | 3300013308 | Bacteria | 4686 |
| 402 | Ga0157375_10183962 | 3300013308 | Bacteria | 2242 |
| 403 | Ga0157375_10326989 | 3300013308 | Bacteria | 1698 |
| 404 | Ga0157375_10487970 | 3300013308 | Bacteria | 1397 |
| 405 | Ga0157375_10982671 | 3300013308 | Bacteria | 985 |
| 406 | Ga0157375_11110484 | 3300013308 | Bacteria | 926 |
| 407 | Ga0157375_11184038 | 3300013308 | Bacteria | 896 |
| 408 | Ga0163163_10017844 | 3300014325 | Bacteria | 6625 |
| 409 | Ga0163163_10027486 | 3300014325 | Bacteria | 5450 |
| 410 | Ga0163163_10044736 | 3300014325 | Bacteria | 4344 |
| 411 | Ga0163163_10142783 | 3300014325 | Bacteria | 2437 |
| 412 | Ga0163163_10734283 | 3300014325 | Bacteria | 1051 |
| 413 | Ga0157380_10010659 | 3300014326 | Bacteria | 6618 |
| 414 | Ga0157380_10047964 | 3300014326 | Bacteria | 3362 |
| 415 | Ga0157380_10285848 | 3300014326 | Bacteria | 1512 |
| 416 | Ga0157380_11050571 | 3300014326 | Bacteria | 851 |
| 417 | Ga0182008_10029051 | 3300014497 | Bacteria | 2794 |
| 418 | Ga0157377_10004959 | 3300014745 | Bacteria | 6205 |
| 419 | Ga0157377_10267338 | 3300014745 | Bacteria | 1115 |
| 420 | Ga0157379_10337136 | 3300014968 | Bacteria | 1379 |
| 421 | Ga0157376_10222397 | 3300014969 | Bacteria | 1749 |
| 422 | Ga0182006_1039545 | 3300015261 | Bacteria | 1861 |
| 423 | Ga0163161_10122635 | 3300017792 | Bacteria | 1954 |
| 424 | Ga0163161_10338769 | 3300017792 | Bacteria | 1193 |
| 425 | Ga0213876_10029473 | 3300021384 | Bacteria | 2892 |
| 426 | Ga0207425_1000522 | 3300025245 | Bacteria | 23469 |
| 427 | Ga0209677_100599 | 3300025253 | Bacteria | 19507 |
| 428 | Ga0209129_1000225 | 3300025258 | Bacteria | 63564 |
| 429 | Ga0209233_1000907 | 3300025261 | Bacteria | 12948 |
| 430 | Ga0209233_1003339 | 3300025261 | Bacteria | 5679 |
| 431 | Ga0209565_1000037 | 3300025263 | Bacteria | 289371 |
| 432 | Ga0207666_1003363 | 3300025271 | Bacteria | 1965 |
| 433 | Ga0209455_1009913 | 3300025272 | Bacteria | 2461 |
| 434 | Ga0209673_1000032 | 3300025273 | Bacteria | 339956 |
| 435 | Ga0207673_1003898 | 3300025290 | Bacteria | 1760 |
| 436 | Ga0209675_1000020 | 3300025291 | Bacteria | 335854 |
| 437 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 438 | Ga0209564_1000196 | 3300025295 | Bacteria | 141368 |
| 439 | Ga0209564_1000951 | 3300025295 | Bacteria | 37038 |
| 440 | Ga0209758_1000181 | 3300025297 | Bacteria | 140847 |
| 441 | Ga0209758_1009611 | 3300025297 | Bacteria | 5971 |
| 442 | Ga0209758_1020987 | 3300025297 | Bacteria | 3064 |
| 443 | Ga0209050_1022660 | 3300025298 | Bacteria | 2243 |
| 444 | Ga0209051_1006158 | 3300025303 | Bacteria | 6815 |
| 445 | Ga0209051_1015429 | 3300025303 | Bacteria | 3513 |
| 446 | Ga0209257_1000734 | 3300025304 | Bacteria | 49703 |
| 447 | Ga0209257_1020408 | 3300025304 | Bacteria | 2451 |
| 448 | Ga0207697_10000319 | 3300025315 | Bacteria | 26864 |
| 449 | Ga0207656_10004660 | 3300025321 | Bacteria | 4807 |
| 450 | Ga0207656_10037161 | 3300025321 | Bacteria | 2048 |
| 451 | Ga0207656_10063131 | 3300025321 | Bacteria | 1630 |
| 452 | Ga0207656_10107453 | 3300025321 | Bacteria | 1286 |
| 453 | Ga0207682_10002499 | 3300025893 | Bacteria | 8216 |
| 454 | Ga0207682_10068966 | 3300025893 | Bacteria | 1495 |
| 455 | Ga0207692_10255021 | 3300025898 | Bacteria | 1053 |
| 456 | Ga0207642_10005842 | 3300025899 | Bacteria | 4049 |
| 457 | Ga0207642_10103452 | 3300025899 | Bacteria | 1435 |
| 458 | Ga0207642_10181398 | 3300025899 | Bacteria | 1147 |
| 459 | Ga0207710_10027753 | 3300025900 | Bacteria | 2454 |
| 460 | Ga0207710_10095267 | 3300025900 | Bacteria | 1398 |
| 461 | Ga0207688_10070330 | 3300025901 | Bacteria | 1984 |
| 462 | Ga0207688_10080120 | 3300025901 | Bacteria | 1864 |
| 463 | Ga0207688_10097818 | 3300025901 | Bacteria | 1691 |
| 464 | Ga0207688_10382543 | 3300025901 | Bacteria | 871 |
| 465 | Ga0207680_10048128 | 3300025903 | Bacteria | 2530 |
| 466 | Ga0207647_10267701 | 3300025904 | Bacteria | 977 |
| 467 | Ga0207645_10007023 | 3300025907 | Bacteria | 8017 |
| 468 | Ga0207645_10012159 | 3300025907 | Bacteria | 5846 |
| 469 | Ga0207645_10257223 | 3300025907 | Bacteria | 1156 |
| 470 | Ga0207643_10000851 | 3300025908 | Bacteria | 18500 |
| 471 | Ga0207643_10040929 | 3300025908 | Bacteria | 2610 |
| 472 | Ga0207643_10229710 | 3300025908 | Bacteria | 1138 |
| 473 | Ga0207684_10592652 | 3300025910 | Bacteria | 947 |
| 474 | Ga0207671_10083591 | 3300025914 | Bacteria | 2397 |
| 475 | Ga0207693_10141032 | 3300025915 | Bacteria | 1895 |
| 476 | Ga0207660_10051862 | 3300025917 | Bacteria | 2918 |
| 477 | Ga0207660_10172306 | 3300025917 | Bacteria | 1676 |
| 478 | Ga0207660_10618110 | 3300025917 | Bacteria | 883 |
| 479 | Ga0207660_10806114 | 3300025917 | Bacteria | 766 |
| 480 | Ga0207662_10111056 | 3300025918 | Bacteria | 1709 |
| 481 | Ga0207657_10006415 | 3300025919 | Bacteria | 12199 |
| 482 | Ga0207657_10008703 | 3300025919 | Bacteria | 10274 |
| 483 | Ga0207657_10022789 | 3300025919 | Bacteria | 5848 |
| 484 | Ga0207657_10121263 | 3300025919 | Bacteria | 2151 |
| 485 | Ga0207657_10219851 | 3300025919 | Bacteria | 1522 |
| 486 | Ga0207649_10005458 | 3300025920 | Bacteria | 6883 |
| 487 | Ga0207649_10006859 | 3300025920 | Bacteria | 6185 |
| 488 | Ga0207649_10096792 | 3300025920 | Bacteria | 1945 |
| 489 | Ga0207649_10114007 | 3300025920 | Bacteria | 1811 |
| 490 | Ga0207649_10205770 | 3300025920 | Bacteria | 1393 |
| 491 | Ga0207649_10227157 | 3300025920 | Bacteria | 1333 |
| 492 | Ga0207652_10300551 | 3300025921 | Bacteria | 1449 |
| 493 | Ga0207652_10674951 | 3300025921 | Bacteria | 923 |
| 494 | Ga0207646_10054665 | 3300025922 | Bacteria | 3571 |
| 495 | Ga0207681_10002154 | 3300025923 | Bacteria | 12555 |
| 496 | Ga0207681_10041742 | 3300025923 | Bacteria | 3060 |
| 497 | Ga0207681_10066301 | 3300025923 | Bacteria | 2499 |
| 498 | Ga0207681_10101154 | 3300025923 | Bacteria | 2079 |
| 499 | Ga0207681_10103646 | 3300025923 | Bacteria | 2056 |
| 500 | Ga0207681_10169607 | 3300025923 | Bacteria | 1653 |
| 501 | Ga0207681_10606554 | 3300025923 | Bacteria | 905 |
| 502 | Ga0207681_10633660 | 3300025923 | Bacteria | 885 |
| 503 | Ga0207694_10055347 | 3300025924 | Bacteria | 3080 |
| 504 | Ga0207694_10131224 | 3300025924 | Bacteria | 2008 |
| 505 | Ga0207650_10006975 | 3300025925 | Bacteria | 7702 |
| 506 | Ga0207650_10010136 | 3300025925 | Bacteria | 6458 |
| 507 | Ga0207650_10384759 | 3300025925 | Bacteria | 1159 |
| 508 | Ga0207659_10003749 | 3300025926 | Bacteria | 9163 |
| 509 | Ga0207659_10356410 | 3300025926 | Bacteria | 1215 |
| 510 | Ga0207659_10988984 | 3300025926 | Bacteria | 724 |
| 511 | Ga0207687_10017108 | 3300025927 | Bacteria | 4767 |
| 512 | Ga0207687_10093590 | 3300025927 | Bacteria | 2198 |
| 513 | Ga0207687_10185053 | 3300025927 | Bacteria | 1616 |
| 514 | Ga0207700_11049110 | 3300025928 | Bacteria | 729 |
| 515 | Ga0207644_10000862 | 3300025931 | Bacteria | 19192 |
| 516 | Ga0207644_10055712 | 3300025931 | Bacteria | 2851 |
| 517 | Ga0207644_10087820 | 3300025931 | Bacteria | 2311 |
| 518 | Ga0207644_10098036 | 3300025931 | Bacteria | 2196 |
| 519 | Ga0207644_10207115 | 3300025931 | Bacteria | 1549 |
| 520 | Ga0207644_10477820 | 3300025931 | Bacteria | 1026 |
| 521 | Ga0207690_10000395 | 3300025932 | Bacteria | 28806 |
| 522 | Ga0207690_10167015 | 3300025932 | Bacteria | 1645 |
| 523 | Ga0207690_10180307 | 3300025932 | Bacteria | 1590 |
| 524 | Ga0207690_10328689 | 3300025932 | Bacteria | 1203 |
| 525 | Ga0207706_10000002 | 3300025933 | Bacteria | 360309 |
| 526 | Ga0207706_10007913 | 3300025933 | Bacteria | 9809 |
| 527 | Ga0207706_10058409 | 3300025933 | Bacteria | 3397 |
| 528 | Ga0207706_10105624 | 3300025933 | Bacteria | 2478 |
| 529 | Ga0207706_10168439 | 3300025933 | Bacteria | 1925 |
| 530 | Ga0207706_10287886 | 3300025933 | Bacteria | 1432 |
| 531 | Ga0207709_10005402 | 3300025935 | Bacteria | 7267 |
| 532 | Ga0207709_10036410 | 3300025935 | Bacteria | 2916 |
| 533 | Ga0207709_10507525 | 3300025935 | Bacteria | 942 |
| 534 | Ga0207670_10007127 | 3300025936 | Bacteria | 6229 |
| 535 | Ga0207670_10131084 | 3300025936 | Bacteria | 1837 |
| 536 | Ga0207670_10159586 | 3300025936 | Bacteria | 1682 |
| 537 | Ga0207670_10164935 | 3300025936 | Bacteria | 1657 |
| 538 | Ga0207669_10012524 | 3300025937 | Bacteria | 4174 |
| 539 | Ga0207669_10045048 | 3300025937 | Bacteria | 2597 |
| 540 | Ga0207669_10056736 | 3300025937 | Bacteria | 2380 |
| 541 | Ga0207669_10082542 | 3300025937 | Bacteria | 2064 |
| 542 | Ga0207704_10000660 | 3300025938 | Bacteria | 15241 |
| 543 | Ga0207704_10138428 | 3300025938 | Bacteria | 1699 |
| 544 | Ga0207704_10333405 | 3300025938 | Bacteria | 1175 |
| 545 | Ga0207691_10009804 | 3300025940 | Bacteria | 9197 |
| 546 | Ga0207691_10040936 | 3300025940 | Bacteria | 4280 |
| 547 | Ga0207691_10051529 | 3300025940 | Bacteria | 3763 |
| 548 | Ga0207691_10105080 | 3300025940 | Bacteria | 2516 |
| 549 | Ga0207691_10175832 | 3300025940 | Bacteria | 1872 |
| 550 | Ga0207691_10298495 | 3300025940 | Bacteria | 1384 |
| 551 | Ga0207691_10376512 | 3300025940 | Bacteria | 1212 |
| 552 | Ga0207691_10383367 | 3300025940 | Bacteria | 1200 |
| 553 | Ga0207691_10857830 | 3300025940 | Bacteria | 761 |
| 554 | Ga0207711_10339234 | 3300025941 | Bacteria | 1391 |
| 555 | Ga0207711_10472558 | 3300025941 | Bacteria | 1168 |
| 556 | Ga0207711_10543838 | 3300025941 | Bacteria | 1083 |
| 557 | Ga0207689_10000030 | 3300025942 | Bacteria | 97584 |
| 558 | Ga0207689_10002080 | 3300025942 | Bacteria | 18880 |
| 559 | Ga0207689_10159972 | 3300025942 | Bacteria | 1856 |
| 560 | Ga0207689_10189541 | 3300025942 | Bacteria | 1696 |
| 561 | Ga0207689_10276225 | 3300025942 | Bacteria | 1391 |
| 562 | Ga0207689_10314111 | 3300025942 | Bacteria | 1300 |
| 563 | Ga0207661_10059462 | 3300025944 | Bacteria | 3080 |
| 564 | Ga0207679_10001203 | 3300025945 | Bacteria | 16448 |
| 565 | Ga0207679_10022620 | 3300025945 | Bacteria | 4283 |
| 566 | Ga0207679_10024748 | 3300025945 | Bacteria | 4119 |
| 567 | Ga0207679_10092208 | 3300025945 | Bacteria | 2346 |
| 568 | Ga0207679_10315853 | 3300025945 | Bacteria | 1351 |
| 569 | Ga0207679_11086428 | 3300025945 | Bacteria | 734 |
| 570 | Ga0207667_10002263 | 3300025949 | Bacteria | 24190 |
| 571 | Ga0207667_10088541 | 3300025949 | Bacteria | 3201 |
| 572 | Ga0207667_10255304 | 3300025949 | Bacteria | 1793 |
| 573 | Ga0207667_10718801 | 3300025949 | Bacteria | 1000 |
| 574 | Ga0207651_10198027 | 3300025960 | Bacteria | 1607 |
| 575 | Ga0207651_10422941 | 3300025960 | Bacteria | 1138 |
| 576 | Ga0207651_10441340 | 3300025960 | Bacteria | 1115 |
| 577 | Ga0207651_10461859 | 3300025960 | Bacteria | 1091 |
| 578 | Ga0207712_10008122 | 3300025961 | Bacteria | 6640 |
| 579 | Ga0207712_10051365 | 3300025961 | Bacteria | 2883 |
| 580 | Ga0207712_10204244 | 3300025961 | Bacteria | 1569 |
| 581 | Ga0207668_10006932 | 3300025972 | Bacteria | 6724 |
| 582 | Ga0207668_10009884 | 3300025972 | Bacteria | 5734 |
| 583 | Ga0207668_10043072 | 3300025972 | Bacteria | 3060 |
| 584 | Ga0207668_10226871 | 3300025972 | Bacteria | 1503 |
| 585 | Ga0207668_10226893 | 3300025972 | Bacteria | 1503 |
| 586 | Ga0207668_10912214 | 3300025972 | Bacteria | 782 |
| 587 | Ga0207640_10194537 | 3300025981 | Bacteria | 1531 |
| 588 | Ga0207658_10033513 | 3300025986 | Bacteria | 3665 |
| 589 | Ga0207658_10387850 | 3300025986 | Bacteria | 1225 |
| 590 | Ga0207658_10411779 | 3300025986 | Unclassified | 1190 |
| 591 | Ga0207677_10104872 | 3300026023 | Bacteria | 2091 |
| 592 | Ga0207677_10337490 | 3300026023 | Bacteria | 1258 |
| 593 | Ga0207703_10050608 | 3300026035 | Bacteria | 3363 |
| 594 | Ga0207703_10252385 | 3300026035 | Bacteria | 1590 |
| 595 | Ga0207703_10276159 | 3300026035 | Bacteria | 1524 |
| 596 | Ga0207703_10294729 | 3300026035 | Bacteria | 1477 |
| 597 | Ga0207703_10401911 | 3300026035 | Bacteria | 1271 |
| 598 | Ga0207703_10777718 | 3300026035 | Bacteria | 913 |
| 599 | Ga0207639_10001640 | 3300026041 | Bacteria | 15075 |
| 600 | Ga0207639_10057159 | 3300026041 | Bacteria | 2994 |
| 601 | Ga0207639_10458196 | 3300026041 | Bacteria | 1159 |
| 602 | Ga0207678_10003781 | 3300026067 | Bacteria | 13610 |
| 603 | Ga0207678_10004977 | 3300026067 | Bacteria | 11917 |
| 604 | Ga0207678_10021290 | 3300026067 | Bacteria | 5685 |
| 605 | Ga0207678_10242617 | 3300026067 | Bacteria | 1543 |
| 606 | Ga0207678_10258972 | 3300026067 | Bacteria | 1491 |
| 607 | Ga0207678_10263649 | 3300026067 | Bacteria | 1477 |
| 608 | Ga0207678_10283781 | 3300026067 | Bacteria | 1421 |
| 609 | Ga0207678_10685534 | 3300026067 | Bacteria | 901 |
| 610 | Ga0207708_10000697 | 3300026075 | Bacteria | 25504 |
| 611 | Ga0207708_10026820 | 3300026075 | Bacteria | 4361 |
| 612 | Ga0207708_10215912 | 3300026075 | Bacteria | 1535 |
| 613 | Ga0207702_10000655 | 3300026078 | Bacteria | 37671 |
| 614 | Ga0207702_11281020 | 3300026078 | Bacteria | 727 |
| 615 | Ga0207641_10048697 | 3300026088 | Bacteria | 3578 |
| 616 | Ga0207641_10157508 | 3300026088 | Bacteria | 2062 |
| 617 | Ga0207641_10277568 | 3300026088 | Bacteria | 1575 |
| 618 | Ga0207641_10294788 | 3300026088 | Bacteria | 1530 |
| 619 | Ga0207641_10397065 | 3300026088 | Bacteria | 1323 |
| 620 | Ga0207641_10448763 | 3300026088 | Bacteria | 1246 |
| 621 | Ga0207648_10000352 | 3300026089 | Bacteria | 50550 |
| 622 | Ga0207648_10027992 | 3300026089 | Bacteria | 5000 |
| 623 | Ga0207648_10131421 | 3300026089 | Bacteria | 2204 |
| 624 | Ga0207648_10258943 | 3300026089 | Bacteria | 1552 |
| 625 | Ga0207648_10533572 | 3300026089 | Bacteria | 1076 |
| 626 | Ga0207676_10005417 | 3300026095 | Bacteria | 9032 |
| 627 | Ga0207676_10364956 | 3300026095 | Bacteria | 1339 |
| 628 | Ga0207674_10012924 | 3300026116 | Bacteria | 9311 |
| 629 | Ga0207674_10028634 | 3300026116 | Bacteria | 5876 |
| 630 | Ga0207674_10777963 | 3300026116 | Bacteria | 924 |
| 631 | Ga0207674_10803606 | 3300026116 | Bacteria | 908 |
| 632 | Ga0207674_10882548 | 3300026116 | Bacteria | 862 |
| 633 | Ga0207675_100000223 | 3300026118 | Bacteria | 53251 |
| 634 | Ga0207675_100003107 | 3300026118 | Bacteria | 16280 |
| 635 | Ga0207675_100016261 | 3300026118 | Bacteria | 6946 |
| 636 | Ga0207675_100024751 | 3300026118 | Bacteria | 5584 |
| 637 | Ga0207675_100069177 | 3300026118 | Bacteria | 3300 |
| 638 | Ga0207675_100187129 | 3300026118 | Bacteria | 1985 |
| 639 | Ga0207675_100281538 | 3300026118 | Bacteria | 1616 |
| 640 | Ga0207675_100403596 | 3300026118 | Bacteria | 1347 |
| 641 | Ga0207675_100727209 | 3300026118 | Bacteria | 1003 |
| 642 | Ga0207683_10044769 | 3300026121 | Bacteria | 3869 |
| 643 | Ga0207683_10094746 | 3300026121 | Bacteria | 2661 |
| 644 | Ga0207683_10172924 | 3300026121 | Bacteria | 1957 |
| 645 | Ga0207683_10236554 | 3300026121 | Bacteria | 1666 |
| 646 | Ga0207683_10341694 | 3300026121 | Bacteria | 1373 |
| 647 | Ga0207698_10024592 | 3300026142 | Bacteria | 4230 |
| 648 | Ga0207698_10137660 | 3300026142 | Bacteria | 2098 |
| 649 | Ga0207698_10320950 | 3300026142 | Bacteria | 1450 |
| 650 | Ga0209969_1025042 | 3300027360 | Bacteria | 899 |
| 651 | Ga0209967_1012407 | 3300027364 | Bacteria | 1204 |
| 652 | Ga0209981_1002385 | 3300027378 | Bacteria | 2387 |
| 653 | Ga0210000_1008319 | 3300027462 | Bacteria | 1521 |
| 654 | Ga0209995_1003102 | 3300027471 | Bacteria | 2638 |
| 655 | Ga0209970_1039549 | 3300027614 | Bacteria | 837 |
| 656 | Ga0209971_1005095 | 3300027682 | Bacteria | 3122 |
| 657 | Ga0209971_1008432 | 3300027682 | Bacteria | 2444 |
| 658 | Ga0209998_10002446 | 3300027717 | Bacteria | 4257 |
| 659 | Ga0209813_10094153 | 3300027866 | Bacteria | 1010 |
| 660 | Ga0209974_10004640 | 3300027876 | Bacteria | 4886 |
| 661 | Ga0209974_10009535 | 3300027876 | Bacteria | 3296 |
| 662 | Ga0207428_10024684 | 3300027907 | Bacteria | 5046 |
| 663 | Ga0268266_10001575 | 3300028379 | Bacteria | 26658 |
| 664 | Ga0268266_10014129 | 3300028379 | Bacteria | 6874 |
| 665 | Ga0268266_10015559 | 3300028379 | Bacteria | 6522 |
| 666 | Ga0268266_10141998 | 3300028379 | Bacteria | 2155 |
| 667 | Ga0268266_10157946 | 3300028379 | Bacteria | 2050 |
| 668 | Ga0268265_10000579 | 3300028380 | Bacteria | 37090 |
| 669 | Ga0268265_10047066 | 3300028380 | Bacteria | 3229 |
| 670 | Ga0268265_10152948 | 3300028380 | Bacteria | 1948 |
| 671 | Ga0268265_10208359 | 3300028380 | Bacteria | 1701 |
| 672 | Ga0268265_10564550 | 3300028380 | Bacteria | 1082 |
| 673 | Ga0268265_10909750 | 3300028380 | Bacteria | 864 |
| 674 | Ga0268265_11048201 | 3300028380 | Bacteria | 807 |
| 675 | Ga0268264_10003459 | 3300028381 | Bacteria | 13616 |
| 676 | Ga0268264_10062225 | 3300028381 | Bacteria | 3133 |
| 677 | Ga0268264_10103649 | 3300028381 | Bacteria | 2478 |
| 678 | Ga0268264_10178470 | 3300028381 | Bacteria | 1927 |
| 679 | Ga0265334_10007172 | 3300028573 | Bacteria | 4783 |
| 680 | Ga0265318_10025204 | 3300028577 | Bacteria | 2350 |
| 681 | Ga0265323_10001672 | 3300028653 | Bacteria | 10624 |
| 682 | Ga0265336_10001896 | 3300028666 | Bacteria | 9038 |
| 683 | Ga0307517_10001423 | 3300028786 | Bacteria | 40213 |
| 684 | Ga0307515_10184990 | 3300028794 | Bacteria | 2017 |
| 685 | Ga0307515_10278535 | 3300028794 | Bacteria | 1383 |
| 686 | Ga0265338_10000081 | 3300028800 | Bacteria | 176402 |
| 687 | Ga0316177_1022593 | 3300030731 | Bacteria | 2912 |
| 688 | Ga0316177_1036321 | 3300030731 | Bacteria | 1609 |
| 689 | Ga0316180_1076004 | 3300030736 | Bacteria | 2212 |
| 690 | Ga0316182_1048253 | 3300030745 | Bacteria | 3883 |
| 691 | Ga0307513_10059822 | 3300031456 | Bacteria | 4042 |
| 692 | Ga0307509_10237260 | 3300031507 | Bacteria | 1620 |
| 693 | Ga0307408_100000576 | 3300031548 | Bacteria | 31629 |
| 694 | Ga0307408_100015800 | 3300031548 | Bacteria | 5030 |
| 695 | Ga0307408_100594374 | 3300031548 | Bacteria | 982 |
| 696 | Ga0307408_100912180 | 3300031548 | Bacteria | 805 |
| 697 | Ga0307508_10037831 | 3300031616 | Bacteria | 4338 |
| 698 | Ga0316576_10054741 | 3300031727 | Bacteria | 2910 |
| 699 | Ga0307516_10111440 | 3300031730 | Bacteria | 2538 |
| 700 | Ga0307516_10341913 | 3300031730 | Bacteria | 1163 |
| 701 | Ga0307405_10002481 | 3300031731 | Bacteria | 8146 |
| 702 | Ga0307405_10570027 | 3300031731 | Bacteria | 919 |
| 703 | Ga0307413_10005033 | 3300031824 | Bacteria | 5837 |
| 704 | Ga0307410_10023495 | 3300031852 | Bacteria | 3833 |
| 705 | Ga0307406_10165607 | 3300031901 | Bacteria | 1594 |
| 706 | Ga0307406_10571489 | 3300031901 | Bacteria | 928 |
| 707 | Ga0307406_10619817 | 3300031901 | Bacteria | 894 |
| 708 | Ga0307407_10000698 | 3300031903 | Bacteria | 10903 |
| 709 | Ga0307407_10135361 | 3300031903 | Bacteria | 1582 |
| 710 | Ga0307407_10318928 | 3300031903 | Bacteria | 1090 |
| 711 | Ga0307412_10031144 | 3300031911 | Bacteria | 3365 |
| 712 | Ga0307409_100005474 | 3300031995 | Bacteria | 7317 |
| 713 | Ga0307409_100428575 | 3300031995 | Bacteria | 1271 |
| 714 | Ga0307409_100496760 | 3300031995 | Bacteria | 1187 |
| 715 | Ga0307416_100002971 | 3300032002 | Bacteria | 9883 |
| 716 | Ga0307416_100108293 | 3300032002 | Bacteria | 2441 |
| 717 | Ga0307416_100587278 | 3300032002 | Bacteria | 1192 |
| 718 | Ga0307416_100638359 | 3300032002 | Bacteria | 1148 |
| 719 | Ga0307416_101580272 | 3300032002 | Bacteria | 761 |
| 720 | Ga0307414_10015320 | 3300032004 | Bacteria | 4628 |
| 721 | Ga0307411_10000867 | 3300032005 | Bacteria | 11397 |
| 722 | Ga0307411_10089726 | 3300032005 | Bacteria | 2142 |
| 723 | Ga0307415_100003950 | 3300032126 | Bacteria | 7623 |
| 724 | Ga0307415_100566620 | 3300032126 | Bacteria | 1005 |
| 725 | Ga0307510_10002798 | 3300033180 | Bacteria | 20009 |
| 726 | Ga0307510_10372225 | 3300033180 | Bacteria | 875 |
| 727 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 728 | Ga0373926_0131676 | 3300035083 | Bacteria | 947 |
| 729 | Ga0373923_0119002 | 3300035111 | Bacteria | 1179 |
| 730 | Ga0373936_0023646 | 3300035113 | Bacteria | 2396 |
| 731 | Ga0373939_0005902 | 3300035114 | Bacteria | 2931 |
| 732 | Ga0373954_0149765 | 3300035118 | Bacteria | 1140 |
| 733 | Ga0373943_0143052 | 3300035170 | Bacteria | 1290 |
| 734 | Ga0373943_0159929 | 3300035170 | Bacteria | 1226 |
| 735 | Ga0373946_0082024 | 3300035171 | Bacteria | 1414 |
| 736 | Ga0373927_0222414 | 3300035695 | Bacteria | 1240 |
| 737 | Ga0373933_0083335 | 3300035724 | Bacteria | 1964 |
| 738 | Ga0373937_0026451 | 3300036401 | Bacteria | 5244 |
| 739 | Ga0373937_0033401 | 3300036401 | Bacteria | 4672 |
| 740 | Ga0373937_0267659 | 3300036401 | Bacteria | 1612 |
| 741 | Ga0373937_1132319 | 3300036401 | Bacteria | 731 |
| 742 | Ga0316584_0377521 | 3300036712 | Bacteria | 1014 |
| 743 | Ga0373925_0041802 | 3300037068 | Bacteria | 3400 |
| 744 | Ga0395899_0051379 | 3300037312 | Bacteria | 3059 |
| 745 | Ga0395899_0091067 | 3300037312 | Bacteria | 2210 |
| 746 | Ga0395900_0004048 | 3300037418 | Bacteria | 15637 |
| 747 | Ga0395900_0016331 | 3300037418 | Bacteria | 7568 |
| 748 | Ga0395898_0151981 | 3300037466 | Bacteria | 2214 |
| 749 | Ga0395898_0152485 | 3300037466 | Bacteria | 2211 |
| 750 | Ga0395905_0001257 | 3300037471 | Bacteria | 31335 |
| 751 | Ga0395905_0074999 | 3300037471 | Bacteria | 3170 |
| 752 | Ga0395905_0858559 | 3300037471 | Bacteria | 811 |
| 753 | Ga0395901_0197417 | 3300038443 | Bacteria | 2109 |
| 754 | Ga0395901_0525920 | 3300038443 | Bacteria | 1201 |
| 755 | Ga0242420_007102 | 3300038996 | Bacteria | 1791 |
| 756 | Ga0436365_1234622 | 3300039437 | Bacteria | 117941 |
| 757 | Ga0436365_1679225 | 3300039437 | Bacteria | 3459 |
| 758 | Ga0436360_0547434 | 3300039438 | Bacteria | 2196 |
| 759 | Ga0436361_0801307 | 3300039447 | Bacteria | 4305 |
| 760 | Ga0436361_1163181 | 3300039447 | Bacteria | 14246 |
| 761 | Ga0439465_0038957 | 3300041413 | Bacteria | 1533 |
| 762 | Ga0439465_0055851 | 3300041413 | Bacteria | 1301 |
| 763 | Ga0451789_0629811 | 3300041443 | Bacteria | 798 |
| 764 | Ga0451797_1353463 | 3300041453 | Bacteria | 646 |
| 765 | Ga0451798_0069368 | 3300041458 | Bacteria | 907 |
| 766 | Ga0451807_0902416 | 3300041486 | Bacteria | 1051 |
| 767 | Ga0451851_0114126 | 3300041507 | Bacteria | 852 |
| 768 | Ga0451853_3174467 | 3300041512 | Bacteria | 1241 |
| 769 | Ga0439431_0000841 | 3300041997 | Bacteria | 6623 |
| 770 | Ga0439432_018117 | 3300042006 | Bacteria | 2357 |
| 771 | Ga0439432_040088 | 3300042006 | Bacteria | 1486 |
| 772 | Ga0450898_014475 | 3300042134 | Bacteria | 1326 |
| 773 | Ga0439446_0106998 | 3300042156 | Bacteria | 889 |
| 774 | Ga0439434_0144558 | 3300042435 | Bacteria | 785 |
| 775 | Ga0466966_0000475 | 3300044684 | Bacteria | 25816 |
| 776 | Ga0466966_0061644 | 3300044684 | Bacteria | 2365 |
| 777 | Ga0466963_0124046 | 3300044694 | Bacteria | 1779 |
| 778 | Ga0466963_0625696 | 3300044694 | Bacteria | 760 |
| 779 | Ga0453684_0666023 | 3300044712 | Bacteria | 1134 |
| 780 | Ga0466968_0043092 | 3300044735 | Bacteria | 1909 |
| 781 | Ga0466957_0047741 | 3300044842 | Bacteria | 2602 |
| 782 | Ga0466959_0153908 | 3300045049 | Bacteria | 1619 |
| 783 | Ga0451576_0001042 | 3300045051 | Bacteria | 51034 |
| 784 | Ga0451576_0088783 | 3300045051 | Bacteria | 3215 |
| 785 | Ga0466958_0108292 | 3300045836 | Bacteria | 1733 |
| 786 | Ga0466958_0329069 | 3300045836 | Bacteria | 982 |
| 787 | Ga0466967_0046160 | 3300045976 | Bacteria | 3791 |
| 788 | Ga0466967_0676265 | 3300045976 | Bacteria | 1022 |
| 789 | Ga0495617_103906 | 3300046452 | Bacteria | 922 |
| 790 | Ga0495592_0008544 | 3300046454 | Bacteria | 7688 |
| 791 | Ga0495603_0103882 | 3300046455 | Bacteria | 1658 |
| 792 | Ga0495603_0108862 | 3300046455 | Bacteria | 1617 |
| 793 | Ga0495590_0023918 | 3300046457 | Bacteria | 2154 |
| 794 | Ga0495590_0158092 | 3300046457 | Bacteria | 823 |
| 795 | Ga0495629_0278114 | 3300046459 | Bacteria | 1149 |
| 796 | Ga0495638_0308680 | 3300046460 | Bacteria | 850 |
| 797 | Ga0495638_0447268 | 3300046460 | Bacteria | 660 |
| 798 | Ga0495650_0000477 | 3300046471 | Bacteria | 61376 |
| 799 | Ga0495650_0078436 | 3300046471 | Bacteria | 1279 |
| 800 | Ga0495650_0216154 | 3300046471 | Bacteria | 662 |
| 801 | Ga0495605_0000044 | 3300046474 | Bacteria | 182513 |
| 802 | Ga0495605_0156443 | 3300046474 | Bacteria | 1013 |
| 803 | Ga0495585_0005634 | 3300046492 | Bacteria | 7865 |
| 804 | Ga0495585_0026097 | 3300046492 | Bacteria | 3339 |
| 805 | Ga0495585_0077078 | 3300046492 | Bacteria | 1810 |
| 806 | Ga0495585_0105655 | 3300046492 | Bacteria | 1502 |
| 807 | Ga0495585_0221216 | 3300046492 | Bacteria | 955 |
| 808 | Ga0495594_0279137 | 3300046499 | Bacteria | 952 |
| 809 | Ga0495607_0000848 | 3300046501 | Bacteria | 28875 |
| 810 | Ga0495607_0009421 | 3300046501 | Bacteria | 6610 |
| 811 | Ga0495583_0000088 | 3300046506 | Bacteria | 164073 |
| 812 | Ga0495583_0089874 | 3300046506 | Bacteria | 1324 |
| 813 | Ga0495606_0000229 | 3300046507 | Bacteria | 98732 |
| 814 | Ga0495606_0006591 | 3300046507 | Bacteria | 10672 |
| 815 | Ga0495606_0069770 | 3300046507 | Bacteria | 2219 |
| 816 | Ga0495610_0002508 | 3300046512 | Bacteria | 15338 |
| 817 | Ga0495610_0006414 | 3300046512 | Bacteria | 8099 |
| 818 | Ga0495610_0016863 | 3300046512 | Bacteria | 4185 |
| 819 | Ga0495610_0027737 | 3300046512 | Bacteria | 3004 |
| 820 | Ga0495610_0104615 | 3300046512 | Bacteria | 1263 |
| 821 | Ga0495616_0077295 | 3300046513 | Bacteria | 1598 |
| 822 | Ga0495616_0158945 | 3300046513 | Bacteria | 1018 |
| 823 | Ga0495620_0001648 | 3300046515 | Bacteria | 13208 |
| 824 | Ga0495620_0092301 | 3300046515 | Bacteria | 1214 |
| 825 | Ga0495630_0354963 | 3300046517 | Bacteria | 1122 |
| 826 | Ga0495631_0000034 | 3300046518 | Bacteria | 84600 |
| 827 | Ga0495643_0004238 | 3300046522 | Bacteria | 10140 |
| 828 | Ga0495643_0006252 | 3300046522 | Bacteria | 7891 |
| 829 | Ga0495643_0152848 | 3300046522 | Bacteria | 1141 |
| 830 | Ga0495643_0238440 | 3300046522 | Bacteria | 854 |
| 831 | Ga0495643_0240185 | 3300046522 | Bacteria | 850 |
| 832 | Ga0495648_0002013 | 3300046524 | Bacteria | 19260 |
| 833 | Ga0495666_0026830 | 3300046526 | Bacteria | 2836 |
| 834 | Ga0495642_0052569 | 3300046528 | Bacteria | 1678 |
| 835 | Ga0495598_0034946 | 3300046537 | Bacteria | 1436 |
| 836 | Ga0495621_0026373 | 3300046539 | Bacteria | 1960 |
| 837 | Ga0495621_0029975 | 3300046539 | Bacteria | 1857 |
| 838 | Ga0495621_0135537 | 3300046539 | Bacteria | 960 |
| 839 | Ga0495622_0013020 | 3300046557 | Bacteria | 3860 |
| 840 | Ga0495633_0004820 | 3300046558 | Bacteria | 8461 |
| 841 | Ga0495656_0032634 | 3300046615 | Bacteria | 2120 |
| 842 | Ga0495668_0000118 | 3300046616 | Bacteria | 119439 |
| 843 | Ga0495668_0006680 | 3300046616 | Bacteria | 7510 |
| 844 | Ga0495668_0053682 | 3300046616 | Bacteria | 2228 |
| 845 | Ga0495668_0141183 | 3300046616 | Bacteria | 1318 |
| 846 | Ga0495611_0000017 | 3300046648 | Bacteria | 128087 |
| 847 | Ga0495625_0079431 | 3300046660 | Bacteria | 2287 |
| 848 | Ga0495625_0372139 | 3300046660 | Bacteria | 898 |
| 849 | Ga0495625_0538709 | 3300046660 | Bacteria | 708 |
| 850 | Ga0495635_0254938 | 3300046663 | Bacteria | 1182 |
| 851 | Ga0495659_0090722 | 3300046664 | Bacteria | 1173 |
| 852 | Ga0495588_0000099 | 3300046674 | Bacteria | 164015 |
| 853 | Ga0495669_0002213 | 3300046684 | Bacteria | 7982 |
| 854 | Ga0495624_0461184 | 3300046690 | Bacteria | 761 |
| 855 | Ga0495670_0031106 | 3300046691 | Bacteria | 2652 |
| 856 | Ga0495671_0029695 | 3300046692 | Bacteria | 2804 |
| 857 | Ga0495660_0078932 | 3300046810 | Bacteria | 1729 |
| 858 | Ga0495581_0245392 | 3300047315 | Bacteria | 1047 |
| 859 | Ga0495636_0013436 | 3300047318 | Bacteria | 3250 |
| 860 | Ga0495636_0045863 | 3300047318 | Bacteria | 1822 |
| 861 | Ga0495672_0000021 | 3300047320 | Bacteria | 422795 |
| 862 | Ga0495672_0000079 | 3300047320 | Bacteria | 161885 |
| 863 | Ga0495672_0021922 | 3300047320 | Bacteria | 4160 |
| 864 | Ga0495672_0087013 | 3300047320 | Bacteria | 1726 |
| 865 | Ga0495672_0106030 | 3300047320 | Bacteria | 1516 |
| 866 | Ga0495672_0258478 | 3300047320 | Bacteria | 842 |
| 867 | Ga0495683_0090294 | 3300047323 | Bacteria | 1485 |
| 868 | Ga0495683_0139742 | 3300047323 | Bacteria | 1136 |
| 869 | Ga0495679_091342 | 3300047446 | Bacteria | 854 |
| 870 | Ga0495685_109045 | 3300047447 | Bacteria | 912 |
| 871 | Ga0495673_0000024 | 3300047469 | Bacteria | 521349 |
| 872 | Ga0495673_0000030 | 3300047469 | Bacteria | 468915 |
| 873 | Ga0495673_0116076 | 3300047469 | Bacteria | 1064 |
| 874 | Ga0495673_0142974 | 3300047469 | Bacteria | 931 |
| 875 | Ga0495686_0007958 | 3300047472 | Bacteria | 7865 |
| 876 | Ga0495686_0041753 | 3300047472 | Bacteria | 2919 |
| 877 | Ga0495686_0366195 | 3300047472 | Bacteria | 780 |
| 878 | Ga0495626_0001155 | 3300048091 | Bacteria | 22059 |
| 879 | Ga0495626_0263885 | 3300048091 | Bacteria | 688 |
| 880 | Ga0496100_0021799 | 3300048903 | Bacteria | 3865 |
| 881 | Ga0496101_0514377 | 3300048904 | Bacteria | 946 |
| 882 | Ga0496102_0001905 | 3300048905 | Bacteria | 17998 |
| 883 | Ga0496102_0010957 | 3300048905 | Bacteria | 7811 |
| 884 | Ga0496102_0116475 | 3300048905 | Bacteria | 2494 |
| 885 | Ga0496102_0383054 | 3300048905 | Bacteria | 1323 |
| 886 | Ga0496102_0572921 | 3300048905 | Bacteria | 1052 |
| 887 | Ga0496102_0866934 | 3300048905 | Bacteria | 825 |
| 888 | Ga0496103_0009452 | 3300048906 | Bacteria | 5773 |
| 889 | Ga0496104_0014540 | 3300048907 | Bacteria | 7109 |
| 890 | Ga0496104_0120097 | 3300048907 | Bacteria | 2523 |
| 891 | Ga0496104_0526604 | 3300048907 | Bacteria | 1093 |
| 892 | Ga0496105_0013537 | 3300048908 | Bacteria | 6480 |
| 893 | Ga0496105_0764166 | 3300048908 | Bacteria | 737 |
| 894 | Ga0496105_0777309 | 3300048908 | Bacteria | 730 |
| 895 | Ga0496106_0009896 | 3300048909 | Bacteria | 7039 |
| 896 | Ga0496106_0061640 | 3300048909 | Bacteria | 2846 |
| 897 | Ga0496106_0471881 | 3300048909 | Bacteria | 1008 |
| 898 | Ga0496107_0020354 | 3300048910 | Bacteria | 4685 |
| 899 | Ga0496107_0040743 | 3300048910 | Bacteria | 3335 |
| 900 | Ga0496107_0064878 | 3300048910 | Bacteria | 2647 |
| 901 | Ga0496107_0309233 | 3300048910 | Bacteria | 1176 |
| 902 | Ga0496107_0329060 | 3300048910 | Bacteria | 1137 |
| 903 | Ga0496108_0034386 | 3300048911 | Bacteria | 4211 |
| 904 | Ga0496108_0047915 | 3300048911 | Bacteria | 3573 |
| 905 | Ga0496108_0050962 | 3300048911 | Bacteria | 3467 |
| 906 | Ga0496108_0372899 | 3300048911 | Bacteria | 1246 |
| 907 | Ga0496108_0835152 | 3300048911 | Bacteria | 793 |
| 908 | Ga0496109_0082698 | 3300048912 | Bacteria | 2959 |
| 909 | Ga0496109_0120495 | 3300048912 | Bacteria | 2444 |
| 910 | Ga0496109_0177110 | 3300048912 | Bacteria | 2002 |
| 911 | Ga0496110_0211017 | 3300048913 | Bacteria | 1765 |
| 912 | Ga0496111_0067136 | 3300048914 | Bacteria | 2605 |
| 913 | Ga0496111_0101823 | 3300048914 | Bacteria | 2110 |
| 914 | Ga0496111_0309633 | 3300048914 | Bacteria | 1170 |
| 915 | Ga0496112_0001802 | 3300048915 | Bacteria | 16862 |
| 916 | Ga0496112_0052086 | 3300048915 | Bacteria | 4016 |
| 917 | Ga0496112_0432707 | 3300048915 | Bacteria | 1254 |
| 918 | Ga0496113_0086146 | 3300048916 | Bacteria | 2414 |
| 919 | Ga0496113_0102149 | 3300048916 | Bacteria | 2223 |
| 920 | Ga0496113_0753936 | 3300048916 | Bacteria | 775 |
| 921 | Ga0496114_0138207 | 3300048917 | Bacteria | 2107 |
| 922 | Ga0496114_0280104 | 3300048917 | Bacteria | 1470 |
| 923 | Ga0496115_0000295 | 3300048918 | Bacteria | 42998 |
| 924 | Ga0496115_0203872 | 3300048918 | Bacteria | 1634 |
| 925 | Ga0496117_0130115 | 3300048920 | Bacteria | 1527 |
| 926 | Ga0496117_0300098 | 3300048920 | Bacteria | 851 |
| 927 | Ga0496118_0131491 | 3300048921 | Bacteria | 1606 |
| 928 | Ga0496118_0139362 | 3300048921 | Bacteria | 1541 |
| 929 | Ga0496121_0003702 | 3300048924 | Bacteria | 21459 |
| 930 | Ga0496121_0082694 | 3300048924 | Bacteria | 2537 |
| 931 | Ga0496121_0302974 | 3300048924 | Bacteria | 1083 |
| 932 | Ga0496121_0462383 | 3300048924 | Bacteria | 815 |
| 933 | Ga0496122_0140949 | 3300048925 | Bacteria | 1508 |
| 934 | Ga0496123_0158430 | 3300048926 | Bacteria | 1210 |
| 935 | Ga0496124_0033172 | 3300048927 | Bacteria | 4545 |
| 936 | Ga0496124_0035157 | 3300048927 | Bacteria | 4387 |
| 937 | Ga0496124_0091593 | 3300048927 | Bacteria | 2477 |
| 938 | Ga0496124_0133963 | 3300048927 | Bacteria | 1964 |
| 939 | Ga0496125_0213885 | 3300048928 | Bacteria | 1249 |
| 940 | Ga0496125_0277585 | 3300048928 | Bacteria | 1040 |
| 941 | Ga0496126_0056218 | 3300048929 | Bacteria | 3558 |
| 942 | Ga0496126_0396373 | 3300048929 | Bacteria | 1120 |
| 943 | Ga0496126_0507797 | 3300048929 | Bacteria | 962 |
| 944 | Ga0495678_000304 | 3300049459 | Bacteria | 53274 |
| 945 | Ga0495678_086855 | 3300049459 | Bacteria | 1111 |
| 946 | Ga0501034_0805293 | 3300049571 | Bacteria | 832 |
| 947 | Ga0501036_0214528 | 3300049572 | Bacteria | 1617 |
| 948 | Ga0501038_0125782 | 3300049574 | Bacteria | 2110 |
| 949 | Ga0501039_0172792 | 3300049575 | Bacteria | 1699 |
| 950 | Ga0501039_0401824 | 3300049575 | Bacteria | 1076 |
| 951 | Ga0501040_0004633 | 3300049576 | Bacteria | 8922 |
| 952 | Ga0501042_0050476 | 3300049578 | Bacteria | 2967 |
| 953 | Ga0501042_0295689 | 3300049578 | Bacteria | 1170 |
| 954 | Ga0501043_0554782 | 3300049579 | Bacteria | 853 |
| 955 | Ga0501048_0014061 | 3300049582 | Bacteria | 5932 |
| 956 | Ga0501067_0058336 | 3300049583 | Bacteria | 2138 |
| 957 | Ga0501068_0110697 | 3300049584 | Bacteria | 1707 |
| 958 | Ga0501071_0045517 | 3300049587 | Bacteria | 3150 |
| 959 | Ga0501071_0434968 | 3300049587 | Bacteria | 1003 |
| 960 | Ga0501072_0406133 | 3300049588 | Bacteria | 1080 |
| 961 | Ga0501074_0283667 | 3300049590 | Bacteria | 1177 |
| 962 | Ga0501075_0557659 | 3300049591 | Bacteria | 874 |
| 963 | Ga0501076_0932464 | 3300049592 | Bacteria | 716 |
| 964 | Ga0501216_038105 | 3300049660 | Bacteria | 911 |
| 965 | Ga0501229_013874 | 3300049706 | Bacteria | 1036 |
| 966 | Ga0501079_0120218 | 3300049741 | Bacteria | 2043 |
| 967 | Ga0501080_0016546 | 3300049742 | Bacteria | 6814 |
| 968 | Ga0501081_0067829 | 3300049743 | Bacteria | 2483 |
| 969 | Ga0501262_016230 | 3300049759 | Bacteria | 984 |
| 970 | Ga0501265_010433 | 3300049762 | Bacteria | 1134 |
| 971 | Ga0501044_0775254 | 3300049823 | Bacteria | 840 |
| 972 | nmdc:mga03683_114812_c1 | 3300050489 | Bacteria | 1193 |
| 973 | nmdc:mga03n38_215760_c1 | 3300050490 | Bacteria | 999 |
| 974 | nmdc:mga03n38_7482_c1 | 3300050490 | Bacteria | 3868 |
| 975 | nmdc:mga00v17_340881_c1 | 3300050491 | Bacteria | 974 |
| 976 | nmdc:mga00v17_445548_c1 | 3300050491 | Bacteria | 841 |
| 977 | nmdc:mga0yw44_116949_c1 | 3300050492 | Bacteria | 1714 |
| 978 | nmdc:mga0yw44_177427_c1 | 3300050492 | Bacteria | 1401 |
| 979 | nmdc:mga0yw44_311267_c1 | 3300050492 | Bacteria | 1056 |
| 980 | nmdc:mga06z11_298060_c1 | 3300050494 | Bacteria | 958 |
| 981 | nmdc:mga06z11_328741_c1 | 3300050494 | Bacteria | 913 |
| 982 | nmdc:mga06z11_72334_c1 | 3300050494 | Bacteria | 1828 |
| 983 | nmdc:mga04h51_55663_c1 | 3300050495 | Bacteria | 1340 |
| 984 | nmdc:mga07m45_156605_c1 | 3300050496 | Bacteria | 1322 |
| 985 | nmdc:mga05p37_134216_c1 | 3300050507 | Bacteria | 3036 |
| 986 | nmdc:mga05p37_191374_c1 | 3300050507 | Bacteria | 2483 |
| 987 | nmdc:mga05p37_209_c1 | 3300050507 | Bacteria | 59030 |
| 988 | nmdc:mga05p37_38529_c1 | 3300050507 | Bacteria | 5863 |
| 989 | nmdc:mga05p37_615236_c1 | 3300050507 | Bacteria | 1223 |
| 990 | nmdc:mga09592_150_c1 | 3300050508 | Bacteria | 47613 |
| 991 | nmdc:mga09592_163437_c1 | 3300050508 | Bacteria | 1924 |
| 992 | nmdc:mga09592_4737_c1 | 3300050508 | Bacteria | 11019 |
| 993 | nmdc:mga09592_581494_c1 | 3300050508 | Bacteria | 960 |
| 994 | nmdc:mga0qj67_131328_c1 | 3300050509 | Bacteria | 2029 |
| 995 | nmdc:mga0qj67_135084_c1 | 3300050509 | Bacteria | 1999 |
| 996 | nmdc:mga0qj67_452189_c1 | 3300050509 | Bacteria | 1035 |
| 997 | nmdc:mga06r32_14895_c1 | 3300050510 | Bacteria | 7056 |
| 998 | nmdc:mga06r32_252374_c1 | 3300050510 | Bacteria | 1752 |
| 999 | nmdc:mga08y16_135314_c1 | 3300050511 | Bacteria | 2561 |
| 1000 | nmdc:mga08y16_38103_c1 | 3300050511 | Bacteria | 5048 |
| 1001 | nmdc:mga08y16_66743_c1 | 3300050511 | Bacteria | 3755 |
| 1002 | nmdc:mga08y16_7676_c1 | 3300050511 | Bacteria | 11291 |
| 1003 | nmdc:mga0n895_156526_c1 | 3300050512 | Bacteria | 2309 |
| 1004 | nmdc:mga0n895_923700_c1 | 3300050512 | Bacteria | 857 |
| 1005 | nmdc:mga0rr50_80679_c1 | 3300050513 | Bacteria | 2509 |
| 1006 | nmdc:mga0rr50_818697_c1 | 3300050513 | Bacteria | 794 |
| 1007 | nmdc:mga08x19_22166_c1 | 3300050514 | Bacteria | 3931 |
| 1008 | nmdc:mga08x19_39288_c1 | 3300050514 | Bacteria | 3008 |
| 1009 | nmdc:mga08x19_55_c1 | 3300050514 | Bacteria | 120851 |
| 1010 | nmdc:mga08x19_610179_c1 | 3300050514 | Bacteria | 773 |
| 1011 | nmdc:mga0sz30_292640_c1 | 3300050516 | Bacteria | 726 |
| 1012 | Ga0500643_062941 | 3300053087 | Bacteria | 1039 |
| 1013 | Ga0500583_0127671 | 3300053092 | Bacteria | 1260 |
| 1014 | Ga0500566_0278844 | 3300053094 | Bacteria | 797 |
| 1015 | Ga0500641_0127854 | 3300053096 | Bacteria | 1096 |
| 1016 | Ga0500554_035556 | 3300053102 | Bacteria | 1499 |
| 1017 | Ga0500572_017424 | 3300053111 | Bacteria | 1845 |
| 1018 | Ga0500572_072164 | 3300053111 | Bacteria | 1069 |
| 1019 | Ga0500595_002541 | 3300053119 | Bacteria | 8942 |
| 1020 | Ga0500595_012296 | 3300053119 | Bacteria | 3316 |
| 1021 | Ga0500595_111956 | 3300053119 | Bacteria | 775 |
| 1022 | Ga0500608_233487 | 3300053122 | Bacteria | 732 |
| 1023 | Ga0500655_016684 | 3300053133 | Bacteria | 1354 |
| 1024 | Ga0500559_0004336 | 3300053136 | Bacteria | 6764 |
| 1025 | Ga0500574_081549 | 3300053141 | Bacteria | 954 |
| 1026 | Ga0500586_011368 | 3300053145 | Bacteria | 2547 |
| 1027 | Ga0500603_029207 | 3300053150 | Bacteria | 1412 |
| 1028 | Ga0500620_011225 | 3300053155 | Bacteria | 2394 |
| 1029 | Ga0500638_155261 | 3300053162 | Bacteria | 1013 |
| 1030 | Ga0500639_033994 | 3300053163 | Bacteria | 2694 |
| 1031 | Ga0500636_0007802 | 3300053177 | Bacteria | 6190 |
| 1032 | Ga0500637_0088589 | 3300053178 | Bacteria | 1790 |
| 1033 | Ga0500661_040282 | 3300055283 | Bacteria | 827 |
| 1034 | Ga0590071_011723 | 3300059421 | Bacteria | 2051 |
| 1035 | Ga0466962_0017422 | 3300061719 | Bacteria | 3458 |
| 1036 | Ga0530510_0771974 | 3300061734 | Bacteria | 733 |
| 1037 | 2513657470 | 2513237096 | Bacteria | 8722461 |
| 1038 | 2513861202 | 2513237137 | Bacteria | 9558895 |
| 1039 | 2513916723 | 2513237145 | Bacteria | 8979722 |
| 1040 | 2517889630 | 2517572143 | Bacteria | 9484767 |
| 1041 | 2524533200 | 2524023228 | Bacteria | 10118060 |
| 1042 | 2644337844 | 2643221660 | Bacteria | 4208257 |
| 1043 | 2671119482 | 2667528175 | Bacteria | 7532676 |
| 1044 | 2793084093 | |||
| 1045 | 2857554220 | 2857553236 | Bacteria | 6166726 |
| 1046 | 2857559826 | 2857558681 | Bacteria | 6617694 |
| 1047 | 2857564991 | 2857564685 | Bacteria | 6290584 |
| 1048 | 2876811102 | 2876808645 | Bacteria | 8824342 |
| 1049 | 2879116994 | 2879110137 | Bacteria | 8907982 |
| 1050 | 2889036407 | 2889033259 | Bacteria | 9099371 |
| 1051 | 2903756083 | 2903748898 | Bacteria | 9972761 |
| 1052 | 2904707614 | |||
| 1053 | 2906614608 | |||
| 1054 | 2906642087 | 2906635258 | Bacteria | 8601019 |
| 1055 | 2906666467 | 2906660503 | Bacteria | 8595048 |
| 1056 | 2908746570 | 2908739725 | Bacteria | 8628932 |
| 1057 | 2922366717 | 2922361189 | Bacteria | 7436256 |
| 1058 | 2922389379 | 2922386360 | Bacteria | 7017218 |
| 1059 | 2922426469 | |||
| 1060 | 2935632810 | 2935630451 | Bacteria | 8169952 |
| 1061 | 2939592420 | 2939589442 | Bacteria | 4214238 |
| 1062 | 2939636090 | 2939631187 | Bacteria | 6118131 |
| 1063 | 2941508526 | 2941507105 | Bacteria | 8166816 |
| 1064 | 2941516356 | 2941515067 | Bacteria | 8166720 |
| 1065 | 2941524628 | 2941523033 | Bacteria | 8169134 |
| 1066 | 2974310226 | 2974307012 | Bacteria | 4172388 |
| 1067 | 2977250952 | 2977247770 | Bacteria | 4160543 |
| 1068 | 2984514554 | 2984514374 | Bacteria | 4172479 |
| 1069 | 3005475811 | 3005474847 | Bacteria | 9259049 |
| 1070 | 8006937128 | 8006933436 | Bacteria | 10410654 |
| 1071 | 8006977138 | 8006973647 | Bacteria | 10679141 |
| 1072 | 8006993125 | 8006984368 | Bacteria | 9651211 |
| 1073 | 8019561531 | 8019555841 | Bacteria | 9642137 |
| 1074 | 8019571607 | 8019565922 | Bacteria | 9639779 |
| 1075 | 8056678165 | 8056673599 | Bacteria | 7871253 |
| 1076 | 8056683444 | 8056681323 | Bacteria | 8472857 |
| 1077 | Ga0075365_10197273 | |||
| 1078 | JGI24751J29686_10022294 | |||
| 1079 | JGI25150J39212_1000628 | |||
| 1080 | JGI25406J46586_10023564 | |||
| 1081 | JGI25153J46596_10001338 | |||
| 1082 | rootL2_10033244 | |||
| 1083 | rootL2_10133234 | |||
| 1084 | Ga0055526_1000198 | |||
| 1085 | Ga0055526_1000218 | |||
| 1086 | Ga0055526_1003042 | |||
| 1087 | Ga0055537_1000790 | |||
| 1088 | Ga0055534_1000180 | |||
| 1089 | Ga0055528_1000262 | |||
| 1090 | Ga0055530_10009923 | |||
| 1091 | Ga0055530_10052351 | |||
| 1092 | Ga0055530_10062741 | |||
| 1093 | Ga0055540_1016176 | |||
| 1094 | Ga0055540_1023639 | |||
| 1095 | Ga0065715_10022737 | |||
| 1096 | Ga0065707_10288654 | |||
| 1097 | Ga0070658_10054218 | |||
| 1098 | Ga0070658_10066192 | |||
| 1099 | Ga0070658_10490996 | |||
| 1100 | Ga0070676_10086765 | |||
| 1101 | Ga0070676_10217250 | |||
| 1102 | Ga0070683_100134544 | |||
| 1103 | Ga0070683_100263427 | |||
| 1104 | Ga0070683_100874374 | |||
| 1105 | Ga0070670_100120456 | |||
| 1106 | Ga0070670_100243204 | |||
| 1107 | Ga0070677_10002466 | |||
| 1108 | Ga0070677_10255665 | |||
| 1109 | Ga0068869_100000108 | |||
| 1110 | Ga0068869_100020312 | |||
| 1111 | Ga0068869_100028565 | |||
| 1112 | Ga0068869_100049825 | |||
| 1113 | Ga0068869_100110247 | |||
| 1114 | Ga0070666_10038220 | |||
| 1115 | Ga0070666_10331269 | |||
| 1116 | Ga0070666_10563692 | |||
| 1117 | Ga0070680_100247583 | |||
| 1118 | Ga0070680_100543169 | |||
| 1119 | Ga0070682_100107660 | |||
| 1120 | Ga0070682_100135317 | |||
| 1121 | Ga0070682_100636601 | |||
| 1122 | Ga0068868_100056259 | |||
| 1123 | Ga0068868_100063616 | |||
| 1124 | Ga0068868_100111191 | |||
| 1125 | Ga0068868_100148026 | |||
| 1126 | Ga0068868_100286347 | |||
| 1127 | Ga0070660_100005400 | |||
| 1128 | Ga0070660_100012123 | |||
| 1129 | Ga0070660_100178680 | |||
| 1130 | Ga0070689_100114572 | |||
| 1131 | Ga0070687_100413572 | |||
| 1132 | Ga0070661_100006353 | |||
| 1133 | Ga0070661_100007131 | |||
| 1134 | Ga0070661_100057780 | |||
| 1135 | Ga0070661_100430512 | |||
| 1136 | Ga0070692_10060812 | |||
| 1137 | Ga0070692_10167276 | |||
| 1138 | Ga0070668_100016851 | |||
| 1139 | Ga0070668_100018823 | |||
| 1140 | Ga0070668_100025885 | |||
| 1141 | Ga0070668_100031665 | |||
| 1142 | Ga0070668_100090578 | |||
| 1143 | Ga0070668_100094000 | |||
| 1144 | Ga0070668_100120049 | |||
| 1145 | Ga0070668_100224242 | |||
| 1146 | Ga0070669_100013057 | |||
| 1147 | Ga0070669_100028863 | |||
| 1148 | Ga0070669_100088425 | |||
| 1149 | Ga0070669_100133174 | |||
| 1150 | Ga0070669_100222466 | |||
| 1151 | Ga0070669_100308067 | |||
| 1152 | Ga0070669_100391885 | |||
| 1153 | Ga0070669_100655948 | |||
| 1154 | Ga0070675_100084625 | |||
| 1155 | Ga0070675_100234544 | |||
| 1156 | Ga0070675_100321954 | |||
| 1157 | Ga0070675_100344366 | |||
| 1158 | Ga0070675_100348051 | |||
| 1159 | Ga0070675_100420827 | |||
| 1160 | Ga0070671_100007885 | |||
| 1161 | Ga0070671_100385010 | |||
| 1162 | Ga0070671_100458067 | |||
| 1163 | Ga0070671_100524851 | |||
| 1164 | Ga0070674_100019883 | |||
| 1165 | Ga0070674_100021123 | |||
| 1166 | Ga0070674_100022113 | |||
| 1167 | Ga0070674_100030839 | |||
| 1168 | Ga0070674_100139236 | |||
| 1169 | Ga0070674_100193973 | |||
| 1170 | Ga0070673_100162386 | |||
| 1171 | Ga0070673_100239533 | |||
| 1172 | Ga0070673_100513294 | |||
| 1173 | Ga0070673_100747066 | |||
| 1174 | Ga0070688_100020439 | |||
| 1175 | Ga0070688_100283626 | |||
| 1176 | Ga0070659_100001088 | |||
| 1177 | Ga0070659_100022667 | |||
| 1178 | Ga0070659_100092659 | |||
| 1179 | Ga0070659_100243227 | |||
| 1180 | Ga0070659_100320829 | |||
| 1181 | Ga0070659_100343157 | |||
| 1182 | Ga0070667_100041022 | |||
| 1183 | Ga0070667_100059966 | |||
| 1184 | Ga0070667_100174002 | |||
| 1185 | Ga0070667_100533825 | |||
| 1186 | Ga0070667_100819341 | |||
| 1187 | Ga0070703_10164315 | |||
| 1188 | Ga0070709_10189103 | |||
| 1189 | Ga0070714_100081392 | |||
| 1190 | Ga0070713_100824998 | |||
| 1191 | Ga0070701_10059957 | |||
| 1192 | Ga0070701_10129129 | |||
| 1193 | Ga0070711_100088699 | |||
| 1194 | Ga0070711_100156253 | |||
| 1195 | Ga0070705_100050412 | |||
| 1196 | Ga0070705_100141440 | |||
| 1197 | Ga0070705_100649683 | |||
| 1198 | Ga0070700_100003206 | |||
| 1199 | Ga0070700_100413556 | |||
| 1200 | Ga0070694_100011084 | |||
| 1201 | Ga0070694_100059684 | |||
| 1202 | Ga0070694_100452485 | |||
| 1203 | Ga0070708_100058166 | |||
| 1204 | Ga0070708_100248456 | |||
| 1205 | Ga0070663_100025065 | |||
| 1206 | Ga0070663_100040343 | |||
| 1207 | Ga0070663_100125775 | |||
| 1208 | Ga0070663_100189959 | |||
| 1209 | Ga0070663_100203418 | |||
| 1210 | Ga0070663_100387388 | |||
| 1211 | Ga0070663_100700897 | |||
| 1212 | Ga0070678_100027111 | |||
| 1213 | Ga0070678_100171756 | |||
| 1214 | Ga0070678_100201052 | |||
| 1215 | Ga0070678_100335735 | |||
| 1216 | Ga0070662_100000134 | |||
| 1217 | Ga0070662_100095159 | |||
| 1218 | Ga0070681_10532994 | |||
| 1219 | Ga0068867_100000126 | |||
| 1220 | Ga0068867_100009464 | |||
| 1221 | Ga0068867_100121493 | |||
| 1222 | Ga0068867_100157700 | |||
| 1223 | Ga0068867_100175113 | |||
| 1224 | Ga0068867_100313851 | |||
| 1225 | Ga0068867_100432244 | |||
| 1226 | Ga0070685_10098733 | |||
| 1227 | Ga0070706_100030612 | |||
| 1228 | Ga0070707_100040082 | |||
| 1229 | Ga0070699_100003308 | |||
| 1230 | Ga0070699_100045054 | |||
| 1231 | Ga0070699_100687793 | |||
| 1232 | Ga0070679_100012228 | |||
| 1233 | Ga0070679_100195222 | |||
| 1234 | Ga0070679_100348458 | |||
| 1235 | Ga0070684_100033871 | |||
| 1236 | Ga0070684_100138955 | |||
| 1237 | Ga0070697_100015469 | |||
| 1238 | Ga0068853_100000458 | |||
| 1239 | Ga0068853_100121596 | |||
| 1240 | Ga0068853_100688275 | |||
| 1241 | Ga0070672_100045716 | |||
| 1242 | Ga0070672_100090790 | |||
| 1243 | Ga0070672_100106878 | |||
| 1244 | Ga0070672_100275045 | |||
| 1245 | Ga0070672_100296559 | |||
| 1246 | Ga0070686_100208741 | |||
| 1247 | Ga0070686_100527002 | |||
| 1248 | Ga0070695_100002348 | |||
| 1249 | Ga0070695_100188331 | |||
| 1250 | Ga0070696_100001808 | |||
| 1251 | Ga0070693_100055156 | |||
| 1252 | Ga0070665_100018469 | |||
| 1253 | Ga0070665_100031980 | |||
| 1254 | Ga0070665_100063857 | |||
| 1255 | Ga0070665_100348152 | |||
| 1256 | Ga0070665_100504053 | |||
| 1257 | Ga0070704_100001833 | |||
| 1258 | Ga0070704_100073317 | |||
| 1259 | Ga0070704_100175710 | |||
| 1260 | Ga0070704_100385774 | |||
| 1261 | Ga0068855_100001419 | |||
| 1262 | Ga0068855_100127510 | |||
| 1263 | Ga0068855_100159333 | |||
| 1264 | Ga0068855_100187278 | |||
| 1265 | Ga0068855_100314928 | |||
| 1266 | Ga0068855_100834500 | |||
| 1267 | Ga0070664_100022570 | |||
| 1268 | Ga0070664_100029120 | |||
| 1269 | Ga0070664_100045817 | |||
| 1270 | Ga0070664_100095464 | |||
| 1271 | Ga0070664_100250675 | |||
| 1272 | Ga0070664_100744052 | |||
| 1273 | Ga0068857_100090614 | |||
| 1274 | Ga0068857_100114401 | |||
| 1275 | Ga0068857_101208364 | |||
| 1276 | Ga0068854_100024108 | |||
| 1277 | Ga0068854_100276410 | |||
| 1278 | Ga0068854_100674803 | |||
| 1279 | Ga0068856_100000265 | |||
| 1280 | Ga0068856_100208376 | |||
| 1281 | Ga0068856_100572465 | |||
| 1282 | Ga0070702_100021708 | |||
| 1283 | Ga0070702_100309967 | |||
| 1284 | Ga0070702_100476993 | |||
| 1285 | Ga0068852_100197004 | |||
| 1286 | Ga0068852_100242791 | |||
| 1287 | Ga0068852_100297249 | |||
| 1288 | Ga0068852_100505901 | |||
| 1289 | Ga0068859_100087220 | |||
| 1290 | Ga0068859_100107772 | |||
| 1291 | Ga0068859_100241030 | |||
| 1292 | Ga0068859_100517306 | |||
| 1293 | Ga0068859_100582057 | |||
| 1294 | Ga0068864_100015296 | |||
| 1295 | Ga0068864_100102798 | |||
| 1296 | Ga0068864_100113505 | |||
| 1297 | Ga0068866_10033930 | |||
| 1298 | Ga0068866_10062661 | |||
| 1299 | Ga0068866_10109947 | |||
| 1300 | Ga0068866_10277517 | |||
| 1301 | Ga0068861_100000134 | |||
| 1302 | Ga0068861_100024453 | |||
| 1303 | Ga0068861_100026946 | |||
| 1304 | Ga0068861_100040936 | |||
| 1305 | Ga0068861_100073614 | |||
| 1306 | Ga0068861_100179829 | |||
| 1307 | Ga0068861_100245590 | |||
| 1308 | Ga0068861_100531090 | |||
| 1309 | Ga0068861_100676169 | |||
| 1310 | Ga0068851_10009081 | |||
| 1311 | Ga0068851_10038811 | |||
| 1312 | Ga0068851_10043848 | |||
| 1313 | Ga0068863_100127597 | |||
| 1314 | Ga0068863_100509264 | |||
| 1315 | Ga0068863_100523160 | |||
| 1316 | Ga0068863_100684032 | |||
| 1317 | Ga0068858_100004830 | |||
| 1318 | Ga0068858_100033213 | |||
| 1319 | Ga0068858_100114315 | |||
| 1320 | Ga0068858_100360429 | |||
| 1321 | Ga0068858_100515963 | |||
| 1322 | Ga0068858_100561099 | |||
| 1323 | Ga0068860_100024360 | |||
| 1324 | Ga0068860_100056905 | |||
| 1325 | Ga0068860_100109845 | |||
| 1326 | Ga0068860_100313172 | |||
| 1327 | Ga0068860_100314642 | |||
| 1328 | Ga0068860_100323708 | |||
| 1329 | Ga0068860_100361394 | |||
| 1330 | Ga0068860_100457368 | |||
| 1331 | Ga0068860_101247787 | |||
| 1332 | Ga0068862_100001111 | |||
| 1333 | Ga0068862_100031836 | |||
| 1334 | Ga0068862_100157649 | |||
| 1335 | Ga0068862_100486919 | |||
| 1336 | Ga0068862_100619419 | |||
| 1337 | Ga0068862_100806479 | |||
| 1338 | Ga0068862_100962104 | |||
| 1339 | Ga0081455_10011490 | |||
| 1340 | Ga0081455_10013541 | |||
| 1341 | Ga0081455_10160337 | |||
| 1342 | Ga0081540_1002758 | |||
| 1343 | Ga0081540_1011235 | |||
| 1344 | Ga0081540_1011459 | |||
| 1345 | Ga0081540_1027454 | |||
| 1346 | Ga0081540_1028410 | |||
| 1347 | Ga0081540_1035676 | |||
| 1348 | Ga0081540_1068810 | |||
| 1349 | Ga0081540_1071970 | |||
| 1350 | Ga0081540_1120933 | |||
| 1351 | Ga0081539_10000157 | |||
| 1352 | Ga0081539_10004364 | |||
| 1353 | Ga0081539_10013206 | |||
| 1354 | Ga0081539_10047257 | |||
| 1355 | Ga0075365_10035982 | |||
| 1356 | Ga0075365_10391628 | |||
| 1357 | Ga0075368_10026128 | |||
| 1358 | Ga0075368_10066870 | |||
| 1359 | Ga0075368_10072890 | |||
| 1360 | Ga0075363_100005124 | |||
| 1361 | Ga0075363_100273555 | |||
| 1362 | Ga0075364_10039828 | |||
| 1363 | Ga0075364_10255648 | |||
| 1364 | Ga0070712_100242081 | |||
| 1365 | Ga0075367_10021040 | |||
| 1366 | Ga0075367_10039085 | |||
| 1367 | Ga0075367_10148621 | |||
| 1368 | Ga0075367_10169285 | |||
| 1369 | Ga0075367_10202034 | |||
| 1370 | Ga0075367_10360377 | |||
| 1371 | Ga0075367_10390709 | |||
| 1372 | Ga0075369_10210627 | |||
| 1373 | Ga0075366_10072746 | |||
| 1374 | Ga0097621_100104530 | |||
| 1375 | Ga0097621_100373255 | |||
| 1376 | Ga0075370_10050352 | |||
| 1377 | Ga0075370_10402949 | |||
| 1378 | Ga0068871_100449357 | |||
| 1379 | Ga0075428_100017818 | |||
| 1380 | Ga0075428_100211597 | |||
| 1381 | Ga0075428_100354924 | |||
| 1382 | Ga0075430_100084363 | |||
| 1383 | Ga0075430_100670677 | |||
| 1384 | Ga0075431_100018399 | |||
| 1385 | Ga0075431_100131935 | |||
| 1386 | Ga0075434_100201802 | |||
| 1387 | Ga0075429_100010239 | |||
| 1388 | Ga0075429_100110711 | |||
| 1389 | Ga0068865_100034493 | |||
| 1390 | Ga0068865_100183572 | |||
| 1391 | Ga0075436_100000050 | |||
| 1392 | Ga0075436_100005257 | |||
| 1393 | Ga0075436_100007947 | |||
| 1394 | Ga0075436_100609756 | |||
| 1395 | Ga0097620_100087224 | |||
| 1396 | Ga0097620_100107770 | |||
| 1397 | Ga0097620_100241038 | |||
| 1398 | Ga0097620_100517361 | |||
| 1399 | Ga0097620_100582117 | |||
| 1400 | Ga0075435_100041256 | |||
| 1401 | Ga0075435_100396203 | |||
| 1402 | Ga0075435_100495687 | |||
| 1403 | Ga0099794_10109280 | |||
| 1404 | Ga0099794_10142775 | |||
| 1405 | Ga0099794_10302669 | |||
| 1406 | Ga0105251_10001824 | |||
| 1407 | Ga0105250_10167931 | |||
| 1408 | Ga0105240_10118311 | |||
| 1409 | Ga0111539_10040711 | |||
| 1410 | Ga0111539_10055286 | |||
| 1411 | Ga0111539_10061749 | |||
| 1412 | Ga0111539_11050481 | |||
| 1413 | Ga0111539_11304903 | |||
| 1414 | Ga0105245_10054214 | |||
| 1415 | Ga0105245_10374427 | |||
| 1416 | Ga0105245_10447229 | |||
| 1417 | Ga0105245_10832374 | |||
| 1418 | Ga0105247_10047736 | |||
| 1419 | Ga0105247_10470944 | |||
| 1420 | Ga0114129_10044616 | |||
| 1421 | Ga0114129_10067343 | |||
| 1422 | Ga0114129_10238075 | |||
| 1423 | Ga0114129_10401408 | |||
| 1424 | Ga0114129_10578970 | |||
| 1425 | Ga0114129_11219193 | |||
| 1426 | Ga0105243_10006474 | |||
| 1427 | Ga0105243_10345664 | |||
| 1428 | Ga0105243_10413347 | |||
| 1429 | Ga0105243_10443059 | |||
| 1430 | Ga0105243_10500450 | |||
| 1431 | Ga0105241_10587787 | |||
| 1432 | Ga0105242_10332109 | |||
| 1433 | Ga0105248_10002088 | |||
| 1434 | Ga0105248_10015422 | |||
| 1435 | Ga0105248_10458614 | |||
| 1436 | Ga0105248_10680063 | |||
| 1437 | Ga0105248_10822032 | |||
| 1438 | Ga0105237_10097698 | |||
| 1439 | Ga0105238_10016932 | |||
| 1440 | Ga0105238_10260559 | |||
| 1441 | Ga0105249_10002649 | |||
| 1442 | Ga0105249_10129691 | |||
| 1443 | Ga0105249_10221304 | |||
| 1444 | Ga0105249_10396731 | |||
| 1445 | Ga0105239_10099207 | |||
| 1446 | Ga0105239_10215173 | |||
| 1447 | Ga0105239_10393950 | |||
| 1448 | Ga0105246_10063209 | |||
| 1449 | Ga0105246_10105982 | |||
| 1450 | Ga0157373_10000321 | |||
| 1451 | Ga0157373_10267352 | |||
| 1452 | Ga0157371_10000470 | |||
| 1453 | Ga0157371_10286158 | |||
| 1454 | Ga0157370_10134702 | |||
| 1455 | Ga0157369_10005334 | |||
| 1456 | Ga0157369_10140396 | |||
| 1457 | Ga0157374_10044934 | |||
| 1458 | Ga0157374_10385845 | |||
| 1459 | Ga0157378_10112524 | |||
| 1460 | Ga0157378_10132465 | |||
| 1461 | Ga0157378_10454995 | |||
| 1462 | Ga0157378_10458435 | |||
| 1463 | Ga0157378_10659067 | |||
| 1464 | Ga0157378_11374209 | |||
| 1465 | Ga0163162_10046096 | |||
| 1466 | Ga0163162_10086573 | |||
| 1467 | Ga0163162_10265511 | |||
| 1468 | Ga0163162_10289386 | |||
| 1469 | Ga0163162_10460020 | |||
| 1470 | Ga0163162_10616796 | |||
| 1471 | Ga0163162_10802183 | |||
| 1472 | Ga0163162_10840522 | |||
| 1473 | Ga0157372_10002397 | |||
| 1474 | Ga0157372_10095119 | |||
| 1475 | Ga0157372_10142657 | |||
| 1476 | Ga0157372_11439873 | |||
| 1477 | Ga0157375_10036786 | |||
| 1478 | Ga0157375_10183962 | |||
| 1479 | Ga0157375_10326989 | |||
| 1480 | Ga0157375_10487970 | |||
| 1481 | Ga0157375_10982671 | |||
| 1482 | Ga0157375_11110484 | |||
| 1483 | Ga0157375_11184038 | |||
| 1484 | Ga0163163_10017844 | |||
| 1485 | Ga0163163_10027486 | |||
| 1486 | Ga0163163_10044736 | |||
| 1487 | Ga0163163_10142783 | |||
| 1488 | Ga0163163_10734283 | |||
| 1489 | Ga0157380_10010659 | |||
| 1490 | Ga0157380_10047964 | |||
| 1491 | Ga0157380_10285848 | |||
| 1492 | Ga0157380_11050571 | |||
| 1493 | Ga0182008_10029051 | |||
| 1494 | Ga0157377_10004959 | |||
| 1495 | Ga0157377_10267338 | |||
| 1496 | Ga0157379_10337136 | |||
| 1497 | Ga0157376_10222397 | |||
| 1498 | Ga0182006_1039545 | |||
| 1499 | Ga0163161_10122635 | |||
| 1500 | Ga0163161_10338769 | |||
| 1501 | Ga0213876_10029473 | |||
| 1502 | Ga0207425_1000522 | |||
| 1503 | Ga0209677_100599 | |||
| 1504 | Ga0209129_1000225 | |||
| 1505 | Ga0209233_1000907 | |||
| 1506 | Ga0209233_1003339 | |||
| 1507 | Ga0209565_1000037 | |||
| 1508 | Ga0207666_1003363 | |||
| 1509 | Ga0209455_1009913 | |||
| 1510 | Ga0209673_1000032 | |||
| 1511 | Ga0207673_1003898 | |||
| 1512 | Ga0209675_1000020 | |||
| 1513 | Ga0209564_1000009 | |||
| 1514 | Ga0209564_1000196 | |||
| 1515 | Ga0209564_1000951 | |||
| 1516 | Ga0209758_1000181 | |||
| 1517 | Ga0209758_1009611 | |||
| 1518 | Ga0209758_1020987 | |||
| 1519 | Ga0209050_1022660 | |||
| 1520 | Ga0209051_1006158 | |||
| 1521 | Ga0209051_1015429 | |||
| 1522 | Ga0209257_1000734 | |||
| 1523 | Ga0209257_1020408 | |||
| 1524 | Ga0207697_10000319 | |||
| 1525 | Ga0207656_10004660 | |||
| 1526 | Ga0207656_10037161 | |||
| 1527 | Ga0207656_10063131 | |||
| 1528 | Ga0207656_10107453 | |||
| 1529 | Ga0207682_10002499 | |||
| 1530 | Ga0207682_10068966 | |||
| 1531 | Ga0207692_10255021 | |||
| 1532 | Ga0207642_10005842 | |||
| 1533 | Ga0207642_10103452 | |||
| 1534 | Ga0207642_10181398 | |||
| 1535 | Ga0207710_10027753 | |||
| 1536 | Ga0207710_10095267 | |||
| 1537 | Ga0207688_10070330 | |||
| 1538 | Ga0207688_10080120 | |||
| 1539 | Ga0207688_10097818 | |||
| 1540 | Ga0207688_10382543 | |||
| 1541 | Ga0207680_10048128 | |||
| 1542 | Ga0207647_10267701 | |||
| 1543 | Ga0207645_10007023 | |||
| 1544 | Ga0207645_10012159 | |||
| 1545 | Ga0207645_10257223 | |||
| 1546 | Ga0207643_10000851 | |||
| 1547 | Ga0207643_10040929 | |||
| 1548 | Ga0207643_10229710 | |||
| 1549 | Ga0207684_10592652 | |||
| 1550 | Ga0207671_10083591 | |||
| 1551 | Ga0207693_10141032 | |||
| 1552 | Ga0207660_10051862 | |||
| 1553 | Ga0207660_10172306 | |||
| 1554 | Ga0207660_10618110 | |||
| 1555 | Ga0207660_10806114 | |||
| 1556 | Ga0207662_10111056 | |||
| 1557 | Ga0207657_10006415 | |||
| 1558 | Ga0207657_10008703 | |||
| 1559 | Ga0207657_10022789 | |||
| 1560 | Ga0207657_10121263 | |||
| 1561 | Ga0207657_10219851 | |||
| 1562 | Ga0207649_10005458 | |||
| 1563 | Ga0207649_10006859 | |||
| 1564 | Ga0207649_10096792 | |||
| 1565 | Ga0207649_10114007 | |||
| 1566 | Ga0207649_10205770 | |||
| 1567 | Ga0207649_10227157 | |||
| 1568 | Ga0207652_10300551 | |||
| 1569 | Ga0207652_10674951 | |||
| 1570 | Ga0207646_10054665 | |||
| 1571 | Ga0207681_10002154 | |||
| 1572 | Ga0207681_10041742 | |||
| 1573 | Ga0207681_10066301 | |||
| 1574 | Ga0207681_10101154 | |||
| 1575 | Ga0207681_10103646 | |||
| 1576 | Ga0207681_10169607 | |||
| 1577 | Ga0207681_10606554 | |||
| 1578 | Ga0207681_10633660 | |||
| 1579 | Ga0207694_10055347 | |||
| 1580 | Ga0207694_10131224 | |||
| 1581 | Ga0207650_10006975 | |||
| 1582 | Ga0207650_10010136 | |||
| 1583 | Ga0207650_10384759 | |||
| 1584 | Ga0207659_10003749 | |||
| 1585 | Ga0207659_10356410 | |||
| 1586 | Ga0207659_10988984 | |||
| 1587 | Ga0207687_10017108 | |||
| 1588 | Ga0207687_10093590 | |||
| 1589 | Ga0207687_10185053 | |||
| 1590 | Ga0207700_11049110 | |||
| 1591 | Ga0207644_10000862 | |||
| 1592 | Ga0207644_10055712 | |||
| 1593 | Ga0207644_10087820 | |||
| 1594 | Ga0207644_10098036 | |||
| 1595 | Ga0207644_10207115 | |||
| 1596 | Ga0207644_10477820 | |||
| 1597 | Ga0207690_10000395 | |||
| 1598 | Ga0207690_10167015 | |||
| 1599 | Ga0207690_10180307 | |||
| 1600 | Ga0207690_10328689 | |||
| 1601 | Ga0207706_10000002 | |||
| 1602 | Ga0207706_10007913 | |||
| 1603 | Ga0207706_10058409 | |||
| 1604 | Ga0207706_10105624 | |||
| 1605 | Ga0207706_10168439 | |||
| 1606 | Ga0207706_10287886 | |||
| 1607 | Ga0207709_10005402 | |||
| 1608 | Ga0207709_10036410 | |||
| 1609 | Ga0207709_10507525 | |||
| 1610 | Ga0207670_10007127 | |||
| 1611 | Ga0207670_10131084 | |||
| 1612 | Ga0207670_10159586 | |||
| 1613 | Ga0207670_10164935 | |||
| 1614 | Ga0207669_10012524 | |||
| 1615 | Ga0207669_10045048 | |||
| 1616 | Ga0207669_10056736 | |||
| 1617 | Ga0207669_10082542 | |||
| 1618 | Ga0207704_10000660 | |||
| 1619 | Ga0207704_10138428 | |||
| 1620 | Ga0207704_10333405 | |||
| 1621 | Ga0207691_10009804 | |||
| 1622 | Ga0207691_10040936 | |||
| 1623 | Ga0207691_10051529 | |||
| 1624 | Ga0207691_10105080 | |||
| 1625 | Ga0207691_10175832 | |||
| 1626 | Ga0207691_10298495 | |||
| 1627 | Ga0207691_10376512 | |||
| 1628 | Ga0207691_10383367 | |||
| 1629 | Ga0207691_10857830 | |||
| 1630 | Ga0207711_10339234 | |||
| 1631 | Ga0207711_10472558 | |||
| 1632 | Ga0207711_10543838 | |||
| 1633 | Ga0207689_10000030 | |||
| 1634 | Ga0207689_10002080 | |||
| 1635 | Ga0207689_10159972 | |||
| 1636 | Ga0207689_10189541 | |||
| 1637 | Ga0207689_10276225 | |||
| 1638 | Ga0207689_10314111 | |||
| 1639 | Ga0207661_10059462 | |||
| 1640 | Ga0207679_10001203 | |||
| 1641 | Ga0207679_10022620 | |||
| 1642 | Ga0207679_10024748 | |||
| 1643 | Ga0207679_10092208 | |||
| 1644 | Ga0207679_10315853 | |||
| 1645 | Ga0207679_11086428 | |||
| 1646 | Ga0207667_10002263 | |||
| 1647 | Ga0207667_10088541 | |||
| 1648 | Ga0207667_10255304 | |||
| 1649 | Ga0207667_10718801 | |||
| 1650 | Ga0207651_10198027 | |||
| 1651 | Ga0207651_10422941 | |||
| 1652 | Ga0207651_10441340 | |||
| 1653 | Ga0207651_10461859 | |||
| 1654 | Ga0207712_10008122 | |||
| 1655 | Ga0207712_10051365 | |||
| 1656 | Ga0207712_10204244 | |||
| 1657 | Ga0207668_10006932 | |||
| 1658 | Ga0207668_10009884 | |||
| 1659 | Ga0207668_10043072 | |||
| 1660 | Ga0207668_10226871 | |||
| 1661 | Ga0207668_10226893 | |||
| 1662 | Ga0207668_10912214 | |||
| 1663 | Ga0207640_10194537 | |||
| 1664 | Ga0207658_10033513 | |||
| 1665 | Ga0207658_10387850 | |||
| 1666 | Ga0207658_10411779 | |||
| 1667 | Ga0207677_10104872 | |||
| 1668 | Ga0207677_10337490 | |||
| 1669 | Ga0207703_10050608 | |||
| 1670 | Ga0207703_10252385 | |||
| 1671 | Ga0207703_10276159 | |||
| 1672 | Ga0207703_10294729 | |||
| 1673 | Ga0207703_10401911 | |||
| 1674 | Ga0207703_10777718 | |||
| 1675 | Ga0207639_10001640 | |||
| 1676 | Ga0207639_10057159 | |||
| 1677 | Ga0207639_10458196 | |||
| 1678 | Ga0207678_10003781 | |||
| 1679 | Ga0207678_10004977 | |||
| 1680 | Ga0207678_10021290 | |||
| 1681 | Ga0207678_10242617 | |||
| 1682 | Ga0207678_10258972 | |||
| 1683 | Ga0207678_10263649 | |||
| 1684 | Ga0207678_10283781 | |||
| 1685 | Ga0207678_10685534 | |||
| 1686 | Ga0207708_10000697 | |||
| 1687 | Ga0207708_10026820 | |||
| 1688 | Ga0207708_10215912 | |||
| 1689 | Ga0207702_10000655 | |||
| 1690 | Ga0207702_11281020 | |||
| 1691 | Ga0207641_10048697 | |||
| 1692 | Ga0207641_10157508 | |||
| 1693 | Ga0207641_10277568 | |||
| 1694 | Ga0207641_10294788 | |||
| 1695 | Ga0207641_10397065 | |||
| 1696 | Ga0207641_10448763 | |||
| 1697 | Ga0207648_10000352 | |||
| 1698 | Ga0207648_10027992 | |||
| 1699 | Ga0207648_10131421 | |||
| 1700 | Ga0207648_10258943 | |||
| 1701 | Ga0207648_10533572 | |||
| 1702 | Ga0207676_10005417 | |||
| 1703 | Ga0207676_10364956 | |||
| 1704 | Ga0207674_10012924 | |||
| 1705 | Ga0207674_10028634 | |||
| 1706 | Ga0207674_10777963 | |||
| 1707 | Ga0207674_10803606 | |||
| 1708 | Ga0207674_10882548 | |||
| 1709 | Ga0207675_100000223 | |||
| 1710 | Ga0207675_100003107 | |||
| 1711 | Ga0207675_100016261 | |||
| 1712 | Ga0207675_100024751 | |||
| 1713 | Ga0207675_100069177 | |||
| 1714 | Ga0207675_100187129 | |||
| 1715 | Ga0207675_100281538 | |||
| 1716 | Ga0207675_100403596 | |||
| 1717 | Ga0207675_100727209 | |||
| 1718 | Ga0207683_10044769 | |||
| 1719 | Ga0207683_10094746 | |||
| 1720 | Ga0207683_10172924 | |||
| 1721 | Ga0207683_10236554 | |||
| 1722 | Ga0207683_10341694 | |||
| 1723 | Ga0207698_10024592 | |||
| 1724 | Ga0207698_10137660 | |||
| 1725 | Ga0207698_10320950 | |||
| 1726 | Ga0209969_1025042 | |||
| 1727 | Ga0209967_1012407 | |||
| 1728 | Ga0209981_1002385 | |||
| 1729 | Ga0210000_1008319 | |||
| 1730 | Ga0209995_1003102 | |||
| 1731 | Ga0209970_1039549 | |||
| 1732 | Ga0209971_1005095 | |||
| 1733 | Ga0209971_1008432 | |||
| 1734 | Ga0209998_10002446 | |||
| 1735 | Ga0209813_10094153 | |||
| 1736 | Ga0209974_10004640 | |||
| 1737 | Ga0209974_10009535 | |||
| 1738 | Ga0207428_10024684 | |||
| 1739 | Ga0268266_10001575 | |||
| 1740 | Ga0268266_10014129 | |||
| 1741 | Ga0268266_10015559 | |||
| 1742 | Ga0268266_10141998 | |||
| 1743 | Ga0268266_10157946 | |||
| 1744 | Ga0268265_10000579 | |||
| 1745 | Ga0268265_10047066 | |||
| 1746 | Ga0268265_10152948 | |||
| 1747 | Ga0268265_10208359 | |||
| 1748 | Ga0268265_10564550 | |||
| 1749 | Ga0268265_10909750 | |||
| 1750 | Ga0268265_11048201 | |||
| 1751 | Ga0268264_10003459 | |||
| 1752 | Ga0268264_10062225 | |||
| 1753 | Ga0268264_10103649 | |||
| 1754 | Ga0268264_10178470 | |||
| 1755 | Ga0265334_10007172 | |||
| 1756 | Ga0265318_10025204 | |||
| 1757 | Ga0265323_10001672 | |||
| 1758 | Ga0265336_10001896 | |||
| 1759 | Ga0307517_10001423 | |||
| 1760 | Ga0307515_10184990 | |||
| 1761 | Ga0307515_10278535 | |||
| 1762 | Ga0265338_10000081 | |||
| 1763 | Ga0316177_1022593 | |||
| 1764 | Ga0316177_1036321 | |||
| 1765 | Ga0316180_1076004 | |||
| 1766 | Ga0316182_1048253 | |||
| 1767 | Ga0307513_10059822 | |||
| 1768 | Ga0307509_10237260 | |||
| 1769 | Ga0307408_100000576 | |||
| 1770 | Ga0307408_100015800 | |||
| 1771 | Ga0307408_100594374 | |||
| 1772 | Ga0307408_100912180 | |||
| 1773 | Ga0307508_10037831 | |||
| 1774 | Ga0316576_10054741 | |||
| 1775 | Ga0307516_10111440 | |||
| 1776 | Ga0307516_10341913 | |||
| 1777 | Ga0307405_10002481 | |||
| 1778 | Ga0307405_10570027 | |||
| 1779 | Ga0307413_10005033 | |||
| 1780 | Ga0307410_10023495 | |||
| 1781 | Ga0307406_10165607 | |||
| 1782 | Ga0307406_10571489 | |||
| 1783 | Ga0307406_10619817 | |||
| 1784 | Ga0307407_10000698 | |||
| 1785 | Ga0307407_10135361 | |||
| 1786 | Ga0307407_10318928 | |||
| 1787 | Ga0307412_10031144 | |||
| 1788 | Ga0307409_100005474 | |||
| 1789 | Ga0307409_100428575 | |||
| 1790 | Ga0307409_100496760 | |||
| 1791 | Ga0307416_100002971 | |||
| 1792 | Ga0307416_100108293 | |||
| 1793 | Ga0307416_100587278 | |||
| 1794 | Ga0307416_100638359 | |||
| 1795 | Ga0307416_101580272 | |||
| 1796 | Ga0307414_10015320 | |||
| 1797 | Ga0307411_10000867 | |||
| 1798 | Ga0307411_10089726 | |||
| 1799 | Ga0307415_100003950 | |||
| 1800 | Ga0307415_100566620 | |||
| 1801 | Ga0307510_10002798 | |||
| 1802 | Ga0307510_10372225 | |||
| 1803 | Ga0315911_1000005 | |||
| 1804 | Ga0373926_0131676 | |||
| 1805 | Ga0373923_0119002 | |||
| 1806 | Ga0373936_0023646 | |||
| 1807 | Ga0373939_0005902 | |||
| 1808 | Ga0373954_0149765 | |||
| 1809 | Ga0373943_0143052 | |||
| 1810 | Ga0373943_0159929 | |||
| 1811 | Ga0373946_0082024 | |||
| 1812 | Ga0373927_0222414 | |||
| 1813 | Ga0373933_0083335 | |||
| 1814 | Ga0373937_0026451 | |||
| 1815 | Ga0373937_0033401 | |||
| 1816 | Ga0373937_0267659 | |||
| 1817 | Ga0373937_1132319 | |||
| 1818 | Ga0316584_0377521 | |||
| 1819 | Ga0373925_0041802 | |||
| 1820 | Ga0395899_0051379 | |||
| 1821 | Ga0395899_0091067 | |||
| 1822 | Ga0395900_0004048 | |||
| 1823 | Ga0395900_0016331 | |||
| 1824 | Ga0395898_0151981 | |||
| 1825 | Ga0395898_0152485 | |||
| 1826 | Ga0395905_0001257 | |||
| 1827 | Ga0395905_0074999 | |||
| 1828 | Ga0395905_0858559 | |||
| 1829 | Ga0395901_0197417 | |||
| 1830 | Ga0395901_0525920 | |||
| 1831 | Ga0242420_007102 | |||
| 1832 | Ga0436365_1234622 | |||
| 1833 | Ga0436365_1679225 | |||
| 1834 | Ga0436360_0547434 | |||
| 1835 | Ga0436361_0801307 | |||
| 1836 | Ga0436361_1163181 | |||
| 1837 | Ga0439465_0038957 | |||
| 1838 | Ga0439465_0055851 | |||
| 1839 | Ga0451789_0629811 | |||
| 1840 | Ga0451797_1353463 | |||
| 1841 | Ga0451798_0069368 | |||
| 1842 | Ga0451807_0902416 | |||
| 1843 | Ga0451851_0114126 | |||
| 1844 | Ga0451853_3174467 | |||
| 1845 | Ga0439431_0000841 | |||
| 1846 | Ga0439432_018117 | |||
| 1847 | Ga0439432_040088 | |||
| 1848 | Ga0450898_014475 | |||
| 1849 | Ga0439446_0106998 | |||
| 1850 | Ga0439434_0144558 | |||
| 1851 | Ga0466966_0000475 | |||
| 1852 | Ga0466966_0061644 | |||
| 1853 | Ga0466963_0124046 | |||
| 1854 | Ga0466963_0625696 | |||
| 1855 | Ga0453684_0666023 | |||
| 1856 | Ga0466968_0043092 | |||
| 1857 | Ga0466957_0047741 | |||
| 1858 | Ga0466959_0153908 | |||
| 1859 | Ga0451576_0001042 | |||
| 1860 | Ga0451576_0088783 | |||
| 1861 | Ga0466958_0108292 | |||
| 1862 | Ga0466958_0329069 | |||
| 1863 | Ga0466967_0046160 | |||
| 1864 | Ga0466967_0676265 | |||
| 1865 | Ga0495617_103906 | |||
| 1866 | Ga0495592_0008544 | |||
| 1867 | Ga0495603_0103882 | |||
| 1868 | Ga0495603_0108862 | |||
| 1869 | Ga0495590_0023918 | |||
| 1870 | Ga0495590_0158092 | |||
| 1871 | Ga0495629_0278114 | |||
| 1872 | Ga0495638_0308680 | |||
| 1873 | Ga0495638_0447268 | |||
| 1874 | Ga0495650_0000477 | |||
| 1875 | Ga0495650_0078436 | |||
| 1876 | Ga0495650_0216154 | |||
| 1877 | Ga0495605_0000044 | |||
| 1878 | Ga0495605_0156443 | |||
| 1879 | Ga0495585_0005634 | |||
| 1880 | Ga0495585_0026097 | |||
| 1881 | Ga0495585_0077078 | |||
| 1882 | Ga0495585_0105655 | |||
| 1883 | Ga0495585_0221216 | |||
| 1884 | Ga0495594_0279137 | |||
| 1885 | Ga0495607_0000848 | |||
| 1886 | Ga0495607_0009421 | |||
| 1887 | Ga0495583_0000088 | |||
| 1888 | Ga0495583_0089874 | |||
| 1889 | Ga0495606_0000229 | |||
| 1890 | Ga0495606_0006591 | |||
| 1891 | Ga0495606_0069770 | |||
| 1892 | Ga0495610_0002508 | |||
| 1893 | Ga0495610_0006414 | |||
| 1894 | Ga0495610_0016863 | |||
| 1895 | Ga0495610_0027737 | |||
| 1896 | Ga0495610_0104615 | |||
| 1897 | Ga0495616_0077295 | |||
| 1898 | Ga0495616_0158945 | |||
| 1899 | Ga0495620_0001648 | |||
| 1900 | Ga0495620_0092301 | |||
| 1901 | Ga0495630_0354963 | |||
| 1902 | Ga0495631_0000034 | |||
| 1903 | Ga0495643_0004238 | |||
| 1904 | Ga0495643_0006252 | |||
| 1905 | Ga0495643_0152848 | |||
| 1906 | Ga0495643_0238440 | |||
| 1907 | Ga0495643_0240185 | |||
| 1908 | Ga0495648_0002013 | |||
| 1909 | Ga0495666_0026830 | |||
| 1910 | Ga0495642_0052569 | |||
| 1911 | Ga0495598_0034946 | |||
| 1912 | Ga0495621_0026373 | |||
| 1913 | Ga0495621_0029975 | |||
| 1914 | Ga0495621_0135537 | |||
| 1915 | Ga0495622_0013020 | |||
| 1916 | Ga0495633_0004820 | |||
| 1917 | Ga0495656_0032634 | |||
| 1918 | Ga0495668_0000118 | |||
| 1919 | Ga0495668_0006680 | |||
| 1920 | Ga0495668_0053682 | |||
| 1921 | Ga0495668_0141183 | |||
| 1922 | Ga0495611_0000017 | |||
| 1923 | Ga0495625_0079431 | |||
| 1924 | Ga0495625_0372139 | |||
| 1925 | Ga0495625_0538709 | |||
| 1926 | Ga0495635_0254938 | |||
| 1927 | Ga0495659_0090722 | |||
| 1928 | Ga0495588_0000099 | |||
| 1929 | Ga0495669_0002213 | |||
| 1930 | Ga0495624_0461184 | |||
| 1931 | Ga0495670_0031106 | |||
| 1932 | Ga0495671_0029695 | |||
| 1933 | Ga0495660_0078932 | |||
| 1934 | Ga0495581_0245392 | |||
| 1935 | Ga0495636_0013436 | |||
| 1936 | Ga0495636_0045863 | |||
| 1937 | Ga0495672_0000021 | |||
| 1938 | Ga0495672_0000079 | |||
| 1939 | Ga0495672_0021922 | |||
| 1940 | Ga0495672_0087013 | |||
| 1941 | Ga0495672_0106030 | |||
| 1942 | Ga0495672_0258478 | |||
| 1943 | Ga0495683_0090294 | |||
| 1944 | Ga0495683_0139742 | |||
| 1945 | Ga0495679_091342 | |||
| 1946 | Ga0495685_109045 | |||
| 1947 | Ga0495673_0000024 | |||
| 1948 | Ga0495673_0000030 | |||
| 1949 | Ga0495673_0116076 | |||
| 1950 | Ga0495673_0142974 | |||
| 1951 | Ga0495686_0007958 | |||
| 1952 | Ga0495686_0041753 | |||
| 1953 | Ga0495686_0366195 | |||
| 1954 | Ga0495626_0001155 | |||
| 1955 | Ga0495626_0263885 | |||
| 1956 | Ga0496100_0021799 | |||
| 1957 | Ga0496101_0514377 | |||
| 1958 | Ga0496102_0001905 | |||
| 1959 | Ga0496102_0010957 | |||
| 1960 | Ga0496102_0116475 | |||
| 1961 | Ga0496102_0383054 | |||
| 1962 | Ga0496102_0572921 | |||
| 1963 | Ga0496102_0866934 | |||
| 1964 | Ga0496103_0009452 | |||
| 1965 | Ga0496104_0014540 | |||
| 1966 | Ga0496104_0120097 | |||
| 1967 | Ga0496104_0526604 | |||
| 1968 | Ga0496105_0013537 | |||
| 1969 | Ga0496105_0764166 | |||
| 1970 | Ga0496105_0777309 | |||
| 1971 | Ga0496106_0009896 | |||
| 1972 | Ga0496106_0061640 | |||
| 1973 | Ga0496106_0471881 | |||
| 1974 | Ga0496107_0020354 | |||
| 1975 | Ga0496107_0040743 | |||
| 1976 | Ga0496107_0064878 | |||
| 1977 | Ga0496107_0309233 | |||
| 1978 | Ga0496107_0329060 | |||
| 1979 | Ga0496108_0034386 | |||
| 1980 | Ga0496108_0047915 | |||
| 1981 | Ga0496108_0050962 | |||
| 1982 | Ga0496108_0372899 | |||
| 1983 | Ga0496108_0835152 | |||
| 1984 | Ga0496109_0082698 | |||
| 1985 | Ga0496109_0120495 | |||
| 1986 | Ga0496109_0177110 | |||
| 1987 | Ga0496110_0211017 | |||
| 1988 | Ga0496111_0067136 | |||
| 1989 | Ga0496111_0101823 | |||
| 1990 | Ga0496111_0309633 | |||
| 1991 | Ga0496112_0001802 | |||
| 1992 | Ga0496112_0052086 | |||
| 1993 | Ga0496112_0432707 | |||
| 1994 | Ga0496113_0086146 | |||
| 1995 | Ga0496113_0102149 | |||
| 1996 | Ga0496113_0753936 | |||
| 1997 | Ga0496114_0138207 | |||
| 1998 | Ga0496114_0280104 | |||
| 1999 | Ga0496115_0000295 | |||
| 2000 | Ga0496115_0203872 | |||
| 2001 | Ga0496117_0130115 | |||
| 2002 | Ga0496117_0300098 | |||
| 2003 | Ga0496118_0131491 | |||
| 2004 | Ga0496118_0139362 | |||
| 2005 | Ga0496121_0003702 | |||
| 2006 | Ga0496121_0082694 | |||
| 2007 | Ga0496121_0302974 | |||
| 2008 | Ga0496121_0462383 | |||
| 2009 | Ga0496122_0140949 | |||
| 2010 | Ga0496123_0158430 | |||
| 2011 | Ga0496124_0033172 | |||
| 2012 | Ga0496124_0035157 | |||
| 2013 | Ga0496124_0091593 | |||
| 2014 | Ga0496124_0133963 | |||
| 2015 | Ga0496125_0213885 | |||
| 2016 | Ga0496125_0277585 | |||
| 2017 | Ga0496126_0056218 | |||
| 2018 | Ga0496126_0396373 | |||
| 2019 | Ga0496126_0507797 | |||
| 2020 | Ga0495678_000304 | |||
| 2021 | Ga0495678_086855 | |||
| 2022 | Ga0501034_0805293 | |||
| 2023 | Ga0501036_0214528 | |||
| 2024 | Ga0501038_0125782 | |||
| 2025 | Ga0501039_0172792 | |||
| 2026 | Ga0501039_0401824 | |||
| 2027 | Ga0501040_0004633 | |||
| 2028 | Ga0501042_0050476 | |||
| 2029 | Ga0501042_0295689 | |||
| 2030 | Ga0501043_0554782 | |||
| 2031 | Ga0501048_0014061 | |||
| 2032 | Ga0501067_0058336 | |||
| 2033 | Ga0501068_0110697 | |||
| 2034 | Ga0501071_0045517 | |||
| 2035 | Ga0501071_0434968 | |||
| 2036 | Ga0501072_0406133 | |||
| 2037 | Ga0501074_0283667 | |||
| 2038 | Ga0501075_0557659 | |||
| 2039 | Ga0501076_0932464 | |||
| 2040 | Ga0501216_038105 | |||
| 2041 | Ga0501229_013874 | |||
| 2042 | Ga0501079_0120218 | |||
| 2043 | Ga0501080_0016546 | |||
| 2044 | Ga0501081_0067829 | |||
| 2045 | Ga0501262_016230 | |||
| 2046 | Ga0501265_010433 | |||
| 2047 | Ga0501044_0775254 | |||
| 2048 | nmdc:mga03683_114812_c1 | |||
| 2049 | nmdc:mga03n38_215760_c1 | |||
| 2050 | nmdc:mga03n38_7482_c1 | |||
| 2051 | nmdc:mga00v17_340881_c1 | |||
| 2052 | nmdc:mga00v17_445548_c1 | |||
| 2053 | nmdc:mga0yw44_116949_c1 | |||
| 2054 | nmdc:mga0yw44_177427_c1 | |||
| 2055 | nmdc:mga0yw44_311267_c1 | |||
| 2056 | nmdc:mga06z11_298060_c1 | |||
| 2057 | nmdc:mga06z11_328741_c1 | |||
| 2058 | nmdc:mga06z11_72334_c1 | |||
| 2059 | nmdc:mga04h51_55663_c1 | |||
| 2060 | nmdc:mga07m45_156605_c1 | |||
| 2061 | nmdc:mga05p37_134216_c1 | |||
| 2062 | nmdc:mga05p37_191374_c1 | |||
| 2063 | nmdc:mga05p37_209_c1 | |||
| 2064 | nmdc:mga05p37_38529_c1 | |||
| 2065 | nmdc:mga05p37_615236_c1 | |||
| 2066 | nmdc:mga09592_150_c1 | |||
| 2067 | nmdc:mga09592_163437_c1 | |||
| 2068 | nmdc:mga09592_4737_c1 | |||
| 2069 | nmdc:mga09592_581494_c1 | |||
| 2070 | nmdc:mga0qj67_131328_c1 | |||
| 2071 | nmdc:mga0qj67_135084_c1 | |||
| 2072 | nmdc:mga0qj67_452189_c1 | |||
| 2073 | nmdc:mga06r32_14895_c1 | |||
| 2074 | nmdc:mga06r32_252374_c1 | |||
| 2075 | nmdc:mga08y16_135314_c1 | |||
| 2076 | nmdc:mga08y16_38103_c1 | |||
| 2077 | nmdc:mga08y16_66743_c1 | |||
| 2078 | nmdc:mga08y16_7676_c1 | |||
| 2079 | nmdc:mga0n895_156526_c1 | |||
| 2080 | nmdc:mga0n895_923700_c1 | |||
| 2081 | nmdc:mga0rr50_80679_c1 | |||
| 2082 | nmdc:mga0rr50_818697_c1 | |||
| 2083 | nmdc:mga08x19_22166_c1 | |||
| 2084 | nmdc:mga08x19_39288_c1 | |||
| 2085 | nmdc:mga08x19_55_c1 | |||
| 2086 | nmdc:mga08x19_610179_c1 | |||
| 2087 | nmdc:mga0sz30_292640_c1 | |||
| 2088 | Ga0500643_062941 | |||
| 2089 | Ga0500583_0127671 | |||
| 2090 | Ga0500566_0278844 | |||
| 2091 | Ga0500641_0127854 | |||
| 2092 | Ga0500554_035556 | |||
| 2093 | Ga0500572_017424 | |||
| 2094 | Ga0500572_072164 | |||
| 2095 | Ga0500595_002541 | |||
| 2096 | Ga0500595_012296 | |||
| 2097 | Ga0500595_111956 | |||
| 2098 | Ga0500608_233487 | |||
| 2099 | Ga0500655_016684 | |||
| 2100 | Ga0500559_0004336 | |||
| 2101 | Ga0500574_081549 | |||
| 2102 | Ga0500586_011368 | |||
| 2103 | Ga0500603_029207 | |||
| 2104 | Ga0500620_011225 | |||
| 2105 | Ga0500638_155261 | |||
| 2106 | Ga0500639_033994 | |||
| 2107 | Ga0500636_0007802 | |||
| 2108 | Ga0500637_0088589 | |||
| 2109 | Ga0500661_040282 | |||
| 2110 | Ga0590071_011723 | |||
| 2111 | Ga0466962_0017422 | |||
| 2112 | Ga0530510_0771974 | |||
| 2113 | 2513657470 | |||
| 2114 | 2513861202 | |||
| 2115 | 2513916723 | |||
| 2116 | 2517889630 | |||
| 2117 | 2524533200 | |||
| 2118 | 2644337844 | |||
| 2119 | 2671119482 | |||
| 2120 | 2793084093 | |||
| 2121 | 2857554220 | |||
| 2122 | 2857559826 | |||
| 2123 | 2857564991 | |||
| 2124 | 2876811102 | |||
| 2125 | 2879116994 | |||
| 2126 | 2889036407 | |||
| 2127 | 2903756083 | |||
| 2128 | 2904707614 | |||
| 2129 | 2906614608 | |||
| 2130 | 2906642087 | |||
| 2131 | 2906666467 | |||
| 2132 | 2908746570 | |||
| 2133 | 2922366717 | |||
| 2134 | 2922389379 | |||
| 2135 | 2922426469 | |||
| 2136 | 2935632810 | |||
| 2137 | 2939592420 | |||
| 2138 | 2939636090 | |||
| 2139 | 2941508526 | |||
| 2140 | 2941516356 | |||
| 2141 | 2941524628 | |||
| 2142 | 2974310226 | |||
| 2143 | 2977250952 | |||
| 2144 | 2984514554 | |||
| 2145 | 3005475811 | |||
| 2146 | 8006937128 | |||
| 2147 | 8006977138 | |||
| 2148 | 8006993125 | |||
| 2149 | 8019561531 | |||
| 2150 | 8019571607 | |||
| 2151 | 8056678165 | |||
| 2152 | 8056683444 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9798 | 14 | 226 |
| 4pxo-assembly1.cif.gz_B | crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) | 0.9766 | 14 | 226 |
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9707 | 14 | 226 |
| 2cz3-assembly1.cif.gz_A | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) | 0.9678 | 12 | 226 |
| 4pxo-assembly1.cif.gz_B | crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) | 0.9632 | 14 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2v6kB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.976 | 97 | 226 | 1.20.1050.10 |
| 2v6kB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9687 | 97 | 226 | 1.20.1050.10 |
| 4px1A02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9662 | 97 | 226 | 1.20.1050.10 |
| 6jwkB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9639 | 97 | 226 | 1.20.1050.10 |
| 6jwkA02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9621 | 97 | 226 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W6S279-F1-model_v4 | Maleylacetoacetate isomerase/maleylpyruvate isomerase (EC 5.2.1.2, EC 5.2.1.4) | 0.993 | 14 | 226 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 GO:0050077 |
| AF-A1AYE6-F1-model_v4 | Maleylacetoacetate isomerase (EC 5.2.1.2) | 0.9928 | 13 | 226 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A5C5SJU5-F1-model_v4 | Maleylacetoacetate isomerase (EC 5.2.1.2) | 0.9926 | 14 | 226 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A3S1I756-F1-model_v4 | Maleylacetoacetate isomerase (EC 5.2.1.2) | 0.9921 | 45 | 226 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A529HQD3-F1-model_v4 | Maleylacetoacetate isomerase | 0.9914 | 97 | 226 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |