F489582
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1076 | 551 | 974 | 575 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10018374|Ga0182008_100183741 |
| Length | 619 |
| Sequence | MHAGLHTASGQFEARGFPEVSPPASVFPKILKSTSAIPMKASRFFVSTLKEAPADAEVASHRLMMRAGMIKKLGTGIYTYMPMGLRVIRKVEAIVREEMNRAGAVELTMPVVQPAEFWQETGRFDKMGPELLRIKDRHDRDFVVQPTSEEVVTDIARQEIRSYKQLPKNFYQIQTKFRDERRPRFGLMRGREFIMKDAYSFDRDLDAAKASYQAMADAYRRIFDRFGLRYRAVAADSGAIGGDLSEEFQVIAATGEDAIVYCPGSDYAANMEKAEALAPAGPRPAAAKALEKTPTPGKSTCADVAELLGVPLSTTVKSLVLATDILDEAGNPKGSQVWLLLLRGDHDMNEIKVGKVPGLDKGFRFATLAEIDDHFGCKPGYLGPLNLKKPVRLVADREVMVMADWITGANEVDFHMTGVNWGRDLPEPELVADLRNVVAGDASPDGKGVLAIERGIEVGHVFVLGTKYSKDMNATYLDEAGKPQFLEMGCYGIGITRLPAAAIEQNHDERGIIWPDALAPFTVVVCPIGMDRSPEVKVAAEALYEQLLAAGIDVLLDDRGERPGAMFADWELIGVPHRVVISDRGLKEGQLEYQHRRDTAATKVPAAGIAEFIAGKFAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 5 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 6 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 7 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 8 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 9 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 10 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 11 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 12 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 13 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 14 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 15 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 16 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 17 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 18 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 19 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 20 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 21 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 22 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 23 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 24 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 25 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 26 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 27 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 28 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 29 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 30 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 31 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 32 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 33 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 34 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 35 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 36 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 37 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 38 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 39 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 40 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 41 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 42 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 43 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 44 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 45 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 46 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 47 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 48 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 49 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 50 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 51 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 52 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 53 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 54 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 55 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 56 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 57 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 58 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 59 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 60 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 61 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 62 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 63 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 64 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 65 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 66 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 67 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 68 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 69 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 70 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 71 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 72 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 73 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 74 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 75 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 76 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 77 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 78 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 79 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 80 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 81 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 82 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 83 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 84 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 85 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 86 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 87 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 88 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 89 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 90 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 91 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 92 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 93 | 2941479691 | |||
| 94 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 95 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 96 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 97 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 98 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 99 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 100 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 101 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 102 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 103 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 104 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 105 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 106 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 107 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 108 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 109 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 110 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 111 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 112 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 113 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 114 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 115 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 116 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 117 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 118 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 119 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 120 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 121 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 122 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 123 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 124 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 125 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 126 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 127 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 128 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 129 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 130 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 132 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 135 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 138 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 141 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 143 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 146 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 153 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 163 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 164 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 165 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 166 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 170 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 171 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 173 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 177 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 178 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 180 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 181 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 183 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 184 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 185 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 186 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 187 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 188 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 189 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 190 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 191 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 192 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 193 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 194 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 196 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 197 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 198 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 199 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 200 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 201 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 202 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 203 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 204 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 206 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 207 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 227 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 231 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 232 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 233 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 235 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 236 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 242 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 243 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 244 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 247 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 248 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 249 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 251 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 253 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 256 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 259 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 316 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 328 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 334 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 338 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 339 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 340 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 341 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 342 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 343 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 344 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 345 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 346 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 347 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 348 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 349 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 350 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 351 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 352 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 353 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 354 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 355 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 356 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 357 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 358 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 359 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 360 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 361 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 362 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 363 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 364 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 365 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 366 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 367 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 368 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 369 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 370 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 371 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 372 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 373 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 374 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 375 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 376 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 377 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 378 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 379 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 380 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 381 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 382 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 383 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 384 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 385 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 386 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 387 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 388 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 389 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 390 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 391 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 392 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 393 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 394 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 395 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 396 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 397 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 398 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 399 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 400 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 401 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 402 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 403 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 404 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 405 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 406 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 407 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 408 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 409 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 410 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 411 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 412 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 413 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 414 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 415 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 416 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 417 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 451 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 452 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 453 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 454 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 455 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 456 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 457 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 458 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 459 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 460 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 461 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 462 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 463 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 464 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 465 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 466 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 467 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 468 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 469 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 470 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 471 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 472 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 473 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 474 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 475 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 494 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 495 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 496 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 497 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 498 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 499 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 500 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 501 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 502 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 503 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 504 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 505 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 506 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 510 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 511 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 512 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 516 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 517 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 518 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 519 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 520 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 521 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 522 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 531 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 532 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 533 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 534 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 535 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 536 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 537 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 538 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 539 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 540 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 541 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 542 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 543 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 544 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 545 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 546 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 547 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 548 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 549 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 550 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 551 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.43 |
| Metatranscriptomes | 0.09 |
| Isolates | 9.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.82 |
| Nodule | 1.3 |
| Rhizoplane | 1.86 |
| Rhizosphere | 63.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000022 | 3300002704 | Bacteria | 142950 |
| 2 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 3 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 4 | JGI25154J39366_1001293 | 3300002738 | Bacteria | 9289 |
| 5 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 6 | JGI25157J39369_1000161 | 3300002741 | Bacteria | 56020 |
| 7 | JGI25157J39369_1000774 | 3300002741 | Bacteria | 16565 |
| 8 | JGI25152J39213_1000892 | 3300002773 | Bacteria | 14659 |
| 9 | JGI25150J39212_1005515 | 3300002774 | Bacteria | 2693 |
| 10 | JGI25159J45721_1001370 | 3300002987 | Bacteria | 10154 |
| 11 | JGI25159J45721_1007405 | 3300002987 | Bacteria | 3151 |
| 12 | JGI25151J46595_10001847 | 3300003187 | Bacteria | 13633 |
| 13 | JGI25151J46595_10003861 | 3300003187 | Bacteria | 8105 |
| 14 | JGI25151J46595_10004995 | 3300003187 | Bacteria | 6914 |
| 15 | JGI25151J46595_10005322 | 3300003187 | Bacteria | 6661 |
| 16 | JGI25151J46595_10007739 | 3300003187 | Bacteria | 5233 |
| 17 | JGI25153J46596_10000420 | 3300003215 | Bacteria | 27768 |
| 18 | JGI25153J46596_10002471 | 3300003215 | Bacteria | 10617 |
| 19 | Ga0006777J48905_1089277 | 3300003308 | Bacteria | 2035 |
| 20 | rootH2_10014247 | 3300003320 | Bacteria | 2247 |
| 21 | JGI25160J50197_1000273 | 3300003354 | Bacteria | 38119 |
| 22 | JGI25161J50226_1000095 | 3300003374 | Bacteria | 72343 |
| 23 | Ga0055539_1000542 | 3300003752 | Bacteria | 11256 |
| 24 | Ga0055539_1001036 | 3300003752 | Bacteria | 5964 |
| 25 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 26 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 27 | Ga0055525_1000689 | 3300003759 | Bacteria | 12543 |
| 28 | Ga0055535_1000221 | 3300003761 | Bacteria | 60185 |
| 29 | Ga0055535_1001368 | 3300003761 | Bacteria | 12770 |
| 30 | Ga0055542_1000129 | 3300003762 | Bacteria | 99542 |
| 31 | Ga0055529_1000661 | 3300003763 | Bacteria | 24331 |
| 32 | Ga0055529_1001314 | 3300003763 | Bacteria | 8432 |
| 33 | Ga0055526_1010439 | 3300003771 | Bacteria | 4319 |
| 34 | Ga0055526_1010839 | 3300003771 | Bacteria | 4191 |
| 35 | Ga0055526_1016398 | 3300003771 | Bacteria | 2904 |
| 36 | Ga0055537_1000205 | 3300003773 | Bacteria | 44266 |
| 37 | Ga0055537_1000717 | 3300003773 | Bacteria | 17146 |
| 38 | Ga0055524_1000073 | 3300003775 | Bacteria | 123033 |
| 39 | Ga0055524_1000109 | 3300003775 | Bacteria | 100308 |
| 40 | Ga0055524_1005152 | 3300003775 | Bacteria | 5895 |
| 41 | Ga0055524_1005801 | 3300003775 | Bacteria | 5455 |
| 42 | Ga0055536_1000044 | 3300003781 | Bacteria | 123111 |
| 43 | Ga0055536_1022076 | 3300003781 | Bacteria | 1911 |
| 44 | Ga0055534_1000337 | 3300003784 | Bacteria | 30592 |
| 45 | Ga0055534_1000363 | 3300003784 | Bacteria | 28579 |
| 46 | Ga0055534_1000467 | 3300003784 | Bacteria | 22933 |
| 47 | Ga0055534_1004577 | 3300003784 | Bacteria | 3953 |
| 48 | Ga0055528_1000289 | 3300003790 | Bacteria | 42964 |
| 49 | Ga0055528_1006545 | 3300003790 | Bacteria | 5277 |
| 50 | Ga0055528_1013900 | 3300003790 | Bacteria | 3019 |
| 51 | Ga0055530_10001804 | 3300003791 | Bacteria | 14848 |
| 52 | Ga0055540_1000013 | 3300003792 | Bacteria | 262274 |
| 53 | Ga0055540_1000037 | 3300003792 | Bacteria | 162957 |
| 54 | Ga0055540_1007611 | 3300003792 | Bacteria | 4047 |
| 55 | Ga0055531_10000112 | 3300003794 | Bacteria | 89016 |
| 56 | Ga0055531_10000158 | 3300003794 | Bacteria | 77918 |
| 57 | Ga0055531_10000500 | 3300003794 | Bacteria | 35897 |
| 58 | Ga0055543_1000218 | 3300004625 | Bacteria | 46120 |
| 59 | Ga0055543_1001329 | 3300004625 | Bacteria | 10110 |
| 60 | Ga0065165_1000016 | 3300005262 | Bacteria | 286248 |
| 61 | Ga0065165_1001026 | 3300005262 | Bacteria | 33855 |
| 62 | Ga0065165_1002013 | 3300005262 | Bacteria | 18978 |
| 63 | Ga0065704_10072444 | 3300005289 | Bacteria | 8516 |
| 64 | Ga0065707_10093995 | 3300005295 | Bacteria | 3552 |
| 65 | Ga0065707_10104681 | 3300005295 | Bacteria | 2683 |
| 66 | Ga0065707_10123248 | 3300005295 | Bacteria | 2065 |
| 67 | Ga0070658_10064689 | 3300005327 | Bacteria | 2983 |
| 68 | Ga0070676_10003268 | 3300005328 | Bacteria | 8419 |
| 69 | Ga0070676_10030581 | 3300005328 | Bacteria | 3072 |
| 70 | Ga0070690_100000107 | 3300005330 | Bacteria | 43179 |
| 71 | Ga0070690_100023747 | 3300005330 | Bacteria | 3764 |
| 72 | Ga0070670_100001440 | 3300005331 | Bacteria | 19100 |
| 73 | Ga0070670_100001784 | 3300005331 | Bacteria | 17512 |
| 74 | Ga0070670_100041149 | 3300005331 | Bacteria | 3971 |
| 75 | Ga0070670_100076880 | 3300005331 | Bacteria | 2868 |
| 76 | Ga0070670_100105389 | 3300005331 | Bacteria | 2429 |
| 77 | Ga0070677_10002257 | 3300005333 | Bacteria | 6145 |
| 78 | Ga0070677_10003533 | 3300005333 | Bacteria | 5042 |
| 79 | Ga0068869_100002674 | 3300005334 | Bacteria | 10774 |
| 80 | Ga0068869_100016954 | 3300005334 | Bacteria | 4925 |
| 81 | Ga0068869_100037918 | 3300005334 | Bacteria | 3430 |
| 82 | Ga0068869_100083034 | 3300005334 | Bacteria | 2395 |
| 83 | Ga0070680_100002947 | 3300005336 | Bacteria | 12648 |
| 84 | Ga0070682_100000079 | 3300005337 | Bacteria | 87919 |
| 85 | Ga0070682_100009153 | 3300005337 | Bacteria | 5600 |
| 86 | Ga0070682_100027278 | 3300005337 | Bacteria | 3426 |
| 87 | Ga0068868_100001535 | 3300005338 | Bacteria | 15804 |
| 88 | Ga0068868_100001584 | 3300005338 | Bacteria | 15507 |
| 89 | Ga0068868_100014958 | 3300005338 | Bacteria | 5729 |
| 90 | Ga0068868_100096553 | 3300005338 | Bacteria | 2387 |
| 91 | Ga0070660_100001319 | 3300005339 | Bacteria | 16886 |
| 92 | Ga0070660_100014250 | 3300005339 | Bacteria | 5725 |
| 93 | Ga0070689_100001349 | 3300005340 | Bacteria | 15575 |
| 94 | Ga0070689_100004489 | 3300005340 | Bacteria | 9439 |
| 95 | Ga0070687_100006716 | 3300005343 | Bacteria | 4737 |
| 96 | Ga0070687_100007662 | 3300005343 | Bacteria | 4519 |
| 97 | Ga0070687_100022178 | 3300005343 | Bacteria | 2998 |
| 98 | Ga0070661_100002141 | 3300005344 | Bacteria | 13611 |
| 99 | Ga0070661_100018312 | 3300005344 | Bacteria | 4978 |
| 100 | Ga0070692_10035278 | 3300005345 | Bacteria | 2531 |
| 101 | Ga0070668_100017950 | 3300005347 | Bacteria | 5307 |
| 102 | Ga0070669_100003084 | 3300005353 | Bacteria | 11996 |
| 103 | Ga0070669_100004692 | 3300005353 | Bacteria | 9860 |
| 104 | Ga0070669_100083648 | 3300005353 | Bacteria | 2380 |
| 105 | Ga0070675_100000897 | 3300005354 | Bacteria | 21177 |
| 106 | Ga0070675_100004992 | 3300005354 | Bacteria | 10130 |
| 107 | Ga0070675_100036240 | 3300005354 | Bacteria | 4012 |
| 108 | Ga0070675_100040766 | 3300005354 | Bacteria | 3792 |
| 109 | Ga0070671_100002016 | 3300005355 | Bacteria | 15615 |
| 110 | Ga0070671_100003626 | 3300005355 | Bacteria | 12086 |
| 111 | Ga0070671_100086173 | 3300005355 | Bacteria | 2627 |
| 112 | Ga0070674_100001095 | 3300005356 | Bacteria | 14216 |
| 113 | Ga0070673_100009353 | 3300005364 | Bacteria | 6576 |
| 114 | Ga0070688_100001166 | 3300005365 | Bacteria | 13076 |
| 115 | Ga0070688_100067471 | 3300005365 | Bacteria | 2279 |
| 116 | Ga0070659_100007265 | 3300005366 | Bacteria | 8042 |
| 117 | Ga0070659_100008981 | 3300005366 | Bacteria | 7329 |
| 118 | Ga0070659_100024688 | 3300005366 | Bacteria | 4609 |
| 119 | Ga0070659_100060132 | 3300005366 | Bacteria | 3001 |
| 120 | Ga0070659_100110470 | 3300005366 | Bacteria | 2219 |
| 121 | Ga0070667_100012295 | 3300005367 | Bacteria | 7082 |
| 122 | Ga0070701_10000356 | 3300005438 | Bacteria | 15169 |
| 123 | Ga0070705_100013380 | 3300005440 | Bacteria | 4196 |
| 124 | Ga0070700_100002053 | 3300005441 | Bacteria | 10234 |
| 125 | Ga0070700_100006861 | 3300005441 | Bacteria | 6111 |
| 126 | Ga0070694_100007484 | 3300005444 | Bacteria | 6659 |
| 127 | Ga0070663_100000518 | 3300005455 | Bacteria | 20374 |
| 128 | Ga0070678_100001803 | 3300005456 | Bacteria | 11540 |
| 129 | Ga0070662_100004722 | 3300005457 | Bacteria | 8634 |
| 130 | Ga0070662_100072457 | 3300005457 | Bacteria | 2543 |
| 131 | Ga0070681_10002791 | 3300005458 | Bacteria | 16131 |
| 132 | Ga0070681_10017140 | 3300005458 | Bacteria | 7243 |
| 133 | Ga0070681_10017818 | 3300005458 | Bacteria | 7097 |
| 134 | Ga0068867_100000020 | 3300005459 | Bacteria | 93210 |
| 135 | Ga0068867_100000735 | 3300005459 | Bacteria | 21966 |
| 136 | Ga0068867_100001564 | 3300005459 | Bacteria | 15888 |
| 137 | Ga0068867_100001947 | 3300005459 | Bacteria | 14386 |
| 138 | Ga0068867_100007291 | 3300005459 | Bacteria | 7825 |
| 139 | Ga0068867_100044545 | 3300005459 | Bacteria | 3251 |
| 140 | Ga0068867_100083162 | 3300005459 | Bacteria | 2416 |
| 141 | Ga0068867_100084548 | 3300005459 | Bacteria | 2397 |
| 142 | Ga0068867_100123527 | 3300005459 | Bacteria | 2003 |
| 143 | Ga0070685_10000570 | 3300005466 | Bacteria | 20652 |
| 144 | Ga0070706_100002083 | 3300005467 | Bacteria | 20391 |
| 145 | Ga0070707_100000110 | 3300005468 | Bacteria | 75472 |
| 146 | Ga0070707_100118641 | 3300005468 | Bacteria | 2568 |
| 147 | Ga0070698_100003773 | 3300005471 | Bacteria | 16645 |
| 148 | Ga0070698_100065792 | 3300005471 | Bacteria | 3650 |
| 149 | Ga0070699_100008765 | 3300005518 | Bacteria | 8766 |
| 150 | Ga0070699_100015887 | 3300005518 | Bacteria | 6463 |
| 151 | Ga0070699_100064514 | 3300005518 | Bacteria | 3176 |
| 152 | Ga0070679_100000726 | 3300005530 | Bacteria | 28453 |
| 153 | Ga0070679_100017182 | 3300005530 | Bacteria | 6998 |
| 154 | Ga0070679_100039416 | 3300005530 | Bacteria | 4695 |
| 155 | Ga0070697_100024444 | 3300005536 | Bacteria | 4809 |
| 156 | Ga0070672_100000368 | 3300005543 | Bacteria | 25953 |
| 157 | Ga0070672_100002347 | 3300005543 | Bacteria | 11964 |
| 158 | Ga0070672_100009632 | 3300005543 | Bacteria | 6667 |
| 159 | Ga0070672_100012177 | 3300005543 | Bacteria | 6026 |
| 160 | Ga0070672_100017220 | 3300005543 | Bacteria | 5196 |
| 161 | Ga0070686_100003006 | 3300005544 | Bacteria | 9242 |
| 162 | Ga0070686_100006419 | 3300005544 | Bacteria | 6533 |
| 163 | Ga0070695_100005400 | 3300005545 | Bacteria | 7523 |
| 164 | Ga0070696_100032488 | 3300005546 | Bacteria | 3580 |
| 165 | Ga0070665_100037542 | 3300005548 | Bacteria | 4871 |
| 166 | Ga0070665_100050414 | 3300005548 | Bacteria | 4177 |
| 167 | Ga0070704_100001426 | 3300005549 | Bacteria | 12763 |
| 168 | Ga0070704_100007740 | 3300005549 | Bacteria | 6405 |
| 169 | Ga0070704_100008826 | 3300005549 | Bacteria | 6067 |
| 170 | Ga0068855_100013962 | 3300005563 | Bacteria | 9684 |
| 171 | Ga0068855_100102108 | 3300005563 | Bacteria | 3301 |
| 172 | Ga0070664_100009588 | 3300005564 | Bacteria | 7853 |
| 173 | Ga0070664_100026696 | 3300005564 | Bacteria | 4793 |
| 174 | Ga0068857_100008925 | 3300005577 | Bacteria | 8685 |
| 175 | Ga0068857_100026238 | 3300005577 | Bacteria | 5134 |
| 176 | Ga0068857_100059410 | 3300005577 | Bacteria | 3396 |
| 177 | Ga0068856_100001351 | 3300005614 | Bacteria | 25782 |
| 178 | Ga0068856_100037330 | 3300005614 | Bacteria | 4768 |
| 179 | Ga0070702_100002394 | 3300005615 | Bacteria | 8074 |
| 180 | Ga0068859_100000648 | 3300005617 | Bacteria | 34840 |
| 181 | Ga0068859_100007249 | 3300005617 | Bacteria | 11248 |
| 182 | Ga0068864_100000001 | 3300005618 | Bacteria | 686767 |
| 183 | Ga0068864_100018085 | 3300005618 | Bacteria | 5883 |
| 184 | Ga0068861_100018170 | 3300005719 | Bacteria | 5004 |
| 185 | Ga0068861_100034989 | 3300005719 | Bacteria | 3718 |
| 186 | Ga0068861_100060362 | 3300005719 | Bacteria | 2906 |
| 187 | Ga0068858_100000467 | 3300005842 | Bacteria | 42180 |
| 188 | Ga0068858_100044054 | 3300005842 | Bacteria | 4137 |
| 189 | Ga0068858_100069799 | 3300005842 | Bacteria | 3257 |
| 190 | Ga0068860_100002278 | 3300005843 | Bacteria | 20163 |
| 191 | Ga0068860_100036131 | 3300005843 | Bacteria | 4736 |
| 192 | Ga0068862_100009207 | 3300005844 | Bacteria | 8179 |
| 193 | Ga0068862_100046353 | 3300005844 | Bacteria | 3709 |
| 194 | Ga0068862_100060633 | 3300005844 | Bacteria | 3250 |
| 195 | Ga0068862_100062922 | 3300005844 | Bacteria | 3192 |
| 196 | Ga0068862_100071690 | 3300005844 | Bacteria | 2991 |
| 197 | Ga0068862_100082879 | 3300005844 | Bacteria | 2784 |
| 198 | Ga0081455_10000552 | 3300005937 | Bacteria | 48660 |
| 199 | Ga0075365_10035474 | 3300006038 | Bacteria | 3227 |
| 200 | Ga0075363_100005602 | 3300006048 | Bacteria | 5610 |
| 201 | Ga0075363_100007828 | 3300006048 | Bacteria | 4940 |
| 202 | Ga0075363_100009510 | 3300006048 | Bacteria | 4570 |
| 203 | Ga0075364_10002743 | 3300006051 | Bacteria | 9897 |
| 204 | Ga0075364_10006841 | 3300006051 | Bacteria | 6728 |
| 205 | Ga0075364_10017870 | 3300006051 | Bacteria | 4435 |
| 206 | Ga0075362_10033082 | 3300006177 | Bacteria | 2247 |
| 207 | Ga0075366_10001208 | 3300006195 | Bacteria | 12818 |
| 208 | Ga0075366_10001813 | 3300006195 | Bacteria | 10789 |
| 209 | Ga0075366_10003680 | 3300006195 | Bacteria | 8136 |
| 210 | Ga0075366_10006507 | 3300006195 | Bacteria | 6404 |
| 211 | Ga0075366_10010444 | 3300006195 | Bacteria | 5214 |
| 212 | Ga0075366_10026687 | 3300006195 | Bacteria | 3384 |
| 213 | Ga0097621_100009437 | 3300006237 | Bacteria | 7080 |
| 214 | Ga0097621_100032048 | 3300006237 | Bacteria | 4176 |
| 215 | Ga0097621_100034919 | 3300006237 | Bacteria | 4014 |
| 216 | Ga0075370_10000288 | 3300006353 | Bacteria | 18082 |
| 217 | Ga0075370_10000910 | 3300006353 | Bacteria | 12135 |
| 218 | Ga0075370_10002426 | 3300006353 | Bacteria | 8638 |
| 219 | Ga0075370_10006446 | 3300006353 | Bacteria | 5903 |
| 220 | Ga0075370_10010497 | 3300006353 | Bacteria | 4842 |
| 221 | Ga0075370_10055769 | 3300006353 | Bacteria | 2245 |
| 222 | Ga0075370_10056336 | 3300006353 | Bacteria | 2234 |
| 223 | Ga0068871_100002097 | 3300006358 | Bacteria | 13494 |
| 224 | Ga0068871_100005094 | 3300006358 | Bacteria | 9179 |
| 225 | Ga0068871_100028897 | 3300006358 | Bacteria | 4351 |
| 226 | Ga0068871_100034947 | 3300006358 | Bacteria | 3991 |
| 227 | Ga0075428_100234656 | 3300006844 | Bacteria | 1979 |
| 228 | Ga0075430_100025182 | 3300006846 | Bacteria | 5060 |
| 229 | Ga0075430_100131987 | 3300006846 | Bacteria | 2082 |
| 230 | Ga0075431_100028239 | 3300006847 | Bacteria | 5762 |
| 231 | Ga0075431_100045331 | 3300006847 | Bacteria | 4533 |
| 232 | Ga0075433_10045779 | 3300006852 | Bacteria | 3804 |
| 233 | Ga0075429_100000018 | 3300006880 | Bacteria | 71039 |
| 234 | Ga0075429_100003110 | 3300006880 | Bacteria | 14099 |
| 235 | Ga0075429_100011337 | 3300006880 | Bacteria | 7717 |
| 236 | Ga0075429_100050294 | 3300006880 | Bacteria | 3626 |
| 237 | Ga0075429_100096308 | 3300006880 | Bacteria | 2581 |
| 238 | Ga0068865_100006429 | 3300006881 | Bacteria | 7165 |
| 239 | Ga0068865_100018444 | 3300006881 | Bacteria | 4502 |
| 240 | Ga0068865_100053538 | 3300006881 | Bacteria | 2800 |
| 241 | Ga0075436_100031317 | 3300006914 | Bacteria | 3662 |
| 242 | Ga0097620_100000648 | 3300006931 | Bacteria | 34840 |
| 243 | Ga0097620_100007249 | 3300006931 | Bacteria | 11248 |
| 244 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 245 | Ga0079104_1000055 | 3300006946 | Bacteria | 166522 |
| 246 | Ga0099826_10001050 | 3300006948 | Bacteria | 15606 |
| 247 | Ga0105244_10003265 | 3300009036 | Bacteria | 11688 |
| 248 | Ga0105250_10001192 | 3300009092 | Bacteria | 14517 |
| 249 | Ga0105240_10005235 | 3300009093 | Bacteria | 19386 |
| 250 | Ga0105240_10019777 | 3300009093 | Bacteria | 8992 |
| 251 | Ga0105240_10026481 | 3300009093 | Bacteria | 7609 |
| 252 | Ga0105240_10080518 | 3300009093 | Bacteria | 4005 |
| 253 | Ga0105245_10000957 | 3300009098 | Bacteria | 26254 |
| 254 | Ga0105245_10005072 | 3300009098 | Bacteria | 11578 |
| 255 | Ga0114129_10005674 | 3300009147 | Bacteria | 17667 |
| 256 | Ga0114129_10012020 | 3300009147 | Bacteria | 12315 |
| 257 | Ga0114129_10047712 | 3300009147 | Bacteria | 6017 |
| 258 | Ga0114129_10104273 | 3300009147 | Bacteria | 3918 |
| 259 | Ga0114129_10173521 | 3300009147 | Bacteria | 2938 |
| 260 | Ga0105243_10002550 | 3300009148 | Bacteria | 15218 |
| 261 | Ga0105243_10002600 | 3300009148 | Bacteria | 15051 |
| 262 | Ga0105243_10014871 | 3300009148 | Bacteria | 5889 |
| 263 | Ga0105243_10031316 | 3300009148 | Bacteria | 4100 |
| 264 | Ga0105243_10085749 | 3300009148 | Bacteria | 2582 |
| 265 | Ga0105242_10003752 | 3300009176 | Bacteria | 11807 |
| 266 | Ga0105242_10027648 | 3300009176 | Bacteria | 4507 |
| 267 | Ga0105242_10043696 | 3300009176 | Bacteria | 3625 |
| 268 | Ga0105242_10079072 | 3300009176 | Bacteria | 2746 |
| 269 | Ga0105248_10000624 | 3300009177 | Bacteria | 40257 |
| 270 | Ga0105248_10004455 | 3300009177 | Bacteria | 15499 |
| 271 | Ga0105237_10002475 | 3300009545 | Bacteria | 22923 |
| 272 | Ga0105237_10017120 | 3300009545 | Bacteria | 7518 |
| 273 | Ga0105237_10109708 | 3300009545 | Bacteria | 2751 |
| 274 | Ga0105249_10026571 | 3300009553 | Bacteria | 5218 |
| 275 | Ga0105239_10001374 | 3300010375 | Bacteria | 32644 |
| 276 | Ga0105239_10025113 | 3300010375 | Bacteria | 6563 |
| 277 | Ga0105239_10047382 | 3300010375 | Bacteria | 4711 |
| 278 | Ga0105246_10007146 | 3300011119 | Bacteria | 6838 |
| 279 | Ga0157373_10021292 | 3300013100 | Bacteria | 4708 |
| 280 | Ga0157369_10008671 | 3300013105 | Bacteria | 11657 |
| 281 | Ga0157369_10069515 | 3300013105 | Bacteria | 3783 |
| 282 | Ga0157369_10161722 | 3300013105 | Bacteria | 2363 |
| 283 | Ga0157374_10009960 | 3300013296 | Bacteria | 8160 |
| 284 | Ga0157378_10003351 | 3300013297 | Bacteria | 14258 |
| 285 | Ga0163162_10001398 | 3300013306 | Bacteria | 22461 |
| 286 | Ga0163162_10119727 | 3300013306 | Bacteria | 2736 |
| 287 | Ga0163162_10121698 | 3300013306 | Bacteria | 2714 |
| 288 | Ga0157375_10000077 | 3300013308 | Bacteria | 100528 |
| 289 | Ga0157375_10005835 | 3300013308 | Bacteria | 10714 |
| 290 | Ga0157375_10020637 | 3300013308 | Bacteria | 6024 |
| 291 | Ga0157375_10031637 | 3300013308 | Bacteria | 5006 |
| 292 | Ga0157375_10163710 | 3300013308 | Bacteria | 2368 |
| 293 | Ga0157380_10097782 | 3300014326 | Bacteria | 2437 |
| 294 | Ga0182008_10005957 | 3300014497 | Bacteria | 6874 |
| 295 | Ga0182008_10018374 | 3300014497 | Bacteria | 3621 |
| 296 | Ga0157377_10000032 | 3300014745 | Bacteria | 121003 |
| 297 | Ga0157377_10000808 | 3300014745 | Bacteria | 12944 |
| 298 | Ga0157377_10004958 | 3300014745 | Bacteria | 6205 |
| 299 | Ga0157379_10008673 | 3300014968 | Bacteria | 8854 |
| 300 | Ga0157379_10017000 | 3300014968 | Bacteria | 6402 |
| 301 | Ga0157379_10053219 | 3300014968 | Bacteria | 3616 |
| 302 | Ga0157379_10117779 | 3300014968 | Bacteria | 2389 |
| 303 | Ga0157376_10000954 | 3300014969 | Bacteria | 18842 |
| 304 | Ga0157376_10006818 | 3300014969 | Bacteria | 8086 |
| 305 | Ga0157376_10011066 | 3300014969 | Bacteria | 6634 |
| 306 | Ga0182006_1008452 | 3300015261 | Bacteria | 4663 |
| 307 | Ga0182007_10000951 | 3300015262 | Bacteria | 15906 |
| 308 | Ga0182007_10017245 | 3300015262 | Bacteria | 2642 |
| 309 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 310 | Ga0163161_10001265 | 3300017792 | Bacteria | 18886 |
| 311 | Ga0163161_10002188 | 3300017792 | Bacteria | 14097 |
| 312 | Ga0163161_10003141 | 3300017792 | Bacteria | 11645 |
| 313 | Ga0163161_10010510 | 3300017792 | Bacteria | 6411 |
| 314 | Ga0213872_10000202 | 3300021361 | Bacteria | 52878 |
| 315 | Ga0213872_10000474 | 3300021361 | Bacteria | 32444 |
| 316 | Ga0213872_10001156 | 3300021361 | Bacteria | 17967 |
| 317 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 318 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 319 | Ga0209672_102177 | 3300025228 | Bacteria | 5143 |
| 320 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 321 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 322 | Ga0207427_100381 | 3300025231 | Bacteria | 26800 |
| 323 | Ga0209258_100240 | 3300025242 | Bacteria | 100990 |
| 324 | Ga0209258_100659 | 3300025242 | Bacteria | 24988 |
| 325 | Ga0209258_100666 | 3300025242 | Bacteria | 24392 |
| 326 | Ga0207425_1000221 | 3300025245 | Bacteria | 44837 |
| 327 | Ga0207425_1001344 | 3300025245 | Bacteria | 10540 |
| 328 | Ga0207425_1002962 | 3300025245 | Bacteria | 5684 |
| 329 | Ga0207425_1003474 | 3300025245 | Bacteria | 5024 |
| 330 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 331 | Ga0209646_1000157 | 3300025246 | Bacteria | 94054 |
| 332 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 333 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 334 | Ga0209677_100900 | 3300025253 | Bacteria | 14544 |
| 335 | Ga0209677_101252 | 3300025253 | Bacteria | 11431 |
| 336 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 337 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 338 | Ga0209759_1000194 | 3300025256 | Bacteria | 97047 |
| 339 | Ga0209759_1001392 | 3300025256 | Bacteria | 13899 |
| 340 | Ga0209759_1003989 | 3300025256 | Bacteria | 5657 |
| 341 | Ga0209759_1005336 | 3300025256 | Bacteria | 4529 |
| 342 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 343 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 344 | Ga0209565_1000067 | 3300025263 | Bacteria | 171247 |
| 345 | Ga0209565_1000128 | 3300025263 | Bacteria | 108959 |
| 346 | Ga0209565_1000679 | 3300025263 | Bacteria | 21221 |
| 347 | Ga0209565_1003213 | 3300025263 | Bacteria | 5406 |
| 348 | Ga0209455_1000227 | 3300025272 | Bacteria | 75434 |
| 349 | Ga0209455_1000569 | 3300025272 | Bacteria | 24392 |
| 350 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 351 | Ga0209673_1000097 | 3300025273 | Bacteria | 193482 |
| 352 | Ga0209673_1000172 | 3300025273 | Bacteria | 133472 |
| 353 | Ga0209673_1006425 | 3300025273 | Bacteria | 5673 |
| 354 | Ga0209673_1006833 | 3300025273 | Bacteria | 5411 |
| 355 | Ga0209130_1000072 | 3300025284 | Bacteria | 175726 |
| 356 | Ga0209130_1001362 | 3300025284 | Bacteria | 16486 |
| 357 | Ga0209130_1001611 | 3300025284 | Bacteria | 14009 |
| 358 | Ga0209675_1000038 | 3300025291 | Bacteria | 250481 |
| 359 | Ga0209675_1000260 | 3300025291 | Bacteria | 52208 |
| 360 | Ga0209675_1000527 | 3300025291 | Bacteria | 28098 |
| 361 | Ga0209675_1000690 | 3300025291 | Bacteria | 23483 |
| 362 | Ga0209675_1001272 | 3300025291 | Bacteria | 15081 |
| 363 | Ga0209675_1001985 | 3300025291 | Bacteria | 10989 |
| 364 | Ga0209675_1006252 | 3300025291 | Bacteria | 4818 |
| 365 | Ga0209675_1016309 | 3300025291 | Bacteria | 2169 |
| 366 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 367 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 368 | Ga0209676_1000141 | 3300025292 | Bacteria | 175894 |
| 369 | Ga0209676_1000739 | 3300025292 | Bacteria | 44487 |
| 370 | Ga0209676_1000836 | 3300025292 | Bacteria | 39908 |
| 371 | Ga0209676_1005022 | 3300025292 | Bacteria | 7082 |
| 372 | Ga0209676_1008633 | 3300025292 | Bacteria | 4514 |
| 373 | Ga0209025_1000028 | 3300025294 | Bacteria | 490678 |
| 374 | Ga0209025_1000174 | 3300025294 | Bacteria | 158915 |
| 375 | Ga0209025_1000538 | 3300025294 | Bacteria | 71789 |
| 376 | Ga0209025_1000657 | 3300025294 | Bacteria | 59935 |
| 377 | Ga0209025_1001066 | 3300025294 | Bacteria | 39849 |
| 378 | Ga0209025_1002686 | 3300025294 | Bacteria | 18150 |
| 379 | Ga0209025_1003753 | 3300025294 | Bacteria | 13924 |
| 380 | Ga0209025_1003759 | 3300025294 | Bacteria | 13908 |
| 381 | Ga0209025_1010615 | 3300025294 | Bacteria | 6214 |
| 382 | Ga0209025_1029285 | 3300025294 | Bacteria | 2670 |
| 383 | Ga0209025_1030949 | 3300025294 | Bacteria | 2545 |
| 384 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 385 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 386 | Ga0209564_1000241 | 3300025295 | Bacteria | 118237 |
| 387 | Ga0209564_1002257 | 3300025295 | Bacteria | 15794 |
| 388 | Ga0209564_1002377 | 3300025295 | Bacteria | 15101 |
| 389 | Ga0209564_1002910 | 3300025295 | Bacteria | 12458 |
| 390 | Ga0209564_1003110 | 3300025295 | Bacteria | 11730 |
| 391 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 392 | Ga0209758_1000124 | 3300025297 | Bacteria | 189933 |
| 393 | Ga0209758_1000234 | 3300025297 | Bacteria | 116217 |
| 394 | Ga0209758_1000456 | 3300025297 | Bacteria | 68269 |
| 395 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 396 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 397 | Ga0209050_1000294 | 3300025298 | Bacteria | 105705 |
| 398 | Ga0209050_1000315 | 3300025298 | Bacteria | 98447 |
| 399 | Ga0209050_1001261 | 3300025298 | Bacteria | 29214 |
| 400 | Ga0209050_1001301 | 3300025298 | Bacteria | 28152 |
| 401 | Ga0209050_1004556 | 3300025298 | Bacteria | 9307 |
| 402 | Ga0209050_1007315 | 3300025298 | Bacteria | 6229 |
| 403 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 404 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 405 | Ga0209256_1000103 | 3300025299 | Bacteria | 193900 |
| 406 | Ga0209256_1000165 | 3300025299 | Bacteria | 135104 |
| 407 | Ga0209256_1000370 | 3300025299 | Bacteria | 72409 |
| 408 | Ga0209256_1000964 | 3300025299 | Bacteria | 34690 |
| 409 | Ga0209256_1003240 | 3300025299 | Bacteria | 11721 |
| 410 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 411 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 412 | Ga0207426_1000319 | 3300025302 | Bacteria | 92696 |
| 413 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 414 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 415 | Ga0209051_1000022 | 3300025303 | Bacteria | 474879 |
| 416 | Ga0209051_1000315 | 3300025303 | Bacteria | 73579 |
| 417 | Ga0209051_1001286 | 3300025303 | Bacteria | 22218 |
| 418 | Ga0209051_1001560 | 3300025303 | Bacteria | 18951 |
| 419 | Ga0209051_1002634 | 3300025303 | Bacteria | 12590 |
| 420 | Ga0209051_1003502 | 3300025303 | Bacteria | 10261 |
| 421 | Ga0209051_1007572 | 3300025303 | Bacteria | 5913 |
| 422 | Ga0209051_1021634 | 3300025303 | Bacteria | 2729 |
| 423 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 424 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 425 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 426 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 427 | Ga0209257_1000131 | 3300025304 | Bacteria | 211464 |
| 428 | Ga0209257_1000309 | 3300025304 | Bacteria | 104166 |
| 429 | Ga0209257_1004305 | 3300025304 | Bacteria | 11192 |
| 430 | Ga0209257_1009377 | 3300025304 | Bacteria | 5264 |
| 431 | Ga0209257_1013165 | 3300025304 | Bacteria | 3716 |
| 432 | Ga0207697_10002324 | 3300025315 | Bacteria | 9900 |
| 433 | Ga0207656_10001162 | 3300025321 | Bacteria | 8647 |
| 434 | Ga0207696_1001691 | 3300025711 | Bacteria | 11466 |
| 435 | Ga0207655_1000639 | 3300025728 | Bacteria | 41880 |
| 436 | Ga0207682_10002632 | 3300025893 | Bacteria | 7995 |
| 437 | Ga0207645_10000012 | 3300025907 | Bacteria | 131374 |
| 438 | Ga0207645_10002553 | 3300025907 | Bacteria | 14225 |
| 439 | Ga0207645_10018626 | 3300025907 | Bacteria | 4561 |
| 440 | Ga0207645_10023666 | 3300025907 | Bacteria | 3988 |
| 441 | Ga0207705_10064175 | 3300025909 | Bacteria | 2654 |
| 442 | Ga0207684_10004074 | 3300025910 | Bacteria | 13941 |
| 443 | Ga0207707_10010822 | 3300025912 | Bacteria | 7928 |
| 444 | Ga0207707_10027135 | 3300025912 | Bacteria | 5007 |
| 445 | Ga0207707_10034449 | 3300025912 | Bacteria | 4430 |
| 446 | Ga0207695_10018847 | 3300025913 | Bacteria | 7964 |
| 447 | Ga0207695_10040979 | 3300025913 | Bacteria | 4959 |
| 448 | Ga0207671_10017064 | 3300025914 | Bacteria | 5613 |
| 449 | Ga0207671_10032349 | 3300025914 | Bacteria | 3894 |
| 450 | Ga0207660_10029907 | 3300025917 | Bacteria | 3741 |
| 451 | Ga0207662_10002618 | 3300025918 | Bacteria | 9081 |
| 452 | Ga0207662_10010476 | 3300025918 | Bacteria | 5121 |
| 453 | Ga0207657_10000268 | 3300025919 | Bacteria | 55307 |
| 454 | Ga0207657_10003453 | 3300025919 | Bacteria | 16866 |
| 455 | Ga0207649_10091844 | 3300025920 | Bacteria | 1989 |
| 456 | Ga0207652_10002099 | 3300025921 | Bacteria | 17115 |
| 457 | Ga0207652_10022525 | 3300025921 | Bacteria | 5213 |
| 458 | Ga0207646_10000035 | 3300025922 | Bacteria | 209056 |
| 459 | Ga0207646_10054211 | 3300025922 | Bacteria | 3587 |
| 460 | Ga0207646_10129928 | 3300025922 | Bacteria | 2266 |
| 461 | Ga0207681_10058859 | 3300025923 | Bacteria | 2632 |
| 462 | Ga0207694_10007736 | 3300025924 | Bacteria | 8136 |
| 463 | Ga0207694_10027863 | 3300025924 | Bacteria | 4304 |
| 464 | Ga0207650_10008398 | 3300025925 | Bacteria | 7049 |
| 465 | Ga0207650_10014392 | 3300025925 | Bacteria | 5498 |
| 466 | Ga0207659_10000393 | 3300025926 | Bacteria | 26320 |
| 467 | Ga0207659_10003084 | 3300025926 | Bacteria | 9945 |
| 468 | Ga0207659_10026282 | 3300025926 | Bacteria | 3926 |
| 469 | Ga0207687_10007205 | 3300025927 | Bacteria | 7332 |
| 470 | Ga0207687_10007937 | 3300025927 | Bacteria | 6951 |
| 471 | Ga0207644_10001550 | 3300025931 | Bacteria | 14827 |
| 472 | Ga0207644_10001683 | 3300025931 | Bacteria | 14251 |
| 473 | Ga0207644_10004993 | 3300025931 | Bacteria | 8661 |
| 474 | Ga0207690_10028634 | 3300025932 | Bacteria | 3532 |
| 475 | Ga0207690_10034594 | 3300025932 | Bacteria | 3256 |
| 476 | Ga0207706_10001875 | 3300025933 | Bacteria | 20601 |
| 477 | Ga0207706_10003908 | 3300025933 | Bacteria | 14140 |
| 478 | Ga0207706_10095167 | 3300025933 | Bacteria | 2620 |
| 479 | Ga0207706_10133846 | 3300025933 | Bacteria | 2180 |
| 480 | Ga0207686_10075332 | 3300025934 | Unclassified | 2184 |
| 481 | Ga0207709_10000111 | 3300025935 | Bacteria | 127580 |
| 482 | Ga0207709_10000874 | 3300025935 | Bacteria | 22951 |
| 483 | Ga0207709_10004954 | 3300025935 | Bacteria | 7622 |
| 484 | Ga0207709_10008146 | 3300025935 | Bacteria | 5804 |
| 485 | Ga0207709_10015294 | 3300025935 | Bacteria | 4254 |
| 486 | Ga0207670_10000023 | 3300025936 | Bacteria | 145527 |
| 487 | Ga0207670_10014626 | 3300025936 | Bacteria | 4665 |
| 488 | Ga0207669_10002595 | 3300025937 | Bacteria | 7723 |
| 489 | Ga0207704_10001416 | 3300025938 | Bacteria | 10725 |
| 490 | Ga0207704_10001487 | 3300025938 | Bacteria | 10503 |
| 491 | Ga0207665_10079438 | 3300025939 | Bacteria | 2255 |
| 492 | Ga0207691_10000966 | 3300025940 | Bacteria | 28538 |
| 493 | Ga0207691_10001174 | 3300025940 | Bacteria | 26054 |
| 494 | Ga0207691_10002462 | 3300025940 | Bacteria | 18101 |
| 495 | Ga0207691_10046301 | 3300025940 | Bacteria | 3997 |
| 496 | Ga0207691_10065625 | 3300025940 | Bacteria | 3284 |
| 497 | Ga0207691_10069360 | 3300025940 | Bacteria | 3184 |
| 498 | Ga0207711_10005817 | 3300025941 | Bacteria | 10420 |
| 499 | Ga0207711_10042841 | 3300025941 | Bacteria | 3858 |
| 500 | Ga0207711_10044319 | 3300025941 | Bacteria | 3797 |
| 501 | Ga0207689_10000709 | 3300025942 | Bacteria | 31888 |
| 502 | Ga0207689_10115183 | 3300025942 | Bacteria | 2209 |
| 503 | Ga0207661_10068893 | 3300025944 | Bacteria | 2883 |
| 504 | Ga0207679_10000671 | 3300025945 | Bacteria | 22930 |
| 505 | Ga0207667_10038069 | 3300025949 | Bacteria | 5138 |
| 506 | Ga0207667_10080484 | 3300025949 | Bacteria | 3375 |
| 507 | Ga0207651_10001471 | 3300025960 | Bacteria | 10709 |
| 508 | Ga0207651_10024688 | 3300025960 | Bacteria | 3723 |
| 509 | Ga0207651_10031942 | 3300025960 | Bacteria | 3373 |
| 510 | Ga0207712_10120631 | 3300025961 | Bacteria | 1983 |
| 511 | Ga0207668_10077214 | 3300025972 | Bacteria | 2400 |
| 512 | Ga0207677_10000003 | 3300026023 | Bacteria | 450061 |
| 513 | Ga0207677_10024519 | 3300026023 | Bacteria | 3749 |
| 514 | Ga0207677_10032337 | 3300026023 | Bacteria | 3362 |
| 515 | Ga0207677_10050975 | 3300026023 | Bacteria | 2803 |
| 516 | Ga0207677_10056522 | 3300026023 | Bacteria | 2689 |
| 517 | Ga0207703_10000085 | 3300026035 | Bacteria | 107333 |
| 518 | Ga0207703_10021855 | 3300026035 | Bacteria | 5009 |
| 519 | Ga0207703_10045165 | 3300026035 | Bacteria | 3543 |
| 520 | Ga0207703_10085653 | 3300026035 | Bacteria | 2638 |
| 521 | Ga0207639_10007668 | 3300026041 | Bacteria | 7368 |
| 522 | Ga0207678_10000837 | 3300026067 | Bacteria | 28213 |
| 523 | Ga0207678_10014036 | 3300026067 | Bacteria | 7044 |
| 524 | Ga0207708_10000228 | 3300026075 | Bacteria | 44336 |
| 525 | Ga0207708_10001059 | 3300026075 | Bacteria | 20614 |
| 526 | Ga0207708_10014415 | 3300026075 | Bacteria | 5917 |
| 527 | Ga0207702_10002902 | 3300026078 | Bacteria | 16043 |
| 528 | Ga0207702_10030008 | 3300026078 | Bacteria | 4529 |
| 529 | Ga0207702_10051306 | 3300026078 | Bacteria | 3485 |
| 530 | Ga0207702_10112944 | 3300026078 | Bacteria | 2419 |
| 531 | Ga0207641_10013071 | 3300026088 | Bacteria | 6809 |
| 532 | Ga0207641_10106387 | 3300026088 | Bacteria | 2479 |
| 533 | Ga0207648_10000172 | 3300026089 | Bacteria | 66986 |
| 534 | Ga0207648_10001516 | 3300026089 | Bacteria | 25587 |
| 535 | Ga0207648_10006261 | 3300026089 | Bacteria | 11850 |
| 536 | Ga0207648_10011123 | 3300026089 | Bacteria | 8490 |
| 537 | Ga0207648_10021655 | 3300026089 | Bacteria | 5775 |
| 538 | Ga0207648_10029775 | 3300026089 | Bacteria | 4841 |
| 539 | Ga0207648_10054826 | 3300026089 | Bacteria | 3481 |
| 540 | Ga0207676_10000002 | 3300026095 | Bacteria | 1198607 |
| 541 | Ga0207676_10013160 | 3300026095 | Bacteria | 5940 |
| 542 | Ga0207676_10068247 | 3300026095 | Bacteria | 2843 |
| 543 | Ga0207674_10004639 | 3300026116 | Bacteria | 16503 |
| 544 | Ga0207674_10104466 | 3300026116 | Bacteria | 2811 |
| 545 | Ga0207675_100000563 | 3300026118 | Bacteria | 36307 |
| 546 | Ga0207675_100019461 | 3300026118 | Bacteria | 6334 |
| 547 | Ga0207675_100025201 | 3300026118 | Bacteria | 5535 |
| 548 | Ga0207675_100036724 | 3300026118 | Bacteria | 4569 |
| 549 | Ga0207683_10000028 | 3300026121 | Bacteria | 109908 |
| 550 | Ga0207683_10004504 | 3300026121 | Bacteria | 12020 |
| 551 | Ga0207698_10087550 | 3300026142 | Bacteria | 2537 |
| 552 | Ga0207698_10097790 | 3300026142 | Bacteria | 2423 |
| 553 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 554 | Ga0209281_1000057 | 3300027111 | Bacteria | 307145 |
| 555 | Ga0209973_1000841 | 3300027252 | Bacteria | 2473 |
| 556 | Ga0209969_1000289 | 3300027360 | Bacteria | 6705 |
| 557 | Ga0209967_1000103 | 3300027364 | Bacteria | 11358 |
| 558 | Ga0209996_1000033 | 3300027395 | Bacteria | 21398 |
| 559 | Ga0210000_1000096 | 3300027462 | Bacteria | 12256 |
| 560 | Ga0209995_1000009 | 3300027471 | Bacteria | 32653 |
| 561 | Ga0209968_1000024 | 3300027526 | Bacteria | 28731 |
| 562 | Ga0209968_1000489 | 3300027526 | Bacteria | 6276 |
| 563 | Ga0209982_1002669 | 3300027552 | Bacteria | 2508 |
| 564 | Ga0209970_1000052 | 3300027614 | Bacteria | 15551 |
| 565 | Ga0209970_1000067 | 3300027614 | Bacteria | 14173 |
| 566 | Ga0210002_1000051 | 3300027617 | Bacteria | 17640 |
| 567 | Ga0209983_1000026 | 3300027665 | Bacteria | 19973 |
| 568 | Ga0209282_1000250 | 3300027666 | Bacteria | 26928 |
| 569 | Ga0209971_1000276 | 3300027682 | Bacteria | 14514 |
| 570 | Ga0209966_1000033 | 3300027695 | Bacteria | 59831 |
| 571 | Ga0209966_1000248 | 3300027695 | Bacteria | 19851 |
| 572 | Ga0209998_10000378 | 3300027717 | Bacteria | 12841 |
| 573 | Ga0209813_10016340 | 3300027866 | Bacteria | 2025 |
| 574 | Ga0209974_10000240 | 3300027876 | Bacteria | 17737 |
| 575 | Ga0209974_10000246 | 3300027876 | Bacteria | 17475 |
| 576 | Ga0209974_10000308 | 3300027876 | Bacteria | 15916 |
| 577 | Ga0209974_10015858 | 3300027876 | Bacteria | 2502 |
| 578 | Ga0207428_10002466 | 3300027907 | Bacteria | 18484 |
| 579 | Ga0268266_10029093 | 3300028379 | Bacteria | 4696 |
| 580 | Ga0268265_10019031 | 3300028380 | Bacteria | 4767 |
| 581 | Ga0268265_10064819 | 3300028380 | Bacteria | 2816 |
| 582 | Ga0268264_10058123 | 3300028381 | Bacteria | 3237 |
| 583 | Ga0265326_10003393 | 3300028558 | Bacteria | 5219 |
| 584 | Ga0265323_10021375 | 3300028653 | Bacteria | 2479 |
| 585 | Ga0265336_10000189 | 3300028666 | Bacteria | 42983 |
| 586 | Ga0307515_10000062 | 3300028794 | Bacteria | 247284 |
| 587 | Ga0307515_10000080 | 3300028794 | Bacteria | 224941 |
| 588 | Ga0307515_10000354 | 3300028794 | Bacteria | 112621 |
| 589 | Ga0307515_10000472 | 3300028794 | Bacteria | 96172 |
| 590 | Ga0307515_10005786 | 3300028794 | Bacteria | 24955 |
| 591 | Ga0307515_10007796 | 3300028794 | Bacteria | 21069 |
| 592 | Ga0307515_10009311 | 3300028794 | Bacteria | 19001 |
| 593 | Ga0307515_10011216 | 3300028794 | Bacteria | 17021 |
| 594 | Ga0307515_10016568 | 3300028794 | Bacteria | 13488 |
| 595 | Ga0265324_10000255 | 3300029957 | Bacteria | 39393 |
| 596 | Ga0316178_1128978 | 3300030735 | Bacteria | 5315 |
| 597 | Ga0265330_10000046 | 3300031235 | Bacteria | 108853 |
| 598 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 599 | Ga0265332_10000125 | 3300031238 | Bacteria | 63932 |
| 600 | Ga0265328_10017531 | 3300031239 | Bacteria | 2773 |
| 601 | Ga0265325_10002346 | 3300031241 | Bacteria | 12816 |
| 602 | Ga0265329_10016913 | 3300031242 | Bacteria | 2519 |
| 603 | Ga0265340_10001687 | 3300031247 | Bacteria | 12705 |
| 604 | Ga0265340_10009685 | 3300031247 | Bacteria | 5164 |
| 605 | Ga0265331_10003243 | 3300031250 | Bacteria | 10605 |
| 606 | Ga0265327_10000035 | 3300031251 | Bacteria | 314419 |
| 607 | Ga0265327_10001654 | 3300031251 | Bacteria | 26845 |
| 608 | Ga0307513_10000038 | 3300031456 | Bacteria | 174780 |
| 609 | Ga0307513_10000117 | 3300031456 | Bacteria | 110951 |
| 610 | Ga0307513_10002583 | 3300031456 | Bacteria | 25034 |
| 611 | Ga0307513_10010732 | 3300031456 | Bacteria | 11453 |
| 612 | Ga0307513_10038056 | 3300031456 | Bacteria | 5346 |
| 613 | Ga0307513_10071355 | 3300031456 | Bacteria | 3625 |
| 614 | Ga0307509_10009732 | 3300031507 | Bacteria | 11928 |
| 615 | Ga0307509_10022375 | 3300031507 | Bacteria | 7127 |
| 616 | Ga0307509_10022711 | 3300031507 | Bacteria | 7064 |
| 617 | Ga0307509_10158651 | 3300031507 | Bacteria | 2164 |
| 618 | Ga0307408_100000023 | 3300031548 | Bacteria | 295931 |
| 619 | Ga0307408_100000288 | 3300031548 | Bacteria | 49765 |
| 620 | Ga0307408_100010362 | 3300031548 | Bacteria | 6146 |
| 621 | Ga0265313_10011790 | 3300031595 | Bacteria | 5406 |
| 622 | Ga0307508_10000043 | 3300031616 | Bacteria | 143889 |
| 623 | Ga0307508_10001327 | 3300031616 | Bacteria | 27990 |
| 624 | Ga0307514_10000920 | 3300031649 | Bacteria | 44996 |
| 625 | Ga0307514_10001251 | 3300031649 | Bacteria | 33354 |
| 626 | Ga0307514_10039025 | 3300031649 | Bacteria | 3753 |
| 627 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 628 | Ga0265314_10020486 | 3300031711 | Bacteria | 5105 |
| 629 | Ga0265342_10029842 | 3300031712 | Bacteria | 3383 |
| 630 | Ga0307516_10000419 | 3300031730 | Bacteria | 55599 |
| 631 | Ga0307516_10000953 | 3300031730 | Bacteria | 39905 |
| 632 | Ga0307516_10001691 | 3300031730 | Bacteria | 30381 |
| 633 | Ga0307516_10002244 | 3300031730 | Bacteria | 26100 |
| 634 | Ga0307516_10013442 | 3300031730 | Bacteria | 8723 |
| 635 | Ga0307516_10023184 | 3300031730 | Bacteria | 6367 |
| 636 | Ga0307405_10031497 | 3300031731 | Bacteria | 3123 |
| 637 | Ga0307413_10000632 | 3300031824 | Bacteria | 11881 |
| 638 | Ga0307410_10051516 | 3300031852 | Bacteria | 2775 |
| 639 | Ga0307406_10003957 | 3300031901 | Bacteria | 8050 |
| 640 | Ga0307412_10002540 | 3300031911 | Bacteria | 10145 |
| 641 | Ga0307412_10004338 | 3300031911 | Bacteria | 7909 |
| 642 | Ga0307412_10017947 | 3300031911 | Bacteria | 4245 |
| 643 | Ga0307412_10020847 | 3300031911 | Bacteria | 3995 |
| 644 | Ga0307416_100001338 | 3300032002 | Bacteria | 13277 |
| 645 | Ga0307414_10037938 | 3300032004 | Bacteria | 3231 |
| 646 | Ga0307414_10059660 | 3300032004 | Bacteria | 2695 |
| 647 | Ga0307411_10012273 | 3300032005 | Bacteria | 4666 |
| 648 | Ga0307411_10013355 | 3300032005 | Bacteria | 4529 |
| 649 | Ga0307415_100001083 | 3300032126 | Bacteria | 12652 |
| 650 | Ga0307510_10015886 | 3300033180 | Bacteria | 8895 |
| 651 | Ga0373934_0000310 | 3300035086 | Bacteria | 17068 |
| 652 | Ga0373923_0002599 | 3300035111 | Bacteria | 5599 |
| 653 | Ga0373939_0000049 | 3300035114 | Bacteria | 42693 |
| 654 | Ga0373954_0003740 | 3300035118 | Bacteria | 6488 |
| 655 | Ga0373954_0018487 | 3300035118 | Bacteria | 3138 |
| 656 | Ga0373956_0000428 | 3300035119 | Bacteria | 17130 |
| 657 | Ga0373957_0002458 | 3300035120 | Bacteria | 5295 |
| 658 | Ga0373960_0000732 | 3300035121 | Bacteria | 6852 |
| 659 | Ga0373931_0005852 | 3300035691 | Bacteria | 5721 |
| 660 | Ga0373931_0006014 | 3300035691 | Bacteria | 5645 |
| 661 | Ga0373931_0016960 | 3300035691 | Bacteria | 3593 |
| 662 | Ga0373927_0009270 | 3300035695 | Bacteria | 6602 |
| 663 | Ga0373927_0037422 | 3300035695 | Bacteria | 3154 |
| 664 | Ga0373927_0065810 | 3300035695 | Bacteria | 2344 |
| 665 | Ga0373933_0000632 | 3300035724 | Bacteria | 21965 |
| 666 | Ga0373937_0000371 | 3300036401 | Bacteria | 41765 |
| 667 | Ga0373937_0002072 | 3300036401 | Bacteria | 16775 |
| 668 | Ga0373937_0007893 | 3300036401 | Bacteria | 9225 |
| 669 | Ga0373937_0029221 | 3300036401 | Bacteria | 4992 |
| 670 | Ga0373937_0064984 | 3300036401 | Bacteria | 3358 |
| 671 | Ga0373925_0005227 | 3300037068 | Bacteria | 9704 |
| 672 | Ga0373925_0015085 | 3300037068 | Bacteria | 5584 |
| 673 | Ga0395899_0001042 | 3300037312 | Bacteria | 25161 |
| 674 | Ga0395899_0001609 | 3300037312 | Bacteria | 18889 |
| 675 | Ga0395899_0002916 | 3300037312 | Bacteria | 13742 |
| 676 | Ga0395899_0006534 | 3300037312 | Bacteria | 9035 |
| 677 | Ga0395900_0010547 | 3300037418 | Bacteria | 9452 |
| 678 | Ga0395900_0014177 | 3300037418 | Bacteria | 8139 |
| 679 | Ga0395900_0046894 | 3300037418 | Bacteria | 4449 |
| 680 | Ga0395900_0087907 | 3300037418 | Bacteria | 3194 |
| 681 | Ga0395898_0007278 | 3300037466 | Bacteria | 11750 |
| 682 | Ga0395898_0010814 | 3300037466 | Bacteria | 9535 |
| 683 | Ga0395898_0026413 | 3300037466 | Bacteria | 5842 |
| 684 | Ga0395898_0072168 | 3300037466 | Bacteria | 3335 |
| 685 | Ga0395905_0000088 | 3300037471 | Bacteria | 152506 |
| 686 | Ga0395905_0000151 | 3300037471 | Bacteria | 115485 |
| 687 | Ga0395905_0001245 | 3300037471 | Bacteria | 31535 |
| 688 | Ga0395905_0002471 | 3300037471 | Bacteria | 20474 |
| 689 | Ga0395905_0010063 | 3300037471 | Bacteria | 9219 |
| 690 | Ga0395905_0012026 | 3300037471 | Bacteria | 8346 |
| 691 | Ga0395905_0014382 | 3300037471 | Bacteria | 7560 |
| 692 | Ga0395905_0046455 | 3300037471 | Bacteria | 4071 |
| 693 | Ga0395905_0107688 | 3300037471 | Bacteria | 2616 |
| 694 | Ga0395905_0186914 | 3300037471 | Bacteria | 1944 |
| 695 | Ga0395901_0001368 | 3300038443 | Bacteria | 25522 |
| 696 | Ga0395901_0022718 | 3300038443 | Bacteria | 6431 |
| 697 | Ga0395901_0044230 | 3300038443 | Bacteria | 4618 |
| 698 | Ga0395901_0138953 | 3300038443 | Bacteria | 2553 |
| 699 | Ga0436365_0288397 | 3300039437 | Bacteria | 14975 |
| 700 | Ga0436361_0379569 | 3300039447 | Bacteria | 51728 |
| 701 | Ga0436361_0659667 | 3300039447 | Bacteria | 30667 |
| 702 | Ga0436361_1096550 | 3300039447 | Bacteria | 54500 |
| 703 | Ga0439436_0000328 | 3300041404 | Bacteria | 11648 |
| 704 | Ga0439436_0003547 | 3300041404 | Bacteria | 4742 |
| 705 | Ga0451853_1861682 | 3300041512 | Bacteria | 2574 |
| 706 | Ga0439431_0003865 | 3300041997 | Bacteria | 3306 |
| 707 | Ga0439441_002858 | 3300042001 | Bacteria | 2475 |
| 708 | Ga0439442_004178 | 3300042002 | Bacteria | 2861 |
| 709 | Ga0439432_001277 | 3300042006 | Bacteria | 9513 |
| 710 | Ga0439449_0001202 | 3300042007 | Bacteria | 10165 |
| 711 | Ga0439449_0002870 | 3300042007 | Bacteria | 6698 |
| 712 | Ga0439452_009710 | 3300042010 | Bacteria | 2827 |
| 713 | Ga0439457_007647 | 3300042014 | Bacteria | 2588 |
| 714 | Ga0439462_0000369 | 3300042015 | Bacteria | 8594 |
| 715 | Ga0450919_002729 | 3300042121 | Bacteria | 2274 |
| 716 | Ga0450888_000115 | 3300042126 | Bacteria | 6339 |
| 717 | Ga0450888_001171 | 3300042126 | Bacteria | 2503 |
| 718 | Ga0450898_003983 | 3300042134 | Bacteria | 2157 |
| 719 | Ga0450889_000093 | 3300042144 | Bacteria | 8414 |
| 720 | Ga0439434_0008547 | 3300042435 | Bacteria | 3004 |
| 721 | Ga0450918_000202 | 3300042531 | Bacteria | 13469 |
| 722 | Ga0450918_000496 | 3300042531 | Bacteria | 8444 |
| 723 | Ga0450893_0000411 | 3300042532 | Bacteria | 6020 |
| 724 | Ga0451577_0000276 | 3300042876 | Bacteria | 99531 |
| 725 | Ga0451577_0002525 | 3300042876 | Bacteria | 21654 |
| 726 | Ga0451577_0003457 | 3300042876 | Bacteria | 17574 |
| 727 | Ga0451577_0005175 | 3300042876 | Bacteria | 13417 |
| 728 | Ga0451577_0010787 | 3300042876 | Bacteria | 8691 |
| 729 | Ga0451577_0067099 | 3300042876 | Bacteria | 3199 |
| 730 | Ga0451577_0089792 | 3300042876 | Bacteria | 2742 |
| 731 | Ga0451577_0176299 | 3300042876 | Bacteria | 1927 |
| 732 | Ga0466969_0000008 | 3300044656 | Bacteria | 139607 |
| 733 | Ga0466969_0003553 | 3300044656 | Bacteria | 8290 |
| 734 | Ga0466969_0017106 | 3300044656 | Bacteria | 3789 |
| 735 | Ga0453683_0012151 | 3300044673 | Bacteria | 5651 |
| 736 | Ga0466966_0008926 | 3300044684 | Bacteria | 6643 |
| 737 | Ga0466966_0075894 | 3300044684 | Bacteria | 2099 |
| 738 | Ga0466961_0093141 | 3300044693 | Bacteria | 1901 |
| 739 | Ga0453684_0000891 | 3300044712 | Bacteria | 99637 |
| 740 | Ga0453684_0012524 | 3300044712 | Bacteria | 13964 |
| 741 | Ga0453684_0032467 | 3300044712 | Bacteria | 7306 |
| 742 | Ga0453684_0036305 | 3300044712 | Bacteria | 6793 |
| 743 | Ga0453684_0099280 | 3300044712 | Bacteria | 3567 |
| 744 | Ga0466970_0003291 | 3300044765 | Bacteria | 7849 |
| 745 | Ga0466957_0006607 | 3300044842 | Bacteria | 6559 |
| 746 | Ga0466959_0000192 | 3300045049 | Bacteria | 40028 |
| 747 | Ga0466959_0054865 | 3300045049 | Bacteria | 2910 |
| 748 | Ga0451576_0002088 | 3300045051 | Bacteria | 31196 |
| 749 | Ga0451576_0002262 | 3300045051 | Bacteria | 29416 |
| 750 | Ga0451576_0004706 | 3300045051 | Bacteria | 17540 |
| 751 | Ga0451576_0005888 | 3300045051 | Bacteria | 15217 |
| 752 | Ga0451576_0006277 | 3300045051 | Bacteria | 14626 |
| 753 | Ga0451576_0008890 | 3300045051 | Bacteria | 11723 |
| 754 | Ga0451576_0016732 | 3300045051 | Bacteria | 8088 |
| 755 | Ga0451576_0078500 | 3300045051 | Bacteria | 3435 |
| 756 | Ga0451576_0097369 | 3300045051 | Bacteria | 3059 |
| 757 | Ga0451576_0127338 | 3300045051 | Bacteria | 2653 |
| 758 | Ga0451576_0132818 | 3300045051 | Bacteria | 2595 |
| 759 | Ga0466967_0052889 | 3300045976 | Bacteria | 3567 |
| 760 | Ga0466967_0205526 | 3300045976 | Bacteria | 1866 |
| 761 | Ga0495592_0017214 | 3300046454 | Bacteria | 5489 |
| 762 | Ga0495590_0000692 | 3300046457 | Bacteria | 15462 |
| 763 | Ga0495629_0126869 | 3300046459 | Bacteria | 1778 |
| 764 | Ga0495638_0026584 | 3300046460 | Bacteria | 3750 |
| 765 | Ga0495651_0000056 | 3300046462 | Bacteria | 83191 |
| 766 | Ga0495650_0003376 | 3300046471 | Bacteria | 11697 |
| 767 | Ga0495607_0000077 | 3300046501 | Bacteria | 99190 |
| 768 | Ga0495583_0001389 | 3300046506 | Bacteria | 24734 |
| 769 | Ga0495606_0002457 | 3300046507 | Bacteria | 21484 |
| 770 | Ga0495630_0106738 | 3300046517 | Bacteria | 2121 |
| 771 | Ga0495631_0015547 | 3300046518 | Bacteria | 3643 |
| 772 | Ga0495637_0006661 | 3300046520 | Bacteria | 5783 |
| 773 | Ga0495643_0001057 | 3300046522 | Bacteria | 27702 |
| 774 | Ga0495643_0045929 | 3300046522 | Bacteria | 2370 |
| 775 | Ga0495642_0009294 | 3300046528 | Bacteria | 3764 |
| 776 | Ga0495598_0002799 | 3300046537 | Bacteria | 3629 |
| 777 | Ga0495621_0001916 | 3300046539 | Bacteria | 5473 |
| 778 | Ga0495621_0004193 | 3300046539 | Bacteria | 4027 |
| 779 | Ga0495597_0001315 | 3300046542 | Bacteria | 18215 |
| 780 | Ga0495597_0016711 | 3300046542 | Bacteria | 3463 |
| 781 | Ga0495633_0000563 | 3300046558 | Bacteria | 36212 |
| 782 | Ga0495667_0011307 | 3300046559 | Bacteria | 6041 |
| 783 | Ga0495656_0000090 | 3300046615 | Bacteria | 39387 |
| 784 | Ga0495625_0001055 | 3300046660 | Bacteria | 36138 |
| 785 | Ga0495625_0003495 | 3300046660 | Bacteria | 15582 |
| 786 | Ga0495625_0022664 | 3300046660 | Bacteria | 4810 |
| 787 | Ga0495661_0001454 | 3300046665 | Bacteria | 19827 |
| 788 | Ga0495661_0036631 | 3300046665 | Bacteria | 3069 |
| 789 | Ga0495588_0021039 | 3300046674 | Bacteria | 3211 |
| 790 | Ga0495657_0008024 | 3300046675 | Bacteria | 8095 |
| 791 | Ga0495657_0014304 | 3300046675 | Bacteria | 5827 |
| 792 | Ga0495649_0006470 | 3300046694 | Bacteria | 7292 |
| 793 | Ga0495581_0049726 | 3300047315 | Bacteria | 2421 |
| 794 | Ga0495636_0010809 | 3300047318 | Bacteria | 3609 |
| 795 | Ga0495676_0022211 | 3300047321 | Bacteria | 5526 |
| 796 | Ga0495687_000705 | 3300047443 | Bacteria | 37210 |
| 797 | Ga0495687_001104 | 3300047443 | Bacteria | 26257 |
| 798 | Ga0495687_012963 | 3300047443 | Bacteria | 4375 |
| 799 | Ga0495686_0020162 | 3300047472 | Bacteria | 4448 |
| 800 | Ga0495593_0008709 | 3300047673 | Bacteria | 5893 |
| 801 | Ga0495626_0047399 | 3300048091 | Bacteria | 1998 |
| 802 | Ga0496101_0001103 | 3300048904 | Bacteria | 16042 |
| 803 | Ga0496101_0033330 | 3300048904 | Bacteria | 3632 |
| 804 | Ga0496102_0006320 | 3300048905 | Bacteria | 10101 |
| 805 | Ga0496102_0028049 | 3300048905 | Bacteria | 5030 |
| 806 | Ga0496102_0137639 | 3300048905 | Bacteria | 2288 |
| 807 | Ga0496103_0015500 | 3300048906 | Bacteria | 4537 |
| 808 | Ga0496104_0035582 | 3300048907 | Bacteria | 4649 |
| 809 | Ga0496105_0010700 | 3300048908 | Bacteria | 7220 |
| 810 | Ga0496106_0009063 | 3300048909 | Bacteria | 7356 |
| 811 | Ga0496108_0063116 | 3300048911 | Bacteria | 3119 |
| 812 | Ga0496110_0032173 | 3300048913 | Bacteria | 4528 |
| 813 | Ga0496110_0059350 | 3300048913 | Bacteria | 3372 |
| 814 | Ga0496111_0027762 | 3300048914 | Bacteria | 4008 |
| 815 | Ga0496111_0036314 | 3300048914 | Bacteria | 3523 |
| 816 | Ga0496113_0002861 | 3300048916 | Bacteria | 10158 |
| 817 | Ga0496114_0003154 | 3300048917 | Bacteria | 12645 |
| 818 | Ga0496116_0017023 | 3300048919 | Bacteria | 5663 |
| 819 | Ga0496118_0020181 | 3300048921 | Bacteria | 5920 |
| 820 | Ga0496118_0072564 | 3300048921 | Bacteria | 2471 |
| 821 | Ga0496118_0074755 | 3300048921 | Bacteria | 2420 |
| 822 | Ga0496120_0009161 | 3300048923 | Bacteria | 7058 |
| 823 | Ga0496121_0000748 | 3300048924 | Bacteria | 59722 |
| 824 | Ga0496121_0010814 | 3300048924 | Bacteria | 10220 |
| 825 | Ga0496121_0015844 | 3300048924 | Bacteria | 7839 |
| 826 | Ga0496122_0003683 | 3300048925 | Bacteria | 19870 |
| 827 | Ga0496122_0020165 | 3300048925 | Bacteria | 6045 |
| 828 | Ga0496123_0000274 | 3300048926 | Bacteria | 101783 |
| 829 | Ga0496123_0001818 | 3300048926 | Bacteria | 28065 |
| 830 | Ga0496124_0000085 | 3300048927 | Bacteria | 203358 |
| 831 | Ga0496124_0001458 | 3300048927 | Bacteria | 34900 |
| 832 | Ga0496124_0153442 | 3300048927 | Bacteria | 1804 |
| 833 | Ga0496125_0000096 | 3300048928 | Bacteria | 205618 |
| 834 | Ga0496125_0026863 | 3300048928 | Bacteria | 5229 |
| 835 | Ga0496125_0128150 | 3300048928 | Bacteria | 1793 |
| 836 | Ga0496126_0151880 | 3300048929 | Bacteria | 1984 |
| 837 | Ga0501290_001523 | 3300049513 | Bacteria | 3159 |
| 838 | Ga0501296_000042 | 3300049519 | Bacteria | 14294 |
| 839 | Ga0501298_000161 | 3300049521 | Bacteria | 8197 |
| 840 | Ga0501299_000093 | 3300049522 | Bacteria | 10085 |
| 841 | Ga0501300_000410 | 3300049523 | Bacteria | 6488 |
| 842 | Ga0501303_000396 | 3300049526 | Bacteria | 3531 |
| 843 | Ga0501031_0000700 | 3300049568 | Bacteria | 20005 |
| 844 | Ga0501031_0003842 | 3300049568 | Bacteria | 9658 |
| 845 | Ga0501031_0004863 | 3300049568 | Bacteria | 8732 |
| 846 | Ga0501031_0054541 | 3300049568 | Bacteria | 2604 |
| 847 | Ga0501032_0070157 | 3300049569 | Bacteria | 2337 |
| 848 | Ga0501032_0082065 | 3300049569 | Bacteria | 2145 |
| 849 | Ga0501034_0003551 | 3300049571 | Bacteria | 17718 |
| 850 | Ga0501034_0026198 | 3300049571 | Bacteria | 5938 |
| 851 | Ga0501034_0055505 | 3300049571 | Bacteria | 3986 |
| 852 | Ga0501036_0091325 | 3300049572 | Bacteria | 2572 |
| 853 | Ga0501036_0106069 | 3300049572 | Bacteria | 2376 |
| 854 | Ga0501037_0002732 | 3300049573 | Bacteria | 12753 |
| 855 | Ga0501037_0004035 | 3300049573 | Bacteria | 10647 |
| 856 | Ga0501038_0017115 | 3300049574 | Bacteria | 6557 |
| 857 | Ga0501038_0142476 | 3300049574 | Bacteria | 1960 |
| 858 | Ga0501039_0000791 | 3300049575 | Bacteria | 22772 |
| 859 | Ga0501039_0013071 | 3300049575 | Bacteria | 6347 |
| 860 | Ga0501039_0018624 | 3300049575 | Bacteria | 5331 |
| 861 | Ga0501041_0000673 | 3300049577 | Bacteria | 18097 |
| 862 | Ga0501041_0011125 | 3300049577 | Bacteria | 5313 |
| 863 | Ga0501041_0028140 | 3300049577 | Bacteria | 3389 |
| 864 | Ga0501042_0050132 | 3300049578 | Bacteria | 2977 |
| 865 | Ga0501043_0000180 | 3300049579 | Bacteria | 56892 |
| 866 | Ga0501043_0061084 | 3300049579 | Bacteria | 2960 |
| 867 | Ga0501046_0000226 | 3300049580 | Bacteria | 58757 |
| 868 | Ga0501046_0002279 | 3300049580 | Bacteria | 18097 |
| 869 | Ga0501046_0017038 | 3300049580 | Bacteria | 6073 |
| 870 | Ga0501046_0049405 | 3300049580 | Bacteria | 3327 |
| 871 | Ga0501047_0000302 | 3300049581 | Bacteria | 56851 |
| 872 | Ga0501047_0014004 | 3300049581 | Bacteria | 7622 |
| 873 | Ga0501048_0000196 | 3300049582 | Bacteria | 39241 |
| 874 | Ga0501048_0002019 | 3300049582 | Bacteria | 15408 |
| 875 | Ga0501048_0025471 | 3300049582 | Bacteria | 4311 |
| 876 | Ga0501068_0030482 | 3300049584 | Bacteria | 3200 |
| 877 | Ga0501071_0038858 | 3300049587 | Bacteria | 3402 |
| 878 | Ga0501072_0043487 | 3300049588 | Bacteria | 3530 |
| 879 | Ga0501075_0016267 | 3300049591 | Bacteria | 5356 |
| 880 | Ga0501075_0052937 | 3300049591 | Bacteria | 3052 |
| 881 | Ga0501076_0007458 | 3300049592 | Bacteria | 7963 |
| 882 | Ga0501076_0061958 | 3300049592 | Bacteria | 2978 |
| 883 | Ga0501076_0186821 | 3300049592 | Bacteria | 1690 |
| 884 | Ga0501198_000012 | 3300049649 | Bacteria | 113529 |
| 885 | Ga0501201_000043 | 3300049651 | Bacteria | 8490 |
| 886 | Ga0501202_001962 | 3300049652 | Bacteria | 3391 |
| 887 | Ga0501222_000010 | 3300049662 | Bacteria | 113536 |
| 888 | Ga0501227_002638 | 3300049665 | Bacteria | 3936 |
| 889 | Ga0501230_002063 | 3300049667 | Bacteria | 2517 |
| 890 | Ga0501233_000054 | 3300049668 | Bacteria | 15155 |
| 891 | Ga0501236_001251 | 3300049670 | Bacteria | 2880 |
| 892 | Ga0501255_000522 | 3300049684 | Bacteria | 2671 |
| 893 | Ga0501261_001125 | 3300049690 | Bacteria | 3276 |
| 894 | Ga0501221_002698 | 3300049704 | Bacteria | 2919 |
| 895 | Ga0501225_0000934 | 3300049705 | Bacteria | 9104 |
| 896 | Ga0501234_000329 | 3300049707 | Bacteria | 6954 |
| 897 | Ga0501079_0027487 | 3300049741 | Bacteria | 4362 |
| 898 | Ga0501080_0032607 | 3300049742 | Bacteria | 4859 |
| 899 | Ga0501080_0224824 | 3300049742 | Bacteria | 1717 |
| 900 | Ga0501081_0051795 | 3300049743 | Bacteria | 2831 |
| 901 | Ga0501081_0085962 | 3300049743 | Bacteria | 2208 |
| 902 | Ga0501264_000432 | 3300049761 | Bacteria | 6466 |
| 903 | Ga0501266_001186 | 3300049763 | Bacteria | 3332 |
| 904 | Ga0501283_000047 | 3300049779 | Bacteria | 15101 |
| 905 | Ga0501035_0004768 | 3300049822 | Bacteria | 12874 |
| 906 | Ga0501035_0006589 | 3300049822 | Bacteria | 10874 |
| 907 | Ga0501035_0034462 | 3300049822 | Bacteria | 4600 |
| 908 | Ga0501035_0052163 | 3300049822 | Bacteria | 3660 |
| 909 | Ga0501035_0080452 | 3300049822 | Bacteria | 2877 |
| 910 | Ga0501044_0001142 | 3300049823 | Bacteria | 31447 |
| 911 | Ga0501044_0002263 | 3300049823 | Bacteria | 21955 |
| 912 | Ga0501045_0009382 | 3300049824 | Bacteria | 6842 |
| 913 | Ga0501045_0029894 | 3300049824 | Bacteria | 3940 |
| 914 | Ga0501226_000633 | 3300049853 | Bacteria | 4819 |
| 915 | nmdc:mga03n38_5586_c1 | 3300050490 | Bacteria | 4294 |
| 916 | nmdc:mga00v17_76928_c1 | 3300050491 | Bacteria | 2077 |
| 917 | nmdc:mga0k408_10294_c1 | 3300050493 | Bacteria | 3361 |
| 918 | nmdc:mga0k408_14915_c1 | 3300050493 | Bacteria | 4291 |
| 919 | nmdc:mga0k408_1770_c1 | 3300050493 | Bacteria | 11584 |
| 920 | nmdc:mga0k408_19088_c1 | 3300050493 | Bacteria | 3829 |
| 921 | nmdc:mga0k408_2369_c1 | 3300050493 | Bacteria | 10026 |
| 922 | nmdc:mga0k408_23982_c1 | 3300050493 | Bacteria | 3446 |
| 923 | nmdc:mga0k408_25087_c1 | 3300050493 | Bacteria | 3374 |
| 924 | nmdc:mga0k408_254_c1 | 3300050493 | Bacteria | 29029 |
| 925 | nmdc:mga0k408_40618_c1 | 3300050493 | Bacteria | 2678 |
| 926 | nmdc:mga0k408_42876_c1 | 3300050493 | Bacteria | 2606 |
| 927 | nmdc:mga0k408_46880_c1 | 3300050493 | Bacteria | 2497 |
| 928 | nmdc:mga0k408_68579_c1 | 3300050493 | Bacteria | 2069 |
| 929 | nmdc:mga06z11_49102_c1 | 3300050494 | Bacteria | 2151 |
| 930 | nmdc:mga04h51_14278_c1 | 3300050495 | Bacteria | 2266 |
| 931 | nmdc:mga07m45_1683_c1 | 3300050496 | Bacteria | 10177 |
| 932 | nmdc:mga07m45_31899_c1 | 3300050496 | Bacteria | 2921 |
| 933 | nmdc:mga07m45_3705_c1 | 3300050496 | Bacteria | 7393 |
| 934 | nmdc:mga07m45_4400_c1 | 3300050496 | Bacteria | 6895 |
| 935 | nmdc:mga07m45_4458_c1 | 3300050496 | Bacteria | 6853 |
| 936 | nmdc:mga07m45_9703_c2 | 3300050496 | Bacteria | 2811 |
| 937 | nmdc:mga05p37_291_c1 | 3300050507 | Bacteria | 52424 |
| 938 | nmdc:mga05p37_53820_c1 | 3300050507 | Bacteria | 4951 |
| 939 | nmdc:mga09592_12531_c1 | 3300050508 | Bacteria | 6909 |
| 940 | nmdc:mga09592_17097_c1 | 3300050508 | Bacteria | 5938 |
| 941 | nmdc:mga09592_88_c1 | 3300050508 | Bacteria | 54764 |
| 942 | nmdc:mga0qj67_20366_c1 | 3300050509 | Bacteria | 5076 |
| 943 | nmdc:mga06r32_10377_c1 | 3300050510 | Bacteria | 8404 |
| 944 | nmdc:mga06r32_1676_c1 | 3300050510 | Bacteria | 19991 |
| 945 | nmdc:mga08y16_22832_c1 | 3300050511 | Bacteria | 6603 |
| 946 | nmdc:mga0n895_151349_c1 | 3300050512 | Bacteria | 2351 |
| 947 | nmdc:mga0rr50_23697_c1 | 3300050513 | Bacteria | 4239 |
| 948 | nmdc:mga08x19_38138_c1 | 3300050514 | Bacteria | 3052 |
| 949 | nmdc:mga08x19_5935_c1 | 3300050514 | Bacteria | 7226 |
| 950 | nmdc:mga0a205_19495_c1 | 3300050515 | Bacteria | 6396 |
| 951 | nmdc:mga0a205_49952_c1 | 3300050515 | Bacteria | 4038 |
| 952 | Ga0500635_0000210 | 3300053080 | Bacteria | 28403 |
| 953 | Ga0500578_0001060 | 3300053086 | Bacteria | 29908 |
| 954 | Ga0500643_000672 | 3300053087 | Bacteria | 22896 |
| 955 | Ga0500651_0000400 | 3300053093 | Bacteria | 23590 |
| 956 | Ga0500571_000129 | 3300053110 | Bacteria | 25327 |
| 957 | Ga0500593_000579 | 3300053117 | Bacteria | 14064 |
| 958 | Ga0500593_002479 | 3300053117 | Bacteria | 6777 |
| 959 | Ga0500594_0006398 | 3300053118 | Bacteria | 2644 |
| 960 | Ga0500652_000299 | 3300053131 | Bacteria | 18083 |
| 961 | Ga0500658_0002393 | 3300053134 | Bacteria | 7265 |
| 962 | Ga0500658_0003299 | 3300053134 | Bacteria | 6124 |
| 963 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 964 | Ga0500568_0000554 | 3300053139 | Bacteria | 27551 |
| 965 | Ga0500568_0002287 | 3300053139 | Bacteria | 11411 |
| 966 | Ga0500590_006655 | 3300053148 | Bacteria | 5644 |
| 967 | Ga0500616_0019210 | 3300053153 | Bacteria | 3853 |
| 968 | Ga0500619_000127 | 3300053154 | Bacteria | 19880 |
| 969 | Ga0500622_0000125 | 3300053156 | Bacteria | 81109 |
| 970 | Ga0500622_0000788 | 3300053156 | Bacteria | 27492 |
| 971 | Ga0500622_0003254 | 3300053156 | Bacteria | 11016 |
| 972 | Ga0500636_0010430 | 3300053177 | Bacteria | 5421 |
| 973 | Ga0590071_001922 | 3300059421 | Bacteria | 5321 |
| 974 | Ga0466962_0029616 | 3300061719 | Bacteria | 2620 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0126869 | Ga0495629_0126869_21_1406 | 460 |
| 2 | 3300045976 | Ga0466967_0205526 | Ga0466967_0205526_16_1554 | 505 |
| 3 | 3300037418 | Ga0395900_0014177 | Ga0395900_0014177_12_1547 | 510 |
| 4 | 3300042876 | Ga0451577_0010787 | Ga0451577_0010787_5160_6905 | 510 |
| 5 | 3300045051 | Ga0451576_0078500 | Ga0451576_0078500_573_2318 | 510 |
| 6 | 3300045051 | Ga0451576_0097369 | Ga0451576_0097369_26_1582 | 512 |
| 7 | 3300006195 | Ga0075366_10010444 | Ga0075366_100104443 | 520 |
| 8 | 3300050493 | nmdc:mga0k408_46880_c1 | nmdc:mga0k408_46880_c1_620_2365 | 520 |
| 9 | iso_pu_bacteria | 2901300506 | 2901305434 | 533 |
| 10 | 3300046518 | Ga0495631_0015547 | Ga0495631_0015547_960_2582 | 534 |
| 11 | 3300049742 | Ga0501080_0224824 | Ga0501080_0224824_31_1647 | 535 |
| 12 | 3300049763 | Ga0501266_001186 | Ga0501266_001186_1712_3322 | 536 |
| 13 | 3300036401 | Ga0373937_0029221 | Ga0373937_0029221_2986_4599 | 537 |
| 14 | 3300047472 | Ga0495686_0020162 | Ga0495686_0020162_1948_3693 | 537 |
| 15 | 3300053080 | Ga0500635_0000210 | Ga0500635_0000210_6723_8468 | 537 |
| 16 | 3300021361 | Ga0213872_10001156 | Ga0213872_1000115610 | 538 |
| 17 | 3300039447 | Ga0436361_0659667 | Ga0436361_0659667_4220_6001 | 538 |
| 18 | 3300050493 | nmdc:mga0k408_68579_c1 | nmdc:mga0k408_68579_c1_11_1630 | 538 |
| 19 | 3300005327 | Ga0070658_10064689 | Ga0070658_100646893 | 539 |
| 20 | 3300025256 | Ga0209759_1003989 | Ga0209759_10039892 | 539 |
| 21 | 3300049592 | Ga0501076_0186821 | Ga0501076_0186821_40_1677 | 539 |
| 22 | 3300050512 | nmdc:mga0n895_151349_c1 | nmdc:mga0n895_151349_c1_688_2325 | 539 |
| 23 | 3300005366 | Ga0070659_100060132 | Ga0070659_1000601321 | 540 |
| 24 | 3300005549 | Ga0070704_100001426 | Ga0070704_1000014262 | 540 |
| 25 | 3300037471 | Ga0395905_0107688 | Ga0395905_0107688_97_1842 | 540 |
| 26 | 3300047315 | Ga0495581_0049726 | Ga0495581_0049726_707_2332 | 540 |
| 27 | 3300050509 | nmdc:mga0qj67_20366_c1 | nmdc:mga0qj67_20366_c1_2115_3740 | 540 |
| 28 | 3300006353 | Ga0075370_10002426 | Ga0075370_100024268 | 541 |
| 29 | 3300031239 | Ga0265328_10017531 | Ga0265328_100175313 | 541 |
| 30 | 3300031250 | Ga0265331_10003243 | Ga0265331_100032437 | 541 |
| 31 | 3300031251 | Ga0265327_10000035 | Ga0265327_10000035240 | 541 |
| 32 | 3300031730 | Ga0307516_10000419 | Ga0307516_100004199 | 541 |
| 33 | 3300050514 | nmdc:mga08x19_5935_c1 | nmdc:mga08x19_5935_c1_1833_3524 | 545 |
| 34 | iso_pu_bacteria | 2857542790 | 2857542810 | 545 |
| 35 | 3300031595 | Ga0265313_10011790 | Ga0265313_100117903 | 546 |
| 36 | 3300031712 | Ga0265342_10029842 | Ga0265342_100298421 | 546 |
| 37 | 3300028666 | Ga0265336_10000189 | Ga0265336_1000018910 | 548 |
| 38 | 3300029957 | Ga0265324_10000255 | Ga0265324_100002556 | 548 |
| 39 | 3300025245 | Ga0207425_1003474 | Ga0207425_10034742 | 550 |
| 40 | 3300025297 | Ga0209758_1000456 | Ga0209758_10004567 | 550 |
| 41 | 3300044693 | Ga0466961_0093141 | Ga0466961_0093141_182_1861 | 550 |
| 42 | 3300025909 | Ga0207705_10064175 | Ga0207705_100641752 | 551 |
| 43 | 3300028653 | Ga0265323_10021375 | Ga0265323_100213752 | 551 |
| 44 | 3300042876 | Ga0451577_0005175 | Ga0451577_0005175_3626_5341 | 551 |
| 45 | 3300044673 | Ga0453683_0012151 | Ga0453683_0012151_3035_4750 | 551 |
| 46 | 3300044712 | Ga0453684_0012524 | Ga0453684_0012524_1567_3282 | 551 |
| 47 | 3300045051 | Ga0451576_0006277 | Ga0451576_0006277_8818_10533 | 551 |
| 48 | 3300031852 | Ga0307410_10051516 | Ga0307410_100515161 | 553 |
| 49 | 3300035086 | Ga0373934_0000310 | Ga0373934_0000310_7696_9402 | 553 |
| 50 | 3300035119 | Ga0373956_0000428 | Ga0373956_0000428_10388_12094 | 553 |
| 51 | 3300035120 | Ga0373957_0002458 | Ga0373957_0002458_952_2658 | 553 |
| 52 | 3300035724 | Ga0373933_0000632 | Ga0373933_0000632_8168_9874 | 553 |
| 53 | 3300036401 | Ga0373937_0000371 | Ga0373937_0000371_38792_40498 | 553 |
| 54 | 3300046462 | Ga0495651_0000056 | Ga0495651_0000056_67299_69005 | 553 |
| 55 | 3300046675 | Ga0495657_0014304 | Ga0495657_0014304_2595_4301 | 553 |
| 56 | 3300003771 | Ga0055526_1010839 | Ga0055526_10108391 | 555 |
| 57 | 3300006195 | Ga0075366_10006507 | Ga0075366_100065077 | 555 |
| 58 | 3300013306 | Ga0163162_10119727 | Ga0163162_101197273 | 555 |
| 59 | 3300014969 | Ga0157376_10000954 | Ga0157376_100009548 | 555 |
| 60 | 3300015262 | Ga0182007_10017245 | Ga0182007_100172453 | 555 |
| 61 | 3300028558 | Ga0265326_10003393 | Ga0265326_100033933 | 555 |
| 62 | 3300031247 | Ga0265340_10001687 | Ga0265340_100016876 | 555 |
| 63 | 3300042876 | Ga0451577_0089792 | Ga0451577_0089792_14_1684 | 555 |
| 64 | 3300044656 | Ga0466969_0017106 | Ga0466969_0017106_16_1758 | 555 |
| 65 | 3300044684 | Ga0466966_0008926 | Ga0466966_0008926_4809_6551 | 555 |
| 66 | 3300046539 | Ga0495621_0004193 | Ga0495621_0004193_891_2564 | 555 |
| 67 | 3300048927 | Ga0496124_0153442 | Ga0496124_0153442_111_1787 | 555 |
| 68 | 3300049569 | Ga0501032_0070157 | Ga0501032_0070157_29_1699 | 555 |
| 69 | 3300053118 | Ga0500594_0006398 | Ga0500594_0006398_821_2494 | 555 |
| 70 | 3300053134 | Ga0500658_0002393 | Ga0500658_0002393_5323_6993 | 555 |
| 71 | 3300053139 | Ga0500568_0000554 | Ga0500568_0000554_21856_23526 | 555 |
| 72 | 3300053153 | Ga0500616_0019210 | Ga0500616_0019210_308_1978 | 555 |
| 73 | 3300053087 | Ga0500643_000672 | Ga0500643_000672_5060_6766 | 556 |
| 74 | 3300053139 | Ga0500568_0002287 | Ga0500568_0002287_162_1868 | 556 |
| 75 | 3300005330 | Ga0070690_100023747 | Ga0070690_1000237473 | 557 |
| 76 | 3300005334 | Ga0068869_100037918 | Ga0068869_1000379183 | 557 |
| 77 | 3300005617 | Ga0068859_100007249 | Ga0068859_1000072495 | 557 |
| 78 | 3300005719 | Ga0068861_100060362 | Ga0068861_1000603622 | 557 |
| 79 | 3300005842 | Ga0068858_100069799 | Ga0068858_1000697993 | 557 |
| 80 | 3300006931 | Ga0097620_100007249 | Ga0097620_10000724910 | 557 |
| 81 | 3300009176 | Ga0105242_10027648 | Ga0105242_100276486 | 557 |
| 82 | 3300014745 | Ga0157377_10004958 | Ga0157377_100049587 | 557 |
| 83 | 3300025942 | Ga0207689_10115183 | Ga0207689_101151832 | 557 |
| 84 | 3300026023 | Ga0207677_10050975 | Ga0207677_100509752 | 557 |
| 85 | 3300026035 | Ga0207703_10045165 | Ga0207703_100451653 | 557 |
| 86 | 3300038443 | Ga0395901_0001368 | Ga0395901_0001368_4436_6181 | 557 |
| 87 | 3300048909 | Ga0496106_0009063 | Ga0496106_0009063_5476_7218 | 557 |
| 88 | 3300050493 | nmdc:mga0k408_25087_c1 | nmdc:mga0k408_25087_c1_316_2061 | 557 |
| 89 | 3300031507 | Ga0307509_10158651 | Ga0307509_101586512 | 559 |
| 90 | 3300049582 | Ga0501048_0025471 | Ga0501048_0025471_2598_4298 | 559 |
| 91 | 3300049670 | Ga0501236_001251 | Ga0501236_001251_492_2180 | 559 |
| 92 | 3300003761 | Ga0055535_1001368 | Ga0055535_10013684 | 560 |
| 93 | 3300003763 | Ga0055529_1000661 | Ga0055529_100066111 | 560 |
| 94 | 3300009147 | Ga0114129_10104273 | Ga0114129_101042732 | 560 |
| 95 | 3300025242 | Ga0209258_100666 | Ga0209258_10066617 | 560 |
| 96 | 3300025256 | Ga0209759_1001392 | Ga0209759_100139212 | 560 |
| 97 | 3300025272 | Ga0209455_1000569 | Ga0209455_100056917 | 560 |
| 98 | 3300025944 | Ga0207661_10068893 | Ga0207661_100688932 | 560 |
| 99 | 3300026142 | Ga0207698_10087550 | Ga0207698_100875501 | 560 |
| 100 | 3300045051 | Ga0451576_0016732 | Ga0451576_0016732_5994_7739 | 560 |
| 101 | 3300053177 | Ga0500636_0010430 | Ga0500636_0010430_481_2226 | 560 |
| 102 | 3300031911 | Ga0307412_10020847 | Ga0307412_100208473 | 561 |
| 103 | 3300041404 | Ga0439436_0003547 | Ga0439436_0003547_346_2091 | 561 |
| 104 | 3300041512 | Ga0451853_1861682 | Ga0451853_1861682_289_2034 | 561 |
| 105 | 3300042007 | Ga0439449_0002870 | Ga0439449_0002870_1836_3581 | 561 |
| 106 | 3300042010 | Ga0439452_009710 | Ga0439452_009710_564_2309 | 561 |
| 107 | 3300042015 | Ga0439462_0000369 | Ga0439462_0000369_3512_5257 | 561 |
| 108 | 3300042134 | Ga0450898_003983 | Ga0450898_003983_146_1891 | 561 |
| 109 | 3300042876 | Ga0451577_0002525 | Ga0451577_0002525_10323_12068 | 561 |
| 110 | 3300005331 | Ga0070670_100041149 | Ga0070670_1000411492 | 562 |
| 111 | 3300006946 | Ga0079104_1000055 | Ga0079104_100005539 | 562 |
| 112 | 3300009092 | Ga0105250_10001192 | Ga0105250_100011927 | 562 |
| 113 | 3300009148 | Ga0105243_10002600 | Ga0105243_100026009 | 562 |
| 114 | 3300025711 | Ga0207696_1001691 | Ga0207696_10016917 | 562 |
| 115 | 3300025922 | Ga0207646_10129928 | Ga0207646_101299282 | 562 |
| 116 | 3300025925 | Ga0207650_10014392 | Ga0207650_100143923 | 562 |
| 117 | 3300025935 | Ga0207709_10000111 | Ga0207709_1000011188 | 562 |
| 118 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007790 | 562 |
| 119 | 3300005334 | Ga0068869_100016954 | Ga0068869_1000169544 | 563 |
| 120 | 3300005338 | Ga0068868_100001584 | Ga0068868_10000158418 | 563 |
| 121 | 3300005354 | Ga0070675_100036240 | Ga0070675_1000362402 | 563 |
| 122 | 3300009147 | Ga0114129_10012020 | Ga0114129_100120207 | 563 |
| 123 | 3300014969 | Ga0157376_10011066 | Ga0157376_100110662 | 563 |
| 124 | 3300025942 | Ga0207689_10000709 | Ga0207689_1000070919 | 563 |
| 125 | 3300026088 | Ga0207641_10106387 | Ga0207641_101063872 | 563 |
| 126 | 3300026118 | Ga0207675_100000563 | Ga0207675_10000056319 | 563 |
| 127 | 3300048914 | Ga0496111_0036314 | Ga0496111_0036314_131_1873 | 563 |
| 128 | 3300005328 | Ga0070676_10003268 | Ga0070676_100032682 | 564 |
| 129 | 3300005331 | Ga0070670_100001784 | Ga0070670_10000178417 | 564 |
| 130 | 3300005334 | Ga0068869_100002674 | Ga0068869_1000026743 | 564 |
| 131 | 3300005336 | Ga0070680_100002947 | Ga0070680_1000029475 | 564 |
| 132 | 3300005337 | Ga0070682_100000079 | Ga0070682_10000007929 | 564 |
| 133 | 3300005337 | Ga0070682_100009153 | Ga0070682_1000091532 | 564 |
| 134 | 3300005337 | Ga0070682_100027278 | Ga0070682_1000272782 | 564 |
| 135 | 3300005338 | Ga0068868_100014958 | Ga0068868_1000149582 | 564 |
| 136 | 3300005339 | Ga0070660_100014250 | Ga0070660_1000142505 | 564 |
| 137 | 3300005340 | Ga0070689_100004489 | Ga0070689_1000044896 | 564 |
| 138 | 3300005343 | Ga0070687_100006716 | Ga0070687_1000067162 | 564 |
| 139 | 3300005343 | Ga0070687_100022178 | Ga0070687_1000221782 | 564 |
| 140 | 3300005344 | Ga0070661_100002141 | Ga0070661_1000021419 | 564 |
| 141 | 3300005345 | Ga0070692_10035278 | Ga0070692_100352782 | 564 |
| 142 | 3300005353 | Ga0070669_100003084 | Ga0070669_1000030847 | 564 |
| 143 | 3300005354 | Ga0070675_100004992 | Ga0070675_1000049925 | 564 |
| 144 | 3300005365 | Ga0070688_100067471 | Ga0070688_1000674712 | 564 |
| 145 | 3300005366 | Ga0070659_100008981 | Ga0070659_1000089812 | 564 |
| 146 | 3300005366 | Ga0070659_100110470 | Ga0070659_1001104702 | 564 |
| 147 | 3300005367 | Ga0070667_100012295 | Ga0070667_1000122952 | 564 |
| 148 | 3300005440 | Ga0070705_100013380 | Ga0070705_1000133802 | 564 |
| 149 | 3300005441 | Ga0070700_100006861 | Ga0070700_1000068615 | 564 |
| 150 | 3300005444 | Ga0070694_100007484 | Ga0070694_1000074843 | 564 |
| 151 | 3300005456 | Ga0070678_100001803 | Ga0070678_1000018034 | 564 |
| 152 | 3300005457 | Ga0070662_100004722 | Ga0070662_1000047222 | 564 |
| 153 | 3300005458 | Ga0070681_10002791 | Ga0070681_100027917 | 564 |
| 154 | 3300005530 | Ga0070679_100017182 | Ga0070679_1000171822 | 564 |
| 155 | 3300005543 | Ga0070672_100000368 | Ga0070672_10000036826 | 564 |
| 156 | 3300005543 | Ga0070672_100012177 | Ga0070672_1000121772 | 564 |
| 157 | 3300005544 | Ga0070686_100003006 | Ga0070686_1000030066 | 564 |
| 158 | 3300005545 | Ga0070695_100005400 | Ga0070695_1000054005 | 564 |
| 159 | 3300005546 | Ga0070696_100032488 | Ga0070696_1000324882 | 564 |
| 160 | 3300005548 | Ga0070665_100050414 | Ga0070665_1000504142 | 564 |
| 161 | 3300005549 | Ga0070704_100008826 | Ga0070704_1000088263 | 564 |
| 162 | 3300005563 | Ga0068855_100102108 | Ga0068855_1001021082 | 564 |
| 163 | 3300005564 | Ga0070664_100009588 | Ga0070664_1000095882 | 564 |
| 164 | 3300005618 | Ga0068864_100000001 | Ga0068864_100000001194 | 564 |
| 165 | 3300005843 | Ga0068860_100036131 | Ga0068860_1000361312 | 564 |
| 166 | 3300005844 | Ga0068862_100060633 | Ga0068862_1000606332 | 564 |
| 167 | 3300005937 | Ga0081455_10000552 | Ga0081455_1000055249 | 564 |
| 168 | 3300006051 | Ga0075364_10006841 | Ga0075364_100068416 | 564 |
| 169 | 3300006358 | Ga0068871_100002097 | Ga0068871_1000020977 | 564 |
| 170 | 3300006847 | Ga0075431_100028239 | Ga0075431_1000282392 | 564 |
| 171 | 3300006852 | Ga0075433_10045779 | Ga0075433_100457792 | 564 |
| 172 | 3300006880 | Ga0075429_100011337 | Ga0075429_1000113372 | 564 |
| 173 | 3300006880 | Ga0075429_100050294 | Ga0075429_1000502942 | 564 |
| 174 | 3300006881 | Ga0068865_100006429 | Ga0068865_1000064292 | 564 |
| 175 | 3300006914 | Ga0075436_100031317 | Ga0075436_1000313172 | 564 |
| 176 | 3300009093 | Ga0105240_10080518 | Ga0105240_100805182 | 564 |
| 177 | 3300009098 | Ga0105245_10000957 | Ga0105245_1000095710 | 564 |
| 178 | 3300009098 | Ga0105245_10005072 | Ga0105245_100050724 | 564 |
| 179 | 3300009147 | Ga0114129_10047712 | Ga0114129_100477124 | 564 |
| 180 | 3300009176 | Ga0105242_10003752 | Ga0105242_100037526 | 564 |
| 181 | 3300010375 | Ga0105239_10025113 | Ga0105239_100251132 | 564 |
| 182 | 3300011119 | Ga0105246_10007146 | Ga0105246_100071465 | 564 |
| 183 | 3300013100 | Ga0157373_10021292 | Ga0157373_100212922 | 564 |
| 184 | 3300013105 | Ga0157369_10161722 | Ga0157369_101617221 | 564 |
| 185 | 3300013296 | Ga0157374_10009960 | Ga0157374_100099607 | 564 |
| 186 | 3300013297 | Ga0157378_10003351 | Ga0157378_100033518 | 564 |
| 187 | 3300013308 | Ga0157375_10000077 | Ga0157375_1000007799 | 564 |
| 188 | 3300014745 | Ga0157377_10000808 | Ga0157377_100008087 | 564 |
| 189 | 3300014969 | Ga0157376_10006818 | Ga0157376_100068183 | 564 |
| 190 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008288 | 564 |
| 191 | 3300025907 | Ga0207645_10000012 | Ga0207645_1000001299 | 564 |
| 192 | 3300025912 | Ga0207707_10010822 | Ga0207707_100108225 | 564 |
| 193 | 3300025918 | Ga0207662_10002618 | Ga0207662_100026187 | 564 |
| 194 | 3300025918 | Ga0207662_10010476 | Ga0207662_100104763 | 564 |
| 195 | 3300025919 | Ga0207657_10000268 | Ga0207657_1000026816 | 564 |
| 196 | 3300025921 | Ga0207652_10022525 | Ga0207652_100225252 | 564 |
| 197 | 3300025924 | Ga0207694_10027863 | Ga0207694_100278634 | 564 |
| 198 | 3300025926 | Ga0207659_10026282 | Ga0207659_100262822 | 564 |
| 199 | 3300025927 | Ga0207687_10007205 | Ga0207687_100072052 | 564 |
| 200 | 3300025927 | Ga0207687_10007937 | Ga0207687_100079372 | 564 |
| 201 | 3300025932 | Ga0207690_10034594 | Ga0207690_100345942 | 564 |
| 202 | 3300025933 | Ga0207706_10001875 | Ga0207706_1000187511 | 564 |
| 203 | 3300025936 | Ga0207670_10014626 | Ga0207670_100146262 | 564 |
| 204 | 3300025938 | Ga0207704_10001416 | Ga0207704_100014162 | 564 |
| 205 | 3300025940 | Ga0207691_10000966 | Ga0207691_1000096628 | 564 |
| 206 | 3300025940 | Ga0207691_10002462 | Ga0207691_100024628 | 564 |
| 207 | 3300025960 | Ga0207651_10031942 | Ga0207651_100319422 | 564 |
| 208 | 3300026023 | Ga0207677_10000003 | Ga0207677_10000003305 | 564 |
| 209 | 3300026035 | Ga0207703_10085653 | Ga0207703_100856532 | 564 |
| 210 | 3300026067 | Ga0207678_10014036 | Ga0207678_100140362 | 564 |
| 211 | 3300026075 | Ga0207708_10001059 | Ga0207708_1000105911 | 564 |
| 212 | 3300026078 | Ga0207702_10030008 | Ga0207702_100300084 | 564 |
| 213 | 3300026089 | Ga0207648_10006261 | Ga0207648_100062615 | 564 |
| 214 | 3300026095 | Ga0207676_10000002 | Ga0207676_10000002640 | 564 |
| 215 | 3300026121 | Ga0207683_10000028 | Ga0207683_1000002891 | 564 |
| 216 | 3300027360 | Ga0209969_1000289 | Ga0209969_10002894 | 564 |
| 217 | 3300027364 | Ga0209967_1000103 | Ga0209967_10001034 | 564 |
| 218 | 3300027395 | Ga0209996_1000033 | Ga0209996_10000332 | 564 |
| 219 | 3300027462 | Ga0210000_1000096 | Ga0210000_10000962 | 564 |
| 220 | 3300027471 | Ga0209995_1000009 | Ga0209995_100000924 | 564 |
| 221 | 3300027526 | Ga0209968_1000024 | Ga0209968_10000242 | 564 |
| 222 | 3300027552 | Ga0209982_1002669 | Ga0209982_10026691 | 564 |
| 223 | 3300027614 | Ga0209970_1000067 | Ga0209970_10000676 | 564 |
| 224 | 3300027617 | Ga0210002_1000051 | Ga0210002_10000518 | 564 |
| 225 | 3300027665 | Ga0209983_1000026 | Ga0209983_100002615 | 564 |
| 226 | 3300027682 | Ga0209971_1000276 | Ga0209971_10002766 | 564 |
| 227 | 3300027695 | Ga0209966_1000248 | Ga0209966_10002484 | 564 |
| 228 | 3300027717 | Ga0209998_10000378 | Ga0209998_100003788 | 564 |
| 229 | 3300027876 | Ga0209974_10000246 | Ga0209974_100002468 | 564 |
| 230 | 3300027876 | Ga0209974_10000308 | Ga0209974_100003085 | 564 |
| 231 | 3300027907 | Ga0207428_10002466 | Ga0207428_1000246611 | 564 |
| 232 | 3300028380 | Ga0268265_10064819 | Ga0268265_100648192 | 564 |
| 233 | 3300032004 | Ga0307414_10037938 | Ga0307414_100379382 | 564 |
| 234 | 3300042126 | Ga0450888_001171 | Ga0450888_001171_644_2347 | 564 |
| 235 | 3300045051 | Ga0451576_0127338 | Ga0451576_0127338_399_2111 | 564 |
| 236 | 3300046457 | Ga0495590_0000692 | Ga0495590_0000692_4630_6375 | 564 |
| 237 | 3300049513 | Ga0501290_001523 | Ga0501290_001523_827_2530 | 564 |
| 238 | 3300049519 | Ga0501296_000042 | Ga0501296_000042_7289_8992 | 564 |
| 239 | 3300049521 | Ga0501298_000161 | Ga0501298_000161_3456_5159 | 564 |
| 240 | 3300049522 | Ga0501299_000093 | Ga0501299_000093_2291_3994 | 564 |
| 241 | 3300049523 | Ga0501300_000410 | Ga0501300_000410_700_2403 | 564 |
| 242 | 3300049526 | Ga0501303_000396 | Ga0501303_000396_1103_2806 | 564 |
| 243 | 3300049568 | Ga0501031_0054541 | Ga0501031_0054541_624_2336 | 564 |
| 244 | 3300049572 | Ga0501036_0091325 | Ga0501036_0091325_817_2529 | 564 |
| 245 | 3300049577 | Ga0501041_0028140 | Ga0501041_0028140_834_2546 | 564 |
| 246 | 3300049580 | Ga0501046_0049405 | Ga0501046_0049405_275_1987 | 564 |
| 247 | 3300049584 | Ga0501068_0030482 | Ga0501068_0030482_1406_3118 | 564 |
| 248 | 3300049587 | Ga0501071_0038858 | Ga0501071_0038858_1135_2847 | 564 |
| 249 | 3300049591 | Ga0501075_0016267 | Ga0501075_0016267_751_2463 | 564 |
| 250 | 3300049592 | Ga0501076_0007458 | Ga0501076_0007458_5589_7301 | 564 |
| 251 | 3300049651 | Ga0501201_000043 | Ga0501201_000043_1994_3697 | 564 |
| 252 | 3300049652 | Ga0501202_001962 | Ga0501202_001962_346_2049 | 564 |
| 253 | 3300049667 | Ga0501230_002063 | Ga0501230_002063_790_2493 | 564 |
| 254 | 3300049668 | Ga0501233_000054 | Ga0501233_000054_4080_5783 | 564 |
| 255 | 3300049684 | Ga0501255_000522 | Ga0501255_000522_726_2429 | 564 |
| 256 | 3300049690 | Ga0501261_001125 | Ga0501261_001125_1099_2802 | 564 |
| 257 | 3300049705 | Ga0501225_0000934 | Ga0501225_0000934_4178_5881 | 564 |
| 258 | 3300049707 | Ga0501234_000329 | Ga0501234_000329_3688_5391 | 564 |
| 259 | 3300049741 | Ga0501079_0027487 | Ga0501079_0027487_1449_3161 | 564 |
| 260 | 3300049742 | Ga0501080_0032607 | Ga0501080_0032607_2627_4339 | 564 |
| 261 | 3300049743 | Ga0501081_0051795 | Ga0501081_0051795_1070_2782 | 564 |
| 262 | 3300049761 | Ga0501264_000432 | Ga0501264_000432_1470_3173 | 564 |
| 263 | 3300049779 | Ga0501283_000047 | Ga0501283_000047_6180_7883 | 564 |
| 264 | 3300049822 | Ga0501035_0034462 | Ga0501035_0034462_2336_4048 | 564 |
| 265 | 3300049853 | Ga0501226_000633 | Ga0501226_000633_316_2019 | 564 |
| 266 | 3300050507 | nmdc:mga05p37_53820_c1 | nmdc:mga05p37_53820_c1_2620_4332 | 564 |
| 267 | 3300050508 | nmdc:mga09592_12531_c1 | nmdc:mga09592_12531_c1_820_2532 | 564 |
| 268 | 3300050510 | nmdc:mga06r32_10377_c1 | nmdc:mga06r32_10377_c1_103_1815 | 564 |
| 269 | 3300050511 | nmdc:mga08y16_22832_c1 | nmdc:mga08y16_22832_c1_4072_5784 | 564 |
| 270 | 3300050513 | nmdc:mga0rr50_23697_c1 | nmdc:mga0rr50_23697_c1_1395_3107 | 564 |
| 271 | 3300050514 | nmdc:mga08x19_38138_c1 | nmdc:mga08x19_38138_c1_852_2564 | 564 |
| 272 | 3300050515 | nmdc:mga0a205_19495_c1 | nmdc:mga0a205_19495_c1_613_2325 | 564 |
| 273 | 3300005295 | Ga0065707_10104681 | Ga0065707_101046812 | 565 |
| 274 | 3300005295 | Ga0065707_10123248 | Ga0065707_101232481 | 565 |
| 275 | 3300005330 | Ga0070690_100000107 | Ga0070690_10000010730 | 565 |
| 276 | 3300005340 | Ga0070689_100001349 | Ga0070689_1000013492 | 565 |
| 277 | 3300005343 | Ga0070687_100007662 | Ga0070687_1000076622 | 565 |
| 278 | 3300005365 | Ga0070688_100001166 | Ga0070688_1000011665 | 565 |
| 279 | 3300005438 | Ga0070701_10000356 | Ga0070701_100003562 | 565 |
| 280 | 3300005441 | Ga0070700_100002053 | Ga0070700_1000020537 | 565 |
| 281 | 3300005458 | Ga0070681_10017818 | Ga0070681_100178186 | 565 |
| 282 | 3300005459 | Ga0068867_100007291 | Ga0068867_1000072915 | 565 |
| 283 | 3300005466 | Ga0070685_10000570 | Ga0070685_1000057029 | 565 |
| 284 | 3300005468 | Ga0070707_100000110 | Ga0070707_10000011052 | 565 |
| 285 | 3300005468 | Ga0070707_100118641 | Ga0070707_1001186412 | 565 |
| 286 | 3300005471 | Ga0070698_100065792 | Ga0070698_1000657922 | 565 |
| 287 | 3300005518 | Ga0070699_100008765 | Ga0070699_1000087655 | 565 |
| 288 | 3300005518 | Ga0070699_100015887 | Ga0070699_1000158873 | 565 |
| 289 | 3300005518 | Ga0070699_100064514 | Ga0070699_1000645141 | 565 |
| 290 | 3300005536 | Ga0070697_100024444 | Ga0070697_1000244443 | 565 |
| 291 | 3300005544 | Ga0070686_100006419 | Ga0070686_1000064192 | 565 |
| 292 | 3300005615 | Ga0070702_100002394 | Ga0070702_1000023946 | 565 |
| 293 | 3300005617 | Ga0068859_100000648 | Ga0068859_10000064824 | 565 |
| 294 | 3300005719 | Ga0068861_100018170 | Ga0068861_1000181702 | 565 |
| 295 | 3300005842 | Ga0068858_100000467 | Ga0068858_1000004675 | 565 |
| 296 | 3300006237 | Ga0097621_100009437 | Ga0097621_1000094373 | 565 |
| 297 | 3300006358 | Ga0068871_100034947 | Ga0068871_1000349472 | 565 |
| 298 | 3300006844 | Ga0075428_100234656 | Ga0075428_1002346562 | 565 |
| 299 | 3300006846 | Ga0075430_100025182 | Ga0075430_1000251823 | 565 |
| 300 | 3300006931 | Ga0097620_100000648 | Ga0097620_10000064824 | 565 |
| 301 | 3300009147 | Ga0114129_10173521 | Ga0114129_101735212 | 565 |
| 302 | 3300009176 | Ga0105242_10079072 | Ga0105242_100790722 | 565 |
| 303 | 3300009177 | Ga0105248_10000624 | Ga0105248_100006248 | 565 |
| 304 | 3300014326 | Ga0157380_10097782 | Ga0157380_100977822 | 565 |
| 305 | 3300025912 | Ga0207707_10027135 | Ga0207707_100271352 | 565 |
| 306 | 3300025922 | Ga0207646_10000035 | Ga0207646_10000035172 | 565 |
| 307 | 3300025922 | Ga0207646_10054211 | Ga0207646_100542112 | 565 |
| 308 | 3300025934 | Ga0207686_10075332 | Ga0207686_100753322 | 565 |
| 309 | 3300025936 | Ga0207670_10000023 | Ga0207670_1000002321 | 565 |
| 310 | 3300025941 | Ga0207711_10005817 | Ga0207711_100058178 | 565 |
| 311 | 3300026035 | Ga0207703_10000085 | Ga0207703_1000008528 | 565 |
| 312 | 3300026075 | Ga0207708_10000228 | Ga0207708_1000022843 | 565 |
| 313 | 3300026089 | Ga0207648_10029775 | Ga0207648_100297752 | 565 |
| 314 | 3300026118 | Ga0207675_100019461 | Ga0207675_1000194612 | 565 |
| 315 | 3300035111 | Ga0373923_0002599 | Ga0373923_0002599_1508_3229 | 565 |
| 316 | 3300035118 | Ga0373954_0018487 | Ga0373954_0018487_1089_2810 | 565 |
| 317 | 3300035695 | Ga0373927_0065810 | Ga0373927_0065810_159_1880 | 565 |
| 318 | 3300036401 | Ga0373937_0002072 | Ga0373937_0002072_6494_8215 | 565 |
| 319 | 3300036401 | Ga0373937_0064984 | Ga0373937_0064984_571_2271 | 565 |
| 320 | 3300042001 | Ga0439441_002858 | Ga0439441_002858_333_2048 | 565 |
| 321 | 3300042876 | Ga0451577_0176299 | Ga0451577_0176299_59_1759 | 565 |
| 322 | 3300046675 | Ga0495657_0008024 | Ga0495657_0008024_4111_5811 | 565 |
| 323 | 3300049568 | Ga0501031_0000700 | Ga0501031_0000700_17872_19578 | 565 |
| 324 | 3300049568 | Ga0501031_0003842 | Ga0501031_0003842_2430_4226 | 565 |
| 325 | 3300049568 | Ga0501031_0004863 | Ga0501031_0004863_1530_3236 | 565 |
| 326 | 3300049569 | Ga0501032_0082065 | Ga0501032_0082065_243_1949 | 565 |
| 327 | 3300049572 | Ga0501036_0106069 | Ga0501036_0106069_213_1931 | 565 |
| 328 | 3300049573 | Ga0501037_0002732 | Ga0501037_0002732_1621_3327 | 565 |
| 329 | 3300049573 | Ga0501037_0004035 | Ga0501037_0004035_7740_9446 | 565 |
| 330 | 3300049574 | Ga0501038_0017115 | Ga0501038_0017115_3246_4952 | 565 |
| 331 | 3300049574 | Ga0501038_0142476 | Ga0501038_0142476_71_1789 | 565 |
| 332 | 3300049575 | Ga0501039_0000791 | Ga0501039_0000791_6718_8424 | 565 |
| 333 | 3300049575 | Ga0501039_0013071 | Ga0501039_0013071_2998_4704 | 565 |
| 334 | 3300049575 | Ga0501039_0018624 | Ga0501039_0018624_3080_4798 | 565 |
| 335 | 3300049577 | Ga0501041_0000673 | Ga0501041_0000673_4594_6300 | 565 |
| 336 | 3300049577 | Ga0501041_0011125 | Ga0501041_0011125_2324_4042 | 565 |
| 337 | 3300049578 | Ga0501042_0050132 | Ga0501042_0050132_494_2200 | 565 |
| 338 | 3300049579 | Ga0501043_0061084 | Ga0501043_0061084_666_2372 | 565 |
| 339 | 3300049580 | Ga0501046_0002279 | Ga0501046_0002279_15134_16840 | 565 |
| 340 | 3300049582 | Ga0501048_0000196 | Ga0501048_0000196_31044_32750 | 565 |
| 341 | 3300049588 | Ga0501072_0043487 | Ga0501072_0043487_466_2172 | 565 |
| 342 | 3300049591 | Ga0501075_0052937 | Ga0501075_0052937_880_2580 | 565 |
| 343 | 3300049592 | Ga0501076_0061958 | Ga0501076_0061958_386_2092 | 565 |
| 344 | 3300049743 | Ga0501081_0085962 | Ga0501081_0085962_320_2020 | 565 |
| 345 | 3300049822 | Ga0501035_0052163 | Ga0501035_0052163_411_2117 | 565 |
| 346 | 3300049822 | Ga0501035_0080452 | Ga0501035_0080452_988_2694 | 565 |
| 347 | 3300049824 | Ga0501045_0029894 | Ga0501045_0029894_1376_3094 | 565 |
| 348 | 3300050515 | nmdc:mga0a205_49952_c1 | nmdc:mga0a205_49952_c1_1994_3694 | 565 |
| 349 | 3300005471 | Ga0070698_100003773 | Ga0070698_10000377314 | 566 |
| 350 | 3300005549 | Ga0070704_100007740 | Ga0070704_1000077408 | 566 |
| 351 | 3300005844 | Ga0068862_100046353 | Ga0068862_1000463533 | 566 |
| 352 | 3300006847 | Ga0075431_100045331 | Ga0075431_1000453311 | 566 |
| 353 | 3300006880 | Ga0075429_100000018 | Ga0075429_10000001823 | 566 |
| 354 | 3300009147 | Ga0114129_10005674 | Ga0114129_1000567411 | 566 |
| 355 | 3300046537 | Ga0495598_0002799 | Ga0495598_0002799_822_2579 | 566 |
| 356 | 3300050507 | nmdc:mga05p37_291_c1 | nmdc:mga05p37_291_c1_48516_50222 | 566 |
| 357 | 3300050508 | nmdc:mga09592_88_c1 | nmdc:mga09592_88_c1_33712_35418 | 566 |
| 358 | 3300050510 | nmdc:mga06r32_1676_c1 | nmdc:mga06r32_1676_c1_14588_16294 | 566 |
| 359 | 3300035118 | Ga0373954_0003740 | Ga0373954_0003740_420_2123 | 567 |
| 360 | 3300035695 | Ga0373927_0037422 | Ga0373927_0037422_1421_3142 | 567 |
| 361 | 3300037068 | Ga0373925_0015085 | Ga0373925_0015085_3179_4903 | 567 |
| 362 | 3300037471 | Ga0395905_0002471 | Ga0395905_0002471_5213_6958 | 567 |
| 363 | 3300046517 | Ga0495630_0106738 | Ga0495630_0106738_304_2007 | 567 |
| 364 | 3300046539 | Ga0495621_0001916 | Ga0495621_0001916_2608_4347 | 567 |
| 365 | 3300046559 | Ga0495667_0011307 | Ga0495667_0011307_3192_4895 | 567 |
| 366 | 3300028794 | Ga0307515_10000062 | Ga0307515_1000006275 | 568 |
| 367 | 3300031235 | Ga0265330_10000046 | Ga0265330_100000465 | 568 |
| 368 | 3300031238 | Ga0265332_10000028 | Ga0265332_10000028107 | 568 |
| 369 | 3300031241 | Ga0265325_10002346 | Ga0265325_100023464 | 568 |
| 370 | 3300031247 | Ga0265340_10009685 | Ga0265340_100096853 | 568 |
| 371 | 3300031711 | Ga0265314_10000054 | Ga0265314_10000054107 | 568 |
| 372 | 3300048905 | Ga0496102_0006320 | Ga0496102_0006320_2872_4617 | 568 |
| 373 | 3300003792 | Ga0055540_1007611 | Ga0055540_10076114 | 569 |
| 374 | 3300003794 | Ga0055531_10000500 | Ga0055531_1000050022 | 569 |
| 375 | 3300005333 | Ga0070677_10003533 | Ga0070677_100035332 | 569 |
| 376 | 3300005459 | Ga0068867_100000735 | Ga0068867_10000073522 | 569 |
| 377 | 3300013308 | Ga0157375_10020637 | Ga0157375_100206377 | 569 |
| 378 | 3300025298 | Ga0209050_1001301 | Ga0209050_10013017 | 569 |
| 379 | 3300025303 | Ga0209051_1003502 | Ga0209051_10035023 | 569 |
| 380 | 3300025303 | Ga0209051_1007572 | Ga0209051_10075724 | 569 |
| 381 | 3300025304 | Ga0209257_1000131 | Ga0209257_100013117 | 569 |
| 382 | 3300025960 | Ga0207651_10024688 | Ga0207651_100246883 | 569 |
| 383 | 3300026023 | Ga0207677_10032337 | Ga0207677_100323371 | 569 |
| 384 | 3300026116 | Ga0207674_10104466 | Ga0207674_101044661 | 569 |
| 385 | iso_pu_bacteria | 2513237150 | 2513954236 | 569 |
| 386 | iso_pu_bacteria | 2513237165 | 2514042976 | 569 |
| 387 | iso_pu_bacteria | 2739367655 | 2739611883 | 569 |
| 388 | iso_pu_bacteria | 2858688981 | 2858692169 | 569 |
| 389 | iso_pu_bacteria | 644736347 | 644749015 | 569 |
| 390 | iso_pu_bacteria | 2858950400 | 2858955363 | 570 |
| 391 | 3300006846 | Ga0075430_100131987 | Ga0075430_1001319872 | 571 |
| 392 | 3300046471 | Ga0495650_0003376 | Ga0495650_0003376_352_2097 | 571 |
| 393 | iso_pu_bacteria | 2599185292 | 2599904497 | 571 |
| 394 | iso_pu_bacteria | 2643221569 | 2643861086 | 571 |
| 395 | iso_pu_bacteria | 2643221594 | 2643983463 | 571 |
| 396 | iso_pu_bacteria | 2643221621 | 2644124387 | 571 |
| 397 | iso_pu_bacteria | 2808606395 | 2809032624 | 571 |
| 398 | iso_pu_bacteria | 2834641062 | 2834642937 | 571 |
| 399 | iso_pu_bacteria | 2855730933 | 2855733756 | 571 |
| 400 | iso_pu_bacteria | 2855767633 | 2855772027 | 571 |
| 401 | iso_pu_bacteria | 2857537821 | 2857542314 | 571 |
| 402 | iso_pu_bacteria | 2881412998 | 2881417616 | 571 |
| 403 | iso_pu_bacteria | 2941479691 | 2941485446 | 571 |
| 404 | iso_pu_bacteria | 8003400568 | 8003400891 | 571 |
| 405 | iso_pu_bacteria | 8055225921 | 8055228897 | 571 |
| 406 | 3300004625 | Ga0055543_1001329 | Ga0055543_10013299 | 572 |
| 407 | 3300005262 | Ga0065165_1000016 | Ga0065165_1000016258 | 572 |
| 408 | 3300005577 | Ga0068857_100059410 | Ga0068857_1000594103 | 572 |
| 409 | 3300006881 | Ga0068865_100053538 | Ga0068865_1000535382 | 572 |
| 410 | 3300009553 | Ga0105249_10026571 | Ga0105249_100265713 | 572 |
| 411 | 3300025263 | Ga0209565_1003213 | Ga0209565_10032134 | 572 |
| 412 | 3300025273 | Ga0209673_1000172 | Ga0209673_100017239 | 572 |
| 413 | 3300025273 | Ga0209673_1006833 | Ga0209673_10068334 | 572 |
| 414 | 3300025291 | Ga0209675_1000690 | Ga0209675_100069022 | 572 |
| 415 | 3300025292 | Ga0209676_1000048 | Ga0209676_1000048365 | 572 |
| 416 | 3300025295 | Ga0209564_1000241 | Ga0209564_1000241103 | 572 |
| 417 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012365 | 572 |
| 418 | 3300025298 | Ga0209050_1000294 | Ga0209050_1000294107 | 572 |
| 419 | 3300025299 | Ga0209256_1000103 | Ga0209256_100010335 | 572 |
| 420 | 3300025302 | Ga0207426_1000058 | Ga0207426_1000058163 | 572 |
| 421 | 3300025303 | Ga0209051_1000019 | Ga0209051_1000019284 | 572 |
| 422 | 3300025303 | Ga0209051_1001560 | Ga0209051_100156020 | 572 |
| 423 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024311 | 572 |
| 424 | 3300026041 | Ga0207639_10007668 | Ga0207639_100076683 | 572 |
| 425 | 3300028794 | Ga0307515_10000080 | Ga0307515_100000801 | 572 |
| 426 | 3300031456 | Ga0307513_10002583 | Ga0307513_100025836 | 572 |
| 427 | 3300044712 | Ga0453684_0036305 | Ga0453684_0036305_4283_6040 | 572 |
| 428 | 3300045051 | Ga0451576_0005888 | Ga0451576_0005888_5135_6862 | 572 |
| 429 | 3300053156 | Ga0500622_0003254 | Ga0500622_0003254_5825_7567 | 572 |
| 430 | iso_pu_bacteria | 2887375801 | 2887380754 | 572 |
| 431 | 3300003187 | JGI25151J46595_10003861 | JGI25151J46595_100038612 | 573 |
| 432 | 3300003187 | JGI25151J46595_10007739 | JGI25151J46595_100077391 | 573 |
| 433 | 3300003771 | Ga0055526_1010439 | Ga0055526_10104394 | 573 |
| 434 | 3300003775 | Ga0055524_1005801 | Ga0055524_10058011 | 573 |
| 435 | 3300003781 | Ga0055536_1000044 | Ga0055536_100004410 | 573 |
| 436 | 3300003784 | Ga0055534_1004577 | Ga0055534_10045774 | 573 |
| 437 | 3300006051 | Ga0075364_10017870 | Ga0075364_100178703 | 573 |
| 438 | 3300025263 | Ga0209565_1000679 | Ga0209565_100067914 | 573 |
| 439 | 3300025291 | Ga0209675_1000260 | Ga0209675_10002601 | 573 |
| 440 | 3300025291 | Ga0209675_1006252 | Ga0209675_10062522 | 573 |
| 441 | 3300025292 | Ga0209676_1000141 | Ga0209676_1000141122 | 573 |
| 442 | 3300025294 | Ga0209025_1000538 | Ga0209025_100053853 | 573 |
| 443 | 3300025294 | Ga0209025_1000657 | Ga0209025_100065714 | 573 |
| 444 | 3300025294 | Ga0209025_1002686 | Ga0209025_10026864 | 573 |
| 445 | 3300025294 | Ga0209025_1003759 | Ga0209025_100375913 | 573 |
| 446 | 3300025295 | Ga0209564_1002257 | Ga0209564_10022572 | 573 |
| 447 | 3300025295 | Ga0209564_1002910 | Ga0209564_10029108 | 573 |
| 448 | 3300025299 | Ga0209256_1000370 | Ga0209256_10003704 | 573 |
| 449 | 3300025299 | Ga0209256_1000964 | Ga0209256_10009648 | 573 |
| 450 | 3300025303 | Ga0209051_1021634 | Ga0209051_10216342 | 573 |
| 451 | 3300025949 | Ga0207667_10038069 | Ga0207667_100380693 | 573 |
| 452 | 3300032004 | Ga0307414_10059660 | Ga0307414_100596601 | 573 |
| 453 | 3300037312 | Ga0395899_0001042 | Ga0395899_0001042_11880_13601 | 573 |
| 454 | 3300037418 | Ga0395900_0010547 | Ga0395900_0010547_889_2610 | 573 |
| 455 | 3300042876 | Ga0451577_0003457 | Ga0451577_0003457_10201_11940 | 573 |
| 456 | 3300047318 | Ga0495636_0010809 | Ga0495636_0010809_724_2445 | 573 |
| 457 | 3300049571 | Ga0501034_0003551 | Ga0501034_0003551_11609_13330 | 573 |
| 458 | 3300049571 | Ga0501034_0055505 | Ga0501034_0055505_544_2265 | 573 |
| 459 | iso_pu_bacteria | 2857576091 | 2857580653 | 573 |
| 460 | 3300005339 | Ga0070660_100001319 | Ga0070660_1000013199 | 574 |
| 461 | 3300005344 | Ga0070661_100018312 | Ga0070661_1000183125 | 574 |
| 462 | 3300005366 | Ga0070659_100007265 | Ga0070659_1000072657 | 574 |
| 463 | 3300025919 | Ga0207657_10003453 | Ga0207657_100034538 | 574 |
| 464 | 3300026142 | Ga0207698_10097790 | Ga0207698_100977902 | 574 |
| 465 | 3300037312 | Ga0395899_0001609 | Ga0395899_0001609_15872_17596 | 574 |
| 466 | 3300037312 | Ga0395899_0002916 | Ga0395899_0002916_11039_12763 | 574 |
| 467 | 3300037418 | Ga0395900_0087907 | Ga0395900_0087907_775_2499 | 574 |
| 468 | 3300038443 | Ga0395901_0022718 | Ga0395901_0022718_317_2041 | 574 |
| 469 | 3300038443 | Ga0395901_0044230 | Ga0395901_0044230_82_1806 | 574 |
| 470 | 3300048927 | Ga0496124_0000085 | Ga0496124_0000085_18837_20570 | 574 |
| 471 | 3300048929 | Ga0496126_0151880 | Ga0496126_0151880_65_1801 | 574 |
| 472 | iso_pu_bacteria | 2857558681 | 2857559501 | 574 |
| 473 | 3300002774 | JGI25150J39212_1005515 | JGI25150J39212_10055152 | 575 |
| 474 | 3300003187 | JGI25151J46595_10001847 | JGI25151J46595_100018471 | 575 |
| 475 | 3300003763 | Ga0055529_1001314 | Ga0055529_10013145 | 575 |
| 476 | 3300006051 | Ga0075364_10002743 | Ga0075364_100027435 | 575 |
| 477 | 3300025272 | Ga0209455_1000227 | Ga0209455_10002276 | 575 |
| 478 | 3300025292 | Ga0209676_1008633 | Ga0209676_10086333 | 575 |
| 479 | 3300025294 | Ga0209025_1000028 | Ga0209025_100002826 | 575 |
| 480 | 3300031911 | Ga0307412_10004338 | Ga0307412_100043385 | 575 |
| 481 | 3300044656 | Ga0466969_0003553 | Ga0466969_0003553_5985_7739 | 575 |
| 482 | 3300044684 | Ga0466966_0075894 | Ga0466966_0075894_136_1890 | 575 |
| 483 | 3300045049 | Ga0466959_0054865 | Ga0466959_0054865_514_2268 | 575 |
| 484 | 3300048921 | Ga0496118_0020181 | Ga0496118_0020181_32_1762 | 575 |
| 485 | 3300048921 | Ga0496118_0074755 | Ga0496118_0074755_575_2305 | 575 |
| 486 | 3300048923 | Ga0496120_0009161 | Ga0496120_0009161_2453_4183 | 575 |
| 487 | 3300048924 | Ga0496121_0000748 | Ga0496121_0000748_36896_38626 | 575 |
| 488 | 3300048924 | Ga0496121_0015844 | Ga0496121_0015844_1443_3176 | 575 |
| 489 | 3300048925 | Ga0496122_0020165 | Ga0496122_0020165_3936_5666 | 575 |
| 490 | 3300048926 | Ga0496123_0001818 | Ga0496123_0001818_4586_6316 | 575 |
| 491 | 3300048928 | Ga0496125_0000096 | Ga0496125_0000096_182505_184235 | 575 |
| 492 | 3300048928 | Ga0496125_0128150 | Ga0496125_0128150_37_1767 | 575 |
| 493 | 3300049571 | Ga0501034_0026198 | Ga0501034_0026198_2887_4620 | 575 |
| 494 | 3300049581 | Ga0501047_0014004 | Ga0501047_0014004_4632_6365 | 575 |
| 495 | 3300049822 | Ga0501035_0006589 | Ga0501035_0006589_2415_4148 | 575 |
| 496 | 3300049823 | Ga0501044_0001142 | Ga0501044_0001142_11650_13380 | 575 |
| 497 | 3300049823 | Ga0501044_0002263 | Ga0501044_0002263_7426_9159 | 575 |
| 498 | iso_pu_bacteria | 2643221644 | 2644244730 | 575 |
| 499 | iso_pu_bacteria | 2831864461 | 2831864657 | 575 |
| 500 | 3300005458 | Ga0070681_10017140 | Ga0070681_100171407 | 576 |
| 501 | 3300005530 | Ga0070679_100000726 | Ga0070679_1000007263 | 576 |
| 502 | 3300025912 | Ga0207707_10034449 | Ga0207707_100344495 | 576 |
| 503 | 3300025917 | Ga0207660_10029907 | Ga0207660_100299073 | 576 |
| 504 | 3300025921 | Ga0207652_10002099 | Ga0207652_1000209912 | 576 |
| 505 | 3300026078 | Ga0207702_10112944 | Ga0207702_101129442 | 576 |
| 506 | 3300037471 | Ga0395905_0010063 | Ga0395905_0010063_2209_3939 | 576 |
| 507 | 3300046522 | Ga0495643_0001057 | Ga0495643_0001057_1510_3240 | 576 |
| 508 | 3300046665 | Ga0495661_0001454 | Ga0495661_0001454_16470_18200 | 576 |
| 509 | 3300047443 | Ga0495687_012963 | Ga0495687_012963_1088_2818 | 576 |
| 510 | 3300048904 | Ga0496101_0033330 | Ga0496101_0033330_959_2689 | 576 |
| 511 | 3300048905 | Ga0496102_0028049 | Ga0496102_0028049_1408_3138 | 576 |
| 512 | 3300048906 | Ga0496103_0015500 | Ga0496103_0015500_2226_3956 | 576 |
| 513 | 3300048911 | Ga0496108_0063116 | Ga0496108_0063116_933_2663 | 576 |
| 514 | 3300048913 | Ga0496110_0032173 | Ga0496110_0032173_417_2147 | 576 |
| 515 | 3300048914 | Ga0496111_0027762 | Ga0496111_0027762_535_2265 | 576 |
| 516 | iso_pu_bacteria | 2511231002 | 2511244630 | 576 |
| 517 | iso_pu_bacteria | 2513020051 | 2513229174 | 576 |
| 518 | iso_pu_bacteria | 2547132374 | 2548499030 | 576 |
| 519 | iso_pu_bacteria | 2585428057 | 2587725324 | 576 |
| 520 | iso_pu_bacteria | 2585428058 | 2587731317 | 576 |
| 521 | iso_pu_bacteria | 2585428062 | 2587754075 | 576 |
| 522 | iso_pu_bacteria | 2588253510 | 2588290073 | 576 |
| 523 | iso_pu_bacteria | 2599185214 | 2599623403 | 576 |
| 524 | iso_pu_bacteria | 2599185226 | 2599675379 | 576 |
| 525 | iso_pu_bacteria | 2599185227 | 2599681008 | 576 |
| 526 | iso_pu_bacteria | 2599185229 | 2599693023 | 576 |
| 527 | iso_pu_bacteria | 2643221544 | 2643743056 | 576 |
| 528 | iso_pu_bacteria | 2643221570 | 2643867765 | 576 |
| 529 | iso_pu_bacteria | 2643221585 | 2643932919 | 576 |
| 530 | iso_pu_bacteria | 2643221592 | 2643972793 | 576 |
| 531 | iso_pu_bacteria | 2643221596 | 2643991628 | 576 |
| 532 | iso_pu_bacteria | 2643221609 | 2644062201 | 576 |
| 533 | iso_pu_bacteria | 2643221611 | 2644071389 | 576 |
| 534 | iso_pu_bacteria | 2643221625 | 2644143360 | 576 |
| 535 | iso_pu_bacteria | 2643221628 | 2644161839 | 576 |
| 536 | iso_pu_bacteria | 2643221639 | 2644218527 | 576 |
| 537 | iso_pu_bacteria | 2643221646 | 2644260422 | 576 |
| 538 | iso_pu_bacteria | 2643221648 | 2644276203 | 576 |
| 539 | iso_pu_bacteria | 2643221652 | 2644293374 | 576 |
| 540 | iso_pu_bacteria | 2643221654 | 2644301278 | 576 |
| 541 | iso_pu_bacteria | 2643221656 | 2644314169 | 576 |
| 542 | iso_pu_bacteria | 2643221658 | 2644325564 | 576 |
| 543 | iso_pu_bacteria | 2643221660 | 2644340886 | 576 |
| 544 | iso_pu_bacteria | 2643221672 | 2644399283 | 576 |
| 545 | iso_pu_bacteria | 2643221683 | 2644467028 | 576 |
| 546 | iso_pu_bacteria | 2643221717 | 2644648487 | 576 |
| 547 | iso_pu_bacteria | 2721755523 | 2722881983 | 576 |
| 548 | iso_pu_bacteria | 2738541277 | 2738718191 | 576 |
| 549 | iso_pu_bacteria | 2738541307 | 2738880423 | 576 |
| 550 | iso_pu_bacteria | 2738541337 | 2739055917 | 576 |
| 551 | iso_pu_bacteria | 2738543012 | 2739245812 | 576 |
| 552 | iso_pu_bacteria | 2738543013 | 2739248272 | 576 |
| 553 | iso_pu_bacteria | 2738543019 | 2739281378 | 576 |
| 554 | iso_pu_bacteria | 2816332133 | 2816470506 | 576 |
| 555 | iso_pu_bacteria | 2818991446 | 2819600579 | 576 |
| 556 | iso_pu_bacteria | 2831265667 | 2831267695 | 576 |
| 557 | iso_pu_bacteria | 2838054893 | 2838061099 | 576 |
| 558 | iso_pu_bacteria | 2839138175 | 2839141876 | 576 |
| 559 | iso_pu_bacteria | 2842677519 | 2842679820 | 576 |
| 560 | iso_pu_bacteria | 2842718218 | 2842718718 | 576 |
| 561 | iso_pu_bacteria | 2842733646 | 2842736366 | 576 |
| 562 | iso_pu_bacteria | 2842747753 | 2842748874 | 576 |
| 563 | iso_pu_bacteria | 2881101125 | 2881103131 | 576 |
| 564 | iso_pu_bacteria | 2885192300 | 2885196940 | 576 |
| 565 | iso_pu_bacteria | 2885198086 | 2885198835 | 576 |
| 566 | iso_pu_bacteria | 2885211737 | 2885211785 | 576 |
| 567 | iso_pu_bacteria | 2894023352 | 2894024332 | 576 |
| 568 | iso_pu_bacteria | 2899924645 | 2899928274 | 576 |
| 569 | iso_pu_bacteria | 2904449895 | 2904452450 | 576 |
| 570 | iso_pu_bacteria | 2904456579 | 2904460951 | 576 |
| 571 | iso_pu_bacteria | 2904479285 | 2904480797 | 576 |
| 572 | iso_pu_bacteria | 2904541872 | 2904545136 | 576 |
| 573 | iso_pu_bacteria | 2919462493 | 2919463918 | 576 |
| 574 | iso_pu_bacteria | 2919704043 | 2919707133 | 576 |
| 575 | iso_pu_bacteria | 2928037797 | 2928041226 | 576 |
| 576 | iso_pu_bacteria | 2928044640 | 2928048068 | 576 |
| 577 | iso_pu_bacteria | 2928051484 | 2928055909 | 576 |
| 578 | iso_pu_bacteria | 2928064002 | 2928066610 | 576 |
| 579 | iso_pu_bacteria | 2928070936 | 2928077236 | 576 |
| 580 | iso_pu_bacteria | 2928084124 | 2928087537 | 576 |
| 581 | iso_pu_bacteria | 2928115317 | 2928120654 | 576 |
| 582 | iso_pu_bacteria | 2929160207 | 2929165314 | 576 |
| 583 | iso_pu_bacteria | 2929520902 | 2929522934 | 576 |
| 584 | iso_pu_bacteria | 2932422444 | 2932424039 | 576 |
| 585 | iso_pu_bacteria | 2939631187 | 2939636218 | 576 |
| 586 | iso_pu_bacteria | 2945909444 | 2945910081 | 576 |
| 587 | iso_pu_bacteria | 2945972063 | 2945975653 | 576 |
| 588 | iso_pu_bacteria | 2945984333 | 2945987903 | 576 |
| 589 | iso_pu_bacteria | 2954767861 | 2954768903 | 576 |
| 590 | iso_pu_bacteria | 2990710928 | 2990713925 | 576 |
| 591 | 3300014968 | Ga0157379_10017000 | Ga0157379_100170008 | 577 |
| 592 | 3300039437 | Ga0436365_0288397 | Ga0436365_0288397_8418_10160 | 577 |
| 593 | 3300046501 | Ga0495607_0000077 | Ga0495607_0000077_15728_17467 | 577 |
| 594 | 3300049822 | Ga0501035_0004768 | Ga0501035_0004768_3068_4810 | 577 |
| 595 | 3300005328 | Ga0070676_10030581 | Ga0070676_100305812 | 578 |
| 596 | 3300005331 | Ga0070670_100001440 | Ga0070670_1000014403 | 578 |
| 597 | 3300005331 | Ga0070670_100076880 | Ga0070670_1000768803 | 578 |
| 598 | 3300005331 | Ga0070670_100105389 | Ga0070670_1001053892 | 578 |
| 599 | 3300005333 | Ga0070677_10002257 | Ga0070677_100022575 | 578 |
| 600 | 3300005334 | Ga0068869_100083034 | Ga0068869_1000830342 | 578 |
| 601 | 3300005353 | Ga0070669_100004692 | Ga0070669_1000046928 | 578 |
| 602 | 3300005354 | Ga0070675_100000897 | Ga0070675_10000089712 | 578 |
| 603 | 3300005355 | Ga0070671_100002016 | Ga0070671_1000020169 | 578 |
| 604 | 3300005356 | Ga0070674_100001095 | Ga0070674_1000010956 | 578 |
| 605 | 3300005364 | Ga0070673_100009353 | Ga0070673_1000093534 | 578 |
| 606 | 3300005459 | Ga0068867_100001564 | Ga0068867_1000015641 | 578 |
| 607 | 3300005459 | Ga0068867_100083162 | Ga0068867_1000831622 | 578 |
| 608 | 3300005459 | Ga0068867_100084548 | Ga0068867_1000845482 | 578 |
| 609 | 3300005543 | Ga0070672_100002347 | Ga0070672_1000023478 | 578 |
| 610 | 3300005842 | Ga0068858_100044054 | Ga0068858_1000440543 | 578 |
| 611 | 3300005844 | Ga0068862_100071690 | Ga0068862_1000716903 | 578 |
| 612 | 3300006237 | Ga0097621_100032048 | Ga0097621_1000320483 | 578 |
| 613 | 3300006237 | Ga0097621_100034919 | Ga0097621_1000349192 | 578 |
| 614 | 3300006358 | Ga0068871_100005094 | Ga0068871_1000050941 | 578 |
| 615 | 3300009148 | Ga0105243_10085749 | Ga0105243_100857492 | 578 |
| 616 | 3300013306 | Ga0163162_10121698 | Ga0163162_101216981 | 578 |
| 617 | 3300013308 | Ga0157375_10005835 | Ga0157375_1000583510 | 578 |
| 618 | 3300014968 | Ga0157379_10117779 | Ga0157379_101177792 | 578 |
| 619 | 3300017792 | Ga0163161_10003141 | Ga0163161_100031416 | 578 |
| 620 | 3300025315 | Ga0207697_10002324 | Ga0207697_100023247 | 578 |
| 621 | 3300025893 | Ga0207682_10002632 | Ga0207682_100026329 | 578 |
| 622 | 3300025907 | Ga0207645_10002553 | Ga0207645_100025533 | 578 |
| 623 | 3300025907 | Ga0207645_10018626 | Ga0207645_100186264 | 578 |
| 624 | 3300025907 | Ga0207645_10023666 | Ga0207645_100236665 | 578 |
| 625 | 3300025926 | Ga0207659_10000393 | Ga0207659_1000039312 | 578 |
| 626 | 3300025931 | Ga0207644_10001683 | Ga0207644_1000168310 | 578 |
| 627 | 3300025937 | Ga0207669_10002595 | Ga0207669_100025952 | 578 |
| 628 | 3300025939 | Ga0207665_10079438 | Ga0207665_100794382 | 578 |
| 629 | 3300025940 | Ga0207691_10001174 | Ga0207691_1000117421 | 578 |
| 630 | 3300025960 | Ga0207651_10001471 | Ga0207651_100014715 | 578 |
| 631 | 3300025972 | Ga0207668_10077214 | Ga0207668_100772142 | 578 |
| 632 | 3300026023 | Ga0207677_10056522 | Ga0207677_100565222 | 578 |
| 633 | 3300026035 | Ga0207703_10021855 | Ga0207703_100218554 | 578 |
| 634 | 3300026089 | Ga0207648_10001516 | Ga0207648_1000151619 | 578 |
| 635 | 3300026089 | Ga0207648_10021655 | Ga0207648_100216557 | 578 |
| 636 | 3300026118 | Ga0207675_100036724 | Ga0207675_1000367244 | 578 |
| 637 | 3300026121 | Ga0207683_10004504 | Ga0207683_100045049 | 578 |
| 638 | 3300028381 | Ga0268264_10058123 | Ga0268264_100581232 | 578 |
| 639 | 3300031731 | Ga0307405_10031497 | Ga0307405_100314973 | 578 |
| 640 | 3300031824 | Ga0307413_10000632 | Ga0307413_100006325 | 578 |
| 641 | 3300031911 | Ga0307412_10002540 | Ga0307412_100025407 | 578 |
| 642 | 3300031911 | Ga0307412_10017947 | Ga0307412_100179473 | 578 |
| 643 | 3300032002 | Ga0307416_100001338 | Ga0307416_10000133810 | 578 |
| 644 | 3300032126 | Ga0307415_100001083 | Ga0307415_1000010836 | 578 |
| 645 | 3300046665 | Ga0495661_0036631 | Ga0495661_0036631_738_2483 | 578 |
| 646 | 3300002987 | JGI25159J45721_1007405 | JGI25159J45721_10074051 | 579 |
| 647 | 3300003354 | JGI25160J50197_1000273 | JGI25160J50197_100027327 | 579 |
| 648 | 3300003374 | JGI25161J50226_1000095 | JGI25161J50226_100009537 | 579 |
| 649 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004302 | 579 |
| 650 | 3300003775 | Ga0055524_1005152 | Ga0055524_10051522 | 579 |
| 651 | 3300004625 | Ga0055543_1000218 | Ga0055543_100021835 | 579 |
| 652 | 3300005262 | Ga0065165_1001026 | Ga0065165_100102626 | 579 |
| 653 | 3300005338 | Ga0068868_100001535 | Ga0068868_10000153510 | 579 |
| 654 | 3300005354 | Ga0070675_100040766 | Ga0070675_1000407665 | 579 |
| 655 | 3300005355 | Ga0070671_100003626 | Ga0070671_10000362610 | 579 |
| 656 | 3300005366 | Ga0070659_100024688 | Ga0070659_1000246884 | 579 |
| 657 | 3300005459 | Ga0068867_100000020 | Ga0068867_10000002066 | 579 |
| 658 | 3300005543 | Ga0070672_100009632 | Ga0070672_1000096328 | 579 |
| 659 | 3300005564 | Ga0070664_100026696 | Ga0070664_1000266962 | 579 |
| 660 | 3300006358 | Ga0068871_100028897 | Ga0068871_1000288972 | 579 |
| 661 | 3300009148 | Ga0105243_10014871 | Ga0105243_100148712 | 579 |
| 662 | 3300009176 | Ga0105242_10043696 | Ga0105242_100436962 | 579 |
| 663 | 3300013308 | Ga0157375_10163710 | Ga0157375_101637101 | 579 |
| 664 | 3300014745 | Ga0157377_10000032 | Ga0157377_1000003247 | 579 |
| 665 | 3300025230 | Ga0209563_100013 | Ga0209563_100013302 | 579 |
| 666 | 3300025273 | Ga0209673_1006425 | Ga0209673_10064252 | 579 |
| 667 | 3300025284 | Ga0209130_1000072 | Ga0209130_100007265 | 579 |
| 668 | 3300025298 | Ga0209050_1004556 | Ga0209050_10045564 | 579 |
| 669 | 3300025299 | Ga0209256_1003240 | Ga0209256_100324013 | 579 |
| 670 | 3300025302 | Ga0207426_1000319 | Ga0207426_100031959 | 579 |
| 671 | 3300025303 | Ga0209051_1001286 | Ga0209051_10012863 | 579 |
| 672 | 3300025304 | Ga0209257_1004305 | Ga0209257_100430512 | 579 |
| 673 | 3300025920 | Ga0207649_10091844 | Ga0207649_100918441 | 579 |
| 674 | 3300025925 | Ga0207650_10008398 | Ga0207650_100083984 | 579 |
| 675 | 3300025926 | Ga0207659_10003084 | Ga0207659_1000308411 | 579 |
| 676 | 3300025931 | Ga0207644_10001550 | Ga0207644_100015507 | 579 |
| 677 | 3300025931 | Ga0207644_10004993 | Ga0207644_100049938 | 579 |
| 678 | 3300025932 | Ga0207690_10028634 | Ga0207690_100286343 | 579 |
| 679 | 3300025935 | Ga0207709_10004954 | Ga0207709_100049547 | 579 |
| 680 | 3300025940 | Ga0207691_10065625 | Ga0207691_100656251 | 579 |
| 681 | 3300025941 | Ga0207711_10042841 | Ga0207711_100428413 | 579 |
| 682 | 3300025945 | Ga0207679_10000671 | Ga0207679_100006712 | 579 |
| 683 | 3300026075 | Ga0207708_10014415 | Ga0207708_100144156 | 579 |
| 684 | 3300026089 | Ga0207648_10000172 | Ga0207648_1000017223 | 579 |
| 685 | 3300026095 | Ga0207676_10068247 | Ga0207676_100682471 | 579 |
| 686 | 3300028794 | Ga0307515_10016568 | Ga0307515_1001656810 | 579 |
| 687 | 3300031242 | Ga0265329_10016913 | Ga0265329_100169132 | 579 |
| 688 | 3300031548 | Ga0307408_100000023 | Ga0307408_100000023195 | 579 |
| 689 | 3300031711 | Ga0265314_10020486 | Ga0265314_100204865 | 579 |
| 690 | 3300035695 | Ga0373927_0009270 | Ga0373927_0009270_120_1862 | 579 |
| 691 | 3300037068 | Ga0373925_0005227 | Ga0373925_0005227_5729_7471 | 579 |
| 692 | 3300041997 | Ga0439431_0003865 | Ga0439431_0003865_378_2120 | 579 |
| 693 | 3300042121 | Ga0450919_002729 | Ga0450919_002729_27_1769 | 579 |
| 694 | 3300042126 | Ga0450888_000115 | Ga0450888_000115_2049_3791 | 579 |
| 695 | 3300042144 | Ga0450889_000093 | Ga0450889_000093_425_2167 | 579 |
| 696 | 3300042531 | Ga0450918_000202 | Ga0450918_000202_6055_7797 | 579 |
| 697 | 3300042532 | Ga0450893_0000411 | Ga0450893_0000411_1446_3188 | 579 |
| 698 | 3300046558 | Ga0495633_0000563 | Ga0495633_0000563_20413_22152 | 579 |
| 699 | 3300048924 | Ga0496121_0010814 | Ga0496121_0010814_3216_4967 | 579 |
| 700 | 3300048928 | Ga0496125_0026863 | Ga0496125_0026863_3138_4889 | 579 |
| 701 | 3300002704 | JGI25155J39150_1000022 | JGI25155J39150_100002298 | 580 |
| 702 | 3300002705 | JGI25156J39149_1000005 | JGI25156J39149_100000590 | 580 |
| 703 | 3300002738 | JGI25154J39366_1000017 | JGI25154J39366_100001782 | 580 |
| 704 | 3300002738 | JGI25154J39366_1001293 | JGI25154J39366_10012933 | 580 |
| 705 | 3300002741 | JGI25157J39369_1000003 | JGI25157J39369_100000398 | 580 |
| 706 | 3300002741 | JGI25157J39369_1000161 | JGI25157J39369_10001619 | 580 |
| 707 | 3300002741 | JGI25157J39369_1000774 | JGI25157J39369_100077410 | 580 |
| 708 | 3300002773 | JGI25152J39213_1000892 | JGI25152J39213_10008926 | 580 |
| 709 | 3300002987 | JGI25159J45721_1001370 | JGI25159J45721_100137010 | 580 |
| 710 | 3300003187 | JGI25151J46595_10004995 | JGI25151J46595_100049957 | 580 |
| 711 | 3300003187 | JGI25151J46595_10005322 | JGI25151J46595_100053226 | 580 |
| 712 | 3300003215 | JGI25153J46596_10000420 | JGI25153J46596_1000042024 | 580 |
| 713 | 3300003215 | JGI25153J46596_10002471 | JGI25153J46596_1000247110 | 580 |
| 714 | 3300003308 | Ga0006777J48905_1089277 | Ga0006777J48905_10892771 | 580 |
| 715 | 3300003320 | rootH2_10014247 | rootH2_100142472 | 580 |
| 716 | 3300003752 | Ga0055539_1000542 | Ga0055539_10005426 | 580 |
| 717 | 3300003752 | Ga0055539_1001036 | Ga0055539_10010367 | 580 |
| 718 | 3300003756 | Ga0055533_1000016 | Ga0055533_10000169 | 580 |
| 719 | 3300003759 | Ga0055525_1000689 | Ga0055525_10006896 | 580 |
| 720 | 3300003761 | Ga0055535_1000221 | Ga0055535_100022151 | 580 |
| 721 | 3300003762 | Ga0055542_1000129 | Ga0055542_10001297 | 580 |
| 722 | 3300003771 | Ga0055526_1016398 | Ga0055526_10163981 | 580 |
| 723 | 3300003773 | Ga0055537_1000205 | Ga0055537_10002052 | 580 |
| 724 | 3300003773 | Ga0055537_1000717 | Ga0055537_10007171 | 580 |
| 725 | 3300003775 | Ga0055524_1000073 | Ga0055524_100007372 | 580 |
| 726 | 3300003775 | Ga0055524_1000109 | Ga0055524_100010924 | 580 |
| 727 | 3300003781 | Ga0055536_1022076 | Ga0055536_10220761 | 580 |
| 728 | 3300003784 | Ga0055534_1000337 | Ga0055534_100033728 | 580 |
| 729 | 3300003784 | Ga0055534_1000363 | Ga0055534_100036319 | 580 |
| 730 | 3300003784 | Ga0055534_1000467 | Ga0055534_10004676 | 580 |
| 731 | 3300003790 | Ga0055528_1000289 | Ga0055528_100028923 | 580 |
| 732 | 3300003790 | Ga0055528_1006545 | Ga0055528_10065454 | 580 |
| 733 | 3300003790 | Ga0055528_1013900 | Ga0055528_10139001 | 580 |
| 734 | 3300003791 | Ga0055530_10001804 | Ga0055530_100018041 | 580 |
| 735 | 3300003792 | Ga0055540_1000013 | Ga0055540_1000013178 | 580 |
| 736 | 3300003792 | Ga0055540_1000037 | Ga0055540_100003784 | 580 |
| 737 | 3300003794 | Ga0055531_10000112 | Ga0055531_1000011283 | 580 |
| 738 | 3300003794 | Ga0055531_10000158 | Ga0055531_1000015874 | 580 |
| 739 | 3300005262 | Ga0065165_1002013 | Ga0065165_100201318 | 580 |
| 740 | 3300005289 | Ga0065704_10072444 | Ga0065704_100724442 | 580 |
| 741 | 3300005295 | Ga0065707_10093995 | Ga0065707_100939952 | 580 |
| 742 | 3300005338 | Ga0068868_100096553 | Ga0068868_1000965532 | 580 |
| 743 | 3300005347 | Ga0070668_100017950 | Ga0070668_1000179504 | 580 |
| 744 | 3300005353 | Ga0070669_100083648 | Ga0070669_1000836482 | 580 |
| 745 | 3300005355 | Ga0070671_100086173 | Ga0070671_1000861732 | 580 |
| 746 | 3300005455 | Ga0070663_100000518 | Ga0070663_10000051821 | 580 |
| 747 | 3300005457 | Ga0070662_100072457 | Ga0070662_1000724572 | 580 |
| 748 | 3300005459 | Ga0068867_100001947 | Ga0068867_1000019477 | 580 |
| 749 | 3300005459 | Ga0068867_100044545 | Ga0068867_1000445452 | 580 |
| 750 | 3300005459 | Ga0068867_100123527 | Ga0068867_1001235271 | 580 |
| 751 | 3300005467 | Ga0070706_100002083 | Ga0070706_1000020837 | 580 |
| 752 | 3300005530 | Ga0070679_100039416 | Ga0070679_1000394165 | 580 |
| 753 | 3300005543 | Ga0070672_100017220 | Ga0070672_1000172205 | 580 |
| 754 | 3300005548 | Ga0070665_100037542 | Ga0070665_1000375423 | 580 |
| 755 | 3300005563 | Ga0068855_100013962 | Ga0068855_1000139626 | 580 |
| 756 | 3300005577 | Ga0068857_100008925 | Ga0068857_1000089252 | 580 |
| 757 | 3300005577 | Ga0068857_100026238 | Ga0068857_1000262384 | 580 |
| 758 | 3300005614 | Ga0068856_100001351 | Ga0068856_10000135123 | 580 |
| 759 | 3300005614 | Ga0068856_100037330 | Ga0068856_1000373302 | 580 |
| 760 | 3300005618 | Ga0068864_100018085 | Ga0068864_1000180855 | 580 |
| 761 | 3300005719 | Ga0068861_100034989 | Ga0068861_1000349892 | 580 |
| 762 | 3300005843 | Ga0068860_100002278 | Ga0068860_1000022786 | 580 |
| 763 | 3300005844 | Ga0068862_100009207 | Ga0068862_1000092078 | 580 |
| 764 | 3300005844 | Ga0068862_100062922 | Ga0068862_1000629223 | 580 |
| 765 | 3300005844 | Ga0068862_100082879 | Ga0068862_1000828793 | 580 |
| 766 | 3300006038 | Ga0075365_10035474 | Ga0075365_100354743 | 580 |
| 767 | 3300006048 | Ga0075363_100005602 | Ga0075363_1000056024 | 580 |
| 768 | 3300006048 | Ga0075363_100007828 | Ga0075363_1000078286 | 580 |
| 769 | 3300006048 | Ga0075363_100009510 | Ga0075363_1000095102 | 580 |
| 770 | 3300006177 | Ga0075362_10033082 | Ga0075362_100330822 | 580 |
| 771 | 3300006195 | Ga0075366_10001208 | Ga0075366_1000120816 | 580 |
| 772 | 3300006195 | Ga0075366_10001813 | Ga0075366_100018139 | 580 |
| 773 | 3300006195 | Ga0075366_10003680 | Ga0075366_100036808 | 580 |
| 774 | 3300006195 | Ga0075366_10026687 | Ga0075366_100266874 | 580 |
| 775 | 3300006353 | Ga0075370_10000288 | Ga0075370_1000028820 | 580 |
| 776 | 3300006353 | Ga0075370_10000910 | Ga0075370_100009103 | 580 |
| 777 | 3300006353 | Ga0075370_10006446 | Ga0075370_100064462 | 580 |
| 778 | 3300006353 | Ga0075370_10010497 | Ga0075370_100104972 | 580 |
| 779 | 3300006353 | Ga0075370_10055769 | Ga0075370_100557691 | 580 |
| 780 | 3300006353 | Ga0075370_10056336 | Ga0075370_100563362 | 580 |
| 781 | 3300006880 | Ga0075429_100003110 | Ga0075429_10000311011 | 580 |
| 782 | 3300006880 | Ga0075429_100096308 | Ga0075429_1000963082 | 580 |
| 783 | 3300006881 | Ga0068865_100018444 | Ga0068865_1000184445 | 580 |
| 784 | 3300006946 | Ga0079104_1000001 | Ga0079104_1000001172 | 580 |
| 785 | 3300006948 | Ga0099826_10001050 | Ga0099826_100010502 | 580 |
| 786 | 3300009036 | Ga0105244_10003265 | Ga0105244_100032651 | 580 |
| 787 | 3300009093 | Ga0105240_10005235 | Ga0105240_1000523519 | 580 |
| 788 | 3300009093 | Ga0105240_10019777 | Ga0105240_100197773 | 580 |
| 789 | 3300009093 | Ga0105240_10026481 | Ga0105240_100264814 | 580 |
| 790 | 3300009148 | Ga0105243_10002550 | Ga0105243_1000255015 | 580 |
| 791 | 3300009148 | Ga0105243_10031316 | Ga0105243_100313161 | 580 |
| 792 | 3300009177 | Ga0105248_10004455 | Ga0105248_1000445512 | 580 |
| 793 | 3300009545 | Ga0105237_10002475 | Ga0105237_100024753 | 580 |
| 794 | 3300009545 | Ga0105237_10017120 | Ga0105237_100171206 | 580 |
| 795 | 3300009545 | Ga0105237_10109708 | Ga0105237_101097083 | 580 |
| 796 | 3300010375 | Ga0105239_10001374 | Ga0105239_1000137424 | 580 |
| 797 | 3300010375 | Ga0105239_10047382 | Ga0105239_100473822 | 580 |
| 798 | 3300013105 | Ga0157369_10008671 | Ga0157369_100086718 | 580 |
| 799 | 3300013105 | Ga0157369_10069515 | Ga0157369_100695152 | 580 |
| 800 | 3300013306 | Ga0163162_10001398 | Ga0163162_1000139819 | 580 |
| 801 | 3300013308 | Ga0157375_10031637 | Ga0157375_100316374 | 580 |
| 802 | 3300014497 | Ga0182008_10005957 | Ga0182008_100059575 | 580 |
| 803 | 3300014497 | Ga0182008_10018374 | Ga0182008_100183741 | 580 |
| 804 | 3300014968 | Ga0157379_10008673 | Ga0157379_100086734 | 580 |
| 805 | 3300014968 | Ga0157379_10053219 | Ga0157379_100532193 | 580 |
| 806 | 3300015261 | Ga0182006_1008452 | Ga0182006_10084525 | 580 |
| 807 | 3300015262 | Ga0182007_10000951 | Ga0182007_100009516 | 580 |
| 808 | 3300015683 | Ga0183362_10003 | Ga0183362_10003585 | 580 |
| 809 | 3300017792 | Ga0163161_10001265 | Ga0163161_100012651 | 580 |
| 810 | 3300017792 | Ga0163161_10002188 | Ga0163161_100021881 | 580 |
| 811 | 3300017792 | Ga0163161_10010510 | Ga0163161_100105105 | 580 |
| 812 | 3300021361 | Ga0213872_10000202 | Ga0213872_1000020217 | 580 |
| 813 | 3300021361 | Ga0213872_10000474 | Ga0213872_1000047415 | 580 |
| 814 | 3300025206 | Ga0209435_100002 | Ga0209435_100002206 | 580 |
| 815 | 3300025226 | Ga0209674_100041 | Ga0209674_100041373 | 580 |
| 816 | 3300025228 | Ga0209672_102177 | Ga0209672_1021773 | 580 |
| 817 | 3300025230 | Ga0209563_100043 | Ga0209563_100043373 | 580 |
| 818 | 3300025231 | Ga0207427_100381 | Ga0207427_10038124 | 580 |
| 819 | 3300025242 | Ga0209258_100240 | Ga0209258_1002408 | 580 |
| 820 | 3300025242 | Ga0209258_100659 | Ga0209258_10065922 | 580 |
| 821 | 3300025245 | Ga0207425_1000221 | Ga0207425_100022133 | 580 |
| 822 | 3300025245 | Ga0207425_1001344 | Ga0207425_10013444 | 580 |
| 823 | 3300025245 | Ga0207425_1002962 | Ga0207425_10029622 | 580 |
| 824 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012349 | 580 |
| 825 | 3300025246 | Ga0209646_1000157 | Ga0209646_100015769 | 580 |
| 826 | 3300025250 | Ga0209026_1000001 | Ga0209026_10000011006 | 580 |
| 827 | 3300025250 | Ga0209026_1000006 | Ga0209026_10000069 | 580 |
| 828 | 3300025253 | Ga0209677_100900 | Ga0209677_1009007 | 580 |
| 829 | 3300025253 | Ga0209677_101252 | Ga0209677_1012526 | 580 |
| 830 | 3300025254 | Ga0209148_1000033 | Ga0209148_10000338 | 580 |
| 831 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011980 | 580 |
| 832 | 3300025256 | Ga0209759_1000194 | Ga0209759_100019486 | 580 |
| 833 | 3300025256 | Ga0209759_1005336 | Ga0209759_10053363 | 580 |
| 834 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012161 | 580 |
| 835 | 3300025258 | Ga0209129_1000054 | Ga0209129_100005433 | 580 |
| 836 | 3300025263 | Ga0209565_1000067 | Ga0209565_1000067179 | 580 |
| 837 | 3300025263 | Ga0209565_1000128 | Ga0209565_100012882 | 580 |
| 838 | 3300025273 | Ga0209673_1000008 | Ga0209673_1000008105 | 580 |
| 839 | 3300025273 | Ga0209673_1000097 | Ga0209673_100009765 | 580 |
| 840 | 3300025284 | Ga0209130_1001362 | Ga0209130_100136213 | 580 |
| 841 | 3300025284 | Ga0209130_1001611 | Ga0209130_10016112 | 580 |
| 842 | 3300025291 | Ga0209675_1000038 | Ga0209675_100003865 | 580 |
| 843 | 3300025291 | Ga0209675_1000527 | Ga0209675_100052719 | 580 |
| 844 | 3300025291 | Ga0209675_1001272 | Ga0209675_10012724 | 580 |
| 845 | 3300025291 | Ga0209675_1001985 | Ga0209675_10019853 | 580 |
| 846 | 3300025291 | Ga0209675_1016309 | Ga0209675_10163092 | 580 |
| 847 | 3300025292 | Ga0209676_1000023 | Ga0209676_1000023329 | 580 |
| 848 | 3300025292 | Ga0209676_1000739 | Ga0209676_100073930 | 580 |
| 849 | 3300025292 | Ga0209676_1000836 | Ga0209676_100083616 | 580 |
| 850 | 3300025292 | Ga0209676_1005022 | Ga0209676_10050224 | 580 |
| 851 | 3300025294 | Ga0209025_1000174 | Ga0209025_1000174121 | 580 |
| 852 | 3300025294 | Ga0209025_1001066 | Ga0209025_100106621 | 580 |
| 853 | 3300025294 | Ga0209025_1003753 | Ga0209025_10037537 | 580 |
| 854 | 3300025294 | Ga0209025_1010615 | Ga0209025_10106157 | 580 |
| 855 | 3300025294 | Ga0209025_1029285 | Ga0209025_10292851 | 580 |
| 856 | 3300025294 | Ga0209025_1030949 | Ga0209025_10309492 | 580 |
| 857 | 3300025295 | Ga0209564_1000022 | Ga0209564_1000022353 | 580 |
| 858 | 3300025295 | Ga0209564_1002377 | Ga0209564_10023777 | 580 |
| 859 | 3300025295 | Ga0209564_1003110 | Ga0209564_10031106 | 580 |
| 860 | 3300025297 | Ga0209758_1000034 | Ga0209758_1000034405 | 580 |
| 861 | 3300025297 | Ga0209758_1000124 | Ga0209758_100012490 | 580 |
| 862 | 3300025297 | Ga0209758_1000234 | Ga0209758_10002346 | 580 |
| 863 | 3300025298 | Ga0209050_1000022 | Ga0209050_1000022311 | 580 |
| 864 | 3300025298 | Ga0209050_1000315 | Ga0209050_100031548 | 580 |
| 865 | 3300025298 | Ga0209050_1001261 | Ga0209050_100126118 | 580 |
| 866 | 3300025298 | Ga0209050_1007315 | Ga0209050_10073157 | 580 |
| 867 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011797 | 580 |
| 868 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015324 | 580 |
| 869 | 3300025299 | Ga0209256_1000165 | Ga0209256_1000165120 | 580 |
| 870 | 3300025302 | Ga0207426_1000067 | Ga0207426_1000067294 | 580 |
| 871 | 3300025303 | Ga0209051_1000013 | Ga0209051_1000013311 | 580 |
| 872 | 3300025303 | Ga0209051_1000022 | Ga0209051_100002289 | 580 |
| 873 | 3300025303 | Ga0209051_1000315 | Ga0209051_100031520 | 580 |
| 874 | 3300025303 | Ga0209051_1002634 | Ga0209051_100263414 | 580 |
| 875 | 3300025304 | Ga0209257_1000030 | Ga0209257_1000030286 | 580 |
| 876 | 3300025304 | Ga0209257_1000042 | Ga0209257_1000042176 | 580 |
| 877 | 3300025304 | Ga0209257_1000057 | Ga0209257_1000057228 | 580 |
| 878 | 3300025304 | Ga0209257_1000309 | Ga0209257_100030932 | 580 |
| 879 | 3300025304 | Ga0209257_1009377 | Ga0209257_10093775 | 580 |
| 880 | 3300025304 | Ga0209257_1013165 | Ga0209257_10131654 | 580 |
| 881 | 3300025321 | Ga0207656_10001162 | Ga0207656_100011625 | 580 |
| 882 | 3300025728 | Ga0207655_1000639 | Ga0207655_100063924 | 580 |
| 883 | 3300025910 | Ga0207684_10004074 | Ga0207684_1000407412 | 580 |
| 884 | 3300025913 | Ga0207695_10018847 | Ga0207695_100188478 | 580 |
| 885 | 3300025913 | Ga0207695_10040979 | Ga0207695_100409794 | 580 |
| 886 | 3300025914 | Ga0207671_10017064 | Ga0207671_100170644 | 580 |
| 887 | 3300025914 | Ga0207671_10032349 | Ga0207671_100323492 | 580 |
| 888 | 3300025923 | Ga0207681_10058859 | Ga0207681_100588592 | 580 |
| 889 | 3300025924 | Ga0207694_10007736 | Ga0207694_1000773610 | 580 |
| 890 | 3300025933 | Ga0207706_10003908 | Ga0207706_100039081 | 580 |
| 891 | 3300025933 | Ga0207706_10095167 | Ga0207706_100951672 | 580 |
| 892 | 3300025933 | Ga0207706_10133846 | Ga0207706_101338461 | 580 |
| 893 | 3300025935 | Ga0207709_10000874 | Ga0207709_100008745 | 580 |
| 894 | 3300025935 | Ga0207709_10008146 | Ga0207709_100081463 | 580 |
| 895 | 3300025935 | Ga0207709_10015294 | Ga0207709_100152944 | 580 |
| 896 | 3300025938 | Ga0207704_10001487 | Ga0207704_1000148713 | 580 |
| 897 | 3300025940 | Ga0207691_10046301 | Ga0207691_100463012 | 580 |
| 898 | 3300025940 | Ga0207691_10069360 | Ga0207691_100693603 | 580 |
| 899 | 3300025941 | Ga0207711_10044319 | Ga0207711_100443194 | 580 |
| 900 | 3300025949 | Ga0207667_10080484 | Ga0207667_100804843 | 580 |
| 901 | 3300025961 | Ga0207712_10120631 | Ga0207712_101206311 | 580 |
| 902 | 3300026023 | Ga0207677_10024519 | Ga0207677_100245192 | 580 |
| 903 | 3300026067 | Ga0207678_10000837 | Ga0207678_100008373 | 580 |
| 904 | 3300026078 | Ga0207702_10002902 | Ga0207702_1000290210 | 580 |
| 905 | 3300026078 | Ga0207702_10051306 | Ga0207702_100513062 | 580 |
| 906 | 3300026088 | Ga0207641_10013071 | Ga0207641_100130713 | 580 |
| 907 | 3300026089 | Ga0207648_10011123 | Ga0207648_100111233 | 580 |
| 908 | 3300026089 | Ga0207648_10054826 | Ga0207648_100548262 | 580 |
| 909 | 3300026095 | Ga0207676_10013160 | Ga0207676_100131605 | 580 |
| 910 | 3300026116 | Ga0207674_10004639 | Ga0207674_1000463910 | 580 |
| 911 | 3300026118 | Ga0207675_100025201 | Ga0207675_1000252014 | 580 |
| 912 | 3300027111 | Ga0209281_1000057 | Ga0209281_1000057145 | 580 |
| 913 | 3300027252 | Ga0209973_1000841 | Ga0209973_10008412 | 580 |
| 914 | 3300027526 | Ga0209968_1000489 | Ga0209968_10004895 | 580 |
| 915 | 3300027614 | Ga0209970_1000052 | Ga0209970_100005218 | 580 |
| 916 | 3300027666 | Ga0209282_1000250 | Ga0209282_10002502 | 580 |
| 917 | 3300027695 | Ga0209966_1000033 | Ga0209966_10000337 | 580 |
| 918 | 3300027866 | Ga0209813_10016340 | Ga0209813_100163402 | 580 |
| 919 | 3300027876 | Ga0209974_10000240 | Ga0209974_1000024018 | 580 |
| 920 | 3300027876 | Ga0209974_10015858 | Ga0209974_100158581 | 580 |
| 921 | 3300028379 | Ga0268266_10029093 | Ga0268266_100290934 | 580 |
| 922 | 3300028380 | Ga0268265_10019031 | Ga0268265_100190313 | 580 |
| 923 | 3300028794 | Ga0307515_10000354 | Ga0307515_1000035447 | 580 |
| 924 | 3300028794 | Ga0307515_10000472 | Ga0307515_1000047296 | 580 |
| 925 | 3300028794 | Ga0307515_10005786 | Ga0307515_1000578613 | 580 |
| 926 | 3300028794 | Ga0307515_10007796 | Ga0307515_100077969 | 580 |
| 927 | 3300028794 | Ga0307515_10009311 | Ga0307515_100093111 | 580 |
| 928 | 3300028794 | Ga0307515_10011216 | Ga0307515_1001121618 | 580 |
| 929 | 3300030735 | Ga0316178_1128978 | Ga0316178_11289782 | 580 |
| 930 | 3300031238 | Ga0265332_10000125 | Ga0265332_1000012510 | 580 |
| 931 | 3300031251 | Ga0265327_10001654 | Ga0265327_1000165427 | 580 |
| 932 | 3300031456 | Ga0307513_10000038 | Ga0307513_10000038159 | 580 |
| 933 | 3300031456 | Ga0307513_10000117 | Ga0307513_10000117112 | 580 |
| 934 | 3300031456 | Ga0307513_10010732 | Ga0307513_100107323 | 580 |
| 935 | 3300031456 | Ga0307513_10038056 | Ga0307513_100380563 | 580 |
| 936 | 3300031456 | Ga0307513_10071355 | Ga0307513_100713553 | 580 |
| 937 | 3300031507 | Ga0307509_10009732 | Ga0307509_100097328 | 580 |
| 938 | 3300031507 | Ga0307509_10022375 | Ga0307509_100223751 | 580 |
| 939 | 3300031507 | Ga0307509_10022711 | Ga0307509_100227112 | 580 |
| 940 | 3300031548 | Ga0307408_100000288 | Ga0307408_10000028842 | 580 |
| 941 | 3300031548 | Ga0307408_100010362 | Ga0307408_1000103623 | 580 |
| 942 | 3300031616 | Ga0307508_10000043 | Ga0307508_1000004376 | 580 |
| 943 | 3300031616 | Ga0307508_10001327 | Ga0307508_1000132720 | 580 |
| 944 | 3300031649 | Ga0307514_10000920 | Ga0307514_1000092020 | 580 |
| 945 | 3300031649 | Ga0307514_10001251 | Ga0307514_1000125110 | 580 |
| 946 | 3300031649 | Ga0307514_10039025 | Ga0307514_100390252 | 580 |
| 947 | 3300031730 | Ga0307516_10000953 | Ga0307516_100009532 | 580 |
| 948 | 3300031730 | Ga0307516_10001691 | Ga0307516_1000169123 | 580 |
| 949 | 3300031730 | Ga0307516_10002244 | Ga0307516_100022448 | 580 |
| 950 | 3300031730 | Ga0307516_10013442 | Ga0307516_100134423 | 580 |
| 951 | 3300031730 | Ga0307516_10023184 | Ga0307516_100231843 | 580 |
| 952 | 3300031901 | Ga0307406_10003957 | Ga0307406_100039578 | 580 |
| 953 | 3300032005 | Ga0307411_10012273 | Ga0307411_100122732 | 580 |
| 954 | 3300032005 | Ga0307411_10013355 | Ga0307411_100133554 | 580 |
| 955 | 3300033180 | Ga0307510_10015886 | Ga0307510_100158865 | 580 |
| 956 | 3300035114 | Ga0373939_0000049 | Ga0373939_0000049_28986_30731 | 580 |
| 957 | 3300035121 | Ga0373960_0000732 | Ga0373960_0000732_4650_6395 | 580 |
| 958 | 3300035691 | Ga0373931_0005852 | Ga0373931_0005852_3812_5557 | 580 |
| 959 | 3300035691 | Ga0373931_0006014 | Ga0373931_0006014_486_2234 | 580 |
| 960 | 3300035691 | Ga0373931_0016960 | Ga0373931_0016960_193_1938 | 580 |
| 961 | 3300036401 | Ga0373937_0007893 | Ga0373937_0007893_6978_8723 | 580 |
| 962 | 3300037312 | Ga0395899_0006534 | Ga0395899_0006534_4200_5945 | 580 |
| 963 | 3300037418 | Ga0395900_0046894 | Ga0395900_0046894_488_2233 | 580 |
| 964 | 3300037466 | Ga0395898_0007278 | Ga0395898_0007278_1235_2980 | 580 |
| 965 | 3300037466 | Ga0395898_0010814 | Ga0395898_0010814_5484_7229 | 580 |
| 966 | 3300037466 | Ga0395898_0026413 | Ga0395898_0026413_1763_3508 | 580 |
| 967 | 3300037466 | Ga0395898_0072168 | Ga0395898_0072168_161_1906 | 580 |
| 968 | 3300037471 | Ga0395905_0000088 | Ga0395905_0000088_34931_36676 | 580 |
| 969 | 3300037471 | Ga0395905_0000151 | Ga0395905_0000151_24338_26083 | 580 |
| 970 | 3300037471 | Ga0395905_0001245 | Ga0395905_0001245_13713_15458 | 580 |
| 971 | 3300037471 | Ga0395905_0012026 | Ga0395905_0012026_5125_6870 | 580 |
| 972 | 3300037471 | Ga0395905_0014382 | Ga0395905_0014382_670_2415 | 580 |
| 973 | 3300037471 | Ga0395905_0046455 | Ga0395905_0046455_1636_3381 | 580 |
| 974 | 3300037471 | Ga0395905_0186914 | Ga0395905_0186914_89_1834 | 580 |
| 975 | 3300038443 | Ga0395901_0138953 | Ga0395901_0138953_137_1882 | 580 |
| 976 | 3300039447 | Ga0436361_0379569 | Ga0436361_0379569_36770_38515 | 580 |
| 977 | 3300039447 | Ga0436361_1096550 | Ga0436361_1096550_39240_40985 | 580 |
| 978 | 3300041404 | Ga0439436_0000328 | Ga0439436_0000328_6723_8468 | 580 |
| 979 | 3300042002 | Ga0439442_004178 | Ga0439442_004178_264_2009 | 580 |
| 980 | 3300042006 | Ga0439432_001277 | Ga0439432_001277_5763_7508 | 580 |
| 981 | 3300042007 | Ga0439449_0001202 | Ga0439449_0001202_5133_6878 | 580 |
| 982 | 3300042014 | Ga0439457_007647 | Ga0439457_007647_566_2311 | 580 |
| 983 | 3300042435 | Ga0439434_0008547 | Ga0439434_0008547_1224_2969 | 580 |
| 984 | 3300042531 | Ga0450918_000496 | Ga0450918_000496_1473_3218 | 580 |
| 985 | 3300042876 | Ga0451577_0000276 | Ga0451577_0000276_75413_77158 | 580 |
| 986 | 3300042876 | Ga0451577_0067099 | Ga0451577_0067099_1347_3089 | 580 |
| 987 | 3300044656 | Ga0466969_0000008 | Ga0466969_0000008_23239_24987 | 580 |
| 988 | 3300044712 | Ga0453684_0000891 | Ga0453684_0000891_22341_24086 | 580 |
| 989 | 3300044712 | Ga0453684_0032467 | Ga0453684_0032467_4469_6214 | 580 |
| 990 | 3300044712 | Ga0453684_0099280 | Ga0453684_0099280_249_1994 | 580 |
| 991 | 3300044765 | Ga0466970_0003291 | Ga0466970_0003291_407_2152 | 580 |
| 992 | 3300044842 | Ga0466957_0006607 | Ga0466957_0006607_4534_6279 | 580 |
| 993 | 3300045049 | Ga0466959_0000192 | Ga0466959_0000192_20365_22110 | 580 |
| 994 | 3300045051 | Ga0451576_0002088 | Ga0451576_0002088_12232_13977 | 580 |
| 995 | 3300045051 | Ga0451576_0002262 | Ga0451576_0002262_5496_7238 | 580 |
| 996 | 3300045051 | Ga0451576_0004706 | Ga0451576_0004706_7936_9681 | 580 |
| 997 | 3300045051 | Ga0451576_0008890 | Ga0451576_0008890_1889_3634 | 580 |
| 998 | 3300045051 | Ga0451576_0132818 | Ga0451576_0132818_261_2006 | 580 |
| 999 | 3300045976 | Ga0466967_0052889 | Ga0466967_0052889_208_1953 | 580 |
| 1000 | 3300046454 | Ga0495592_0017214 | Ga0495592_0017214_3486_5231 | 580 |
| 1001 | 3300046460 | Ga0495638_0026584 | Ga0495638_0026584_126_1871 | 580 |
| 1002 | 3300046506 | Ga0495583_0001389 | Ga0495583_0001389_16438_18183 | 580 |
| 1003 | 3300046507 | Ga0495606_0002457 | Ga0495606_0002457_3677_5422 | 580 |
| 1004 | 3300046520 | Ga0495637_0006661 | Ga0495637_0006661_3971_5716 | 580 |
| 1005 | 3300046522 | Ga0495643_0045929 | Ga0495643_0045929_331_2076 | 580 |
| 1006 | 3300046528 | Ga0495642_0009294 | Ga0495642_0009294_817_2562 | 580 |
| 1007 | 3300046542 | Ga0495597_0001315 | Ga0495597_0001315_16395_18140 | 580 |
| 1008 | 3300046542 | Ga0495597_0016711 | Ga0495597_0016711_1150_2895 | 580 |
| 1009 | 3300046615 | Ga0495656_0000090 | Ga0495656_0000090_21310_23058 | 580 |
| 1010 | 3300046660 | Ga0495625_0001055 | Ga0495625_0001055_33947_35692 | 580 |
| 1011 | 3300046660 | Ga0495625_0003495 | Ga0495625_0003495_8241_9986 | 580 |
| 1012 | 3300046660 | Ga0495625_0022664 | Ga0495625_0022664_2606_4351 | 580 |
| 1013 | 3300046674 | Ga0495588_0021039 | Ga0495588_0021039_466_2211 | 580 |
| 1014 | 3300046694 | Ga0495649_0006470 | Ga0495649_0006470_4128_5873 | 580 |
| 1015 | 3300047321 | Ga0495676_0022211 | Ga0495676_0022211_2448_4193 | 580 |
| 1016 | 3300047443 | Ga0495687_000705 | Ga0495687_000705_35262_37007 | 580 |
| 1017 | 3300047443 | Ga0495687_001104 | Ga0495687_001104_1159_2904 | 580 |
| 1018 | 3300047673 | Ga0495593_0008709 | Ga0495593_0008709_3804_5549 | 580 |
| 1019 | 3300048091 | Ga0495626_0047399 | Ga0495626_0047399_36_1781 | 580 |
| 1020 | 3300048904 | Ga0496101_0001103 | Ga0496101_0001103_10540_12288 | 580 |
| 1021 | 3300048905 | Ga0496102_0137639 | Ga0496102_0137639_392_2140 | 580 |
| 1022 | 3300048907 | Ga0496104_0035582 | Ga0496104_0035582_205_1953 | 580 |
| 1023 | 3300048908 | Ga0496105_0010700 | Ga0496105_0010700_128_1876 | 580 |
| 1024 | 3300048913 | Ga0496110_0059350 | Ga0496110_0059350_1356_3104 | 580 |
| 1025 | 3300048916 | Ga0496113_0002861 | Ga0496113_0002861_1178_2923 | 580 |
| 1026 | 3300048917 | Ga0496114_0003154 | Ga0496114_0003154_10204_11949 | 580 |
| 1027 | 3300048919 | Ga0496116_0017023 | Ga0496116_0017023_1953_3698 | 580 |
| 1028 | 3300048921 | Ga0496118_0072564 | Ga0496118_0072564_347_2092 | 580 |
| 1029 | 3300048925 | Ga0496122_0003683 | Ga0496122_0003683_13625_15370 | 580 |
| 1030 | 3300048926 | Ga0496123_0000274 | Ga0496123_0000274_8669_10414 | 580 |
| 1031 | 3300048927 | Ga0496124_0001458 | Ga0496124_0001458_11270_13015 | 580 |
| 1032 | 3300049579 | Ga0501043_0000180 | Ga0501043_0000180_12308_14053 | 580 |
| 1033 | 3300049580 | Ga0501046_0000226 | Ga0501046_0000226_12207_13952 | 580 |
| 1034 | 3300049580 | Ga0501046_0017038 | Ga0501046_0017038_3247_4992 | 580 |
| 1035 | 3300049581 | Ga0501047_0000302 | Ga0501047_0000302_42857_44602 | 580 |
| 1036 | 3300049582 | Ga0501048_0002019 | Ga0501048_0002019_1531_3276 | 580 |
| 1037 | 3300049649 | Ga0501198_000012 | Ga0501198_000012_35503_37248 | 580 |
| 1038 | 3300049662 | Ga0501222_000010 | Ga0501222_000010_35509_37254 | 580 |
| 1039 | 3300049665 | Ga0501227_002638 | Ga0501227_002638_1293_3038 | 580 |
| 1040 | 3300049704 | Ga0501221_002698 | Ga0501221_002698_896_2641 | 580 |
| 1041 | 3300049824 | Ga0501045_0009382 | Ga0501045_0009382_3913_5658 | 580 |
| 1042 | 3300050490 | nmdc:mga03n38_5586_c1 | nmdc:mga03n38_5586_c1_927_2672 | 580 |
| 1043 | 3300050491 | nmdc:mga00v17_76928_c1 | nmdc:mga00v17_76928_c1_136_1881 | 580 |
| 1044 | 3300050493 | nmdc:mga0k408_10294_c1 | nmdc:mga0k408_10294_c1_134_1879 | 580 |
| 1045 | 3300050493 | nmdc:mga0k408_14915_c1 | nmdc:mga0k408_14915_c1_2330_4087 | 580 |
| 1046 | 3300050493 | nmdc:mga0k408_1770_c1 | nmdc:mga0k408_1770_c1_6185_7930 | 580 |
| 1047 | 3300050493 | nmdc:mga0k408_19088_c1 | nmdc:mga0k408_19088_c1_1080_2825 | 580 |
| 1048 | 3300050493 | nmdc:mga0k408_2369_c1 | nmdc:mga0k408_2369_c1_6663_8408 | 580 |
| 1049 | 3300050493 | nmdc:mga0k408_23982_c1 | nmdc:mga0k408_23982_c1_163_1908 | 580 |
| 1050 | 3300050493 | nmdc:mga0k408_254_c1 | nmdc:mga0k408_254_c1_15285_17030 | 580 |
| 1051 | 3300050493 | nmdc:mga0k408_40618_c1 | nmdc:mga0k408_40618_c1_749_2494 | 580 |
| 1052 | 3300050493 | nmdc:mga0k408_42876_c1 | nmdc:mga0k408_42876_c1_107_1852 | 580 |
| 1053 | 3300050494 | nmdc:mga06z11_49102_c1 | nmdc:mga06z11_49102_c1_67_1812 | 580 |
| 1054 | 3300050495 | nmdc:mga04h51_14278_c1 | nmdc:mga04h51_14278_c1_327_2072 | 580 |
| 1055 | 3300050496 | nmdc:mga07m45_1683_c1 | nmdc:mga07m45_1683_c1_3655_5400 | 580 |
| 1056 | 3300050496 | nmdc:mga07m45_31899_c1 | nmdc:mga07m45_31899_c1_1006_2751 | 580 |
| 1057 | 3300050496 | nmdc:mga07m45_3705_c1 | nmdc:mga07m45_3705_c1_5232_6977 | 580 |
| 1058 | 3300050496 | nmdc:mga07m45_4400_c1 | nmdc:mga07m45_4400_c1_1727_3484 | 580 |
| 1059 | 3300050496 | nmdc:mga07m45_4458_c1 | nmdc:mga07m45_4458_c1_4971_6716 | 580 |
| 1060 | 3300050496 | nmdc:mga07m45_9703_c2 | nmdc:mga07m45_9703_c2_209_1954 | 580 |
| 1061 | 3300050508 | nmdc:mga09592_17097_c1 | nmdc:mga09592_17097_c1_278_2023 | 580 |
| 1062 | 3300053086 | Ga0500578_0001060 | Ga0500578_0001060_18690_20435 | 580 |
| 1063 | 3300053093 | Ga0500651_0000400 | Ga0500651_0000400_4145_5890 | 580 |
| 1064 | 3300053110 | Ga0500571_000129 | Ga0500571_000129_19554_21299 | 580 |
| 1065 | 3300053117 | Ga0500593_000579 | Ga0500593_000579_8009_9751 | 580 |
| 1066 | 3300053117 | Ga0500593_002479 | Ga0500593_002479_945_2690 | 580 |
| 1067 | 3300053131 | Ga0500652_000299 | Ga0500652_000299_16218_18011 | 580 |
| 1068 | 3300053134 | Ga0500658_0003299 | Ga0500658_0003299_4182_5927 | 580 |
| 1069 | 3300053136 | Ga0500559_0000019 | Ga0500559_0000019_26973_28718 | 580 |
| 1070 | 3300053148 | Ga0500590_006655 | Ga0500590_006655_867_2612 | 580 |
| 1071 | 3300053154 | Ga0500619_000127 | Ga0500619_000127_11453_13198 | 580 |
| 1072 | 3300053156 | Ga0500622_0000125 | Ga0500622_0000125_18476_20269 | 580 |
| 1073 | 3300053156 | Ga0500622_0000788 | Ga0500622_0000788_16020_17765 | 580 |
| 1074 | 3300059421 | Ga0590071_001922 | Ga0590071_001922_2331_4097 | 580 |
| 1075 | 3300061719 | Ga0466962_0029616 | Ga0466962_0029616_849_2594 | 580 |
| 1076 | iso_pu_bacteria | 2945945610 | 2945946054 | 580 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ucm-assembly1.cif.gz_B | crystal structure of prolyl-trna synthetase from pseudomonas aeruginosa | 0.9396 | 1 | 578 |
| 5ucm-assembly1.cif.gz_B | crystal structure of prolyl-trna synthetase from pseudomonas aeruginosa | 0.9364 | 1 | 578 |
| 5xih-assembly1.cif.gz_A | crystal structure of toxoplasma gondii prolyl-trna synthetase (tgprs) in complex with inhibitor 5 | 0.8965 | 22 | 576 |
| 5xii-assembly1.cif.gz_A | crystal structure of toxoplasma gondii prolyl-trna synthetase (tgprs) in complex with inhibitor 6 | 0.8961 | 22 | 576 |
| 5xii-assembly2.cif.gz_B | crystal structure of toxoplasma gondii prolyl-trna synthetase (tgprs) in complex with inhibitor 6 | 0.8955 | 22 | 576 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1Z4_2_243_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9812 | 2 | 239 | 3.30.930.10 |
| af_P9WFT9_1_251_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9638 | 1 | 243 | 3.30.930.10 |
| af_Q2G1Z4_2_243_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9613 | 2 | 239 | 3.30.930.10 |
| af_Q75JK9_51_340_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9583 | 4 | 240 | 3.30.930.10 |
| 2j3mA02 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9525 | 19 | 473 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836WUL9-F1-model_v4 | deleted | 0.992 | 1 | 160 |
|
| AF-A0A1W9PTY6-F1-model_v4 | Proline--tRNA ligase (EC 6.1.1.15) (Prolyl-tRNA synthetase) | 0.9915 | 1 | 160 |
GO:0004827
GO:0005524 GO:0005829 GO:0006433 |
| AF-A0A359LYZ8-F1-model_v4 | Proline--tRNA ligase (EC 6.1.1.15) (Prolyl-tRNA synthetase) | 0.9905 | 1 | 160 |
GO:0004827
GO:0005524 GO:0005829 GO:0006433 |
| AF-A0A3D2JU10-F1-model_v4 | Proline--tRNA ligase (EC 6.1.1.15) | 0.9904 | 1 | 163 |
GO:0004827
GO:0005524 GO:0005829 GO:0006433 |
| AF-A0A7Y1T868-F1-model_v4 | Proline--tRNA ligase (EC 6.1.1.15) | 0.9891 | 1 | 134 |
GO:0004827
GO:0005524 GO:0005829 GO:0006433 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar