F489582

General Info

Members Datasets Scaffolds Average Seq Length
1076 551 974 575

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10018374|Ga0182008_100183741
Length 619
Sequence MHAGLHTASGQFEARGFPEVSPPASVFPKILKSTSAIPMKASRFFVSTLKEAPADAEVASHRLMMRAGMIKKLGTGIYTYMPMGLRVIRKVEAIVREEMNRAGAVELTMPVVQPAEFWQETGRFDKMGPELLRIKDRHDRDFVVQPTSEEVVTDIARQEIRSYKQLPKNFYQIQTKFRDERRPRFGLMRGREFIMKDAYSFDRDLDAAKASYQAMADAYRRIFDRFGLRYRAVAADSGAIGGDLSEEFQVIAATGEDAIVYCPGSDYAANMEKAEALAPAGPRPAAAKALEKTPTPGKSTCADVAELLGVPLSTTVKSLVLATDILDEAGNPKGSQVWLLLLRGDHDMNEIKVGKVPGLDKGFRFATLAEIDDHFGCKPGYLGPLNLKKPVRLVADREVMVMADWITGANEVDFHMTGVNWGRDLPEPELVADLRNVVAGDASPDGKGVLAIERGIEVGHVFVLGTKYSKDMNATYLDEAGKPQFLEMGCYGIGITRLPAAAIEQNHDERGIIWPDALAPFTVVVCPIGMDRSPEVKVAAEALYEQLLAAGIDVLLDDRGERPGAMFADWELIGVPHRVVISDRGLKEGQLEYQHRRDTAATKVPAAGIAEFIAGKFAQ

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2547132374 Acidovorax radicis N35 Isolate Unclassified
6 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
7 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
8 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
9 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
10 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
11 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
12 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
13 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
14 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
15 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
16 2643221569 Achromobacter sp. Root565 Isolate Unclassified
17 2643221570 Acidovorax sp. Root568 Isolate Unclassified
18 2643221585 Pelomonas sp. Root662 Isolate Unclassified
19 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
20 2643221594 Achromobacter sp. Root170 Isolate Unclassified
21 2643221596 Acidovorax sp. Root70 Isolate Unclassified
22 2643221609 Acidovorax sp. Root217 Isolate Unclassified
23 2643221611 Acidovorax sp. Root219 Isolate Unclassified
24 2643221621 Achromobacter sp. Root83 Isolate Unclassified
25 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
26 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
27 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
28 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
29 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
30 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
31 2643221652 Acidovorax sp. Root402 Isolate Unclassified
32 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
33 2643221656 Pelomonas sp. Root405 Isolate Unclassified
34 2643221658 Variovorax sp. Root411 Isolate Unclassified
35 2643221660 Methylibium sp. Root1272 Isolate Unclassified
36 2643221672 Variovorax sp. Root434 Isolate Unclassified
37 2643221683 Variovorax sp. Root473 Isolate Unclassified
38 2643221717 Acidovorax sp. Root267 Isolate Unclassified
39 2721755523 Delftia sp. HK171 Isolate Unclassified
40 2738541277 Variovorax sp. GV051 Isolate Unclassified
41 2738541307 Variovorax sp. GV008 Isolate Unclassified
42 2738541337 Pelomonas sp. BT06 Isolate Unclassified
43 2738543012 Acidovorax sp. CF301 Isolate Unclassified
44 2738543013 Variovorax sp. BT01 Isolate Unclassified
45 2738543019 Variovorax sp. GV040 Isolate Unclassified
46 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
47 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
48 2816332133 Acidovorax radicis 2721A Isolate Unclassified
49 2818991446 Variovorax sp. 1180 Isolate Unclassified
50 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
51 2831864461 Roseateles noduli HZ7 Isolate Nodule
52 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
53 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
54 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
55 2842677519 Variovorax sp. R-72495 Isolate Unclassified
56 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
57 2842733646 Variovorax sp. R-72446 Isolate Unclassified
58 2842747753 Variovorax sp. R-72060 Isolate Unclassified
59 2855730933 Achromobacter sp. HZ28 Isolate Nodule
60 2855767633 Achromobacter sp. HZ34 Isolate Nodule
61 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
62 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
63 2857558681 Duganella sp. R-74565 Isolate Unclassified
64 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
65 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
66 2858950400 Achromobacter sp. K91 Isolate Unclassified
67 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
68 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
69 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
70 2885198086 Variovorax sp. 679 Isolate Unclassified
71 2885211737 Variovorax sp. 553 Isolate Unclassified
72 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
73 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
74 2899924645 Variovorax sp. 369 Isolate Unclassified
75 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
76 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
77 2904456579 Variovorax sp. 2002 Isolate Unclassified
78 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
79 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
80 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
81 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
82 2928037797 Variovorax sp. 1126 Isolate Unclassified
83 2928044640 Variovorax sp. 1128 Isolate Unclassified
84 2928051484 Variovorax sp. 1133 Isolate Unclassified
85 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
86 2928070936 Variovorax gossypii 1167 Isolate Unclassified
87 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
88 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
89 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
90 2929520902 Variovorax beijingensis 502 Isolate Unclassified
91 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
92 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
93 2941479691
94 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
95 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
96 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
97 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
98 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
99 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
100 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
101 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
102 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
103 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
104 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
105 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
106 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
107 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
108 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
109 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
110 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
111 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
112 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
113 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
114 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
115 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
116 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
117 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
118 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
119 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
120 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
121 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
122 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
123 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
124 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
125 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
126 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
127 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
128 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
129 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
130 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
131 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
132 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
133 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
134 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
135 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
136 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
137 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
138 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
139 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
140 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
141 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
142 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
143 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
144 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
145 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
146 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
147 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
148 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
149 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
150 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
151 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
152 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
153 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
154 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
155 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
156 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
157 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
158 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
159 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
160 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
161 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
162 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
163 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
164 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
165 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
166 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
167 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
168 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
169 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
170 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
171 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
172 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
173 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
174 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
175 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
176 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
177 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
178 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
179 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
180 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
181 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
182 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
183 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
184 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
185 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
186 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
187 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
188 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
189 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
190 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
191 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
192 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
193 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
194 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
195 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
196 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
197 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
198 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
199 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
200 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
201 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
202 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
203 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
204 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
205 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
206 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
207 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
208 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
209 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
210 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
211 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
212 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
213 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
214 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
215 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
216 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
217 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
218 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
219 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
220 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
221 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
222 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
223 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
224 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
225 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
226 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
227 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
228 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
229 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
230 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
231 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
232 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
233 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
234 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
235 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
236 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
240 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
242 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
243 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
244 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
247 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
248 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
252 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
255 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
256 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
257 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
260 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
316 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
328 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
332 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
334 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
338 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
339 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
340 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
341 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
342 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
343 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
344 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
345 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
346 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
347 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
348 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
349 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
350 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
351 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
352 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
353 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
354 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
355 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
356 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
357 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
358 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
359 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
360 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
361 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
362 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
363 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
364 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
365 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
366 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
367 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
368 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
369 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
370 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
371 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
372 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
373 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
374 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
375 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
376 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
377 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
378 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
379 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
380 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
381 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
382 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
383 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
384 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
385 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
386 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
387 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
388 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
389 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
390 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
391 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
392 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
393 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
394 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
395 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
396 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
397 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
398 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
399 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
400 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
401 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
402 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
403 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
404 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
405 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
406 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
407 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
408 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
409 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
410 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
411 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
412 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
413 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
414 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
415 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
416 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
417 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
418 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
419 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
420 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
421 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
422 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
423 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
424 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
425 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
426 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
427 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
428 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
429 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
430 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
431 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
432 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
433 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
434 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
435 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
436 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
437 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
438 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
439 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
440 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
441 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
442 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
443 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
444 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
445 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
446 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
447 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
448 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
449 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
450 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
451 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
452 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
453 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
454 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
455 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
456 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
457 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
458 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
459 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
460 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
461 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
462 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
463 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
464 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
465 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
466 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
467 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
468 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
469 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
470 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
471 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
472 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
473 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
474 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
475 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
489 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
490 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
491 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
492 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
493 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
494 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
495 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
496 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
497 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
498 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
499 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
500 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
501 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
502 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
503 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
504 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
505 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
506 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
507 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
508 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
509 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
510 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
511 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
512 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
516 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
517 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
518 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
519 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
520 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
521 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
522 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
523 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
524 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
525 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
526 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
527 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
528 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
529 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
530 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
531 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
532 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
533 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
534 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
535 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
536 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
537 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
538 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
539 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
540 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
541 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
542 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
543 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
544 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
545 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
546 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
547 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
548 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
549 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
550 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
551 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.43
Metatranscriptomes 0.09
Isolates 9.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.82
Nodule 1.3
Rhizoplane 1.86
Rhizosphere 63.75
Stem 0
Stem Tuber 0
Unclassified 12.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000022 3300002704 Bacteria 142950
2 JGI25156J39149_1000005 3300002705 Bacteria 263980
3 JGI25154J39366_1000017 3300002738 Bacteria 252448
4 JGI25154J39366_1001293 3300002738 Bacteria 9289
5 JGI25157J39369_1000003 3300002741 Bacteria 274935
6 JGI25157J39369_1000161 3300002741 Bacteria 56020
7 JGI25157J39369_1000774 3300002741 Bacteria 16565
8 JGI25152J39213_1000892 3300002773 Bacteria 14659
9 JGI25150J39212_1005515 3300002774 Bacteria 2693
10 JGI25159J45721_1001370 3300002987 Bacteria 10154
11 JGI25159J45721_1007405 3300002987 Bacteria 3151
12 JGI25151J46595_10001847 3300003187 Bacteria 13633
13 JGI25151J46595_10003861 3300003187 Bacteria 8105
14 JGI25151J46595_10004995 3300003187 Bacteria 6914
15 JGI25151J46595_10005322 3300003187 Bacteria 6661
16 JGI25151J46595_10007739 3300003187 Bacteria 5233
17 JGI25153J46596_10000420 3300003215 Bacteria 27768
18 JGI25153J46596_10002471 3300003215 Bacteria 10617
19 Ga0006777J48905_1089277 3300003308 Bacteria 2035
20 rootH2_10014247 3300003320 Bacteria 2247
21 JGI25160J50197_1000273 3300003354 Bacteria 38119
22 JGI25161J50226_1000095 3300003374 Bacteria 72343
23 Ga0055539_1000542 3300003752 Bacteria 11256
24 Ga0055539_1001036 3300003752 Bacteria 5964
25 Ga0055533_1000016 3300003756 Bacteria 396179
26 Ga0055525_1000004 3300003759 Bacteria 888039
27 Ga0055525_1000689 3300003759 Bacteria 12543
28 Ga0055535_1000221 3300003761 Bacteria 60185
29 Ga0055535_1001368 3300003761 Bacteria 12770
30 Ga0055542_1000129 3300003762 Bacteria 99542
31 Ga0055529_1000661 3300003763 Bacteria 24331
32 Ga0055529_1001314 3300003763 Bacteria 8432
33 Ga0055526_1010439 3300003771 Bacteria 4319
34 Ga0055526_1010839 3300003771 Bacteria 4191
35 Ga0055526_1016398 3300003771 Bacteria 2904
36 Ga0055537_1000205 3300003773 Bacteria 44266
37 Ga0055537_1000717 3300003773 Bacteria 17146
38 Ga0055524_1000073 3300003775 Bacteria 123033
39 Ga0055524_1000109 3300003775 Bacteria 100308
40 Ga0055524_1005152 3300003775 Bacteria 5895
41 Ga0055524_1005801 3300003775 Bacteria 5455
42 Ga0055536_1000044 3300003781 Bacteria 123111
43 Ga0055536_1022076 3300003781 Bacteria 1911
44 Ga0055534_1000337 3300003784 Bacteria 30592
45 Ga0055534_1000363 3300003784 Bacteria 28579
46 Ga0055534_1000467 3300003784 Bacteria 22933
47 Ga0055534_1004577 3300003784 Bacteria 3953
48 Ga0055528_1000289 3300003790 Bacteria 42964
49 Ga0055528_1006545 3300003790 Bacteria 5277
50 Ga0055528_1013900 3300003790 Bacteria 3019
51 Ga0055530_10001804 3300003791 Bacteria 14848
52 Ga0055540_1000013 3300003792 Bacteria 262274
53 Ga0055540_1000037 3300003792 Bacteria 162957
54 Ga0055540_1007611 3300003792 Bacteria 4047
55 Ga0055531_10000112 3300003794 Bacteria 89016
56 Ga0055531_10000158 3300003794 Bacteria 77918
57 Ga0055531_10000500 3300003794 Bacteria 35897
58 Ga0055543_1000218 3300004625 Bacteria 46120
59 Ga0055543_1001329 3300004625 Bacteria 10110
60 Ga0065165_1000016 3300005262 Bacteria 286248
61 Ga0065165_1001026 3300005262 Bacteria 33855
62 Ga0065165_1002013 3300005262 Bacteria 18978
63 Ga0065704_10072444 3300005289 Bacteria 8516
64 Ga0065707_10093995 3300005295 Bacteria 3552
65 Ga0065707_10104681 3300005295 Bacteria 2683
66 Ga0065707_10123248 3300005295 Bacteria 2065
67 Ga0070658_10064689 3300005327 Bacteria 2983
68 Ga0070676_10003268 3300005328 Bacteria 8419
69 Ga0070676_10030581 3300005328 Bacteria 3072
70 Ga0070690_100000107 3300005330 Bacteria 43179
71 Ga0070690_100023747 3300005330 Bacteria 3764
72 Ga0070670_100001440 3300005331 Bacteria 19100
73 Ga0070670_100001784 3300005331 Bacteria 17512
74 Ga0070670_100041149 3300005331 Bacteria 3971
75 Ga0070670_100076880 3300005331 Bacteria 2868
76 Ga0070670_100105389 3300005331 Bacteria 2429
77 Ga0070677_10002257 3300005333 Bacteria 6145
78 Ga0070677_10003533 3300005333 Bacteria 5042
79 Ga0068869_100002674 3300005334 Bacteria 10774
80 Ga0068869_100016954 3300005334 Bacteria 4925
81 Ga0068869_100037918 3300005334 Bacteria 3430
82 Ga0068869_100083034 3300005334 Bacteria 2395
83 Ga0070680_100002947 3300005336 Bacteria 12648
84 Ga0070682_100000079 3300005337 Bacteria 87919
85 Ga0070682_100009153 3300005337 Bacteria 5600
86 Ga0070682_100027278 3300005337 Bacteria 3426
87 Ga0068868_100001535 3300005338 Bacteria 15804
88 Ga0068868_100001584 3300005338 Bacteria 15507
89 Ga0068868_100014958 3300005338 Bacteria 5729
90 Ga0068868_100096553 3300005338 Bacteria 2387
91 Ga0070660_100001319 3300005339 Bacteria 16886
92 Ga0070660_100014250 3300005339 Bacteria 5725
93 Ga0070689_100001349 3300005340 Bacteria 15575
94 Ga0070689_100004489 3300005340 Bacteria 9439
95 Ga0070687_100006716 3300005343 Bacteria 4737
96 Ga0070687_100007662 3300005343 Bacteria 4519
97 Ga0070687_100022178 3300005343 Bacteria 2998
98 Ga0070661_100002141 3300005344 Bacteria 13611
99 Ga0070661_100018312 3300005344 Bacteria 4978
100 Ga0070692_10035278 3300005345 Bacteria 2531
101 Ga0070668_100017950 3300005347 Bacteria 5307
102 Ga0070669_100003084 3300005353 Bacteria 11996
103 Ga0070669_100004692 3300005353 Bacteria 9860
104 Ga0070669_100083648 3300005353 Bacteria 2380
105 Ga0070675_100000897 3300005354 Bacteria 21177
106 Ga0070675_100004992 3300005354 Bacteria 10130
107 Ga0070675_100036240 3300005354 Bacteria 4012
108 Ga0070675_100040766 3300005354 Bacteria 3792
109 Ga0070671_100002016 3300005355 Bacteria 15615
110 Ga0070671_100003626 3300005355 Bacteria 12086
111 Ga0070671_100086173 3300005355 Bacteria 2627
112 Ga0070674_100001095 3300005356 Bacteria 14216
113 Ga0070673_100009353 3300005364 Bacteria 6576
114 Ga0070688_100001166 3300005365 Bacteria 13076
115 Ga0070688_100067471 3300005365 Bacteria 2279
116 Ga0070659_100007265 3300005366 Bacteria 8042
117 Ga0070659_100008981 3300005366 Bacteria 7329
118 Ga0070659_100024688 3300005366 Bacteria 4609
119 Ga0070659_100060132 3300005366 Bacteria 3001
120 Ga0070659_100110470 3300005366 Bacteria 2219
121 Ga0070667_100012295 3300005367 Bacteria 7082
122 Ga0070701_10000356 3300005438 Bacteria 15169
123 Ga0070705_100013380 3300005440 Bacteria 4196
124 Ga0070700_100002053 3300005441 Bacteria 10234
125 Ga0070700_100006861 3300005441 Bacteria 6111
126 Ga0070694_100007484 3300005444 Bacteria 6659
127 Ga0070663_100000518 3300005455 Bacteria 20374
128 Ga0070678_100001803 3300005456 Bacteria 11540
129 Ga0070662_100004722 3300005457 Bacteria 8634
130 Ga0070662_100072457 3300005457 Bacteria 2543
131 Ga0070681_10002791 3300005458 Bacteria 16131
132 Ga0070681_10017140 3300005458 Bacteria 7243
133 Ga0070681_10017818 3300005458 Bacteria 7097
134 Ga0068867_100000020 3300005459 Bacteria 93210
135 Ga0068867_100000735 3300005459 Bacteria 21966
136 Ga0068867_100001564 3300005459 Bacteria 15888
137 Ga0068867_100001947 3300005459 Bacteria 14386
138 Ga0068867_100007291 3300005459 Bacteria 7825
139 Ga0068867_100044545 3300005459 Bacteria 3251
140 Ga0068867_100083162 3300005459 Bacteria 2416
141 Ga0068867_100084548 3300005459 Bacteria 2397
142 Ga0068867_100123527 3300005459 Bacteria 2003
143 Ga0070685_10000570 3300005466 Bacteria 20652
144 Ga0070706_100002083 3300005467 Bacteria 20391
145 Ga0070707_100000110 3300005468 Bacteria 75472
146 Ga0070707_100118641 3300005468 Bacteria 2568
147 Ga0070698_100003773 3300005471 Bacteria 16645
148 Ga0070698_100065792 3300005471 Bacteria 3650
149 Ga0070699_100008765 3300005518 Bacteria 8766
150 Ga0070699_100015887 3300005518 Bacteria 6463
151 Ga0070699_100064514 3300005518 Bacteria 3176
152 Ga0070679_100000726 3300005530 Bacteria 28453
153 Ga0070679_100017182 3300005530 Bacteria 6998
154 Ga0070679_100039416 3300005530 Bacteria 4695
155 Ga0070697_100024444 3300005536 Bacteria 4809
156 Ga0070672_100000368 3300005543 Bacteria 25953
157 Ga0070672_100002347 3300005543 Bacteria 11964
158 Ga0070672_100009632 3300005543 Bacteria 6667
159 Ga0070672_100012177 3300005543 Bacteria 6026
160 Ga0070672_100017220 3300005543 Bacteria 5196
161 Ga0070686_100003006 3300005544 Bacteria 9242
162 Ga0070686_100006419 3300005544 Bacteria 6533
163 Ga0070695_100005400 3300005545 Bacteria 7523
164 Ga0070696_100032488 3300005546 Bacteria 3580
165 Ga0070665_100037542 3300005548 Bacteria 4871
166 Ga0070665_100050414 3300005548 Bacteria 4177
167 Ga0070704_100001426 3300005549 Bacteria 12763
168 Ga0070704_100007740 3300005549 Bacteria 6405
169 Ga0070704_100008826 3300005549 Bacteria 6067
170 Ga0068855_100013962 3300005563 Bacteria 9684
171 Ga0068855_100102108 3300005563 Bacteria 3301
172 Ga0070664_100009588 3300005564 Bacteria 7853
173 Ga0070664_100026696 3300005564 Bacteria 4793
174 Ga0068857_100008925 3300005577 Bacteria 8685
175 Ga0068857_100026238 3300005577 Bacteria 5134
176 Ga0068857_100059410 3300005577 Bacteria 3396
177 Ga0068856_100001351 3300005614 Bacteria 25782
178 Ga0068856_100037330 3300005614 Bacteria 4768
179 Ga0070702_100002394 3300005615 Bacteria 8074
180 Ga0068859_100000648 3300005617 Bacteria 34840
181 Ga0068859_100007249 3300005617 Bacteria 11248
182 Ga0068864_100000001 3300005618 Bacteria 686767
183 Ga0068864_100018085 3300005618 Bacteria 5883
184 Ga0068861_100018170 3300005719 Bacteria 5004
185 Ga0068861_100034989 3300005719 Bacteria 3718
186 Ga0068861_100060362 3300005719 Bacteria 2906
187 Ga0068858_100000467 3300005842 Bacteria 42180
188 Ga0068858_100044054 3300005842 Bacteria 4137
189 Ga0068858_100069799 3300005842 Bacteria 3257
190 Ga0068860_100002278 3300005843 Bacteria 20163
191 Ga0068860_100036131 3300005843 Bacteria 4736
192 Ga0068862_100009207 3300005844 Bacteria 8179
193 Ga0068862_100046353 3300005844 Bacteria 3709
194 Ga0068862_100060633 3300005844 Bacteria 3250
195 Ga0068862_100062922 3300005844 Bacteria 3192
196 Ga0068862_100071690 3300005844 Bacteria 2991
197 Ga0068862_100082879 3300005844 Bacteria 2784
198 Ga0081455_10000552 3300005937 Bacteria 48660
199 Ga0075365_10035474 3300006038 Bacteria 3227
200 Ga0075363_100005602 3300006048 Bacteria 5610
201 Ga0075363_100007828 3300006048 Bacteria 4940
202 Ga0075363_100009510 3300006048 Bacteria 4570
203 Ga0075364_10002743 3300006051 Bacteria 9897
204 Ga0075364_10006841 3300006051 Bacteria 6728
205 Ga0075364_10017870 3300006051 Bacteria 4435
206 Ga0075362_10033082 3300006177 Bacteria 2247
207 Ga0075366_10001208 3300006195 Bacteria 12818
208 Ga0075366_10001813 3300006195 Bacteria 10789
209 Ga0075366_10003680 3300006195 Bacteria 8136
210 Ga0075366_10006507 3300006195 Bacteria 6404
211 Ga0075366_10010444 3300006195 Bacteria 5214
212 Ga0075366_10026687 3300006195 Bacteria 3384
213 Ga0097621_100009437 3300006237 Bacteria 7080
214 Ga0097621_100032048 3300006237 Bacteria 4176
215 Ga0097621_100034919 3300006237 Bacteria 4014
216 Ga0075370_10000288 3300006353 Bacteria 18082
217 Ga0075370_10000910 3300006353 Bacteria 12135
218 Ga0075370_10002426 3300006353 Bacteria 8638
219 Ga0075370_10006446 3300006353 Bacteria 5903
220 Ga0075370_10010497 3300006353 Bacteria 4842
221 Ga0075370_10055769 3300006353 Bacteria 2245
222 Ga0075370_10056336 3300006353 Bacteria 2234
223 Ga0068871_100002097 3300006358 Bacteria 13494
224 Ga0068871_100005094 3300006358 Bacteria 9179
225 Ga0068871_100028897 3300006358 Bacteria 4351
226 Ga0068871_100034947 3300006358 Bacteria 3991
227 Ga0075428_100234656 3300006844 Bacteria 1979
228 Ga0075430_100025182 3300006846 Bacteria 5060
229 Ga0075430_100131987 3300006846 Bacteria 2082
230 Ga0075431_100028239 3300006847 Bacteria 5762
231 Ga0075431_100045331 3300006847 Bacteria 4533
232 Ga0075433_10045779 3300006852 Bacteria 3804
233 Ga0075429_100000018 3300006880 Bacteria 71039
234 Ga0075429_100003110 3300006880 Bacteria 14099
235 Ga0075429_100011337 3300006880 Bacteria 7717
236 Ga0075429_100050294 3300006880 Bacteria 3626
237 Ga0075429_100096308 3300006880 Bacteria 2581
238 Ga0068865_100006429 3300006881 Bacteria 7165
239 Ga0068865_100018444 3300006881 Bacteria 4502
240 Ga0068865_100053538 3300006881 Bacteria 2800
241 Ga0075436_100031317 3300006914 Bacteria 3662
242 Ga0097620_100000648 3300006931 Bacteria 34840
243 Ga0097620_100007249 3300006931 Bacteria 11248
244 Ga0079104_1000001 3300006946 Bacteria 521847
245 Ga0079104_1000055 3300006946 Bacteria 166522
246 Ga0099826_10001050 3300006948 Bacteria 15606
247 Ga0105244_10003265 3300009036 Bacteria 11688
248 Ga0105250_10001192 3300009092 Bacteria 14517
249 Ga0105240_10005235 3300009093 Bacteria 19386
250 Ga0105240_10019777 3300009093 Bacteria 8992
251 Ga0105240_10026481 3300009093 Bacteria 7609
252 Ga0105240_10080518 3300009093 Bacteria 4005
253 Ga0105245_10000957 3300009098 Bacteria 26254
254 Ga0105245_10005072 3300009098 Bacteria 11578
255 Ga0114129_10005674 3300009147 Bacteria 17667
256 Ga0114129_10012020 3300009147 Bacteria 12315
257 Ga0114129_10047712 3300009147 Bacteria 6017
258 Ga0114129_10104273 3300009147 Bacteria 3918
259 Ga0114129_10173521 3300009147 Bacteria 2938
260 Ga0105243_10002550 3300009148 Bacteria 15218
261 Ga0105243_10002600 3300009148 Bacteria 15051
262 Ga0105243_10014871 3300009148 Bacteria 5889
263 Ga0105243_10031316 3300009148 Bacteria 4100
264 Ga0105243_10085749 3300009148 Bacteria 2582
265 Ga0105242_10003752 3300009176 Bacteria 11807
266 Ga0105242_10027648 3300009176 Bacteria 4507
267 Ga0105242_10043696 3300009176 Bacteria 3625
268 Ga0105242_10079072 3300009176 Bacteria 2746
269 Ga0105248_10000624 3300009177 Bacteria 40257
270 Ga0105248_10004455 3300009177 Bacteria 15499
271 Ga0105237_10002475 3300009545 Bacteria 22923
272 Ga0105237_10017120 3300009545 Bacteria 7518
273 Ga0105237_10109708 3300009545 Bacteria 2751
274 Ga0105249_10026571 3300009553 Bacteria 5218
275 Ga0105239_10001374 3300010375 Bacteria 32644
276 Ga0105239_10025113 3300010375 Bacteria 6563
277 Ga0105239_10047382 3300010375 Bacteria 4711
278 Ga0105246_10007146 3300011119 Bacteria 6838
279 Ga0157373_10021292 3300013100 Bacteria 4708
280 Ga0157369_10008671 3300013105 Bacteria 11657
281 Ga0157369_10069515 3300013105 Bacteria 3783
282 Ga0157369_10161722 3300013105 Bacteria 2363
283 Ga0157374_10009960 3300013296 Bacteria 8160
284 Ga0157378_10003351 3300013297 Bacteria 14258
285 Ga0163162_10001398 3300013306 Bacteria 22461
286 Ga0163162_10119727 3300013306 Bacteria 2736
287 Ga0163162_10121698 3300013306 Bacteria 2714
288 Ga0157375_10000077 3300013308 Bacteria 100528
289 Ga0157375_10005835 3300013308 Bacteria 10714
290 Ga0157375_10020637 3300013308 Bacteria 6024
291 Ga0157375_10031637 3300013308 Bacteria 5006
292 Ga0157375_10163710 3300013308 Bacteria 2368
293 Ga0157380_10097782 3300014326 Bacteria 2437
294 Ga0182008_10005957 3300014497 Bacteria 6874
295 Ga0182008_10018374 3300014497 Bacteria 3621
296 Ga0157377_10000032 3300014745 Bacteria 121003
297 Ga0157377_10000808 3300014745 Bacteria 12944
298 Ga0157377_10004958 3300014745 Bacteria 6205
299 Ga0157379_10008673 3300014968 Bacteria 8854
300 Ga0157379_10017000 3300014968 Bacteria 6402
301 Ga0157379_10053219 3300014968 Bacteria 3616
302 Ga0157379_10117779 3300014968 Bacteria 2389
303 Ga0157376_10000954 3300014969 Bacteria 18842
304 Ga0157376_10006818 3300014969 Bacteria 8086
305 Ga0157376_10011066 3300014969 Bacteria 6634
306 Ga0182006_1008452 3300015261 Bacteria 4663
307 Ga0182007_10000951 3300015262 Bacteria 15906
308 Ga0182007_10017245 3300015262 Bacteria 2642
309 Ga0183362_10003 3300015683 Bacteria 977584
310 Ga0163161_10001265 3300017792 Bacteria 18886
311 Ga0163161_10002188 3300017792 Bacteria 14097
312 Ga0163161_10003141 3300017792 Bacteria 11645
313 Ga0163161_10010510 3300017792 Bacteria 6411
314 Ga0213872_10000202 3300021361 Bacteria 52878
315 Ga0213872_10000474 3300021361 Bacteria 32444
316 Ga0213872_10001156 3300021361 Bacteria 17967
317 Ga0209435_100002 3300025206 Bacteria 794178
318 Ga0209674_100041 3300025226 Bacteria 396231
319 Ga0209672_102177 3300025228 Bacteria 5143
320 Ga0209563_100013 3300025230 Bacteria 941463
321 Ga0209563_100043 3300025230 Bacteria 397271
322 Ga0207427_100381 3300025231 Bacteria 26800
323 Ga0209258_100240 3300025242 Bacteria 100990
324 Ga0209258_100659 3300025242 Bacteria 24988
325 Ga0209258_100666 3300025242 Bacteria 24392
326 Ga0207425_1000221 3300025245 Bacteria 44837
327 Ga0207425_1001344 3300025245 Bacteria 10540
328 Ga0207425_1002962 3300025245 Bacteria 5684
329 Ga0207425_1003474 3300025245 Bacteria 5024
330 Ga0209646_1000001 3300025246 Bacteria 3092932
331 Ga0209646_1000157 3300025246 Bacteria 94054
332 Ga0209026_1000001 3300025250 Bacteria 1228671
333 Ga0209026_1000006 3300025250 Bacteria 677225
334 Ga0209677_100900 3300025253 Bacteria 14544
335 Ga0209677_101252 3300025253 Bacteria 11431
336 Ga0209148_1000033 3300025254 Bacteria 555508
337 Ga0209759_1000001 3300025256 Bacteria 2799452
338 Ga0209759_1000194 3300025256 Bacteria 97047
339 Ga0209759_1001392 3300025256 Bacteria 13899
340 Ga0209759_1003989 3300025256 Bacteria 5657
341 Ga0209759_1005336 3300025256 Bacteria 4529
342 Ga0209129_1000012 3300025258 Bacteria 541516
343 Ga0209129_1000054 3300025258 Bacteria 261997
344 Ga0209565_1000067 3300025263 Bacteria 171247
345 Ga0209565_1000128 3300025263 Bacteria 108959
346 Ga0209565_1000679 3300025263 Bacteria 21221
347 Ga0209565_1003213 3300025263 Bacteria 5406
348 Ga0209455_1000227 3300025272 Bacteria 75434
349 Ga0209455_1000569 3300025272 Bacteria 24392
350 Ga0209673_1000008 3300025273 Bacteria 626013
351 Ga0209673_1000097 3300025273 Bacteria 193482
352 Ga0209673_1000172 3300025273 Bacteria 133472
353 Ga0209673_1006425 3300025273 Bacteria 5673
354 Ga0209673_1006833 3300025273 Bacteria 5411
355 Ga0209130_1000072 3300025284 Bacteria 175726
356 Ga0209130_1001362 3300025284 Bacteria 16486
357 Ga0209130_1001611 3300025284 Bacteria 14009
358 Ga0209675_1000038 3300025291 Bacteria 250481
359 Ga0209675_1000260 3300025291 Bacteria 52208
360 Ga0209675_1000527 3300025291 Bacteria 28098
361 Ga0209675_1000690 3300025291 Bacteria 23483
362 Ga0209675_1001272 3300025291 Bacteria 15081
363 Ga0209675_1001985 3300025291 Bacteria 10989
364 Ga0209675_1006252 3300025291 Bacteria 4818
365 Ga0209675_1016309 3300025291 Bacteria 2169
366 Ga0209676_1000023 3300025292 Bacteria 589732
367 Ga0209676_1000048 3300025292 Bacteria 403716
368 Ga0209676_1000141 3300025292 Bacteria 175894
369 Ga0209676_1000739 3300025292 Bacteria 44487
370 Ga0209676_1000836 3300025292 Bacteria 39908
371 Ga0209676_1005022 3300025292 Bacteria 7082
372 Ga0209676_1008633 3300025292 Bacteria 4514
373 Ga0209025_1000028 3300025294 Bacteria 490678
374 Ga0209025_1000174 3300025294 Bacteria 158915
375 Ga0209025_1000538 3300025294 Bacteria 71789
376 Ga0209025_1000657 3300025294 Bacteria 59935
377 Ga0209025_1001066 3300025294 Bacteria 39849
378 Ga0209025_1002686 3300025294 Bacteria 18150
379 Ga0209025_1003753 3300025294 Bacteria 13924
380 Ga0209025_1003759 3300025294 Bacteria 13908
381 Ga0209025_1010615 3300025294 Bacteria 6214
382 Ga0209025_1029285 3300025294 Bacteria 2670
383 Ga0209025_1030949 3300025294 Bacteria 2545
384 Ga0209564_1000008 3300025295 Bacteria 953227
385 Ga0209564_1000022 3300025295 Bacteria 555109
386 Ga0209564_1000241 3300025295 Bacteria 118237
387 Ga0209564_1002257 3300025295 Bacteria 15794
388 Ga0209564_1002377 3300025295 Bacteria 15101
389 Ga0209564_1002910 3300025295 Bacteria 12458
390 Ga0209564_1003110 3300025295 Bacteria 11730
391 Ga0209758_1000034 3300025297 Bacteria 467637
392 Ga0209758_1000124 3300025297 Bacteria 189933
393 Ga0209758_1000234 3300025297 Bacteria 116217
394 Ga0209758_1000456 3300025297 Bacteria 68269
395 Ga0209050_1000012 3300025298 Bacteria 813717
396 Ga0209050_1000022 3300025298 Bacteria 565239
397 Ga0209050_1000294 3300025298 Bacteria 105705
398 Ga0209050_1000315 3300025298 Bacteria 98447
399 Ga0209050_1001261 3300025298 Bacteria 29214
400 Ga0209050_1001301 3300025298 Bacteria 28152
401 Ga0209050_1004556 3300025298 Bacteria 9307
402 Ga0209050_1007315 3300025298 Bacteria 6229
403 Ga0209256_1000001 3300025299 Bacteria 2166974
404 Ga0209256_1000015 3300025299 Bacteria 622953
405 Ga0209256_1000103 3300025299 Bacteria 193900
406 Ga0209256_1000165 3300025299 Bacteria 135104
407 Ga0209256_1000370 3300025299 Bacteria 72409
408 Ga0209256_1000964 3300025299 Bacteria 34690
409 Ga0209256_1003240 3300025299 Bacteria 11721
410 Ga0207426_1000058 3300025302 Bacteria 363857
411 Ga0207426_1000067 3300025302 Bacteria 342108
412 Ga0207426_1000319 3300025302 Bacteria 92696
413 Ga0209051_1000013 3300025303 Bacteria 565239
414 Ga0209051_1000019 3300025303 Bacteria 511268
415 Ga0209051_1000022 3300025303 Bacteria 474879
416 Ga0209051_1000315 3300025303 Bacteria 73579
417 Ga0209051_1001286 3300025303 Bacteria 22218
418 Ga0209051_1001560 3300025303 Bacteria 18951
419 Ga0209051_1002634 3300025303 Bacteria 12590
420 Ga0209051_1003502 3300025303 Bacteria 10261
421 Ga0209051_1007572 3300025303 Bacteria 5913
422 Ga0209051_1021634 3300025303 Bacteria 2729
423 Ga0209257_1000024 3300025304 Bacteria 726068
424 Ga0209257_1000030 3300025304 Bacteria 689812
425 Ga0209257_1000042 3300025304 Bacteria 537149
426 Ga0209257_1000057 3300025304 Bacteria 396985
427 Ga0209257_1000131 3300025304 Bacteria 211464
428 Ga0209257_1000309 3300025304 Bacteria 104166
429 Ga0209257_1004305 3300025304 Bacteria 11192
430 Ga0209257_1009377 3300025304 Bacteria 5264
431 Ga0209257_1013165 3300025304 Bacteria 3716
432 Ga0207697_10002324 3300025315 Bacteria 9900
433 Ga0207656_10001162 3300025321 Bacteria 8647
434 Ga0207696_1001691 3300025711 Bacteria 11466
435 Ga0207655_1000639 3300025728 Bacteria 41880
436 Ga0207682_10002632 3300025893 Bacteria 7995
437 Ga0207645_10000012 3300025907 Bacteria 131374
438 Ga0207645_10002553 3300025907 Bacteria 14225
439 Ga0207645_10018626 3300025907 Bacteria 4561
440 Ga0207645_10023666 3300025907 Bacteria 3988
441 Ga0207705_10064175 3300025909 Bacteria 2654
442 Ga0207684_10004074 3300025910 Bacteria 13941
443 Ga0207707_10010822 3300025912 Bacteria 7928
444 Ga0207707_10027135 3300025912 Bacteria 5007
445 Ga0207707_10034449 3300025912 Bacteria 4430
446 Ga0207695_10018847 3300025913 Bacteria 7964
447 Ga0207695_10040979 3300025913 Bacteria 4959
448 Ga0207671_10017064 3300025914 Bacteria 5613
449 Ga0207671_10032349 3300025914 Bacteria 3894
450 Ga0207660_10029907 3300025917 Bacteria 3741
451 Ga0207662_10002618 3300025918 Bacteria 9081
452 Ga0207662_10010476 3300025918 Bacteria 5121
453 Ga0207657_10000268 3300025919 Bacteria 55307
454 Ga0207657_10003453 3300025919 Bacteria 16866
455 Ga0207649_10091844 3300025920 Bacteria 1989
456 Ga0207652_10002099 3300025921 Bacteria 17115
457 Ga0207652_10022525 3300025921 Bacteria 5213
458 Ga0207646_10000035 3300025922 Bacteria 209056
459 Ga0207646_10054211 3300025922 Bacteria 3587
460 Ga0207646_10129928 3300025922 Bacteria 2266
461 Ga0207681_10058859 3300025923 Bacteria 2632
462 Ga0207694_10007736 3300025924 Bacteria 8136
463 Ga0207694_10027863 3300025924 Bacteria 4304
464 Ga0207650_10008398 3300025925 Bacteria 7049
465 Ga0207650_10014392 3300025925 Bacteria 5498
466 Ga0207659_10000393 3300025926 Bacteria 26320
467 Ga0207659_10003084 3300025926 Bacteria 9945
468 Ga0207659_10026282 3300025926 Bacteria 3926
469 Ga0207687_10007205 3300025927 Bacteria 7332
470 Ga0207687_10007937 3300025927 Bacteria 6951
471 Ga0207644_10001550 3300025931 Bacteria 14827
472 Ga0207644_10001683 3300025931 Bacteria 14251
473 Ga0207644_10004993 3300025931 Bacteria 8661
474 Ga0207690_10028634 3300025932 Bacteria 3532
475 Ga0207690_10034594 3300025932 Bacteria 3256
476 Ga0207706_10001875 3300025933 Bacteria 20601
477 Ga0207706_10003908 3300025933 Bacteria 14140
478 Ga0207706_10095167 3300025933 Bacteria 2620
479 Ga0207706_10133846 3300025933 Bacteria 2180
480 Ga0207686_10075332 3300025934 Unclassified 2184
481 Ga0207709_10000111 3300025935 Bacteria 127580
482 Ga0207709_10000874 3300025935 Bacteria 22951
483 Ga0207709_10004954 3300025935 Bacteria 7622
484 Ga0207709_10008146 3300025935 Bacteria 5804
485 Ga0207709_10015294 3300025935 Bacteria 4254
486 Ga0207670_10000023 3300025936 Bacteria 145527
487 Ga0207670_10014626 3300025936 Bacteria 4665
488 Ga0207669_10002595 3300025937 Bacteria 7723
489 Ga0207704_10001416 3300025938 Bacteria 10725
490 Ga0207704_10001487 3300025938 Bacteria 10503
491 Ga0207665_10079438 3300025939 Bacteria 2255
492 Ga0207691_10000966 3300025940 Bacteria 28538
493 Ga0207691_10001174 3300025940 Bacteria 26054
494 Ga0207691_10002462 3300025940 Bacteria 18101
495 Ga0207691_10046301 3300025940 Bacteria 3997
496 Ga0207691_10065625 3300025940 Bacteria 3284
497 Ga0207691_10069360 3300025940 Bacteria 3184
498 Ga0207711_10005817 3300025941 Bacteria 10420
499 Ga0207711_10042841 3300025941 Bacteria 3858
500 Ga0207711_10044319 3300025941 Bacteria 3797
501 Ga0207689_10000709 3300025942 Bacteria 31888
502 Ga0207689_10115183 3300025942 Bacteria 2209
503 Ga0207661_10068893 3300025944 Bacteria 2883
504 Ga0207679_10000671 3300025945 Bacteria 22930
505 Ga0207667_10038069 3300025949 Bacteria 5138
506 Ga0207667_10080484 3300025949 Bacteria 3375
507 Ga0207651_10001471 3300025960 Bacteria 10709
508 Ga0207651_10024688 3300025960 Bacteria 3723
509 Ga0207651_10031942 3300025960 Bacteria 3373
510 Ga0207712_10120631 3300025961 Bacteria 1983
511 Ga0207668_10077214 3300025972 Bacteria 2400
512 Ga0207677_10000003 3300026023 Bacteria 450061
513 Ga0207677_10024519 3300026023 Bacteria 3749
514 Ga0207677_10032337 3300026023 Bacteria 3362
515 Ga0207677_10050975 3300026023 Bacteria 2803
516 Ga0207677_10056522 3300026023 Bacteria 2689
517 Ga0207703_10000085 3300026035 Bacteria 107333
518 Ga0207703_10021855 3300026035 Bacteria 5009
519 Ga0207703_10045165 3300026035 Bacteria 3543
520 Ga0207703_10085653 3300026035 Bacteria 2638
521 Ga0207639_10007668 3300026041 Bacteria 7368
522 Ga0207678_10000837 3300026067 Bacteria 28213
523 Ga0207678_10014036 3300026067 Bacteria 7044
524 Ga0207708_10000228 3300026075 Bacteria 44336
525 Ga0207708_10001059 3300026075 Bacteria 20614
526 Ga0207708_10014415 3300026075 Bacteria 5917
527 Ga0207702_10002902 3300026078 Bacteria 16043
528 Ga0207702_10030008 3300026078 Bacteria 4529
529 Ga0207702_10051306 3300026078 Bacteria 3485
530 Ga0207702_10112944 3300026078 Bacteria 2419
531 Ga0207641_10013071 3300026088 Bacteria 6809
532 Ga0207641_10106387 3300026088 Bacteria 2479
533 Ga0207648_10000172 3300026089 Bacteria 66986
534 Ga0207648_10001516 3300026089 Bacteria 25587
535 Ga0207648_10006261 3300026089 Bacteria 11850
536 Ga0207648_10011123 3300026089 Bacteria 8490
537 Ga0207648_10021655 3300026089 Bacteria 5775
538 Ga0207648_10029775 3300026089 Bacteria 4841
539 Ga0207648_10054826 3300026089 Bacteria 3481
540 Ga0207676_10000002 3300026095 Bacteria 1198607
541 Ga0207676_10013160 3300026095 Bacteria 5940
542 Ga0207676_10068247 3300026095 Bacteria 2843
543 Ga0207674_10004639 3300026116 Bacteria 16503
544 Ga0207674_10104466 3300026116 Bacteria 2811
545 Ga0207675_100000563 3300026118 Bacteria 36307
546 Ga0207675_100019461 3300026118 Bacteria 6334
547 Ga0207675_100025201 3300026118 Bacteria 5535
548 Ga0207675_100036724 3300026118 Bacteria 4569
549 Ga0207683_10000028 3300026121 Bacteria 109908
550 Ga0207683_10004504 3300026121 Bacteria 12020
551 Ga0207698_10087550 3300026142 Bacteria 2537
552 Ga0207698_10097790 3300026142 Bacteria 2423
553 Ga0209281_1000007 3300027111 Bacteria 938265
554 Ga0209281_1000057 3300027111 Bacteria 307145
555 Ga0209973_1000841 3300027252 Bacteria 2473
556 Ga0209969_1000289 3300027360 Bacteria 6705
557 Ga0209967_1000103 3300027364 Bacteria 11358
558 Ga0209996_1000033 3300027395 Bacteria 21398
559 Ga0210000_1000096 3300027462 Bacteria 12256
560 Ga0209995_1000009 3300027471 Bacteria 32653
561 Ga0209968_1000024 3300027526 Bacteria 28731
562 Ga0209968_1000489 3300027526 Bacteria 6276
563 Ga0209982_1002669 3300027552 Bacteria 2508
564 Ga0209970_1000052 3300027614 Bacteria 15551
565 Ga0209970_1000067 3300027614 Bacteria 14173
566 Ga0210002_1000051 3300027617 Bacteria 17640
567 Ga0209983_1000026 3300027665 Bacteria 19973
568 Ga0209282_1000250 3300027666 Bacteria 26928
569 Ga0209971_1000276 3300027682 Bacteria 14514
570 Ga0209966_1000033 3300027695 Bacteria 59831
571 Ga0209966_1000248 3300027695 Bacteria 19851
572 Ga0209998_10000378 3300027717 Bacteria 12841
573 Ga0209813_10016340 3300027866 Bacteria 2025
574 Ga0209974_10000240 3300027876 Bacteria 17737
575 Ga0209974_10000246 3300027876 Bacteria 17475
576 Ga0209974_10000308 3300027876 Bacteria 15916
577 Ga0209974_10015858 3300027876 Bacteria 2502
578 Ga0207428_10002466 3300027907 Bacteria 18484
579 Ga0268266_10029093 3300028379 Bacteria 4696
580 Ga0268265_10019031 3300028380 Bacteria 4767
581 Ga0268265_10064819 3300028380 Bacteria 2816
582 Ga0268264_10058123 3300028381 Bacteria 3237
583 Ga0265326_10003393 3300028558 Bacteria 5219
584 Ga0265323_10021375 3300028653 Bacteria 2479
585 Ga0265336_10000189 3300028666 Bacteria 42983
586 Ga0307515_10000062 3300028794 Bacteria 247284
587 Ga0307515_10000080 3300028794 Bacteria 224941
588 Ga0307515_10000354 3300028794 Bacteria 112621
589 Ga0307515_10000472 3300028794 Bacteria 96172
590 Ga0307515_10005786 3300028794 Bacteria 24955
591 Ga0307515_10007796 3300028794 Bacteria 21069
592 Ga0307515_10009311 3300028794 Bacteria 19001
593 Ga0307515_10011216 3300028794 Bacteria 17021
594 Ga0307515_10016568 3300028794 Bacteria 13488
595 Ga0265324_10000255 3300029957 Bacteria 39393
596 Ga0316178_1128978 3300030735 Bacteria 5315
597 Ga0265330_10000046 3300031235 Bacteria 108853
598 Ga0265332_10000028 3300031238 Bacteria 184029
599 Ga0265332_10000125 3300031238 Bacteria 63932
600 Ga0265328_10017531 3300031239 Bacteria 2773
601 Ga0265325_10002346 3300031241 Bacteria 12816
602 Ga0265329_10016913 3300031242 Bacteria 2519
603 Ga0265340_10001687 3300031247 Bacteria 12705
604 Ga0265340_10009685 3300031247 Bacteria 5164
605 Ga0265331_10003243 3300031250 Bacteria 10605
606 Ga0265327_10000035 3300031251 Bacteria 314419
607 Ga0265327_10001654 3300031251 Bacteria 26845
608 Ga0307513_10000038 3300031456 Bacteria 174780
609 Ga0307513_10000117 3300031456 Bacteria 110951
610 Ga0307513_10002583 3300031456 Bacteria 25034
611 Ga0307513_10010732 3300031456 Bacteria 11453
612 Ga0307513_10038056 3300031456 Bacteria 5346
613 Ga0307513_10071355 3300031456 Bacteria 3625
614 Ga0307509_10009732 3300031507 Bacteria 11928
615 Ga0307509_10022375 3300031507 Bacteria 7127
616 Ga0307509_10022711 3300031507 Bacteria 7064
617 Ga0307509_10158651 3300031507 Bacteria 2164
618 Ga0307408_100000023 3300031548 Bacteria 295931
619 Ga0307408_100000288 3300031548 Bacteria 49765
620 Ga0307408_100010362 3300031548 Bacteria 6146
621 Ga0265313_10011790 3300031595 Bacteria 5406
622 Ga0307508_10000043 3300031616 Bacteria 143889
623 Ga0307508_10001327 3300031616 Bacteria 27990
624 Ga0307514_10000920 3300031649 Bacteria 44996
625 Ga0307514_10001251 3300031649 Bacteria 33354
626 Ga0307514_10039025 3300031649 Bacteria 3753
627 Ga0265314_10000054 3300031711 Bacteria 184029
628 Ga0265314_10020486 3300031711 Bacteria 5105
629 Ga0265342_10029842 3300031712 Bacteria 3383
630 Ga0307516_10000419 3300031730 Bacteria 55599
631 Ga0307516_10000953 3300031730 Bacteria 39905
632 Ga0307516_10001691 3300031730 Bacteria 30381
633 Ga0307516_10002244 3300031730 Bacteria 26100
634 Ga0307516_10013442 3300031730 Bacteria 8723
635 Ga0307516_10023184 3300031730 Bacteria 6367
636 Ga0307405_10031497 3300031731 Bacteria 3123
637 Ga0307413_10000632 3300031824 Bacteria 11881
638 Ga0307410_10051516 3300031852 Bacteria 2775
639 Ga0307406_10003957 3300031901 Bacteria 8050
640 Ga0307412_10002540 3300031911 Bacteria 10145
641 Ga0307412_10004338 3300031911 Bacteria 7909
642 Ga0307412_10017947 3300031911 Bacteria 4245
643 Ga0307412_10020847 3300031911 Bacteria 3995
644 Ga0307416_100001338 3300032002 Bacteria 13277
645 Ga0307414_10037938 3300032004 Bacteria 3231
646 Ga0307414_10059660 3300032004 Bacteria 2695
647 Ga0307411_10012273 3300032005 Bacteria 4666
648 Ga0307411_10013355 3300032005 Bacteria 4529
649 Ga0307415_100001083 3300032126 Bacteria 12652
650 Ga0307510_10015886 3300033180 Bacteria 8895
651 Ga0373934_0000310 3300035086 Bacteria 17068
652 Ga0373923_0002599 3300035111 Bacteria 5599
653 Ga0373939_0000049 3300035114 Bacteria 42693
654 Ga0373954_0003740 3300035118 Bacteria 6488
655 Ga0373954_0018487 3300035118 Bacteria 3138
656 Ga0373956_0000428 3300035119 Bacteria 17130
657 Ga0373957_0002458 3300035120 Bacteria 5295
658 Ga0373960_0000732 3300035121 Bacteria 6852
659 Ga0373931_0005852 3300035691 Bacteria 5721
660 Ga0373931_0006014 3300035691 Bacteria 5645
661 Ga0373931_0016960 3300035691 Bacteria 3593
662 Ga0373927_0009270 3300035695 Bacteria 6602
663 Ga0373927_0037422 3300035695 Bacteria 3154
664 Ga0373927_0065810 3300035695 Bacteria 2344
665 Ga0373933_0000632 3300035724 Bacteria 21965
666 Ga0373937_0000371 3300036401 Bacteria 41765
667 Ga0373937_0002072 3300036401 Bacteria 16775
668 Ga0373937_0007893 3300036401 Bacteria 9225
669 Ga0373937_0029221 3300036401 Bacteria 4992
670 Ga0373937_0064984 3300036401 Bacteria 3358
671 Ga0373925_0005227 3300037068 Bacteria 9704
672 Ga0373925_0015085 3300037068 Bacteria 5584
673 Ga0395899_0001042 3300037312 Bacteria 25161
674 Ga0395899_0001609 3300037312 Bacteria 18889
675 Ga0395899_0002916 3300037312 Bacteria 13742
676 Ga0395899_0006534 3300037312 Bacteria 9035
677 Ga0395900_0010547 3300037418 Bacteria 9452
678 Ga0395900_0014177 3300037418 Bacteria 8139
679 Ga0395900_0046894 3300037418 Bacteria 4449
680 Ga0395900_0087907 3300037418 Bacteria 3194
681 Ga0395898_0007278 3300037466 Bacteria 11750
682 Ga0395898_0010814 3300037466 Bacteria 9535
683 Ga0395898_0026413 3300037466 Bacteria 5842
684 Ga0395898_0072168 3300037466 Bacteria 3335
685 Ga0395905_0000088 3300037471 Bacteria 152506
686 Ga0395905_0000151 3300037471 Bacteria 115485
687 Ga0395905_0001245 3300037471 Bacteria 31535
688 Ga0395905_0002471 3300037471 Bacteria 20474
689 Ga0395905_0010063 3300037471 Bacteria 9219
690 Ga0395905_0012026 3300037471 Bacteria 8346
691 Ga0395905_0014382 3300037471 Bacteria 7560
692 Ga0395905_0046455 3300037471 Bacteria 4071
693 Ga0395905_0107688 3300037471 Bacteria 2616
694 Ga0395905_0186914 3300037471 Bacteria 1944
695 Ga0395901_0001368 3300038443 Bacteria 25522
696 Ga0395901_0022718 3300038443 Bacteria 6431
697 Ga0395901_0044230 3300038443 Bacteria 4618
698 Ga0395901_0138953 3300038443 Bacteria 2553
699 Ga0436365_0288397 3300039437 Bacteria 14975
700 Ga0436361_0379569 3300039447 Bacteria 51728
701 Ga0436361_0659667 3300039447 Bacteria 30667
702 Ga0436361_1096550 3300039447 Bacteria 54500
703 Ga0439436_0000328 3300041404 Bacteria 11648
704 Ga0439436_0003547 3300041404 Bacteria 4742
705 Ga0451853_1861682 3300041512 Bacteria 2574
706 Ga0439431_0003865 3300041997 Bacteria 3306
707 Ga0439441_002858 3300042001 Bacteria 2475
708 Ga0439442_004178 3300042002 Bacteria 2861
709 Ga0439432_001277 3300042006 Bacteria 9513
710 Ga0439449_0001202 3300042007 Bacteria 10165
711 Ga0439449_0002870 3300042007 Bacteria 6698
712 Ga0439452_009710 3300042010 Bacteria 2827
713 Ga0439457_007647 3300042014 Bacteria 2588
714 Ga0439462_0000369 3300042015 Bacteria 8594
715 Ga0450919_002729 3300042121 Bacteria 2274
716 Ga0450888_000115 3300042126 Bacteria 6339
717 Ga0450888_001171 3300042126 Bacteria 2503
718 Ga0450898_003983 3300042134 Bacteria 2157
719 Ga0450889_000093 3300042144 Bacteria 8414
720 Ga0439434_0008547 3300042435 Bacteria 3004
721 Ga0450918_000202 3300042531 Bacteria 13469
722 Ga0450918_000496 3300042531 Bacteria 8444
723 Ga0450893_0000411 3300042532 Bacteria 6020
724 Ga0451577_0000276 3300042876 Bacteria 99531
725 Ga0451577_0002525 3300042876 Bacteria 21654
726 Ga0451577_0003457 3300042876 Bacteria 17574
727 Ga0451577_0005175 3300042876 Bacteria 13417
728 Ga0451577_0010787 3300042876 Bacteria 8691
729 Ga0451577_0067099 3300042876 Bacteria 3199
730 Ga0451577_0089792 3300042876 Bacteria 2742
731 Ga0451577_0176299 3300042876 Bacteria 1927
732 Ga0466969_0000008 3300044656 Bacteria 139607
733 Ga0466969_0003553 3300044656 Bacteria 8290
734 Ga0466969_0017106 3300044656 Bacteria 3789
735 Ga0453683_0012151 3300044673 Bacteria 5651
736 Ga0466966_0008926 3300044684 Bacteria 6643
737 Ga0466966_0075894 3300044684 Bacteria 2099
738 Ga0466961_0093141 3300044693 Bacteria 1901
739 Ga0453684_0000891 3300044712 Bacteria 99637
740 Ga0453684_0012524 3300044712 Bacteria 13964
741 Ga0453684_0032467 3300044712 Bacteria 7306
742 Ga0453684_0036305 3300044712 Bacteria 6793
743 Ga0453684_0099280 3300044712 Bacteria 3567
744 Ga0466970_0003291 3300044765 Bacteria 7849
745 Ga0466957_0006607 3300044842 Bacteria 6559
746 Ga0466959_0000192 3300045049 Bacteria 40028
747 Ga0466959_0054865 3300045049 Bacteria 2910
748 Ga0451576_0002088 3300045051 Bacteria 31196
749 Ga0451576_0002262 3300045051 Bacteria 29416
750 Ga0451576_0004706 3300045051 Bacteria 17540
751 Ga0451576_0005888 3300045051 Bacteria 15217
752 Ga0451576_0006277 3300045051 Bacteria 14626
753 Ga0451576_0008890 3300045051 Bacteria 11723
754 Ga0451576_0016732 3300045051 Bacteria 8088
755 Ga0451576_0078500 3300045051 Bacteria 3435
756 Ga0451576_0097369 3300045051 Bacteria 3059
757 Ga0451576_0127338 3300045051 Bacteria 2653
758 Ga0451576_0132818 3300045051 Bacteria 2595
759 Ga0466967_0052889 3300045976 Bacteria 3567
760 Ga0466967_0205526 3300045976 Bacteria 1866
761 Ga0495592_0017214 3300046454 Bacteria 5489
762 Ga0495590_0000692 3300046457 Bacteria 15462
763 Ga0495629_0126869 3300046459 Bacteria 1778
764 Ga0495638_0026584 3300046460 Bacteria 3750
765 Ga0495651_0000056 3300046462 Bacteria 83191
766 Ga0495650_0003376 3300046471 Bacteria 11697
767 Ga0495607_0000077 3300046501 Bacteria 99190
768 Ga0495583_0001389 3300046506 Bacteria 24734
769 Ga0495606_0002457 3300046507 Bacteria 21484
770 Ga0495630_0106738 3300046517 Bacteria 2121
771 Ga0495631_0015547 3300046518 Bacteria 3643
772 Ga0495637_0006661 3300046520 Bacteria 5783
773 Ga0495643_0001057 3300046522 Bacteria 27702
774 Ga0495643_0045929 3300046522 Bacteria 2370
775 Ga0495642_0009294 3300046528 Bacteria 3764
776 Ga0495598_0002799 3300046537 Bacteria 3629
777 Ga0495621_0001916 3300046539 Bacteria 5473
778 Ga0495621_0004193 3300046539 Bacteria 4027
779 Ga0495597_0001315 3300046542 Bacteria 18215
780 Ga0495597_0016711 3300046542 Bacteria 3463
781 Ga0495633_0000563 3300046558 Bacteria 36212
782 Ga0495667_0011307 3300046559 Bacteria 6041
783 Ga0495656_0000090 3300046615 Bacteria 39387
784 Ga0495625_0001055 3300046660 Bacteria 36138
785 Ga0495625_0003495 3300046660 Bacteria 15582
786 Ga0495625_0022664 3300046660 Bacteria 4810
787 Ga0495661_0001454 3300046665 Bacteria 19827
788 Ga0495661_0036631 3300046665 Bacteria 3069
789 Ga0495588_0021039 3300046674 Bacteria 3211
790 Ga0495657_0008024 3300046675 Bacteria 8095
791 Ga0495657_0014304 3300046675 Bacteria 5827
792 Ga0495649_0006470 3300046694 Bacteria 7292
793 Ga0495581_0049726 3300047315 Bacteria 2421
794 Ga0495636_0010809 3300047318 Bacteria 3609
795 Ga0495676_0022211 3300047321 Bacteria 5526
796 Ga0495687_000705 3300047443 Bacteria 37210
797 Ga0495687_001104 3300047443 Bacteria 26257
798 Ga0495687_012963 3300047443 Bacteria 4375
799 Ga0495686_0020162 3300047472 Bacteria 4448
800 Ga0495593_0008709 3300047673 Bacteria 5893
801 Ga0495626_0047399 3300048091 Bacteria 1998
802 Ga0496101_0001103 3300048904 Bacteria 16042
803 Ga0496101_0033330 3300048904 Bacteria 3632
804 Ga0496102_0006320 3300048905 Bacteria 10101
805 Ga0496102_0028049 3300048905 Bacteria 5030
806 Ga0496102_0137639 3300048905 Bacteria 2288
807 Ga0496103_0015500 3300048906 Bacteria 4537
808 Ga0496104_0035582 3300048907 Bacteria 4649
809 Ga0496105_0010700 3300048908 Bacteria 7220
810 Ga0496106_0009063 3300048909 Bacteria 7356
811 Ga0496108_0063116 3300048911 Bacteria 3119
812 Ga0496110_0032173 3300048913 Bacteria 4528
813 Ga0496110_0059350 3300048913 Bacteria 3372
814 Ga0496111_0027762 3300048914 Bacteria 4008
815 Ga0496111_0036314 3300048914 Bacteria 3523
816 Ga0496113_0002861 3300048916 Bacteria 10158
817 Ga0496114_0003154 3300048917 Bacteria 12645
818 Ga0496116_0017023 3300048919 Bacteria 5663
819 Ga0496118_0020181 3300048921 Bacteria 5920
820 Ga0496118_0072564 3300048921 Bacteria 2471
821 Ga0496118_0074755 3300048921 Bacteria 2420
822 Ga0496120_0009161 3300048923 Bacteria 7058
823 Ga0496121_0000748 3300048924 Bacteria 59722
824 Ga0496121_0010814 3300048924 Bacteria 10220
825 Ga0496121_0015844 3300048924 Bacteria 7839
826 Ga0496122_0003683 3300048925 Bacteria 19870
827 Ga0496122_0020165 3300048925 Bacteria 6045
828 Ga0496123_0000274 3300048926 Bacteria 101783
829 Ga0496123_0001818 3300048926 Bacteria 28065
830 Ga0496124_0000085 3300048927 Bacteria 203358
831 Ga0496124_0001458 3300048927 Bacteria 34900
832 Ga0496124_0153442 3300048927 Bacteria 1804
833 Ga0496125_0000096 3300048928 Bacteria 205618
834 Ga0496125_0026863 3300048928 Bacteria 5229
835 Ga0496125_0128150 3300048928 Bacteria 1793
836 Ga0496126_0151880 3300048929 Bacteria 1984
837 Ga0501290_001523 3300049513 Bacteria 3159
838 Ga0501296_000042 3300049519 Bacteria 14294
839 Ga0501298_000161 3300049521 Bacteria 8197
840 Ga0501299_000093 3300049522 Bacteria 10085
841 Ga0501300_000410 3300049523 Bacteria 6488
842 Ga0501303_000396 3300049526 Bacteria 3531
843 Ga0501031_0000700 3300049568 Bacteria 20005
844 Ga0501031_0003842 3300049568 Bacteria 9658
845 Ga0501031_0004863 3300049568 Bacteria 8732
846 Ga0501031_0054541 3300049568 Bacteria 2604
847 Ga0501032_0070157 3300049569 Bacteria 2337
848 Ga0501032_0082065 3300049569 Bacteria 2145
849 Ga0501034_0003551 3300049571 Bacteria 17718
850 Ga0501034_0026198 3300049571 Bacteria 5938
851 Ga0501034_0055505 3300049571 Bacteria 3986
852 Ga0501036_0091325 3300049572 Bacteria 2572
853 Ga0501036_0106069 3300049572 Bacteria 2376
854 Ga0501037_0002732 3300049573 Bacteria 12753
855 Ga0501037_0004035 3300049573 Bacteria 10647
856 Ga0501038_0017115 3300049574 Bacteria 6557
857 Ga0501038_0142476 3300049574 Bacteria 1960
858 Ga0501039_0000791 3300049575 Bacteria 22772
859 Ga0501039_0013071 3300049575 Bacteria 6347
860 Ga0501039_0018624 3300049575 Bacteria 5331
861 Ga0501041_0000673 3300049577 Bacteria 18097
862 Ga0501041_0011125 3300049577 Bacteria 5313
863 Ga0501041_0028140 3300049577 Bacteria 3389
864 Ga0501042_0050132 3300049578 Bacteria 2977
865 Ga0501043_0000180 3300049579 Bacteria 56892
866 Ga0501043_0061084 3300049579 Bacteria 2960
867 Ga0501046_0000226 3300049580 Bacteria 58757
868 Ga0501046_0002279 3300049580 Bacteria 18097
869 Ga0501046_0017038 3300049580 Bacteria 6073
870 Ga0501046_0049405 3300049580 Bacteria 3327
871 Ga0501047_0000302 3300049581 Bacteria 56851
872 Ga0501047_0014004 3300049581 Bacteria 7622
873 Ga0501048_0000196 3300049582 Bacteria 39241
874 Ga0501048_0002019 3300049582 Bacteria 15408
875 Ga0501048_0025471 3300049582 Bacteria 4311
876 Ga0501068_0030482 3300049584 Bacteria 3200
877 Ga0501071_0038858 3300049587 Bacteria 3402
878 Ga0501072_0043487 3300049588 Bacteria 3530
879 Ga0501075_0016267 3300049591 Bacteria 5356
880 Ga0501075_0052937 3300049591 Bacteria 3052
881 Ga0501076_0007458 3300049592 Bacteria 7963
882 Ga0501076_0061958 3300049592 Bacteria 2978
883 Ga0501076_0186821 3300049592 Bacteria 1690
884 Ga0501198_000012 3300049649 Bacteria 113529
885 Ga0501201_000043 3300049651 Bacteria 8490
886 Ga0501202_001962 3300049652 Bacteria 3391
887 Ga0501222_000010 3300049662 Bacteria 113536
888 Ga0501227_002638 3300049665 Bacteria 3936
889 Ga0501230_002063 3300049667 Bacteria 2517
890 Ga0501233_000054 3300049668 Bacteria 15155
891 Ga0501236_001251 3300049670 Bacteria 2880
892 Ga0501255_000522 3300049684 Bacteria 2671
893 Ga0501261_001125 3300049690 Bacteria 3276
894 Ga0501221_002698 3300049704 Bacteria 2919
895 Ga0501225_0000934 3300049705 Bacteria 9104
896 Ga0501234_000329 3300049707 Bacteria 6954
897 Ga0501079_0027487 3300049741 Bacteria 4362
898 Ga0501080_0032607 3300049742 Bacteria 4859
899 Ga0501080_0224824 3300049742 Bacteria 1717
900 Ga0501081_0051795 3300049743 Bacteria 2831
901 Ga0501081_0085962 3300049743 Bacteria 2208
902 Ga0501264_000432 3300049761 Bacteria 6466
903 Ga0501266_001186 3300049763 Bacteria 3332
904 Ga0501283_000047 3300049779 Bacteria 15101
905 Ga0501035_0004768 3300049822 Bacteria 12874
906 Ga0501035_0006589 3300049822 Bacteria 10874
907 Ga0501035_0034462 3300049822 Bacteria 4600
908 Ga0501035_0052163 3300049822 Bacteria 3660
909 Ga0501035_0080452 3300049822 Bacteria 2877
910 Ga0501044_0001142 3300049823 Bacteria 31447
911 Ga0501044_0002263 3300049823 Bacteria 21955
912 Ga0501045_0009382 3300049824 Bacteria 6842
913 Ga0501045_0029894 3300049824 Bacteria 3940
914 Ga0501226_000633 3300049853 Bacteria 4819
915 nmdc:mga03n38_5586_c1 3300050490 Bacteria 4294
916 nmdc:mga00v17_76928_c1 3300050491 Bacteria 2077
917 nmdc:mga0k408_10294_c1 3300050493 Bacteria 3361
918 nmdc:mga0k408_14915_c1 3300050493 Bacteria 4291
919 nmdc:mga0k408_1770_c1 3300050493 Bacteria 11584
920 nmdc:mga0k408_19088_c1 3300050493 Bacteria 3829
921 nmdc:mga0k408_2369_c1 3300050493 Bacteria 10026
922 nmdc:mga0k408_23982_c1 3300050493 Bacteria 3446
923 nmdc:mga0k408_25087_c1 3300050493 Bacteria 3374
924 nmdc:mga0k408_254_c1 3300050493 Bacteria 29029
925 nmdc:mga0k408_40618_c1 3300050493 Bacteria 2678
926 nmdc:mga0k408_42876_c1 3300050493 Bacteria 2606
927 nmdc:mga0k408_46880_c1 3300050493 Bacteria 2497
928 nmdc:mga0k408_68579_c1 3300050493 Bacteria 2069
929 nmdc:mga06z11_49102_c1 3300050494 Bacteria 2151
930 nmdc:mga04h51_14278_c1 3300050495 Bacteria 2266
931 nmdc:mga07m45_1683_c1 3300050496 Bacteria 10177
932 nmdc:mga07m45_31899_c1 3300050496 Bacteria 2921
933 nmdc:mga07m45_3705_c1 3300050496 Bacteria 7393
934 nmdc:mga07m45_4400_c1 3300050496 Bacteria 6895
935 nmdc:mga07m45_4458_c1 3300050496 Bacteria 6853
936 nmdc:mga07m45_9703_c2 3300050496 Bacteria 2811
937 nmdc:mga05p37_291_c1 3300050507 Bacteria 52424
938 nmdc:mga05p37_53820_c1 3300050507 Bacteria 4951
939 nmdc:mga09592_12531_c1 3300050508 Bacteria 6909
940 nmdc:mga09592_17097_c1 3300050508 Bacteria 5938
941 nmdc:mga09592_88_c1 3300050508 Bacteria 54764
942 nmdc:mga0qj67_20366_c1 3300050509 Bacteria 5076
943 nmdc:mga06r32_10377_c1 3300050510 Bacteria 8404
944 nmdc:mga06r32_1676_c1 3300050510 Bacteria 19991
945 nmdc:mga08y16_22832_c1 3300050511 Bacteria 6603
946 nmdc:mga0n895_151349_c1 3300050512 Bacteria 2351
947 nmdc:mga0rr50_23697_c1 3300050513 Bacteria 4239
948 nmdc:mga08x19_38138_c1 3300050514 Bacteria 3052
949 nmdc:mga08x19_5935_c1 3300050514 Bacteria 7226
950 nmdc:mga0a205_19495_c1 3300050515 Bacteria 6396
951 nmdc:mga0a205_49952_c1 3300050515 Bacteria 4038
952 Ga0500635_0000210 3300053080 Bacteria 28403
953 Ga0500578_0001060 3300053086 Bacteria 29908
954 Ga0500643_000672 3300053087 Bacteria 22896
955 Ga0500651_0000400 3300053093 Bacteria 23590
956 Ga0500571_000129 3300053110 Bacteria 25327
957 Ga0500593_000579 3300053117 Bacteria 14064
958 Ga0500593_002479 3300053117 Bacteria 6777
959 Ga0500594_0006398 3300053118 Bacteria 2644
960 Ga0500652_000299 3300053131 Bacteria 18083
961 Ga0500658_0002393 3300053134 Bacteria 7265
962 Ga0500658_0003299 3300053134 Bacteria 6124
963 Ga0500559_0000019 3300053136 Bacteria 134862
964 Ga0500568_0000554 3300053139 Bacteria 27551
965 Ga0500568_0002287 3300053139 Bacteria 11411
966 Ga0500590_006655 3300053148 Bacteria 5644
967 Ga0500616_0019210 3300053153 Bacteria 3853
968 Ga0500619_000127 3300053154 Bacteria 19880
969 Ga0500622_0000125 3300053156 Bacteria 81109
970 Ga0500622_0000788 3300053156 Bacteria 27492
971 Ga0500622_0003254 3300053156 Bacteria 11016
972 Ga0500636_0010430 3300053177 Bacteria 5421
973 Ga0590071_001922 3300059421 Bacteria 5321
974 Ga0466962_0029616 3300061719 Bacteria 2620

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0126869 Ga0495629_0126869_21_1406 460
2 3300045976 Ga0466967_0205526 Ga0466967_0205526_16_1554 505
3 3300037418 Ga0395900_0014177 Ga0395900_0014177_12_1547 510
4 3300042876 Ga0451577_0010787 Ga0451577_0010787_5160_6905 510
5 3300045051 Ga0451576_0078500 Ga0451576_0078500_573_2318 510
6 3300045051 Ga0451576_0097369 Ga0451576_0097369_26_1582 512
7 3300006195 Ga0075366_10010444 Ga0075366_100104443 520
8 3300050493 nmdc:mga0k408_46880_c1 nmdc:mga0k408_46880_c1_620_2365 520
9 iso_pu_bacteria 2901300506 2901305434 533
10 3300046518 Ga0495631_0015547 Ga0495631_0015547_960_2582 534
11 3300049742 Ga0501080_0224824 Ga0501080_0224824_31_1647 535
12 3300049763 Ga0501266_001186 Ga0501266_001186_1712_3322 536
13 3300036401 Ga0373937_0029221 Ga0373937_0029221_2986_4599 537
14 3300047472 Ga0495686_0020162 Ga0495686_0020162_1948_3693 537
15 3300053080 Ga0500635_0000210 Ga0500635_0000210_6723_8468 537
16 3300021361 Ga0213872_10001156 Ga0213872_1000115610 538
17 3300039447 Ga0436361_0659667 Ga0436361_0659667_4220_6001 538
18 3300050493 nmdc:mga0k408_68579_c1 nmdc:mga0k408_68579_c1_11_1630 538
19 3300005327 Ga0070658_10064689 Ga0070658_100646893 539
20 3300025256 Ga0209759_1003989 Ga0209759_10039892 539
21 3300049592 Ga0501076_0186821 Ga0501076_0186821_40_1677 539
22 3300050512 nmdc:mga0n895_151349_c1 nmdc:mga0n895_151349_c1_688_2325 539
23 3300005366 Ga0070659_100060132 Ga0070659_1000601321 540
24 3300005549 Ga0070704_100001426 Ga0070704_1000014262 540
25 3300037471 Ga0395905_0107688 Ga0395905_0107688_97_1842 540
26 3300047315 Ga0495581_0049726 Ga0495581_0049726_707_2332 540
27 3300050509 nmdc:mga0qj67_20366_c1 nmdc:mga0qj67_20366_c1_2115_3740 540
28 3300006353 Ga0075370_10002426 Ga0075370_100024268 541
29 3300031239 Ga0265328_10017531 Ga0265328_100175313 541
30 3300031250 Ga0265331_10003243 Ga0265331_100032437 541
31 3300031251 Ga0265327_10000035 Ga0265327_10000035240 541
32 3300031730 Ga0307516_10000419 Ga0307516_100004199 541
33 3300050514 nmdc:mga08x19_5935_c1 nmdc:mga08x19_5935_c1_1833_3524 545
34 iso_pu_bacteria 2857542790 2857542810 545
35 3300031595 Ga0265313_10011790 Ga0265313_100117903 546
36 3300031712 Ga0265342_10029842 Ga0265342_100298421 546
37 3300028666 Ga0265336_10000189 Ga0265336_1000018910 548
38 3300029957 Ga0265324_10000255 Ga0265324_100002556 548
39 3300025245 Ga0207425_1003474 Ga0207425_10034742 550
40 3300025297 Ga0209758_1000456 Ga0209758_10004567 550
41 3300044693 Ga0466961_0093141 Ga0466961_0093141_182_1861 550
42 3300025909 Ga0207705_10064175 Ga0207705_100641752 551
43 3300028653 Ga0265323_10021375 Ga0265323_100213752 551
44 3300042876 Ga0451577_0005175 Ga0451577_0005175_3626_5341 551
45 3300044673 Ga0453683_0012151 Ga0453683_0012151_3035_4750 551
46 3300044712 Ga0453684_0012524 Ga0453684_0012524_1567_3282 551
47 3300045051 Ga0451576_0006277 Ga0451576_0006277_8818_10533 551
48 3300031852 Ga0307410_10051516 Ga0307410_100515161 553
49 3300035086 Ga0373934_0000310 Ga0373934_0000310_7696_9402 553
50 3300035119 Ga0373956_0000428 Ga0373956_0000428_10388_12094 553
51 3300035120 Ga0373957_0002458 Ga0373957_0002458_952_2658 553
52 3300035724 Ga0373933_0000632 Ga0373933_0000632_8168_9874 553
53 3300036401 Ga0373937_0000371 Ga0373937_0000371_38792_40498 553
54 3300046462 Ga0495651_0000056 Ga0495651_0000056_67299_69005 553
55 3300046675 Ga0495657_0014304 Ga0495657_0014304_2595_4301 553
56 3300003771 Ga0055526_1010839 Ga0055526_10108391 555
57 3300006195 Ga0075366_10006507 Ga0075366_100065077 555
58 3300013306 Ga0163162_10119727 Ga0163162_101197273 555
59 3300014969 Ga0157376_10000954 Ga0157376_100009548 555
60 3300015262 Ga0182007_10017245 Ga0182007_100172453 555
61 3300028558 Ga0265326_10003393 Ga0265326_100033933 555
62 3300031247 Ga0265340_10001687 Ga0265340_100016876 555
63 3300042876 Ga0451577_0089792 Ga0451577_0089792_14_1684 555
64 3300044656 Ga0466969_0017106 Ga0466969_0017106_16_1758 555
65 3300044684 Ga0466966_0008926 Ga0466966_0008926_4809_6551 555
66 3300046539 Ga0495621_0004193 Ga0495621_0004193_891_2564 555
67 3300048927 Ga0496124_0153442 Ga0496124_0153442_111_1787 555
68 3300049569 Ga0501032_0070157 Ga0501032_0070157_29_1699 555
69 3300053118 Ga0500594_0006398 Ga0500594_0006398_821_2494 555
70 3300053134 Ga0500658_0002393 Ga0500658_0002393_5323_6993 555
71 3300053139 Ga0500568_0000554 Ga0500568_0000554_21856_23526 555
72 3300053153 Ga0500616_0019210 Ga0500616_0019210_308_1978 555
73 3300053087 Ga0500643_000672 Ga0500643_000672_5060_6766 556
74 3300053139 Ga0500568_0002287 Ga0500568_0002287_162_1868 556
75 3300005330 Ga0070690_100023747 Ga0070690_1000237473 557
76 3300005334 Ga0068869_100037918 Ga0068869_1000379183 557
77 3300005617 Ga0068859_100007249 Ga0068859_1000072495 557
78 3300005719 Ga0068861_100060362 Ga0068861_1000603622 557
79 3300005842 Ga0068858_100069799 Ga0068858_1000697993 557
80 3300006931 Ga0097620_100007249 Ga0097620_10000724910 557
81 3300009176 Ga0105242_10027648 Ga0105242_100276486 557
82 3300014745 Ga0157377_10004958 Ga0157377_100049587 557
83 3300025942 Ga0207689_10115183 Ga0207689_101151832 557
84 3300026023 Ga0207677_10050975 Ga0207677_100509752 557
85 3300026035 Ga0207703_10045165 Ga0207703_100451653 557
86 3300038443 Ga0395901_0001368 Ga0395901_0001368_4436_6181 557
87 3300048909 Ga0496106_0009063 Ga0496106_0009063_5476_7218 557
88 3300050493 nmdc:mga0k408_25087_c1 nmdc:mga0k408_25087_c1_316_2061 557
89 3300031507 Ga0307509_10158651 Ga0307509_101586512 559
90 3300049582 Ga0501048_0025471 Ga0501048_0025471_2598_4298 559
91 3300049670 Ga0501236_001251 Ga0501236_001251_492_2180 559
92 3300003761 Ga0055535_1001368 Ga0055535_10013684 560
93 3300003763 Ga0055529_1000661 Ga0055529_100066111 560
94 3300009147 Ga0114129_10104273 Ga0114129_101042732 560
95 3300025242 Ga0209258_100666 Ga0209258_10066617 560
96 3300025256 Ga0209759_1001392 Ga0209759_100139212 560
97 3300025272 Ga0209455_1000569 Ga0209455_100056917 560
98 3300025944 Ga0207661_10068893 Ga0207661_100688932 560
99 3300026142 Ga0207698_10087550 Ga0207698_100875501 560
100 3300045051 Ga0451576_0016732 Ga0451576_0016732_5994_7739 560
101 3300053177 Ga0500636_0010430 Ga0500636_0010430_481_2226 560
102 3300031911 Ga0307412_10020847 Ga0307412_100208473 561
103 3300041404 Ga0439436_0003547 Ga0439436_0003547_346_2091 561
104 3300041512 Ga0451853_1861682 Ga0451853_1861682_289_2034 561
105 3300042007 Ga0439449_0002870 Ga0439449_0002870_1836_3581 561
106 3300042010 Ga0439452_009710 Ga0439452_009710_564_2309 561
107 3300042015 Ga0439462_0000369 Ga0439462_0000369_3512_5257 561
108 3300042134 Ga0450898_003983 Ga0450898_003983_146_1891 561
109 3300042876 Ga0451577_0002525 Ga0451577_0002525_10323_12068 561
110 3300005331 Ga0070670_100041149 Ga0070670_1000411492 562
111 3300006946 Ga0079104_1000055 Ga0079104_100005539 562
112 3300009092 Ga0105250_10001192 Ga0105250_100011927 562
113 3300009148 Ga0105243_10002600 Ga0105243_100026009 562
114 3300025711 Ga0207696_1001691 Ga0207696_10016917 562
115 3300025922 Ga0207646_10129928 Ga0207646_101299282 562
116 3300025925 Ga0207650_10014392 Ga0207650_100143923 562
117 3300025935 Ga0207709_10000111 Ga0207709_1000011188 562
118 3300027111 Ga0209281_1000007 Ga0209281_1000007790 562
119 3300005334 Ga0068869_100016954 Ga0068869_1000169544 563
120 3300005338 Ga0068868_100001584 Ga0068868_10000158418 563
121 3300005354 Ga0070675_100036240 Ga0070675_1000362402 563
122 3300009147 Ga0114129_10012020 Ga0114129_100120207 563
123 3300014969 Ga0157376_10011066 Ga0157376_100110662 563
124 3300025942 Ga0207689_10000709 Ga0207689_1000070919 563
125 3300026088 Ga0207641_10106387 Ga0207641_101063872 563
126 3300026118 Ga0207675_100000563 Ga0207675_10000056319 563
127 3300048914 Ga0496111_0036314 Ga0496111_0036314_131_1873 563
128 3300005328 Ga0070676_10003268 Ga0070676_100032682 564
129 3300005331 Ga0070670_100001784 Ga0070670_10000178417 564
130 3300005334 Ga0068869_100002674 Ga0068869_1000026743 564
131 3300005336 Ga0070680_100002947 Ga0070680_1000029475 564
132 3300005337 Ga0070682_100000079 Ga0070682_10000007929 564
133 3300005337 Ga0070682_100009153 Ga0070682_1000091532 564
134 3300005337 Ga0070682_100027278 Ga0070682_1000272782 564
135 3300005338 Ga0068868_100014958 Ga0068868_1000149582 564
136 3300005339 Ga0070660_100014250 Ga0070660_1000142505 564
137 3300005340 Ga0070689_100004489 Ga0070689_1000044896 564
138 3300005343 Ga0070687_100006716 Ga0070687_1000067162 564
139 3300005343 Ga0070687_100022178 Ga0070687_1000221782 564
140 3300005344 Ga0070661_100002141 Ga0070661_1000021419 564
141 3300005345 Ga0070692_10035278 Ga0070692_100352782 564
142 3300005353 Ga0070669_100003084 Ga0070669_1000030847 564
143 3300005354 Ga0070675_100004992 Ga0070675_1000049925 564
144 3300005365 Ga0070688_100067471 Ga0070688_1000674712 564
145 3300005366 Ga0070659_100008981 Ga0070659_1000089812 564
146 3300005366 Ga0070659_100110470 Ga0070659_1001104702 564
147 3300005367 Ga0070667_100012295 Ga0070667_1000122952 564
148 3300005440 Ga0070705_100013380 Ga0070705_1000133802 564
149 3300005441 Ga0070700_100006861 Ga0070700_1000068615 564
150 3300005444 Ga0070694_100007484 Ga0070694_1000074843 564
151 3300005456 Ga0070678_100001803 Ga0070678_1000018034 564
152 3300005457 Ga0070662_100004722 Ga0070662_1000047222 564
153 3300005458 Ga0070681_10002791 Ga0070681_100027917 564
154 3300005530 Ga0070679_100017182 Ga0070679_1000171822 564
155 3300005543 Ga0070672_100000368 Ga0070672_10000036826 564
156 3300005543 Ga0070672_100012177 Ga0070672_1000121772 564
157 3300005544 Ga0070686_100003006 Ga0070686_1000030066 564
158 3300005545 Ga0070695_100005400 Ga0070695_1000054005 564
159 3300005546 Ga0070696_100032488 Ga0070696_1000324882 564
160 3300005548 Ga0070665_100050414 Ga0070665_1000504142 564
161 3300005549 Ga0070704_100008826 Ga0070704_1000088263 564
162 3300005563 Ga0068855_100102108 Ga0068855_1001021082 564
163 3300005564 Ga0070664_100009588 Ga0070664_1000095882 564
164 3300005618 Ga0068864_100000001 Ga0068864_100000001194 564
165 3300005843 Ga0068860_100036131 Ga0068860_1000361312 564
166 3300005844 Ga0068862_100060633 Ga0068862_1000606332 564
167 3300005937 Ga0081455_10000552 Ga0081455_1000055249 564
168 3300006051 Ga0075364_10006841 Ga0075364_100068416 564
169 3300006358 Ga0068871_100002097 Ga0068871_1000020977 564
170 3300006847 Ga0075431_100028239 Ga0075431_1000282392 564
171 3300006852 Ga0075433_10045779 Ga0075433_100457792 564
172 3300006880 Ga0075429_100011337 Ga0075429_1000113372 564
173 3300006880 Ga0075429_100050294 Ga0075429_1000502942 564
174 3300006881 Ga0068865_100006429 Ga0068865_1000064292 564
175 3300006914 Ga0075436_100031317 Ga0075436_1000313172 564
176 3300009093 Ga0105240_10080518 Ga0105240_100805182 564
177 3300009098 Ga0105245_10000957 Ga0105245_1000095710 564
178 3300009098 Ga0105245_10005072 Ga0105245_100050724 564
179 3300009147 Ga0114129_10047712 Ga0114129_100477124 564
180 3300009176 Ga0105242_10003752 Ga0105242_100037526 564
181 3300010375 Ga0105239_10025113 Ga0105239_100251132 564
182 3300011119 Ga0105246_10007146 Ga0105246_100071465 564
183 3300013100 Ga0157373_10021292 Ga0157373_100212922 564
184 3300013105 Ga0157369_10161722 Ga0157369_101617221 564
185 3300013296 Ga0157374_10009960 Ga0157374_100099607 564
186 3300013297 Ga0157378_10003351 Ga0157378_100033518 564
187 3300013308 Ga0157375_10000077 Ga0157375_1000007799 564
188 3300014745 Ga0157377_10000808 Ga0157377_100008087 564
189 3300014969 Ga0157376_10006818 Ga0157376_100068183 564
190 3300025295 Ga0209564_1000008 Ga0209564_1000008288 564
191 3300025907 Ga0207645_10000012 Ga0207645_1000001299 564
192 3300025912 Ga0207707_10010822 Ga0207707_100108225 564
193 3300025918 Ga0207662_10002618 Ga0207662_100026187 564
194 3300025918 Ga0207662_10010476 Ga0207662_100104763 564
195 3300025919 Ga0207657_10000268 Ga0207657_1000026816 564
196 3300025921 Ga0207652_10022525 Ga0207652_100225252 564
197 3300025924 Ga0207694_10027863 Ga0207694_100278634 564
198 3300025926 Ga0207659_10026282 Ga0207659_100262822 564
199 3300025927 Ga0207687_10007205 Ga0207687_100072052 564
200 3300025927 Ga0207687_10007937 Ga0207687_100079372 564
201 3300025932 Ga0207690_10034594 Ga0207690_100345942 564
202 3300025933 Ga0207706_10001875 Ga0207706_1000187511 564
203 3300025936 Ga0207670_10014626 Ga0207670_100146262 564
204 3300025938 Ga0207704_10001416 Ga0207704_100014162 564
205 3300025940 Ga0207691_10000966 Ga0207691_1000096628 564
206 3300025940 Ga0207691_10002462 Ga0207691_100024628 564
207 3300025960 Ga0207651_10031942 Ga0207651_100319422 564
208 3300026023 Ga0207677_10000003 Ga0207677_10000003305 564
209 3300026035 Ga0207703_10085653 Ga0207703_100856532 564
210 3300026067 Ga0207678_10014036 Ga0207678_100140362 564
211 3300026075 Ga0207708_10001059 Ga0207708_1000105911 564
212 3300026078 Ga0207702_10030008 Ga0207702_100300084 564
213 3300026089 Ga0207648_10006261 Ga0207648_100062615 564
214 3300026095 Ga0207676_10000002 Ga0207676_10000002640 564
215 3300026121 Ga0207683_10000028 Ga0207683_1000002891 564
216 3300027360 Ga0209969_1000289 Ga0209969_10002894 564
217 3300027364 Ga0209967_1000103 Ga0209967_10001034 564
218 3300027395 Ga0209996_1000033 Ga0209996_10000332 564
219 3300027462 Ga0210000_1000096 Ga0210000_10000962 564
220 3300027471 Ga0209995_1000009 Ga0209995_100000924 564
221 3300027526 Ga0209968_1000024 Ga0209968_10000242 564
222 3300027552 Ga0209982_1002669 Ga0209982_10026691 564
223 3300027614 Ga0209970_1000067 Ga0209970_10000676 564
224 3300027617 Ga0210002_1000051 Ga0210002_10000518 564
225 3300027665 Ga0209983_1000026 Ga0209983_100002615 564
226 3300027682 Ga0209971_1000276 Ga0209971_10002766 564
227 3300027695 Ga0209966_1000248 Ga0209966_10002484 564
228 3300027717 Ga0209998_10000378 Ga0209998_100003788 564
229 3300027876 Ga0209974_10000246 Ga0209974_100002468 564
230 3300027876 Ga0209974_10000308 Ga0209974_100003085 564
231 3300027907 Ga0207428_10002466 Ga0207428_1000246611 564
232 3300028380 Ga0268265_10064819 Ga0268265_100648192 564
233 3300032004 Ga0307414_10037938 Ga0307414_100379382 564
234 3300042126 Ga0450888_001171 Ga0450888_001171_644_2347 564
235 3300045051 Ga0451576_0127338 Ga0451576_0127338_399_2111 564
236 3300046457 Ga0495590_0000692 Ga0495590_0000692_4630_6375 564
237 3300049513 Ga0501290_001523 Ga0501290_001523_827_2530 564
238 3300049519 Ga0501296_000042 Ga0501296_000042_7289_8992 564
239 3300049521 Ga0501298_000161 Ga0501298_000161_3456_5159 564
240 3300049522 Ga0501299_000093 Ga0501299_000093_2291_3994 564
241 3300049523 Ga0501300_000410 Ga0501300_000410_700_2403 564
242 3300049526 Ga0501303_000396 Ga0501303_000396_1103_2806 564
243 3300049568 Ga0501031_0054541 Ga0501031_0054541_624_2336 564
244 3300049572 Ga0501036_0091325 Ga0501036_0091325_817_2529 564
245 3300049577 Ga0501041_0028140 Ga0501041_0028140_834_2546 564
246 3300049580 Ga0501046_0049405 Ga0501046_0049405_275_1987 564
247 3300049584 Ga0501068_0030482 Ga0501068_0030482_1406_3118 564
248 3300049587 Ga0501071_0038858 Ga0501071_0038858_1135_2847 564
249 3300049591 Ga0501075_0016267 Ga0501075_0016267_751_2463 564
250 3300049592 Ga0501076_0007458 Ga0501076_0007458_5589_7301 564
251 3300049651 Ga0501201_000043 Ga0501201_000043_1994_3697 564
252 3300049652 Ga0501202_001962 Ga0501202_001962_346_2049 564
253 3300049667 Ga0501230_002063 Ga0501230_002063_790_2493 564
254 3300049668 Ga0501233_000054 Ga0501233_000054_4080_5783 564
255 3300049684 Ga0501255_000522 Ga0501255_000522_726_2429 564
256 3300049690 Ga0501261_001125 Ga0501261_001125_1099_2802 564
257 3300049705 Ga0501225_0000934 Ga0501225_0000934_4178_5881 564
258 3300049707 Ga0501234_000329 Ga0501234_000329_3688_5391 564
259 3300049741 Ga0501079_0027487 Ga0501079_0027487_1449_3161 564
260 3300049742 Ga0501080_0032607 Ga0501080_0032607_2627_4339 564
261 3300049743 Ga0501081_0051795 Ga0501081_0051795_1070_2782 564
262 3300049761 Ga0501264_000432 Ga0501264_000432_1470_3173 564
263 3300049779 Ga0501283_000047 Ga0501283_000047_6180_7883 564
264 3300049822 Ga0501035_0034462 Ga0501035_0034462_2336_4048 564
265 3300049853 Ga0501226_000633 Ga0501226_000633_316_2019 564
266 3300050507 nmdc:mga05p37_53820_c1 nmdc:mga05p37_53820_c1_2620_4332 564
267 3300050508 nmdc:mga09592_12531_c1 nmdc:mga09592_12531_c1_820_2532 564
268 3300050510 nmdc:mga06r32_10377_c1 nmdc:mga06r32_10377_c1_103_1815 564
269 3300050511 nmdc:mga08y16_22832_c1 nmdc:mga08y16_22832_c1_4072_5784 564
270 3300050513 nmdc:mga0rr50_23697_c1 nmdc:mga0rr50_23697_c1_1395_3107 564
271 3300050514 nmdc:mga08x19_38138_c1 nmdc:mga08x19_38138_c1_852_2564 564
272 3300050515 nmdc:mga0a205_19495_c1 nmdc:mga0a205_19495_c1_613_2325 564
273 3300005295 Ga0065707_10104681 Ga0065707_101046812 565
274 3300005295 Ga0065707_10123248 Ga0065707_101232481 565
275 3300005330 Ga0070690_100000107 Ga0070690_10000010730 565
276 3300005340 Ga0070689_100001349 Ga0070689_1000013492 565
277 3300005343 Ga0070687_100007662 Ga0070687_1000076622 565
278 3300005365 Ga0070688_100001166 Ga0070688_1000011665 565
279 3300005438 Ga0070701_10000356 Ga0070701_100003562 565
280 3300005441 Ga0070700_100002053 Ga0070700_1000020537 565
281 3300005458 Ga0070681_10017818 Ga0070681_100178186 565
282 3300005459 Ga0068867_100007291 Ga0068867_1000072915 565
283 3300005466 Ga0070685_10000570 Ga0070685_1000057029 565
284 3300005468 Ga0070707_100000110 Ga0070707_10000011052 565
285 3300005468 Ga0070707_100118641 Ga0070707_1001186412 565
286 3300005471 Ga0070698_100065792 Ga0070698_1000657922 565
287 3300005518 Ga0070699_100008765 Ga0070699_1000087655 565
288 3300005518 Ga0070699_100015887 Ga0070699_1000158873 565
289 3300005518 Ga0070699_100064514 Ga0070699_1000645141 565
290 3300005536 Ga0070697_100024444 Ga0070697_1000244443 565
291 3300005544 Ga0070686_100006419 Ga0070686_1000064192 565
292 3300005615 Ga0070702_100002394 Ga0070702_1000023946 565
293 3300005617 Ga0068859_100000648 Ga0068859_10000064824 565
294 3300005719 Ga0068861_100018170 Ga0068861_1000181702 565
295 3300005842 Ga0068858_100000467 Ga0068858_1000004675 565
296 3300006237 Ga0097621_100009437 Ga0097621_1000094373 565
297 3300006358 Ga0068871_100034947 Ga0068871_1000349472 565
298 3300006844 Ga0075428_100234656 Ga0075428_1002346562 565
299 3300006846 Ga0075430_100025182 Ga0075430_1000251823 565
300 3300006931 Ga0097620_100000648 Ga0097620_10000064824 565
301 3300009147 Ga0114129_10173521 Ga0114129_101735212 565
302 3300009176 Ga0105242_10079072 Ga0105242_100790722 565
303 3300009177 Ga0105248_10000624 Ga0105248_100006248 565
304 3300014326 Ga0157380_10097782 Ga0157380_100977822 565
305 3300025912 Ga0207707_10027135 Ga0207707_100271352 565
306 3300025922 Ga0207646_10000035 Ga0207646_10000035172 565
307 3300025922 Ga0207646_10054211 Ga0207646_100542112 565
308 3300025934 Ga0207686_10075332 Ga0207686_100753322 565
309 3300025936 Ga0207670_10000023 Ga0207670_1000002321 565
310 3300025941 Ga0207711_10005817 Ga0207711_100058178 565
311 3300026035 Ga0207703_10000085 Ga0207703_1000008528 565
312 3300026075 Ga0207708_10000228 Ga0207708_1000022843 565
313 3300026089 Ga0207648_10029775 Ga0207648_100297752 565
314 3300026118 Ga0207675_100019461 Ga0207675_1000194612 565
315 3300035111 Ga0373923_0002599 Ga0373923_0002599_1508_3229 565
316 3300035118 Ga0373954_0018487 Ga0373954_0018487_1089_2810 565
317 3300035695 Ga0373927_0065810 Ga0373927_0065810_159_1880 565
318 3300036401 Ga0373937_0002072 Ga0373937_0002072_6494_8215 565
319 3300036401 Ga0373937_0064984 Ga0373937_0064984_571_2271 565
320 3300042001 Ga0439441_002858 Ga0439441_002858_333_2048 565
321 3300042876 Ga0451577_0176299 Ga0451577_0176299_59_1759 565
322 3300046675 Ga0495657_0008024 Ga0495657_0008024_4111_5811 565
323 3300049568 Ga0501031_0000700 Ga0501031_0000700_17872_19578 565
324 3300049568 Ga0501031_0003842 Ga0501031_0003842_2430_4226 565
325 3300049568 Ga0501031_0004863 Ga0501031_0004863_1530_3236 565
326 3300049569 Ga0501032_0082065 Ga0501032_0082065_243_1949 565
327 3300049572 Ga0501036_0106069 Ga0501036_0106069_213_1931 565
328 3300049573 Ga0501037_0002732 Ga0501037_0002732_1621_3327 565
329 3300049573 Ga0501037_0004035 Ga0501037_0004035_7740_9446 565
330 3300049574 Ga0501038_0017115 Ga0501038_0017115_3246_4952 565
331 3300049574 Ga0501038_0142476 Ga0501038_0142476_71_1789 565
332 3300049575 Ga0501039_0000791 Ga0501039_0000791_6718_8424 565
333 3300049575 Ga0501039_0013071 Ga0501039_0013071_2998_4704 565
334 3300049575 Ga0501039_0018624 Ga0501039_0018624_3080_4798 565
335 3300049577 Ga0501041_0000673 Ga0501041_0000673_4594_6300 565
336 3300049577 Ga0501041_0011125 Ga0501041_0011125_2324_4042 565
337 3300049578 Ga0501042_0050132 Ga0501042_0050132_494_2200 565
338 3300049579 Ga0501043_0061084 Ga0501043_0061084_666_2372 565
339 3300049580 Ga0501046_0002279 Ga0501046_0002279_15134_16840 565
340 3300049582 Ga0501048_0000196 Ga0501048_0000196_31044_32750 565
341 3300049588 Ga0501072_0043487 Ga0501072_0043487_466_2172 565
342 3300049591 Ga0501075_0052937 Ga0501075_0052937_880_2580 565
343 3300049592 Ga0501076_0061958 Ga0501076_0061958_386_2092 565
344 3300049743 Ga0501081_0085962 Ga0501081_0085962_320_2020 565
345 3300049822 Ga0501035_0052163 Ga0501035_0052163_411_2117 565
346 3300049822 Ga0501035_0080452 Ga0501035_0080452_988_2694 565
347 3300049824 Ga0501045_0029894 Ga0501045_0029894_1376_3094 565
348 3300050515 nmdc:mga0a205_49952_c1 nmdc:mga0a205_49952_c1_1994_3694 565
349 3300005471 Ga0070698_100003773 Ga0070698_10000377314 566
350 3300005549 Ga0070704_100007740 Ga0070704_1000077408 566
351 3300005844 Ga0068862_100046353 Ga0068862_1000463533 566
352 3300006847 Ga0075431_100045331 Ga0075431_1000453311 566
353 3300006880 Ga0075429_100000018 Ga0075429_10000001823 566
354 3300009147 Ga0114129_10005674 Ga0114129_1000567411 566
355 3300046537 Ga0495598_0002799 Ga0495598_0002799_822_2579 566
356 3300050507 nmdc:mga05p37_291_c1 nmdc:mga05p37_291_c1_48516_50222 566
357 3300050508 nmdc:mga09592_88_c1 nmdc:mga09592_88_c1_33712_35418 566
358 3300050510 nmdc:mga06r32_1676_c1 nmdc:mga06r32_1676_c1_14588_16294 566
359 3300035118 Ga0373954_0003740 Ga0373954_0003740_420_2123 567
360 3300035695 Ga0373927_0037422 Ga0373927_0037422_1421_3142 567
361 3300037068 Ga0373925_0015085 Ga0373925_0015085_3179_4903 567
362 3300037471 Ga0395905_0002471 Ga0395905_0002471_5213_6958 567
363 3300046517 Ga0495630_0106738 Ga0495630_0106738_304_2007 567
364 3300046539 Ga0495621_0001916 Ga0495621_0001916_2608_4347 567
365 3300046559 Ga0495667_0011307 Ga0495667_0011307_3192_4895 567
366 3300028794 Ga0307515_10000062 Ga0307515_1000006275 568
367 3300031235 Ga0265330_10000046 Ga0265330_100000465 568
368 3300031238 Ga0265332_10000028 Ga0265332_10000028107 568
369 3300031241 Ga0265325_10002346 Ga0265325_100023464 568
370 3300031247 Ga0265340_10009685 Ga0265340_100096853 568
371 3300031711 Ga0265314_10000054 Ga0265314_10000054107 568
372 3300048905 Ga0496102_0006320 Ga0496102_0006320_2872_4617 568
373 3300003792 Ga0055540_1007611 Ga0055540_10076114 569
374 3300003794 Ga0055531_10000500 Ga0055531_1000050022 569
375 3300005333 Ga0070677_10003533 Ga0070677_100035332 569
376 3300005459 Ga0068867_100000735 Ga0068867_10000073522 569
377 3300013308 Ga0157375_10020637 Ga0157375_100206377 569
378 3300025298 Ga0209050_1001301 Ga0209050_10013017 569
379 3300025303 Ga0209051_1003502 Ga0209051_10035023 569
380 3300025303 Ga0209051_1007572 Ga0209051_10075724 569
381 3300025304 Ga0209257_1000131 Ga0209257_100013117 569
382 3300025960 Ga0207651_10024688 Ga0207651_100246883 569
383 3300026023 Ga0207677_10032337 Ga0207677_100323371 569
384 3300026116 Ga0207674_10104466 Ga0207674_101044661 569
385 iso_pu_bacteria 2513237150 2513954236 569
386 iso_pu_bacteria 2513237165 2514042976 569
387 iso_pu_bacteria 2739367655 2739611883 569
388 iso_pu_bacteria 2858688981 2858692169 569
389 iso_pu_bacteria 644736347 644749015 569
390 iso_pu_bacteria 2858950400 2858955363 570
391 3300006846 Ga0075430_100131987 Ga0075430_1001319872 571
392 3300046471 Ga0495650_0003376 Ga0495650_0003376_352_2097 571
393 iso_pu_bacteria 2599185292 2599904497 571
394 iso_pu_bacteria 2643221569 2643861086 571
395 iso_pu_bacteria 2643221594 2643983463 571
396 iso_pu_bacteria 2643221621 2644124387 571
397 iso_pu_bacteria 2808606395 2809032624 571
398 iso_pu_bacteria 2834641062 2834642937 571
399 iso_pu_bacteria 2855730933 2855733756 571
400 iso_pu_bacteria 2855767633 2855772027 571
401 iso_pu_bacteria 2857537821 2857542314 571
402 iso_pu_bacteria 2881412998 2881417616 571
403 iso_pu_bacteria 2941479691 2941485446 571
404 iso_pu_bacteria 8003400568 8003400891 571
405 iso_pu_bacteria 8055225921 8055228897 571
406 3300004625 Ga0055543_1001329 Ga0055543_10013299 572
407 3300005262 Ga0065165_1000016 Ga0065165_1000016258 572
408 3300005577 Ga0068857_100059410 Ga0068857_1000594103 572
409 3300006881 Ga0068865_100053538 Ga0068865_1000535382 572
410 3300009553 Ga0105249_10026571 Ga0105249_100265713 572
411 3300025263 Ga0209565_1003213 Ga0209565_10032134 572
412 3300025273 Ga0209673_1000172 Ga0209673_100017239 572
413 3300025273 Ga0209673_1006833 Ga0209673_10068334 572
414 3300025291 Ga0209675_1000690 Ga0209675_100069022 572
415 3300025292 Ga0209676_1000048 Ga0209676_1000048365 572
416 3300025295 Ga0209564_1000241 Ga0209564_1000241103 572
417 3300025298 Ga0209050_1000012 Ga0209050_1000012365 572
418 3300025298 Ga0209050_1000294 Ga0209050_1000294107 572
419 3300025299 Ga0209256_1000103 Ga0209256_100010335 572
420 3300025302 Ga0207426_1000058 Ga0207426_1000058163 572
421 3300025303 Ga0209051_1000019 Ga0209051_1000019284 572
422 3300025303 Ga0209051_1001560 Ga0209051_100156020 572
423 3300025304 Ga0209257_1000024 Ga0209257_1000024311 572
424 3300026041 Ga0207639_10007668 Ga0207639_100076683 572
425 3300028794 Ga0307515_10000080 Ga0307515_100000801 572
426 3300031456 Ga0307513_10002583 Ga0307513_100025836 572
427 3300044712 Ga0453684_0036305 Ga0453684_0036305_4283_6040 572
428 3300045051 Ga0451576_0005888 Ga0451576_0005888_5135_6862 572
429 3300053156 Ga0500622_0003254 Ga0500622_0003254_5825_7567 572
430 iso_pu_bacteria 2887375801 2887380754 572
431 3300003187 JGI25151J46595_10003861 JGI25151J46595_100038612 573
432 3300003187 JGI25151J46595_10007739 JGI25151J46595_100077391 573
433 3300003771 Ga0055526_1010439 Ga0055526_10104394 573
434 3300003775 Ga0055524_1005801 Ga0055524_10058011 573
435 3300003781 Ga0055536_1000044 Ga0055536_100004410 573
436 3300003784 Ga0055534_1004577 Ga0055534_10045774 573
437 3300006051 Ga0075364_10017870 Ga0075364_100178703 573
438 3300025263 Ga0209565_1000679 Ga0209565_100067914 573
439 3300025291 Ga0209675_1000260 Ga0209675_10002601 573
440 3300025291 Ga0209675_1006252 Ga0209675_10062522 573
441 3300025292 Ga0209676_1000141 Ga0209676_1000141122 573
442 3300025294 Ga0209025_1000538 Ga0209025_100053853 573
443 3300025294 Ga0209025_1000657 Ga0209025_100065714 573
444 3300025294 Ga0209025_1002686 Ga0209025_10026864 573
445 3300025294 Ga0209025_1003759 Ga0209025_100375913 573
446 3300025295 Ga0209564_1002257 Ga0209564_10022572 573
447 3300025295 Ga0209564_1002910 Ga0209564_10029108 573
448 3300025299 Ga0209256_1000370 Ga0209256_10003704 573
449 3300025299 Ga0209256_1000964 Ga0209256_10009648 573
450 3300025303 Ga0209051_1021634 Ga0209051_10216342 573
451 3300025949 Ga0207667_10038069 Ga0207667_100380693 573
452 3300032004 Ga0307414_10059660 Ga0307414_100596601 573
453 3300037312 Ga0395899_0001042 Ga0395899_0001042_11880_13601 573
454 3300037418 Ga0395900_0010547 Ga0395900_0010547_889_2610 573
455 3300042876 Ga0451577_0003457 Ga0451577_0003457_10201_11940 573
456 3300047318 Ga0495636_0010809 Ga0495636_0010809_724_2445 573
457 3300049571 Ga0501034_0003551 Ga0501034_0003551_11609_13330 573
458 3300049571 Ga0501034_0055505 Ga0501034_0055505_544_2265 573
459 iso_pu_bacteria 2857576091 2857580653 573
460 3300005339 Ga0070660_100001319 Ga0070660_1000013199 574
461 3300005344 Ga0070661_100018312 Ga0070661_1000183125 574
462 3300005366 Ga0070659_100007265 Ga0070659_1000072657 574
463 3300025919 Ga0207657_10003453 Ga0207657_100034538 574
464 3300026142 Ga0207698_10097790 Ga0207698_100977902 574
465 3300037312 Ga0395899_0001609 Ga0395899_0001609_15872_17596 574
466 3300037312 Ga0395899_0002916 Ga0395899_0002916_11039_12763 574
467 3300037418 Ga0395900_0087907 Ga0395900_0087907_775_2499 574
468 3300038443 Ga0395901_0022718 Ga0395901_0022718_317_2041 574
469 3300038443 Ga0395901_0044230 Ga0395901_0044230_82_1806 574
470 3300048927 Ga0496124_0000085 Ga0496124_0000085_18837_20570 574
471 3300048929 Ga0496126_0151880 Ga0496126_0151880_65_1801 574
472 iso_pu_bacteria 2857558681 2857559501 574
473 3300002774 JGI25150J39212_1005515 JGI25150J39212_10055152 575
474 3300003187 JGI25151J46595_10001847 JGI25151J46595_100018471 575
475 3300003763 Ga0055529_1001314 Ga0055529_10013145 575
476 3300006051 Ga0075364_10002743 Ga0075364_100027435 575
477 3300025272 Ga0209455_1000227 Ga0209455_10002276 575
478 3300025292 Ga0209676_1008633 Ga0209676_10086333 575
479 3300025294 Ga0209025_1000028 Ga0209025_100002826 575
480 3300031911 Ga0307412_10004338 Ga0307412_100043385 575
481 3300044656 Ga0466969_0003553 Ga0466969_0003553_5985_7739 575
482 3300044684 Ga0466966_0075894 Ga0466966_0075894_136_1890 575
483 3300045049 Ga0466959_0054865 Ga0466959_0054865_514_2268 575
484 3300048921 Ga0496118_0020181 Ga0496118_0020181_32_1762 575
485 3300048921 Ga0496118_0074755 Ga0496118_0074755_575_2305 575
486 3300048923 Ga0496120_0009161 Ga0496120_0009161_2453_4183 575
487 3300048924 Ga0496121_0000748 Ga0496121_0000748_36896_38626 575
488 3300048924 Ga0496121_0015844 Ga0496121_0015844_1443_3176 575
489 3300048925 Ga0496122_0020165 Ga0496122_0020165_3936_5666 575
490 3300048926 Ga0496123_0001818 Ga0496123_0001818_4586_6316 575
491 3300048928 Ga0496125_0000096 Ga0496125_0000096_182505_184235 575
492 3300048928 Ga0496125_0128150 Ga0496125_0128150_37_1767 575
493 3300049571 Ga0501034_0026198 Ga0501034_0026198_2887_4620 575
494 3300049581 Ga0501047_0014004 Ga0501047_0014004_4632_6365 575
495 3300049822 Ga0501035_0006589 Ga0501035_0006589_2415_4148 575
496 3300049823 Ga0501044_0001142 Ga0501044_0001142_11650_13380 575
497 3300049823 Ga0501044_0002263 Ga0501044_0002263_7426_9159 575
498 iso_pu_bacteria 2643221644 2644244730 575
499 iso_pu_bacteria 2831864461 2831864657 575
500 3300005458 Ga0070681_10017140 Ga0070681_100171407 576
501 3300005530 Ga0070679_100000726 Ga0070679_1000007263 576
502 3300025912 Ga0207707_10034449 Ga0207707_100344495 576
503 3300025917 Ga0207660_10029907 Ga0207660_100299073 576
504 3300025921 Ga0207652_10002099 Ga0207652_1000209912 576
505 3300026078 Ga0207702_10112944 Ga0207702_101129442 576
506 3300037471 Ga0395905_0010063 Ga0395905_0010063_2209_3939 576
507 3300046522 Ga0495643_0001057 Ga0495643_0001057_1510_3240 576
508 3300046665 Ga0495661_0001454 Ga0495661_0001454_16470_18200 576
509 3300047443 Ga0495687_012963 Ga0495687_012963_1088_2818 576
510 3300048904 Ga0496101_0033330 Ga0496101_0033330_959_2689 576
511 3300048905 Ga0496102_0028049 Ga0496102_0028049_1408_3138 576
512 3300048906 Ga0496103_0015500 Ga0496103_0015500_2226_3956 576
513 3300048911 Ga0496108_0063116 Ga0496108_0063116_933_2663 576
514 3300048913 Ga0496110_0032173 Ga0496110_0032173_417_2147 576
515 3300048914 Ga0496111_0027762 Ga0496111_0027762_535_2265 576
516 iso_pu_bacteria 2511231002 2511244630 576
517 iso_pu_bacteria 2513020051 2513229174 576
518 iso_pu_bacteria 2547132374 2548499030 576
519 iso_pu_bacteria 2585428057 2587725324 576
520 iso_pu_bacteria 2585428058 2587731317 576
521 iso_pu_bacteria 2585428062 2587754075 576
522 iso_pu_bacteria 2588253510 2588290073 576
523 iso_pu_bacteria 2599185214 2599623403 576
524 iso_pu_bacteria 2599185226 2599675379 576
525 iso_pu_bacteria 2599185227 2599681008 576
526 iso_pu_bacteria 2599185229 2599693023 576
527 iso_pu_bacteria 2643221544 2643743056 576
528 iso_pu_bacteria 2643221570 2643867765 576
529 iso_pu_bacteria 2643221585 2643932919 576
530 iso_pu_bacteria 2643221592 2643972793 576
531 iso_pu_bacteria 2643221596 2643991628 576
532 iso_pu_bacteria 2643221609 2644062201 576
533 iso_pu_bacteria 2643221611 2644071389 576
534 iso_pu_bacteria 2643221625 2644143360 576
535 iso_pu_bacteria 2643221628 2644161839 576
536 iso_pu_bacteria 2643221639 2644218527 576
537 iso_pu_bacteria 2643221646 2644260422 576
538 iso_pu_bacteria 2643221648 2644276203 576
539 iso_pu_bacteria 2643221652 2644293374 576
540 iso_pu_bacteria 2643221654 2644301278 576
541 iso_pu_bacteria 2643221656 2644314169 576
542 iso_pu_bacteria 2643221658 2644325564 576
543 iso_pu_bacteria 2643221660 2644340886 576
544 iso_pu_bacteria 2643221672 2644399283 576
545 iso_pu_bacteria 2643221683 2644467028 576
546 iso_pu_bacteria 2643221717 2644648487 576
547 iso_pu_bacteria 2721755523 2722881983 576
548 iso_pu_bacteria 2738541277 2738718191 576
549 iso_pu_bacteria 2738541307 2738880423 576
550 iso_pu_bacteria 2738541337 2739055917 576
551 iso_pu_bacteria 2738543012 2739245812 576
552 iso_pu_bacteria 2738543013 2739248272 576
553 iso_pu_bacteria 2738543019 2739281378 576
554 iso_pu_bacteria 2816332133 2816470506 576
555 iso_pu_bacteria 2818991446 2819600579 576
556 iso_pu_bacteria 2831265667 2831267695 576
557 iso_pu_bacteria 2838054893 2838061099 576
558 iso_pu_bacteria 2839138175 2839141876 576
559 iso_pu_bacteria 2842677519 2842679820 576
560 iso_pu_bacteria 2842718218 2842718718 576
561 iso_pu_bacteria 2842733646 2842736366 576
562 iso_pu_bacteria 2842747753 2842748874 576
563 iso_pu_bacteria 2881101125 2881103131 576
564 iso_pu_bacteria 2885192300 2885196940 576
565 iso_pu_bacteria 2885198086 2885198835 576
566 iso_pu_bacteria 2885211737 2885211785 576
567 iso_pu_bacteria 2894023352 2894024332 576
568 iso_pu_bacteria 2899924645 2899928274 576
569 iso_pu_bacteria 2904449895 2904452450 576
570 iso_pu_bacteria 2904456579 2904460951 576
571 iso_pu_bacteria 2904479285 2904480797 576
572 iso_pu_bacteria 2904541872 2904545136 576
573 iso_pu_bacteria 2919462493 2919463918 576
574 iso_pu_bacteria 2919704043 2919707133 576
575 iso_pu_bacteria 2928037797 2928041226 576
576 iso_pu_bacteria 2928044640 2928048068 576
577 iso_pu_bacteria 2928051484 2928055909 576
578 iso_pu_bacteria 2928064002 2928066610 576
579 iso_pu_bacteria 2928070936 2928077236 576
580 iso_pu_bacteria 2928084124 2928087537 576
581 iso_pu_bacteria 2928115317 2928120654 576
582 iso_pu_bacteria 2929160207 2929165314 576
583 iso_pu_bacteria 2929520902 2929522934 576
584 iso_pu_bacteria 2932422444 2932424039 576
585 iso_pu_bacteria 2939631187 2939636218 576
586 iso_pu_bacteria 2945909444 2945910081 576
587 iso_pu_bacteria 2945972063 2945975653 576
588 iso_pu_bacteria 2945984333 2945987903 576
589 iso_pu_bacteria 2954767861 2954768903 576
590 iso_pu_bacteria 2990710928 2990713925 576
591 3300014968 Ga0157379_10017000 Ga0157379_100170008 577
592 3300039437 Ga0436365_0288397 Ga0436365_0288397_8418_10160 577
593 3300046501 Ga0495607_0000077 Ga0495607_0000077_15728_17467 577
594 3300049822 Ga0501035_0004768 Ga0501035_0004768_3068_4810 577
595 3300005328 Ga0070676_10030581 Ga0070676_100305812 578
596 3300005331 Ga0070670_100001440 Ga0070670_1000014403 578
597 3300005331 Ga0070670_100076880 Ga0070670_1000768803 578
598 3300005331 Ga0070670_100105389 Ga0070670_1001053892 578
599 3300005333 Ga0070677_10002257 Ga0070677_100022575 578
600 3300005334 Ga0068869_100083034 Ga0068869_1000830342 578
601 3300005353 Ga0070669_100004692 Ga0070669_1000046928 578
602 3300005354 Ga0070675_100000897 Ga0070675_10000089712 578
603 3300005355 Ga0070671_100002016 Ga0070671_1000020169 578
604 3300005356 Ga0070674_100001095 Ga0070674_1000010956 578
605 3300005364 Ga0070673_100009353 Ga0070673_1000093534 578
606 3300005459 Ga0068867_100001564 Ga0068867_1000015641 578
607 3300005459 Ga0068867_100083162 Ga0068867_1000831622 578
608 3300005459 Ga0068867_100084548 Ga0068867_1000845482 578
609 3300005543 Ga0070672_100002347 Ga0070672_1000023478 578
610 3300005842 Ga0068858_100044054 Ga0068858_1000440543 578
611 3300005844 Ga0068862_100071690 Ga0068862_1000716903 578
612 3300006237 Ga0097621_100032048 Ga0097621_1000320483 578
613 3300006237 Ga0097621_100034919 Ga0097621_1000349192 578
614 3300006358 Ga0068871_100005094 Ga0068871_1000050941 578
615 3300009148 Ga0105243_10085749 Ga0105243_100857492 578
616 3300013306 Ga0163162_10121698 Ga0163162_101216981 578
617 3300013308 Ga0157375_10005835 Ga0157375_1000583510 578
618 3300014968 Ga0157379_10117779 Ga0157379_101177792 578
619 3300017792 Ga0163161_10003141 Ga0163161_100031416 578
620 3300025315 Ga0207697_10002324 Ga0207697_100023247 578
621 3300025893 Ga0207682_10002632 Ga0207682_100026329 578
622 3300025907 Ga0207645_10002553 Ga0207645_100025533 578
623 3300025907 Ga0207645_10018626 Ga0207645_100186264 578
624 3300025907 Ga0207645_10023666 Ga0207645_100236665 578
625 3300025926 Ga0207659_10000393 Ga0207659_1000039312 578
626 3300025931 Ga0207644_10001683 Ga0207644_1000168310 578
627 3300025937 Ga0207669_10002595 Ga0207669_100025952 578
628 3300025939 Ga0207665_10079438 Ga0207665_100794382 578
629 3300025940 Ga0207691_10001174 Ga0207691_1000117421 578
630 3300025960 Ga0207651_10001471 Ga0207651_100014715 578
631 3300025972 Ga0207668_10077214 Ga0207668_100772142 578
632 3300026023 Ga0207677_10056522 Ga0207677_100565222 578
633 3300026035 Ga0207703_10021855 Ga0207703_100218554 578
634 3300026089 Ga0207648_10001516 Ga0207648_1000151619 578
635 3300026089 Ga0207648_10021655 Ga0207648_100216557 578
636 3300026118 Ga0207675_100036724 Ga0207675_1000367244 578
637 3300026121 Ga0207683_10004504 Ga0207683_100045049 578
638 3300028381 Ga0268264_10058123 Ga0268264_100581232 578
639 3300031731 Ga0307405_10031497 Ga0307405_100314973 578
640 3300031824 Ga0307413_10000632 Ga0307413_100006325 578
641 3300031911 Ga0307412_10002540 Ga0307412_100025407 578
642 3300031911 Ga0307412_10017947 Ga0307412_100179473 578
643 3300032002 Ga0307416_100001338 Ga0307416_10000133810 578
644 3300032126 Ga0307415_100001083 Ga0307415_1000010836 578
645 3300046665 Ga0495661_0036631 Ga0495661_0036631_738_2483 578
646 3300002987 JGI25159J45721_1007405 JGI25159J45721_10074051 579
647 3300003354 JGI25160J50197_1000273 JGI25160J50197_100027327 579
648 3300003374 JGI25161J50226_1000095 JGI25161J50226_100009537 579
649 3300003759 Ga0055525_1000004 Ga0055525_1000004302 579
650 3300003775 Ga0055524_1005152 Ga0055524_10051522 579
651 3300004625 Ga0055543_1000218 Ga0055543_100021835 579
652 3300005262 Ga0065165_1001026 Ga0065165_100102626 579
653 3300005338 Ga0068868_100001535 Ga0068868_10000153510 579
654 3300005354 Ga0070675_100040766 Ga0070675_1000407665 579
655 3300005355 Ga0070671_100003626 Ga0070671_10000362610 579
656 3300005366 Ga0070659_100024688 Ga0070659_1000246884 579
657 3300005459 Ga0068867_100000020 Ga0068867_10000002066 579
658 3300005543 Ga0070672_100009632 Ga0070672_1000096328 579
659 3300005564 Ga0070664_100026696 Ga0070664_1000266962 579
660 3300006358 Ga0068871_100028897 Ga0068871_1000288972 579
661 3300009148 Ga0105243_10014871 Ga0105243_100148712 579
662 3300009176 Ga0105242_10043696 Ga0105242_100436962 579
663 3300013308 Ga0157375_10163710 Ga0157375_101637101 579
664 3300014745 Ga0157377_10000032 Ga0157377_1000003247 579
665 3300025230 Ga0209563_100013 Ga0209563_100013302 579
666 3300025273 Ga0209673_1006425 Ga0209673_10064252 579
667 3300025284 Ga0209130_1000072 Ga0209130_100007265 579
668 3300025298 Ga0209050_1004556 Ga0209050_10045564 579
669 3300025299 Ga0209256_1003240 Ga0209256_100324013 579
670 3300025302 Ga0207426_1000319 Ga0207426_100031959 579
671 3300025303 Ga0209051_1001286 Ga0209051_10012863 579
672 3300025304 Ga0209257_1004305 Ga0209257_100430512 579
673 3300025920 Ga0207649_10091844 Ga0207649_100918441 579
674 3300025925 Ga0207650_10008398 Ga0207650_100083984 579
675 3300025926 Ga0207659_10003084 Ga0207659_1000308411 579
676 3300025931 Ga0207644_10001550 Ga0207644_100015507 579
677 3300025931 Ga0207644_10004993 Ga0207644_100049938 579
678 3300025932 Ga0207690_10028634 Ga0207690_100286343 579
679 3300025935 Ga0207709_10004954 Ga0207709_100049547 579
680 3300025940 Ga0207691_10065625 Ga0207691_100656251 579
681 3300025941 Ga0207711_10042841 Ga0207711_100428413 579
682 3300025945 Ga0207679_10000671 Ga0207679_100006712 579
683 3300026075 Ga0207708_10014415 Ga0207708_100144156 579
684 3300026089 Ga0207648_10000172 Ga0207648_1000017223 579
685 3300026095 Ga0207676_10068247 Ga0207676_100682471 579
686 3300028794 Ga0307515_10016568 Ga0307515_1001656810 579
687 3300031242 Ga0265329_10016913 Ga0265329_100169132 579
688 3300031548 Ga0307408_100000023 Ga0307408_100000023195 579
689 3300031711 Ga0265314_10020486 Ga0265314_100204865 579
690 3300035695 Ga0373927_0009270 Ga0373927_0009270_120_1862 579
691 3300037068 Ga0373925_0005227 Ga0373925_0005227_5729_7471 579
692 3300041997 Ga0439431_0003865 Ga0439431_0003865_378_2120 579
693 3300042121 Ga0450919_002729 Ga0450919_002729_27_1769 579
694 3300042126 Ga0450888_000115 Ga0450888_000115_2049_3791 579
695 3300042144 Ga0450889_000093 Ga0450889_000093_425_2167 579
696 3300042531 Ga0450918_000202 Ga0450918_000202_6055_7797 579
697 3300042532 Ga0450893_0000411 Ga0450893_0000411_1446_3188 579
698 3300046558 Ga0495633_0000563 Ga0495633_0000563_20413_22152 579
699 3300048924 Ga0496121_0010814 Ga0496121_0010814_3216_4967 579
700 3300048928 Ga0496125_0026863 Ga0496125_0026863_3138_4889 579
701 3300002704 JGI25155J39150_1000022 JGI25155J39150_100002298 580
702 3300002705 JGI25156J39149_1000005 JGI25156J39149_100000590 580
703 3300002738 JGI25154J39366_1000017 JGI25154J39366_100001782 580
704 3300002738 JGI25154J39366_1001293 JGI25154J39366_10012933 580
705 3300002741 JGI25157J39369_1000003 JGI25157J39369_100000398 580
706 3300002741 JGI25157J39369_1000161 JGI25157J39369_10001619 580
707 3300002741 JGI25157J39369_1000774 JGI25157J39369_100077410 580
708 3300002773 JGI25152J39213_1000892 JGI25152J39213_10008926 580
709 3300002987 JGI25159J45721_1001370 JGI25159J45721_100137010 580
710 3300003187 JGI25151J46595_10004995 JGI25151J46595_100049957 580
711 3300003187 JGI25151J46595_10005322 JGI25151J46595_100053226 580
712 3300003215 JGI25153J46596_10000420 JGI25153J46596_1000042024 580
713 3300003215 JGI25153J46596_10002471 JGI25153J46596_1000247110 580
714 3300003308 Ga0006777J48905_1089277 Ga0006777J48905_10892771 580
715 3300003320 rootH2_10014247 rootH2_100142472 580
716 3300003752 Ga0055539_1000542 Ga0055539_10005426 580
717 3300003752 Ga0055539_1001036 Ga0055539_10010367 580
718 3300003756 Ga0055533_1000016 Ga0055533_10000169 580
719 3300003759 Ga0055525_1000689 Ga0055525_10006896 580
720 3300003761 Ga0055535_1000221 Ga0055535_100022151 580
721 3300003762 Ga0055542_1000129 Ga0055542_10001297 580
722 3300003771 Ga0055526_1016398 Ga0055526_10163981 580
723 3300003773 Ga0055537_1000205 Ga0055537_10002052 580
724 3300003773 Ga0055537_1000717 Ga0055537_10007171 580
725 3300003775 Ga0055524_1000073 Ga0055524_100007372 580
726 3300003775 Ga0055524_1000109 Ga0055524_100010924 580
727 3300003781 Ga0055536_1022076 Ga0055536_10220761 580
728 3300003784 Ga0055534_1000337 Ga0055534_100033728 580
729 3300003784 Ga0055534_1000363 Ga0055534_100036319 580
730 3300003784 Ga0055534_1000467 Ga0055534_10004676 580
731 3300003790 Ga0055528_1000289 Ga0055528_100028923 580
732 3300003790 Ga0055528_1006545 Ga0055528_10065454 580
733 3300003790 Ga0055528_1013900 Ga0055528_10139001 580
734 3300003791 Ga0055530_10001804 Ga0055530_100018041 580
735 3300003792 Ga0055540_1000013 Ga0055540_1000013178 580
736 3300003792 Ga0055540_1000037 Ga0055540_100003784 580
737 3300003794 Ga0055531_10000112 Ga0055531_1000011283 580
738 3300003794 Ga0055531_10000158 Ga0055531_1000015874 580
739 3300005262 Ga0065165_1002013 Ga0065165_100201318 580
740 3300005289 Ga0065704_10072444 Ga0065704_100724442 580
741 3300005295 Ga0065707_10093995 Ga0065707_100939952 580
742 3300005338 Ga0068868_100096553 Ga0068868_1000965532 580
743 3300005347 Ga0070668_100017950 Ga0070668_1000179504 580
744 3300005353 Ga0070669_100083648 Ga0070669_1000836482 580
745 3300005355 Ga0070671_100086173 Ga0070671_1000861732 580
746 3300005455 Ga0070663_100000518 Ga0070663_10000051821 580
747 3300005457 Ga0070662_100072457 Ga0070662_1000724572 580
748 3300005459 Ga0068867_100001947 Ga0068867_1000019477 580
749 3300005459 Ga0068867_100044545 Ga0068867_1000445452 580
750 3300005459 Ga0068867_100123527 Ga0068867_1001235271 580
751 3300005467 Ga0070706_100002083 Ga0070706_1000020837 580
752 3300005530 Ga0070679_100039416 Ga0070679_1000394165 580
753 3300005543 Ga0070672_100017220 Ga0070672_1000172205 580
754 3300005548 Ga0070665_100037542 Ga0070665_1000375423 580
755 3300005563 Ga0068855_100013962 Ga0068855_1000139626 580
756 3300005577 Ga0068857_100008925 Ga0068857_1000089252 580
757 3300005577 Ga0068857_100026238 Ga0068857_1000262384 580
758 3300005614 Ga0068856_100001351 Ga0068856_10000135123 580
759 3300005614 Ga0068856_100037330 Ga0068856_1000373302 580
760 3300005618 Ga0068864_100018085 Ga0068864_1000180855 580
761 3300005719 Ga0068861_100034989 Ga0068861_1000349892 580
762 3300005843 Ga0068860_100002278 Ga0068860_1000022786 580
763 3300005844 Ga0068862_100009207 Ga0068862_1000092078 580
764 3300005844 Ga0068862_100062922 Ga0068862_1000629223 580
765 3300005844 Ga0068862_100082879 Ga0068862_1000828793 580
766 3300006038 Ga0075365_10035474 Ga0075365_100354743 580
767 3300006048 Ga0075363_100005602 Ga0075363_1000056024 580
768 3300006048 Ga0075363_100007828 Ga0075363_1000078286 580
769 3300006048 Ga0075363_100009510 Ga0075363_1000095102 580
770 3300006177 Ga0075362_10033082 Ga0075362_100330822 580
771 3300006195 Ga0075366_10001208 Ga0075366_1000120816 580
772 3300006195 Ga0075366_10001813 Ga0075366_100018139 580
773 3300006195 Ga0075366_10003680 Ga0075366_100036808 580
774 3300006195 Ga0075366_10026687 Ga0075366_100266874 580
775 3300006353 Ga0075370_10000288 Ga0075370_1000028820 580
776 3300006353 Ga0075370_10000910 Ga0075370_100009103 580
777 3300006353 Ga0075370_10006446 Ga0075370_100064462 580
778 3300006353 Ga0075370_10010497 Ga0075370_100104972 580
779 3300006353 Ga0075370_10055769 Ga0075370_100557691 580
780 3300006353 Ga0075370_10056336 Ga0075370_100563362 580
781 3300006880 Ga0075429_100003110 Ga0075429_10000311011 580
782 3300006880 Ga0075429_100096308 Ga0075429_1000963082 580
783 3300006881 Ga0068865_100018444 Ga0068865_1000184445 580
784 3300006946 Ga0079104_1000001 Ga0079104_1000001172 580
785 3300006948 Ga0099826_10001050 Ga0099826_100010502 580
786 3300009036 Ga0105244_10003265 Ga0105244_100032651 580
787 3300009093 Ga0105240_10005235 Ga0105240_1000523519 580
788 3300009093 Ga0105240_10019777 Ga0105240_100197773 580
789 3300009093 Ga0105240_10026481 Ga0105240_100264814 580
790 3300009148 Ga0105243_10002550 Ga0105243_1000255015 580
791 3300009148 Ga0105243_10031316 Ga0105243_100313161 580
792 3300009177 Ga0105248_10004455 Ga0105248_1000445512 580
793 3300009545 Ga0105237_10002475 Ga0105237_100024753 580
794 3300009545 Ga0105237_10017120 Ga0105237_100171206 580
795 3300009545 Ga0105237_10109708 Ga0105237_101097083 580
796 3300010375 Ga0105239_10001374 Ga0105239_1000137424 580
797 3300010375 Ga0105239_10047382 Ga0105239_100473822 580
798 3300013105 Ga0157369_10008671 Ga0157369_100086718 580
799 3300013105 Ga0157369_10069515 Ga0157369_100695152 580
800 3300013306 Ga0163162_10001398 Ga0163162_1000139819 580
801 3300013308 Ga0157375_10031637 Ga0157375_100316374 580
802 3300014497 Ga0182008_10005957 Ga0182008_100059575 580
803 3300014497 Ga0182008_10018374 Ga0182008_100183741 580
804 3300014968 Ga0157379_10008673 Ga0157379_100086734 580
805 3300014968 Ga0157379_10053219 Ga0157379_100532193 580
806 3300015261 Ga0182006_1008452 Ga0182006_10084525 580
807 3300015262 Ga0182007_10000951 Ga0182007_100009516 580
808 3300015683 Ga0183362_10003 Ga0183362_10003585 580
809 3300017792 Ga0163161_10001265 Ga0163161_100012651 580
810 3300017792 Ga0163161_10002188 Ga0163161_100021881 580
811 3300017792 Ga0163161_10010510 Ga0163161_100105105 580
812 3300021361 Ga0213872_10000202 Ga0213872_1000020217 580
813 3300021361 Ga0213872_10000474 Ga0213872_1000047415 580
814 3300025206 Ga0209435_100002 Ga0209435_100002206 580
815 3300025226 Ga0209674_100041 Ga0209674_100041373 580
816 3300025228 Ga0209672_102177 Ga0209672_1021773 580
817 3300025230 Ga0209563_100043 Ga0209563_100043373 580
818 3300025231 Ga0207427_100381 Ga0207427_10038124 580
819 3300025242 Ga0209258_100240 Ga0209258_1002408 580
820 3300025242 Ga0209258_100659 Ga0209258_10065922 580
821 3300025245 Ga0207425_1000221 Ga0207425_100022133 580
822 3300025245 Ga0207425_1001344 Ga0207425_10013444 580
823 3300025245 Ga0207425_1002962 Ga0207425_10029622 580
824 3300025246 Ga0209646_1000001 Ga0209646_10000012349 580
825 3300025246 Ga0209646_1000157 Ga0209646_100015769 580
826 3300025250 Ga0209026_1000001 Ga0209026_10000011006 580
827 3300025250 Ga0209026_1000006 Ga0209026_10000069 580
828 3300025253 Ga0209677_100900 Ga0209677_1009007 580
829 3300025253 Ga0209677_101252 Ga0209677_1012526 580
830 3300025254 Ga0209148_1000033 Ga0209148_10000338 580
831 3300025256 Ga0209759_1000001 Ga0209759_10000011980 580
832 3300025256 Ga0209759_1000194 Ga0209759_100019486 580
833 3300025256 Ga0209759_1005336 Ga0209759_10053363 580
834 3300025258 Ga0209129_1000012 Ga0209129_1000012161 580
835 3300025258 Ga0209129_1000054 Ga0209129_100005433 580
836 3300025263 Ga0209565_1000067 Ga0209565_1000067179 580
837 3300025263 Ga0209565_1000128 Ga0209565_100012882 580
838 3300025273 Ga0209673_1000008 Ga0209673_1000008105 580
839 3300025273 Ga0209673_1000097 Ga0209673_100009765 580
840 3300025284 Ga0209130_1001362 Ga0209130_100136213 580
841 3300025284 Ga0209130_1001611 Ga0209130_10016112 580
842 3300025291 Ga0209675_1000038 Ga0209675_100003865 580
843 3300025291 Ga0209675_1000527 Ga0209675_100052719 580
844 3300025291 Ga0209675_1001272 Ga0209675_10012724 580
845 3300025291 Ga0209675_1001985 Ga0209675_10019853 580
846 3300025291 Ga0209675_1016309 Ga0209675_10163092 580
847 3300025292 Ga0209676_1000023 Ga0209676_1000023329 580
848 3300025292 Ga0209676_1000739 Ga0209676_100073930 580
849 3300025292 Ga0209676_1000836 Ga0209676_100083616 580
850 3300025292 Ga0209676_1005022 Ga0209676_10050224 580
851 3300025294 Ga0209025_1000174 Ga0209025_1000174121 580
852 3300025294 Ga0209025_1001066 Ga0209025_100106621 580
853 3300025294 Ga0209025_1003753 Ga0209025_10037537 580
854 3300025294 Ga0209025_1010615 Ga0209025_10106157 580
855 3300025294 Ga0209025_1029285 Ga0209025_10292851 580
856 3300025294 Ga0209025_1030949 Ga0209025_10309492 580
857 3300025295 Ga0209564_1000022 Ga0209564_1000022353 580
858 3300025295 Ga0209564_1002377 Ga0209564_10023777 580
859 3300025295 Ga0209564_1003110 Ga0209564_10031106 580
860 3300025297 Ga0209758_1000034 Ga0209758_1000034405 580
861 3300025297 Ga0209758_1000124 Ga0209758_100012490 580
862 3300025297 Ga0209758_1000234 Ga0209758_10002346 580
863 3300025298 Ga0209050_1000022 Ga0209050_1000022311 580
864 3300025298 Ga0209050_1000315 Ga0209050_100031548 580
865 3300025298 Ga0209050_1001261 Ga0209050_100126118 580
866 3300025298 Ga0209050_1007315 Ga0209050_10073157 580
867 3300025299 Ga0209256_1000001 Ga0209256_10000011797 580
868 3300025299 Ga0209256_1000015 Ga0209256_1000015324 580
869 3300025299 Ga0209256_1000165 Ga0209256_1000165120 580
870 3300025302 Ga0207426_1000067 Ga0207426_1000067294 580
871 3300025303 Ga0209051_1000013 Ga0209051_1000013311 580
872 3300025303 Ga0209051_1000022 Ga0209051_100002289 580
873 3300025303 Ga0209051_1000315 Ga0209051_100031520 580
874 3300025303 Ga0209051_1002634 Ga0209051_100263414 580
875 3300025304 Ga0209257_1000030 Ga0209257_1000030286 580
876 3300025304 Ga0209257_1000042 Ga0209257_1000042176 580
877 3300025304 Ga0209257_1000057 Ga0209257_1000057228 580
878 3300025304 Ga0209257_1000309 Ga0209257_100030932 580
879 3300025304 Ga0209257_1009377 Ga0209257_10093775 580
880 3300025304 Ga0209257_1013165 Ga0209257_10131654 580
881 3300025321 Ga0207656_10001162 Ga0207656_100011625 580
882 3300025728 Ga0207655_1000639 Ga0207655_100063924 580
883 3300025910 Ga0207684_10004074 Ga0207684_1000407412 580
884 3300025913 Ga0207695_10018847 Ga0207695_100188478 580
885 3300025913 Ga0207695_10040979 Ga0207695_100409794 580
886 3300025914 Ga0207671_10017064 Ga0207671_100170644 580
887 3300025914 Ga0207671_10032349 Ga0207671_100323492 580
888 3300025923 Ga0207681_10058859 Ga0207681_100588592 580
889 3300025924 Ga0207694_10007736 Ga0207694_1000773610 580
890 3300025933 Ga0207706_10003908 Ga0207706_100039081 580
891 3300025933 Ga0207706_10095167 Ga0207706_100951672 580
892 3300025933 Ga0207706_10133846 Ga0207706_101338461 580
893 3300025935 Ga0207709_10000874 Ga0207709_100008745 580
894 3300025935 Ga0207709_10008146 Ga0207709_100081463 580
895 3300025935 Ga0207709_10015294 Ga0207709_100152944 580
896 3300025938 Ga0207704_10001487 Ga0207704_1000148713 580
897 3300025940 Ga0207691_10046301 Ga0207691_100463012 580
898 3300025940 Ga0207691_10069360 Ga0207691_100693603 580
899 3300025941 Ga0207711_10044319 Ga0207711_100443194 580
900 3300025949 Ga0207667_10080484 Ga0207667_100804843 580
901 3300025961 Ga0207712_10120631 Ga0207712_101206311 580
902 3300026023 Ga0207677_10024519 Ga0207677_100245192 580
903 3300026067 Ga0207678_10000837 Ga0207678_100008373 580
904 3300026078 Ga0207702_10002902 Ga0207702_1000290210 580
905 3300026078 Ga0207702_10051306 Ga0207702_100513062 580
906 3300026088 Ga0207641_10013071 Ga0207641_100130713 580
907 3300026089 Ga0207648_10011123 Ga0207648_100111233 580
908 3300026089 Ga0207648_10054826 Ga0207648_100548262 580
909 3300026095 Ga0207676_10013160 Ga0207676_100131605 580
910 3300026116 Ga0207674_10004639 Ga0207674_1000463910 580
911 3300026118 Ga0207675_100025201 Ga0207675_1000252014 580
912 3300027111 Ga0209281_1000057 Ga0209281_1000057145 580
913 3300027252 Ga0209973_1000841 Ga0209973_10008412 580
914 3300027526 Ga0209968_1000489 Ga0209968_10004895 580
915 3300027614 Ga0209970_1000052 Ga0209970_100005218 580
916 3300027666 Ga0209282_1000250 Ga0209282_10002502 580
917 3300027695 Ga0209966_1000033 Ga0209966_10000337 580
918 3300027866 Ga0209813_10016340 Ga0209813_100163402 580
919 3300027876 Ga0209974_10000240 Ga0209974_1000024018 580
920 3300027876 Ga0209974_10015858 Ga0209974_100158581 580
921 3300028379 Ga0268266_10029093 Ga0268266_100290934 580
922 3300028380 Ga0268265_10019031 Ga0268265_100190313 580
923 3300028794 Ga0307515_10000354 Ga0307515_1000035447 580
924 3300028794 Ga0307515_10000472 Ga0307515_1000047296 580
925 3300028794 Ga0307515_10005786 Ga0307515_1000578613 580
926 3300028794 Ga0307515_10007796 Ga0307515_100077969 580
927 3300028794 Ga0307515_10009311 Ga0307515_100093111 580
928 3300028794 Ga0307515_10011216 Ga0307515_1001121618 580
929 3300030735 Ga0316178_1128978 Ga0316178_11289782 580
930 3300031238 Ga0265332_10000125 Ga0265332_1000012510 580
931 3300031251 Ga0265327_10001654 Ga0265327_1000165427 580
932 3300031456 Ga0307513_10000038 Ga0307513_10000038159 580
933 3300031456 Ga0307513_10000117 Ga0307513_10000117112 580
934 3300031456 Ga0307513_10010732 Ga0307513_100107323 580
935 3300031456 Ga0307513_10038056 Ga0307513_100380563 580
936 3300031456 Ga0307513_10071355 Ga0307513_100713553 580
937 3300031507 Ga0307509_10009732 Ga0307509_100097328 580
938 3300031507 Ga0307509_10022375 Ga0307509_100223751 580
939 3300031507 Ga0307509_10022711 Ga0307509_100227112 580
940 3300031548 Ga0307408_100000288 Ga0307408_10000028842 580
941 3300031548 Ga0307408_100010362 Ga0307408_1000103623 580
942 3300031616 Ga0307508_10000043 Ga0307508_1000004376 580
943 3300031616 Ga0307508_10001327 Ga0307508_1000132720 580
944 3300031649 Ga0307514_10000920 Ga0307514_1000092020 580
945 3300031649 Ga0307514_10001251 Ga0307514_1000125110 580
946 3300031649 Ga0307514_10039025 Ga0307514_100390252 580
947 3300031730 Ga0307516_10000953 Ga0307516_100009532 580
948 3300031730 Ga0307516_10001691 Ga0307516_1000169123 580
949 3300031730 Ga0307516_10002244 Ga0307516_100022448 580
950 3300031730 Ga0307516_10013442 Ga0307516_100134423 580
951 3300031730 Ga0307516_10023184 Ga0307516_100231843 580
952 3300031901 Ga0307406_10003957 Ga0307406_100039578 580
953 3300032005 Ga0307411_10012273 Ga0307411_100122732 580
954 3300032005 Ga0307411_10013355 Ga0307411_100133554 580
955 3300033180 Ga0307510_10015886 Ga0307510_100158865 580
956 3300035114 Ga0373939_0000049 Ga0373939_0000049_28986_30731 580
957 3300035121 Ga0373960_0000732 Ga0373960_0000732_4650_6395 580
958 3300035691 Ga0373931_0005852 Ga0373931_0005852_3812_5557 580
959 3300035691 Ga0373931_0006014 Ga0373931_0006014_486_2234 580
960 3300035691 Ga0373931_0016960 Ga0373931_0016960_193_1938 580
961 3300036401 Ga0373937_0007893 Ga0373937_0007893_6978_8723 580
962 3300037312 Ga0395899_0006534 Ga0395899_0006534_4200_5945 580
963 3300037418 Ga0395900_0046894 Ga0395900_0046894_488_2233 580
964 3300037466 Ga0395898_0007278 Ga0395898_0007278_1235_2980 580
965 3300037466 Ga0395898_0010814 Ga0395898_0010814_5484_7229 580
966 3300037466 Ga0395898_0026413 Ga0395898_0026413_1763_3508 580
967 3300037466 Ga0395898_0072168 Ga0395898_0072168_161_1906 580
968 3300037471 Ga0395905_0000088 Ga0395905_0000088_34931_36676 580
969 3300037471 Ga0395905_0000151 Ga0395905_0000151_24338_26083 580
970 3300037471 Ga0395905_0001245 Ga0395905_0001245_13713_15458 580
971 3300037471 Ga0395905_0012026 Ga0395905_0012026_5125_6870 580
972 3300037471 Ga0395905_0014382 Ga0395905_0014382_670_2415 580
973 3300037471 Ga0395905_0046455 Ga0395905_0046455_1636_3381 580
974 3300037471 Ga0395905_0186914 Ga0395905_0186914_89_1834 580
975 3300038443 Ga0395901_0138953 Ga0395901_0138953_137_1882 580
976 3300039447 Ga0436361_0379569 Ga0436361_0379569_36770_38515 580
977 3300039447 Ga0436361_1096550 Ga0436361_1096550_39240_40985 580
978 3300041404 Ga0439436_0000328 Ga0439436_0000328_6723_8468 580
979 3300042002 Ga0439442_004178 Ga0439442_004178_264_2009 580
980 3300042006 Ga0439432_001277 Ga0439432_001277_5763_7508 580
981 3300042007 Ga0439449_0001202 Ga0439449_0001202_5133_6878 580
982 3300042014 Ga0439457_007647 Ga0439457_007647_566_2311 580
983 3300042435 Ga0439434_0008547 Ga0439434_0008547_1224_2969 580
984 3300042531 Ga0450918_000496 Ga0450918_000496_1473_3218 580
985 3300042876 Ga0451577_0000276 Ga0451577_0000276_75413_77158 580
986 3300042876 Ga0451577_0067099 Ga0451577_0067099_1347_3089 580
987 3300044656 Ga0466969_0000008 Ga0466969_0000008_23239_24987 580
988 3300044712 Ga0453684_0000891 Ga0453684_0000891_22341_24086 580
989 3300044712 Ga0453684_0032467 Ga0453684_0032467_4469_6214 580
990 3300044712 Ga0453684_0099280 Ga0453684_0099280_249_1994 580
991 3300044765 Ga0466970_0003291 Ga0466970_0003291_407_2152 580
992 3300044842 Ga0466957_0006607 Ga0466957_0006607_4534_6279 580
993 3300045049 Ga0466959_0000192 Ga0466959_0000192_20365_22110 580
994 3300045051 Ga0451576_0002088 Ga0451576_0002088_12232_13977 580
995 3300045051 Ga0451576_0002262 Ga0451576_0002262_5496_7238 580
996 3300045051 Ga0451576_0004706 Ga0451576_0004706_7936_9681 580
997 3300045051 Ga0451576_0008890 Ga0451576_0008890_1889_3634 580
998 3300045051 Ga0451576_0132818 Ga0451576_0132818_261_2006 580
999 3300045976 Ga0466967_0052889 Ga0466967_0052889_208_1953 580
1000 3300046454 Ga0495592_0017214 Ga0495592_0017214_3486_5231 580
1001 3300046460 Ga0495638_0026584 Ga0495638_0026584_126_1871 580
1002 3300046506 Ga0495583_0001389 Ga0495583_0001389_16438_18183 580
1003 3300046507 Ga0495606_0002457 Ga0495606_0002457_3677_5422 580
1004 3300046520 Ga0495637_0006661 Ga0495637_0006661_3971_5716 580
1005 3300046522 Ga0495643_0045929 Ga0495643_0045929_331_2076 580
1006 3300046528 Ga0495642_0009294 Ga0495642_0009294_817_2562 580
1007 3300046542 Ga0495597_0001315 Ga0495597_0001315_16395_18140 580
1008 3300046542 Ga0495597_0016711 Ga0495597_0016711_1150_2895 580
1009 3300046615 Ga0495656_0000090 Ga0495656_0000090_21310_23058 580
1010 3300046660 Ga0495625_0001055 Ga0495625_0001055_33947_35692 580
1011 3300046660 Ga0495625_0003495 Ga0495625_0003495_8241_9986 580
1012 3300046660 Ga0495625_0022664 Ga0495625_0022664_2606_4351 580
1013 3300046674 Ga0495588_0021039 Ga0495588_0021039_466_2211 580
1014 3300046694 Ga0495649_0006470 Ga0495649_0006470_4128_5873 580
1015 3300047321 Ga0495676_0022211 Ga0495676_0022211_2448_4193 580
1016 3300047443 Ga0495687_000705 Ga0495687_000705_35262_37007 580
1017 3300047443 Ga0495687_001104 Ga0495687_001104_1159_2904 580
1018 3300047673 Ga0495593_0008709 Ga0495593_0008709_3804_5549 580
1019 3300048091 Ga0495626_0047399 Ga0495626_0047399_36_1781 580
1020 3300048904 Ga0496101_0001103 Ga0496101_0001103_10540_12288 580
1021 3300048905 Ga0496102_0137639 Ga0496102_0137639_392_2140 580
1022 3300048907 Ga0496104_0035582 Ga0496104_0035582_205_1953 580
1023 3300048908 Ga0496105_0010700 Ga0496105_0010700_128_1876 580
1024 3300048913 Ga0496110_0059350 Ga0496110_0059350_1356_3104 580
1025 3300048916 Ga0496113_0002861 Ga0496113_0002861_1178_2923 580
1026 3300048917 Ga0496114_0003154 Ga0496114_0003154_10204_11949 580
1027 3300048919 Ga0496116_0017023 Ga0496116_0017023_1953_3698 580
1028 3300048921 Ga0496118_0072564 Ga0496118_0072564_347_2092 580
1029 3300048925 Ga0496122_0003683 Ga0496122_0003683_13625_15370 580
1030 3300048926 Ga0496123_0000274 Ga0496123_0000274_8669_10414 580
1031 3300048927 Ga0496124_0001458 Ga0496124_0001458_11270_13015 580
1032 3300049579 Ga0501043_0000180 Ga0501043_0000180_12308_14053 580
1033 3300049580 Ga0501046_0000226 Ga0501046_0000226_12207_13952 580
1034 3300049580 Ga0501046_0017038 Ga0501046_0017038_3247_4992 580
1035 3300049581 Ga0501047_0000302 Ga0501047_0000302_42857_44602 580
1036 3300049582 Ga0501048_0002019 Ga0501048_0002019_1531_3276 580
1037 3300049649 Ga0501198_000012 Ga0501198_000012_35503_37248 580
1038 3300049662 Ga0501222_000010 Ga0501222_000010_35509_37254 580
1039 3300049665 Ga0501227_002638 Ga0501227_002638_1293_3038 580
1040 3300049704 Ga0501221_002698 Ga0501221_002698_896_2641 580
1041 3300049824 Ga0501045_0009382 Ga0501045_0009382_3913_5658 580
1042 3300050490 nmdc:mga03n38_5586_c1 nmdc:mga03n38_5586_c1_927_2672 580
1043 3300050491 nmdc:mga00v17_76928_c1 nmdc:mga00v17_76928_c1_136_1881 580
1044 3300050493 nmdc:mga0k408_10294_c1 nmdc:mga0k408_10294_c1_134_1879 580
1045 3300050493 nmdc:mga0k408_14915_c1 nmdc:mga0k408_14915_c1_2330_4087 580
1046 3300050493 nmdc:mga0k408_1770_c1 nmdc:mga0k408_1770_c1_6185_7930 580
1047 3300050493 nmdc:mga0k408_19088_c1 nmdc:mga0k408_19088_c1_1080_2825 580
1048 3300050493 nmdc:mga0k408_2369_c1 nmdc:mga0k408_2369_c1_6663_8408 580
1049 3300050493 nmdc:mga0k408_23982_c1 nmdc:mga0k408_23982_c1_163_1908 580
1050 3300050493 nmdc:mga0k408_254_c1 nmdc:mga0k408_254_c1_15285_17030 580
1051 3300050493 nmdc:mga0k408_40618_c1 nmdc:mga0k408_40618_c1_749_2494 580
1052 3300050493 nmdc:mga0k408_42876_c1 nmdc:mga0k408_42876_c1_107_1852 580
1053 3300050494 nmdc:mga06z11_49102_c1 nmdc:mga06z11_49102_c1_67_1812 580
1054 3300050495 nmdc:mga04h51_14278_c1 nmdc:mga04h51_14278_c1_327_2072 580
1055 3300050496 nmdc:mga07m45_1683_c1 nmdc:mga07m45_1683_c1_3655_5400 580
1056 3300050496 nmdc:mga07m45_31899_c1 nmdc:mga07m45_31899_c1_1006_2751 580
1057 3300050496 nmdc:mga07m45_3705_c1 nmdc:mga07m45_3705_c1_5232_6977 580
1058 3300050496 nmdc:mga07m45_4400_c1 nmdc:mga07m45_4400_c1_1727_3484 580
1059 3300050496 nmdc:mga07m45_4458_c1 nmdc:mga07m45_4458_c1_4971_6716 580
1060 3300050496 nmdc:mga07m45_9703_c2 nmdc:mga07m45_9703_c2_209_1954 580
1061 3300050508 nmdc:mga09592_17097_c1 nmdc:mga09592_17097_c1_278_2023 580
1062 3300053086 Ga0500578_0001060 Ga0500578_0001060_18690_20435 580
1063 3300053093 Ga0500651_0000400 Ga0500651_0000400_4145_5890 580
1064 3300053110 Ga0500571_000129 Ga0500571_000129_19554_21299 580
1065 3300053117 Ga0500593_000579 Ga0500593_000579_8009_9751 580
1066 3300053117 Ga0500593_002479 Ga0500593_002479_945_2690 580
1067 3300053131 Ga0500652_000299 Ga0500652_000299_16218_18011 580
1068 3300053134 Ga0500658_0003299 Ga0500658_0003299_4182_5927 580
1069 3300053136 Ga0500559_0000019 Ga0500559_0000019_26973_28718 580
1070 3300053148 Ga0500590_006655 Ga0500590_006655_867_2612 580
1071 3300053154 Ga0500619_000127 Ga0500619_000127_11453_13198 580
1072 3300053156 Ga0500622_0000125 Ga0500622_0000125_18476_20269 580
1073 3300053156 Ga0500622_0000788 Ga0500622_0000788_16020_17765 580
1074 3300059421 Ga0590071_001922 Ga0590071_001922_2331_4097 580
1075 3300061719 Ga0466962_0029616 Ga0466962_0029616_849_2594 580
1076 iso_pu_bacteria 2945945610 2945946054 580

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

295

425

0.96

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

132

506

0.95

PF03129

HGTP_anticodon

Anticodon binding domain

522

616

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ucm-assembly1.cif.gz_B crystal structure of prolyl-trna synthetase from pseudomonas aeruginosa 0.9396 1 578
5ucm-assembly1.cif.gz_B crystal structure of prolyl-trna synthetase from pseudomonas aeruginosa 0.9364 1 578
5xih-assembly1.cif.gz_A crystal structure of toxoplasma gondii prolyl-trna synthetase (tgprs) in complex with inhibitor 5 0.8965 22 576
5xii-assembly1.cif.gz_A crystal structure of toxoplasma gondii prolyl-trna synthetase (tgprs) in complex with inhibitor 6 0.8961 22 576
5xii-assembly2.cif.gz_B crystal structure of toxoplasma gondii prolyl-trna synthetase (tgprs) in complex with inhibitor 6 0.8955 22 576
ID Description Score Start End Superfamily
af_Q2G1Z4_2_243_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9812 2 239 3.30.930.10
af_P9WFT9_1_251_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9638 1 243 3.30.930.10
af_Q2G1Z4_2_243_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9613 2 239 3.30.930.10
af_Q75JK9_51_340_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9583 4 240 3.30.930.10
2j3mA02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9525 19 473 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A836WUL9-F1-model_v4 deleted 0.992 1 160
AF-A0A1W9PTY6-F1-model_v4 Proline--tRNA ligase (EC 6.1.1.15) (Prolyl-tRNA synthetase) 0.9915 1 160 GO:0004827
GO:0005524
GO:0005829
GO:0006433
AF-A0A359LYZ8-F1-model_v4 Proline--tRNA ligase (EC 6.1.1.15) (Prolyl-tRNA synthetase) 0.9905 1 160 GO:0004827
GO:0005524
GO:0005829
GO:0006433
AF-A0A3D2JU10-F1-model_v4 Proline--tRNA ligase (EC 6.1.1.15) 0.9904 1 163 GO:0004827
GO:0005524
GO:0005829
GO:0006433
AF-A0A7Y1T868-F1-model_v4 Proline--tRNA ligase (EC 6.1.1.15) 0.9891 1 134 GO:0004827
GO:0005524
GO:0005829
GO:0006433

Feature Viewer

pLDDT pTM Quality
94.53 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map