F489583
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1076 | 607 | 875 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300021321|Ga0214542_1021066|Ga0214542_10210665 |
| Length | 236 |
| Sequence | MTGARAYIRKTGPERDDMTGFGNNGLGPSRRAALTLIGAGALAVGGIVSARAATGDDEVLTEAKVLRDPDTPVAGNPDGNITIVEWSDYNCPYCRKLEPELRQVVQDDGKVRLVMKDWPILGPVSVTAARSALAAKFQGKYHQAHDALIGVSSRLTEPRINELLAAAGVDMDRLKRDLTGHAKDIDAILKRNNEQAEAFGFQGTPSFIVGKYRVPGVLSMTEFEQVIADARKAKMN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 17 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 18 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 19 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 20 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 21 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 22 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 23 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 24 | 2791355199 | |||
| 25 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 26 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 27 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 28 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 29 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 30 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 31 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 32 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 33 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 34 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 35 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 36 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 37 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 38 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 39 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 40 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 41 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 42 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 43 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 44 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 45 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 46 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 47 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 48 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 49 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 50 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 51 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 52 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 53 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 54 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 55 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 56 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 57 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 58 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 59 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 60 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 61 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 62 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 63 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 64 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 65 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 66 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 67 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 68 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 69 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 70 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 71 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 72 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 73 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 74 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 75 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 76 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 77 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 78 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 79 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 80 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 81 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 82 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 83 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 84 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 85 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 86 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 87 | 2904699407 | |||
| 88 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 89 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 90 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 91 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 92 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 93 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 94 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 95 | 2922368715 | |||
| 96 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 97 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 98 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 99 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 100 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 101 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 102 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 103 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 104 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 105 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 106 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 107 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 108 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 109 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 110 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 111 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 112 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 113 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 114 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 115 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 116 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 117 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 118 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 119 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 120 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 121 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 122 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 123 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 124 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 125 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 126 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 127 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 128 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 129 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 130 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 131 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 132 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 133 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 134 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 135 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 136 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 137 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 138 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 139 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 140 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 141 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 142 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 143 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 144 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 145 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 146 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 147 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 148 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 149 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 150 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 151 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 152 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 153 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 154 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 155 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 156 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 157 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 158 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 159 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 160 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 161 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 162 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 163 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 164 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 165 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 166 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 167 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 168 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 169 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 170 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 171 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 172 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 173 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 174 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 177 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 179 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 180 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 181 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 182 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 184 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 185 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 192 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 193 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 194 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 200 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 201 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 202 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 204 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 205 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 206 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 211 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 213 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 214 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 216 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 217 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 218 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 219 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 220 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 221 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 222 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 223 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 224 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 225 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 226 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 227 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 229 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 230 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 231 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 232 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 233 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 234 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 235 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 236 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 237 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 239 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 240 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 241 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 242 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 243 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 245 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 246 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 247 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 248 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 249 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 250 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 275 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 276 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 277 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 278 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 279 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 280 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 281 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 282 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 283 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 284 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 285 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 291 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 292 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 345 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 346 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 347 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 348 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 354 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 355 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 356 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 357 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 358 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 359 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 360 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 361 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 362 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 363 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 364 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 365 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 366 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 367 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 368 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 369 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 370 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 371 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 372 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 373 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 374 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 375 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 376 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 377 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 378 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 379 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 380 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 381 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 382 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 383 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 384 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 385 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 386 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 387 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 388 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 389 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 390 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 391 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 392 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 393 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 394 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 395 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 396 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 397 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 398 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 399 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 400 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 401 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 402 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 403 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 404 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 405 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 406 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 407 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 408 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 409 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 410 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 411 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 412 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 413 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 414 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 415 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 477 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 478 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 479 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 480 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 481 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 482 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 483 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 484 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 485 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 486 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 487 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 488 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 489 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 490 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 491 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 492 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 493 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 494 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 495 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 496 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 497 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 498 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 499 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 500 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 501 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 508 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 509 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 510 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 511 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 512 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 513 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 514 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 515 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 516 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 521 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 523 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 524 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 527 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 528 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 529 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 530 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 531 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 532 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 533 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 534 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 535 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 536 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 537 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 538 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 539 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 540 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 541 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 542 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 543 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 544 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 545 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 546 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 547 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 548 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 549 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 550 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 551 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 552 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 553 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 554 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 555 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 556 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 557 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 558 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 559 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 560 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 561 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 562 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 563 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 564 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 565 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 566 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 567 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 568 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 569 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 570 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 571 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 572 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 573 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 574 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 575 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 576 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 577 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 578 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 579 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 580 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 581 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 582 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 583 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 584 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 585 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 586 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 587 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 588 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 589 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 590 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 591 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 592 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 593 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 594 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 595 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 596 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 597 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 598 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 599 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 600 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 601 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 602 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 603 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 604 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 605 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 606 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 607 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.99 |
| Metatranscriptomes | 0.56 |
| Isolates | 18.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.31 |
| Nodule | 15.43 |
| Rhizoplane | 5.67 |
| Rhizosphere | 54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10006811 | 3300003203 | Bacteria | 5249 |
| 2 | JGI25153J46596_10002547 | 3300003215 | Bacteria | 10449 |
| 3 | JGI25153J46596_10003542 | 3300003215 | Bacteria | 8707 |
| 4 | JGI25153J46596_10004097 | 3300003215 | Bacteria | 7925 |
| 5 | JGI25153J46596_10014855 | 3300003215 | Bacteria | 3211 |
| 6 | rootH1_10016026 | 3300003323 | Bacteria | 1867 |
| 7 | JGI25160J50197_1001680 | 3300003354 | Bacteria | 10780 |
| 8 | JGI25160J50197_1003442 | 3300003354 | Bacteria | 7079 |
| 9 | JGI25160J50197_1005384 | 3300003354 | Bacteria | 5338 |
| 10 | JGI25404J52841_10025272 | 3300003659 | Bacteria | 1279 |
| 11 | JGI25404J52841_10030013 | 3300003659 | Bacteria | 1165 |
| 12 | Ga0055531_10007525 | 3300003794 | Bacteria | 5917 |
| 13 | Ga0055543_1007516 | 3300004625 | Bacteria | 2506 |
| 14 | Ga0065165_1000370 | 3300005262 | Bacteria | 73604 |
| 15 | Ga0065165_1006098 | 3300005262 | Bacteria | 6459 |
| 16 | Ga0065165_1008717 | 3300005262 | Bacteria | 4687 |
| 17 | Ga0070658_10021405 | 3300005327 | Bacteria | 5182 |
| 18 | Ga0070676_10394328 | 3300005328 | Bacteria | 961 |
| 19 | Ga0070683_100042686 | 3300005329 | Bacteria | 4176 |
| 20 | Ga0070683_100139749 | 3300005329 | Bacteria | 2294 |
| 21 | Ga0070683_100521941 | 3300005329 | Bacteria | 1135 |
| 22 | Ga0070670_100124537 | 3300005331 | Bacteria | 2224 |
| 23 | Ga0068869_100013181 | 3300005334 | Bacteria | 5491 |
| 24 | Ga0068869_100064153 | 3300005334 | Bacteria | 2701 |
| 25 | Ga0070680_100019553 | 3300005336 | Bacteria | 5369 |
| 26 | Ga0070680_100079829 | 3300005336 | Bacteria | 2697 |
| 27 | Ga0070680_100104138 | 3300005336 | Bacteria | 2358 |
| 28 | Ga0070680_100221827 | 3300005336 | Bacteria | 1596 |
| 29 | Ga0070682_100110140 | 3300005337 | Bacteria | 1834 |
| 30 | Ga0068868_100063339 | 3300005338 | Bacteria | 2933 |
| 31 | Ga0068868_100284079 | 3300005338 | Bacteria | 1401 |
| 32 | Ga0068868_100658426 | 3300005338 | Bacteria | 933 |
| 33 | Ga0070660_100244847 | 3300005339 | Bacteria | 1461 |
| 34 | Ga0070689_100474764 | 3300005340 | Bacteria | 1067 |
| 35 | Ga0070691_10090375 | 3300005341 | Bacteria | 1509 |
| 36 | Ga0070668_100008756 | 3300005347 | Bacteria | 7517 |
| 37 | Ga0070668_100027658 | 3300005347 | Bacteria | 4306 |
| 38 | Ga0070671_100032245 | 3300005355 | Bacteria | 4332 |
| 39 | Ga0070673_100719100 | 3300005364 | Bacteria | 918 |
| 40 | Ga0070667_100137265 | 3300005367 | Bacteria | 2138 |
| 41 | Ga0070667_100425118 | 3300005367 | Bacteria | 1212 |
| 42 | Ga0070709_10003090 | 3300005434 | Bacteria | 8947 |
| 43 | Ga0070709_10008369 | 3300005434 | Bacteria | 5681 |
| 44 | Ga0070714_100162069 | 3300005435 | Bacteria | 2024 |
| 45 | Ga0070713_100002234 | 3300005436 | Bacteria | 12560 |
| 46 | Ga0070713_100008846 | 3300005436 | Bacteria | 7167 |
| 47 | Ga0070713_101072866 | 3300005436 | Bacteria | 778 |
| 48 | Ga0070710_10000552 | 3300005437 | Bacteria | 17723 |
| 49 | Ga0070710_10172200 | 3300005437 | Bacteria | 1349 |
| 50 | Ga0070701_10348617 | 3300005438 | Bacteria | 924 |
| 51 | Ga0070711_100011221 | 3300005439 | Bacteria | 5556 |
| 52 | Ga0070711_100017038 | 3300005439 | Bacteria | 4621 |
| 53 | Ga0070711_100027986 | 3300005439 | Bacteria | 3705 |
| 54 | Ga0070711_100062871 | 3300005439 | Bacteria | 2589 |
| 55 | Ga0070711_100166520 | 3300005439 | Bacteria | 1676 |
| 56 | Ga0070711_100752190 | 3300005439 | Bacteria | 824 |
| 57 | Ga0070700_100252535 | 3300005441 | Bacteria | 1265 |
| 58 | Ga0070663_100435647 | 3300005455 | Bacteria | 1078 |
| 59 | Ga0070663_100672247 | 3300005455 | Bacteria | 878 |
| 60 | Ga0070678_100012735 | 3300005456 | Bacteria | 5243 |
| 61 | Ga0070678_100029982 | 3300005456 | Bacteria | 3732 |
| 62 | Ga0070678_100164756 | 3300005456 | Bacteria | 1800 |
| 63 | Ga0070678_100862047 | 3300005456 | Bacteria | 826 |
| 64 | Ga0070662_100230394 | 3300005457 | Bacteria | 1482 |
| 65 | Ga0070681_10012819 | 3300005458 | Bacteria | 8322 |
| 66 | Ga0070681_10037527 | 3300005458 | Bacteria | 4861 |
| 67 | Ga0070681_10051933 | 3300005458 | Bacteria | 4088 |
| 68 | Ga0070681_10125936 | 3300005458 | Bacteria | 2494 |
| 69 | Ga0070681_10607547 | 3300005458 | Bacteria | 1008 |
| 70 | Ga0070685_10132407 | 3300005466 | Bacteria | 1561 |
| 71 | Ga0070685_10187510 | 3300005466 | Bacteria | 1336 |
| 72 | Ga0070706_100736318 | 3300005467 | Bacteria | 914 |
| 73 | Ga0070698_100604936 | 3300005471 | Bacteria | 1036 |
| 74 | Ga0070679_100031919 | 3300005530 | Bacteria | 5207 |
| 75 | Ga0070679_100034291 | 3300005530 | Bacteria | 5029 |
| 76 | Ga0070679_100109277 | 3300005530 | Bacteria | 2751 |
| 77 | Ga0070679_100137259 | 3300005530 | Bacteria | 2426 |
| 78 | Ga0070679_100138618 | 3300005530 | Bacteria | 2413 |
| 79 | Ga0070679_100600551 | 3300005530 | Bacteria | 1044 |
| 80 | Ga0070684_100003258 | 3300005535 | Bacteria | 12159 |
| 81 | Ga0068853_100026606 | 3300005539 | Bacteria | 4858 |
| 82 | Ga0068853_100112148 | 3300005539 | Bacteria | 2424 |
| 83 | Ga0070672_100649058 | 3300005543 | Bacteria | 922 |
| 84 | Ga0070696_100164886 | 3300005546 | Bacteria | 1635 |
| 85 | Ga0070693_100262254 | 3300005547 | Bacteria | 1150 |
| 86 | Ga0070665_100028897 | 3300005548 | Bacteria | 5581 |
| 87 | Ga0070665_100045145 | 3300005548 | Bacteria | 4425 |
| 88 | Ga0070665_100071651 | 3300005548 | Bacteria | 3472 |
| 89 | Ga0070665_100135904 | 3300005548 | Bacteria | 2461 |
| 90 | Ga0070665_100136213 | 3300005548 | Bacteria | 2458 |
| 91 | Ga0070665_100161250 | 3300005548 | Bacteria | 2245 |
| 92 | Ga0070665_100472269 | 3300005548 | Bacteria | 1265 |
| 93 | Ga0070665_100554908 | 3300005548 | Bacteria | 1161 |
| 94 | Ga0068855_100015587 | 3300005563 | Bacteria | 9146 |
| 95 | Ga0068855_100073742 | 3300005563 | Bacteria | 3965 |
| 96 | Ga0068855_100188786 | 3300005563 | Bacteria | 2326 |
| 97 | Ga0068855_100217196 | 3300005563 | Bacteria | 2146 |
| 98 | Ga0070664_100249863 | 3300005564 | Bacteria | 1594 |
| 99 | Ga0070664_100516844 | 3300005564 | Bacteria | 1102 |
| 100 | Ga0068857_100125486 | 3300005577 | Bacteria | 2313 |
| 101 | Ga0068857_100264142 | 3300005577 | Bacteria | 1580 |
| 102 | Ga0068856_100013570 | 3300005614 | Bacteria | 7888 |
| 103 | Ga0068856_100152081 | 3300005614 | Bacteria | 2324 |
| 104 | Ga0068856_100253525 | 3300005614 | Bacteria | 1775 |
| 105 | Ga0068856_100255228 | 3300005614 | Bacteria | 1768 |
| 106 | Ga0068856_100467549 | 3300005614 | Bacteria | 1282 |
| 107 | Ga0068856_100832796 | 3300005614 | Bacteria | 942 |
| 108 | Ga0070702_100269391 | 3300005615 | Bacteria | 1164 |
| 109 | Ga0070702_100437731 | 3300005615 | Bacteria | 945 |
| 110 | Ga0070702_100510897 | 3300005615 | Bacteria | 884 |
| 111 | Ga0068852_100002075 | 3300005616 | Bacteria | 13685 |
| 112 | Ga0068852_100185761 | 3300005616 | Bacteria | 1958 |
| 113 | Ga0068859_100127861 | 3300005617 | Bacteria | 2611 |
| 114 | Ga0068859_100538127 | 3300005617 | Bacteria | 1263 |
| 115 | Ga0068864_100182468 | 3300005618 | Bacteria | 1919 |
| 116 | Ga0068864_100257270 | 3300005618 | Bacteria | 1623 |
| 117 | Ga0068861_100139299 | 3300005719 | Bacteria | 1978 |
| 118 | Ga0068861_100151333 | 3300005719 | Bacteria | 1904 |
| 119 | Ga0068851_10113048 | 3300005834 | Bacteria | 1451 |
| 120 | Ga0068863_100776274 | 3300005841 | Bacteria | 955 |
| 121 | Ga0068858_100150433 | 3300005842 | Bacteria | 2189 |
| 122 | Ga0068858_100721009 | 3300005842 | Bacteria | 971 |
| 123 | Ga0068860_100084953 | 3300005843 | Bacteria | 3010 |
| 124 | Ga0068860_100215672 | 3300005843 | Bacteria | 1862 |
| 125 | Ga0068860_100238488 | 3300005843 | Bacteria | 1768 |
| 126 | Ga0068862_100158116 | 3300005844 | Bacteria | 2021 |
| 127 | Ga0068862_100373845 | 3300005844 | Bacteria | 1327 |
| 128 | Ga0068862_100569757 | 3300005844 | Bacteria | 1083 |
| 129 | Ga0081455_10003156 | 3300005937 | Bacteria | 19144 |
| 130 | Ga0081455_10006663 | 3300005937 | Bacteria | 12343 |
| 131 | Ga0081455_10007464 | 3300005937 | Bacteria | 11515 |
| 132 | Ga0081455_10073137 | 3300005937 | Bacteria | 2835 |
| 133 | Ga0081540_1001341 | 3300005983 | Bacteria | 21422 |
| 134 | Ga0081540_1002121 | 3300005983 | Bacteria | 16515 |
| 135 | Ga0081540_1012706 | 3300005983 | Bacteria | 5523 |
| 136 | Ga0081540_1018462 | 3300005983 | Bacteria | 4276 |
| 137 | Ga0081540_1073482 | 3300005983 | Bacteria | 1571 |
| 138 | Ga0081540_1100945 | 3300005983 | Bacteria | 1243 |
| 139 | Ga0081540_1120509 | 3300005983 | Bacteria | 1090 |
| 140 | Ga0081540_1120511 | 3300005983 | Bacteria | 1090 |
| 141 | Ga0081539_10000729 | 3300005985 | Bacteria | 65907 |
| 142 | Ga0081539_10091157 | 3300005985 | Bacteria | 1575 |
| 143 | Ga0081539_10125163 | 3300005985 | Bacteria | 1271 |
| 144 | Ga0070717_10001026 | 3300006028 | Bacteria | 18703 |
| 145 | Ga0070717_10237647 | 3300006028 | Bacteria | 1606 |
| 146 | Ga0075365_10033553 | 3300006038 | Bacteria | 3309 |
| 147 | Ga0075365_10046161 | 3300006038 | Bacteria | 2860 |
| 148 | Ga0075368_10008533 | 3300006042 | Bacteria | 3653 |
| 149 | Ga0075368_10102393 | 3300006042 | Bacteria | 1177 |
| 150 | Ga0075368_10103345 | 3300006042 | Bacteria | 1172 |
| 151 | Ga0075368_10127023 | 3300006042 | Bacteria | 1058 |
| 152 | Ga0075363_100003880 | 3300006048 | Bacteria | 6449 |
| 153 | Ga0075363_100013422 | 3300006048 | Bacteria | 3971 |
| 154 | Ga0075363_100060796 | 3300006048 | Bacteria | 2035 |
| 155 | Ga0075363_100163594 | 3300006048 | Bacteria | 1261 |
| 156 | Ga0075364_10039240 | 3300006051 | Bacteria | 3069 |
| 157 | Ga0070716_100069962 | 3300006173 | Bacteria | 2059 |
| 158 | Ga0070716_100073994 | 3300006173 | Bacteria | 2011 |
| 159 | Ga0070716_100585493 | 3300006173 | Bacteria | 837 |
| 160 | Ga0070712_100044616 | 3300006175 | Bacteria | 3057 |
| 161 | Ga0070712_100502818 | 3300006175 | Bacteria | 1016 |
| 162 | Ga0070712_100840602 | 3300006175 | Bacteria | 789 |
| 163 | Ga0075367_10098911 | 3300006178 | Bacteria | 1781 |
| 164 | Ga0075367_10110452 | 3300006178 | Bacteria | 1687 |
| 165 | Ga0075367_10330846 | 3300006178 | Bacteria | 960 |
| 166 | Ga0075369_10028877 | 3300006186 | Bacteria | 2327 |
| 167 | Ga0075366_10008044 | 3300006195 | Bacteria | 5844 |
| 168 | Ga0075366_10071534 | 3300006195 | Bacteria | 2066 |
| 169 | Ga0075366_10094649 | 3300006195 | Bacteria | 1791 |
| 170 | Ga0097621_100234276 | 3300006237 | Bacteria | 1603 |
| 171 | Ga0097621_100239636 | 3300006237 | Bacteria | 1585 |
| 172 | Ga0075370_10028282 | 3300006353 | Bacteria | 3115 |
| 173 | Ga0075370_10042444 | 3300006353 | Bacteria | 2570 |
| 174 | Ga0075370_10116584 | 3300006353 | Bacteria | 1553 |
| 175 | Ga0075370_10132901 | 3300006353 | Bacteria | 1452 |
| 176 | Ga0075370_10216835 | 3300006353 | Bacteria | 1130 |
| 177 | Ga0075428_100622896 | 3300006844 | Bacteria | 1152 |
| 178 | Ga0075434_100092226 | 3300006871 | Bacteria | 3031 |
| 179 | Ga0075434_100826714 | 3300006871 | Bacteria | 942 |
| 180 | Ga0068865_100069342 | 3300006881 | Bacteria | 2495 |
| 181 | Ga0068865_100316538 | 3300006881 | Bacteria | 1254 |
| 182 | Ga0075436_100134933 | 3300006914 | Bacteria | 1732 |
| 183 | Ga0097620_100127864 | 3300006931 | Bacteria | 2611 |
| 184 | Ga0097620_100538168 | 3300006931 | Bacteria | 1263 |
| 185 | Ga0099824_1002047 | 3300006942 | Bacteria | 29222 |
| 186 | Ga0099824_1018951 | 3300006942 | Bacteria | 5500 |
| 187 | Ga0099822_1004737 | 3300006943 | Bacteria | 17740 |
| 188 | Ga0099822_1063565 | 3300006943 | Bacteria | 1165 |
| 189 | Ga0099823_1071205 | 3300006944 | Bacteria | 1538 |
| 190 | Ga0075435_100109533 | 3300007076 | Bacteria | 2296 |
| 191 | Ga0099794_10112341 | 3300007265 | Bacteria | 1366 |
| 192 | Ga0099795_10017558 | 3300007788 | Bacteria | 2284 |
| 193 | Ga0099795_10161517 | 3300007788 | Bacteria | 925 |
| 194 | Ga0105240_10002295 | 3300009093 | Bacteria | 30967 |
| 195 | Ga0105240_10053247 | 3300009093 | Bacteria | 5081 |
| 196 | Ga0105240_10183475 | 3300009093 | Bacteria | 2467 |
| 197 | Ga0105240_10218361 | 3300009093 | Bacteria | 2223 |
| 198 | Ga0105240_10251298 | 3300009093 | Bacteria | 2045 |
| 199 | Ga0105240_10266078 | 3300009093 | Bacteria | 1976 |
| 200 | Ga0105240_10672889 | 3300009093 | Bacteria | 1132 |
| 201 | Ga0111539_10182022 | 3300009094 | Bacteria | 2454 |
| 202 | Ga0111539_10395278 | 3300009094 | Bacteria | 1610 |
| 203 | Ga0105245_10037331 | 3300009098 | Bacteria | 4319 |
| 204 | Ga0105245_10340923 | 3300009098 | Bacteria | 1482 |
| 205 | Ga0105245_10904070 | 3300009098 | Bacteria | 924 |
| 206 | Ga0105243_10994056 | 3300009148 | Bacteria | 841 |
| 207 | Ga0105241_10012898 | 3300009174 | Bacteria | 6131 |
| 208 | Ga0105241_10046174 | 3300009174 | Bacteria | 3307 |
| 209 | Ga0105241_10066451 | 3300009174 | Bacteria | 2788 |
| 210 | Ga0105241_10444899 | 3300009174 | Bacteria | 1145 |
| 211 | Ga0105242_10234670 | 3300009176 | Bacteria | 1646 |
| 212 | Ga0105242_10458835 | 3300009176 | Bacteria | 1203 |
| 213 | Ga0105248_10042923 | 3300009177 | Bacteria | 5071 |
| 214 | Ga0105248_10144863 | 3300009177 | Bacteria | 2681 |
| 215 | Ga0105248_10211185 | 3300009177 | Bacteria | 2187 |
| 216 | Ga0105237_10002301 | 3300009545 | Bacteria | 23744 |
| 217 | Ga0105237_10006999 | 3300009545 | Bacteria | 12427 |
| 218 | Ga0105237_10026831 | 3300009545 | Bacteria | 5887 |
| 219 | Ga0105237_10080389 | 3300009545 | Bacteria | 3250 |
| 220 | Ga0105237_10259204 | 3300009545 | Bacteria | 1741 |
| 221 | Ga0105237_10346620 | 3300009545 | Bacteria | 1489 |
| 222 | Ga0105237_10358448 | 3300009545 | Bacteria | 1463 |
| 223 | Ga0105237_10430729 | 3300009545 | Bacteria | 1325 |
| 224 | Ga0105237_10807367 | 3300009545 | Bacteria | 945 |
| 225 | Ga0105238_10018488 | 3300009551 | Bacteria | 7091 |
| 226 | Ga0105238_10063133 | 3300009551 | Bacteria | 3704 |
| 227 | Ga0105238_10112590 | 3300009551 | Bacteria | 2701 |
| 228 | Ga0105238_10247537 | 3300009551 | Bacteria | 1760 |
| 229 | Ga0105238_10345957 | 3300009551 | Bacteria | 1475 |
| 230 | Ga0105238_10422128 | 3300009551 | Bacteria | 1328 |
| 231 | Ga0105249_10165545 | 3300009553 | Bacteria | 2140 |
| 232 | Ga0105249_10395205 | 3300009553 | Bacteria | 1412 |
| 233 | Ga0105249_11331530 | 3300009553 | Bacteria | 790 |
| 234 | Ga0105239_10025401 | 3300010375 | Bacteria | 6522 |
| 235 | Ga0105239_10083534 | 3300010375 | Bacteria | 3517 |
| 236 | Ga0105239_10142048 | 3300010375 | Bacteria | 2676 |
| 237 | Ga0105239_10321091 | 3300010375 | Bacteria | 1746 |
| 238 | Ga0105239_11309354 | 3300010375 | Bacteria | 836 |
| 239 | Ga0105246_10114789 | 3300011119 | Bacteria | 1985 |
| 240 | Ga0105246_10484397 | 3300011119 | Bacteria | 1047 |
| 241 | Ga0157370_10061670 | 3300013104 | Bacteria | 3559 |
| 242 | Ga0157370_10497971 | 3300013104 | Bacteria | 1119 |
| 243 | Ga0157369_10017488 | 3300013105 | Bacteria | 8058 |
| 244 | Ga0157369_10102904 | 3300013105 | Bacteria | 3042 |
| 245 | Ga0157369_10570470 | 3300013105 | Bacteria | 1169 |
| 246 | Ga0157374_10191301 | 3300013296 | Bacteria | 2002 |
| 247 | Ga0157378_10057612 | 3300013297 | Bacteria | 3463 |
| 248 | Ga0157378_10146176 | 3300013297 | Bacteria | 2199 |
| 249 | Ga0157378_10573750 | 3300013297 | Bacteria | 1136 |
| 250 | Ga0163162_10155709 | 3300013306 | Bacteria | 2405 |
| 251 | Ga0163162_10362366 | 3300013306 | Bacteria | 1583 |
| 252 | Ga0163162_10475004 | 3300013306 | Bacteria | 1382 |
| 253 | Ga0157372_10118851 | 3300013307 | Bacteria | 3033 |
| 254 | Ga0157375_10069051 | 3300013308 | Bacteria | 3538 |
| 255 | Ga0157375_10076159 | 3300013308 | Bacteria | 3381 |
| 256 | Ga0157375_10137987 | 3300013308 | Bacteria | 2564 |
| 257 | Ga0157375_10541055 | 3300013308 | Bacteria | 1327 |
| 258 | Ga0157375_10784330 | 3300013308 | Bacteria | 1102 |
| 259 | Ga0163163_10002774 | 3300014325 | Bacteria | 14789 |
| 260 | Ga0163163_10043948 | 3300014325 | Bacteria | 4382 |
| 261 | Ga0163163_10129093 | 3300014325 | Bacteria | 2567 |
| 262 | Ga0163163_10183688 | 3300014325 | Bacteria | 2139 |
| 263 | Ga0163163_10203230 | 3300014325 | Bacteria | 2030 |
| 264 | Ga0163163_10910132 | 3300014325 | Bacteria | 943 |
| 265 | Ga0157377_10044206 | 3300014745 | Bacteria | 2483 |
| 266 | Ga0157379_10192263 | 3300014968 | Bacteria | 1844 |
| 267 | Ga0157379_10255394 | 3300014968 | Bacteria | 1592 |
| 268 | Ga0157379_10609805 | 3300014968 | Bacteria | 1019 |
| 269 | Ga0157376_10086282 | 3300014969 | Bacteria | 2706 |
| 270 | Ga0157376_10179560 | 3300014969 | Bacteria | 1934 |
| 271 | Ga0157376_10321788 | 3300014969 | Bacteria | 1471 |
| 272 | Ga0157376_10537824 | 3300014969 | Bacteria | 1154 |
| 273 | Ga0163161_10171094 | 3300017792 | Bacteria | 1661 |
| 274 | Ga0163161_10299170 | 3300017792 | Bacteria | 1267 |
| 275 | Ga0163161_10338303 | 3300017792 | Bacteria | 1193 |
| 276 | Ga0197907_11157109 | 3300020069 | Bacteria | 1476 |
| 277 | Ga0206355_1507511 | 3300020076 | Bacteria | 1302 |
| 278 | Ga0206350_10389318 | 3300020080 | Bacteria | 991 |
| 279 | Ga0206353_10556866 | 3300020082 | Bacteria | 959 |
| 280 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 281 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 282 | Ga0214542_1021066 | 3300021321 | Bacteria | 4603 |
| 283 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 284 | Ga0214545_1021274 | 3300021324 | Bacteria | 4909 |
| 285 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 286 | Ga0213876_10002755 | 3300021384 | Bacteria | 10233 |
| 287 | Ga0213876_10094238 | 3300021384 | Bacteria | 1586 |
| 288 | Ga0213875_10130551 | 3300021388 | Bacteria | 1175 |
| 289 | Ga0224712_10107802 | 3300022467 | Bacteria | 1191 |
| 290 | Ga0209563_100438 | 3300025230 | Bacteria | 14431 |
| 291 | Ga0209677_103197 | 3300025253 | Bacteria | 5489 |
| 292 | Ga0209148_1000267 | 3300025254 | Bacteria | 81839 |
| 293 | Ga0209233_1012874 | 3300025261 | Bacteria | 2408 |
| 294 | Ga0209455_1001737 | 3300025272 | Bacteria | 9272 |
| 295 | Ga0209673_1013733 | 3300025273 | Bacteria | 3180 |
| 296 | Ga0209564_1010432 | 3300025295 | Bacteria | 4282 |
| 297 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 298 | Ga0209758_1000277 | 3300025297 | Bacteria | 102106 |
| 299 | Ga0209758_1000711 | 3300025297 | Bacteria | 49164 |
| 300 | Ga0209758_1000893 | 3300025297 | Bacteria | 40627 |
| 301 | Ga0209758_1001645 | 3300025297 | Bacteria | 25366 |
| 302 | Ga0209758_1002462 | 3300025297 | Bacteria | 18855 |
| 303 | Ga0209758_1005049 | 3300025297 | Bacteria | 10483 |
| 304 | Ga0209758_1050686 | 3300025297 | Bacteria | 1453 |
| 305 | Ga0207426_1000271 | 3300025302 | Bacteria | 108392 |
| 306 | Ga0207426_1001517 | 3300025302 | Bacteria | 18935 |
| 307 | Ga0207426_1008000 | 3300025302 | Bacteria | 4342 |
| 308 | Ga0209257_1000662 | 3300025304 | Bacteria | 54143 |
| 309 | Ga0209257_1015967 | 3300025304 | Bacteria | 3073 |
| 310 | Ga0207653_10004044 | 3300025885 | Bacteria | 4615 |
| 311 | Ga0207692_10001302 | 3300025898 | Bacteria | 9295 |
| 312 | Ga0207692_10075621 | 3300025898 | Bacteria | 1787 |
| 313 | Ga0207692_10250024 | 3300025898 | Bacteria | 1062 |
| 314 | Ga0207710_10028157 | 3300025900 | Bacteria | 2438 |
| 315 | Ga0207688_10033353 | 3300025901 | Bacteria | 2847 |
| 316 | Ga0207688_10069981 | 3300025901 | Bacteria | 1989 |
| 317 | Ga0207680_10231384 | 3300025903 | Bacteria | 1270 |
| 318 | Ga0207647_10008109 | 3300025904 | Bacteria | 7549 |
| 319 | Ga0207647_10211960 | 3300025904 | Bacteria | 1118 |
| 320 | Ga0207699_10023510 | 3300025906 | Bacteria | 3355 |
| 321 | Ga0207699_10045183 | 3300025906 | Bacteria | 2569 |
| 322 | Ga0207645_10084865 | 3300025907 | Bacteria | 2033 |
| 323 | Ga0207684_10261744 | 3300025910 | Bacteria | 1492 |
| 324 | Ga0207707_10000438 | 3300025912 | Bacteria | 43316 |
| 325 | Ga0207707_10136890 | 3300025912 | Bacteria | 2141 |
| 326 | Ga0207707_10669633 | 3300025912 | Bacteria | 873 |
| 327 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 328 | Ga0207695_10027002 | 3300025913 | Bacteria | 6397 |
| 329 | Ga0207695_10043272 | 3300025913 | Bacteria | 4800 |
| 330 | Ga0207695_10218834 | 3300025913 | Bacteria | 1812 |
| 331 | Ga0207671_10001109 | 3300025914 | Bacteria | 32478 |
| 332 | Ga0207671_10035801 | 3300025914 | Bacteria | 3681 |
| 333 | Ga0207671_10069327 | 3300025914 | Bacteria | 2629 |
| 334 | Ga0207671_10162971 | 3300025914 | Bacteria | 1727 |
| 335 | Ga0207671_10173745 | 3300025914 | Bacteria | 1674 |
| 336 | Ga0207693_10027888 | 3300025915 | Bacteria | 4463 |
| 337 | Ga0207693_10104554 | 3300025915 | Bacteria | 2221 |
| 338 | Ga0207693_10114267 | 3300025915 | Bacteria | 2118 |
| 339 | Ga0207693_10235143 | 3300025915 | Bacteria | 1439 |
| 340 | Ga0207693_10463230 | 3300025915 | Bacteria | 990 |
| 341 | Ga0207663_10017392 | 3300025916 | Bacteria | 4006 |
| 342 | Ga0207663_10030104 | 3300025916 | Bacteria | 3197 |
| 343 | Ga0207663_10095514 | 3300025916 | Bacteria | 1983 |
| 344 | Ga0207660_10017792 | 3300025917 | Bacteria | 4730 |
| 345 | Ga0207660_10087395 | 3300025917 | Bacteria | 2303 |
| 346 | Ga0207660_10183018 | 3300025917 | Bacteria | 1628 |
| 347 | Ga0207660_10219447 | 3300025917 | Bacteria | 1492 |
| 348 | Ga0207660_10619273 | 3300025917 | Bacteria | 882 |
| 349 | Ga0207657_10275808 | 3300025919 | Bacteria | 1336 |
| 350 | Ga0207657_10506158 | 3300025919 | Bacteria | 946 |
| 351 | Ga0207652_10047083 | 3300025921 | Bacteria | 3683 |
| 352 | Ga0207652_10518673 | 3300025921 | Bacteria | 1072 |
| 353 | Ga0207694_10173320 | 3300025924 | Bacteria | 1747 |
| 354 | Ga0207694_10356417 | 3300025924 | Bacteria | 1211 |
| 355 | Ga0207650_10158200 | 3300025925 | Bacteria | 1793 |
| 356 | Ga0207659_10263324 | 3300025926 | Bacteria | 1403 |
| 357 | Ga0207700_10067007 | 3300025928 | Bacteria | 2746 |
| 358 | Ga0207700_10234026 | 3300025928 | Bacteria | 1563 |
| 359 | Ga0207700_10634800 | 3300025928 | Bacteria | 952 |
| 360 | Ga0207664_10021535 | 3300025929 | Bacteria | 4797 |
| 361 | Ga0207644_10018254 | 3300025931 | Bacteria | 4744 |
| 362 | Ga0207644_10334329 | 3300025931 | Bacteria | 1227 |
| 363 | Ga0207644_10743095 | 3300025931 | Bacteria | 819 |
| 364 | Ga0207706_10059147 | 3300025933 | Bacteria | 3375 |
| 365 | Ga0207706_10134929 | 3300025933 | Bacteria | 2171 |
| 366 | Ga0207706_10499489 | 3300025933 | Bacteria | 1050 |
| 367 | Ga0207686_10200241 | 3300025934 | Bacteria | 1430 |
| 368 | Ga0207686_10225341 | 3300025934 | Bacteria | 1356 |
| 369 | Ga0207670_10389508 | 3300025936 | Bacteria | 1112 |
| 370 | Ga0207669_10478717 | 3300025937 | Bacteria | 992 |
| 371 | Ga0207669_10624750 | 3300025937 | Bacteria | 878 |
| 372 | Ga0207704_10265709 | 3300025938 | Bacteria | 1296 |
| 373 | Ga0207665_10014858 | 3300025939 | Bacteria | 5119 |
| 374 | Ga0207665_10061914 | 3300025939 | Bacteria | 2538 |
| 375 | Ga0207665_10380452 | 3300025939 | Bacteria | 1071 |
| 376 | Ga0207691_10197132 | 3300025940 | Bacteria | 1754 |
| 377 | Ga0207711_10018230 | 3300025941 | Bacteria | 5835 |
| 378 | Ga0207711_10276472 | 3300025941 | Bacteria | 1546 |
| 379 | Ga0207711_10876686 | 3300025941 | Bacteria | 835 |
| 380 | Ga0207689_10080482 | 3300025942 | Bacteria | 2678 |
| 381 | Ga0207689_10208165 | 3300025942 | Bacteria | 1615 |
| 382 | Ga0207661_10000959 | 3300025944 | Bacteria | 18985 |
| 383 | Ga0207661_10412760 | 3300025944 | Bacteria | 1225 |
| 384 | Ga0207679_10401124 | 3300025945 | Bacteria | 1206 |
| 385 | Ga0207667_10044714 | 3300025949 | Bacteria | 4691 |
| 386 | Ga0207667_10086148 | 3300025949 | Bacteria | 3251 |
| 387 | Ga0207667_10101512 | 3300025949 | Bacteria | 2967 |
| 388 | Ga0207667_10406284 | 3300025949 | Bacteria | 1386 |
| 389 | Ga0207668_10060395 | 3300025972 | Bacteria | 2660 |
| 390 | Ga0207668_10069357 | 3300025972 | Bacteria | 2510 |
| 391 | Ga0207668_10095673 | 3300025972 | Bacteria | 2192 |
| 392 | Ga0207668_10124091 | 3300025972 | Bacteria | 1960 |
| 393 | Ga0207668_10425960 | 3300025972 | Bacteria | 1127 |
| 394 | Ga0207658_10678577 | 3300025986 | Bacteria | 930 |
| 395 | Ga0207677_10461146 | 3300026023 | Bacteria | 1091 |
| 396 | Ga0207703_10050557 | 3300026035 | Bacteria | 3365 |
| 397 | Ga0207703_10181953 | 3300026035 | Bacteria | 1855 |
| 398 | Ga0207639_10023427 | 3300026041 | Bacteria | 4459 |
| 399 | Ga0207639_10160589 | 3300026041 | Bacteria | 1893 |
| 400 | Ga0207639_10163367 | 3300026041 | Bacteria | 1879 |
| 401 | Ga0207639_10267758 | 3300026041 | Bacteria | 1497 |
| 402 | Ga0207678_10021386 | 3300026067 | Bacteria | 5673 |
| 403 | Ga0207678_10023768 | 3300026067 | Bacteria | 5359 |
| 404 | Ga0207678_10025320 | 3300026067 | Bacteria | 5180 |
| 405 | Ga0207678_10040824 | 3300026067 | Bacteria | 4022 |
| 406 | Ga0207678_10052328 | 3300026067 | Bacteria | 3523 |
| 407 | Ga0207678_10064507 | 3300026067 | Bacteria | 3147 |
| 408 | Ga0207678_10698805 | 3300026067 | Bacteria | 892 |
| 409 | Ga0207708_10433723 | 3300026075 | Bacteria | 1092 |
| 410 | Ga0207708_10513717 | 3300026075 | Bacteria | 1006 |
| 411 | Ga0207702_10106927 | 3300026078 | Bacteria | 2480 |
| 412 | Ga0207702_10186192 | 3300026078 | Bacteria | 1915 |
| 413 | Ga0207702_10380959 | 3300026078 | Bacteria | 1356 |
| 414 | Ga0207702_10436225 | 3300026078 | Bacteria | 1269 |
| 415 | Ga0207648_10042881 | 3300026089 | Bacteria | 3973 |
| 416 | Ga0207648_10704914 | 3300026089 | Bacteria | 935 |
| 417 | Ga0207676_10128955 | 3300026095 | Bacteria | 2147 |
| 418 | Ga0207676_10163439 | 3300026095 | Bacteria | 1932 |
| 419 | Ga0207676_10614381 | 3300026095 | Bacteria | 1046 |
| 420 | Ga0207674_10055839 | 3300026116 | Bacteria | 4013 |
| 421 | Ga0207674_10057340 | 3300026116 | Bacteria | 3948 |
| 422 | Ga0207674_10084699 | 3300026116 | Bacteria | 3167 |
| 423 | Ga0207674_10310289 | 3300026116 | Bacteria | 1527 |
| 424 | Ga0207675_100031542 | 3300026118 | Bacteria | 4936 |
| 425 | Ga0207675_100279247 | 3300026118 | Bacteria | 1623 |
| 426 | Ga0207675_100354860 | 3300026118 | Bacteria | 1438 |
| 427 | Ga0207683_10008695 | 3300026121 | Bacteria | 8677 |
| 428 | Ga0207683_10032517 | 3300026121 | Bacteria | 4531 |
| 429 | Ga0207683_10135169 | 3300026121 | Bacteria | 2219 |
| 430 | Ga0207683_10450052 | 3300026121 | Bacteria | 1187 |
| 431 | Ga0207683_10470438 | 3300026121 | Bacteria | 1159 |
| 432 | Ga0207698_10013446 | 3300026142 | Bacteria | 5400 |
| 433 | Ga0207698_10166178 | 3300026142 | Bacteria | 1937 |
| 434 | Ga0207698_10371088 | 3300026142 | Bacteria | 1358 |
| 435 | Ga0207698_11005794 | 3300026142 | Bacteria | 844 |
| 436 | Ga0207698_11336862 | 3300026142 | Bacteria | 731 |
| 437 | Ga0209389_1000055 | 3300027296 | Bacteria | 108798 |
| 438 | Ga0209389_1000494 | 3300027296 | Bacteria | 23661 |
| 439 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 440 | Ga0209589_1000024 | 3300027357 | Bacteria | 169886 |
| 441 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 442 | Ga0209489_100123 | 3300027361 | Bacteria | 113105 |
| 443 | Ga0209489_103769 | 3300027361 | Bacteria | 28981 |
| 444 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 445 | Ga0209700_100420 | 3300027363 | Bacteria | 77617 |
| 446 | Ga0209588_1014950 | 3300027671 | Bacteria | 2383 |
| 447 | Ga0209588_1031471 | 3300027671 | Bacteria | 1698 |
| 448 | Ga0209813_10024296 | 3300027866 | Bacteria | 1732 |
| 449 | Ga0268266_10000638 | 3300028379 | Bacteria | 47680 |
| 450 | Ga0268266_10001364 | 3300028379 | Bacteria | 29475 |
| 451 | Ga0268266_10030958 | 3300028379 | Bacteria | 4544 |
| 452 | Ga0268266_10070131 | 3300028379 | Bacteria | 3037 |
| 453 | Ga0268266_10085353 | 3300028379 | Bacteria | 2758 |
| 454 | Ga0268266_10117632 | 3300028379 | Bacteria | 2362 |
| 455 | Ga0268266_10366104 | 3300028379 | Bacteria | 1357 |
| 456 | Ga0268266_10712521 | 3300028379 | Bacteria | 967 |
| 457 | Ga0268266_10768309 | 3300028379 | Bacteria | 930 |
| 458 | Ga0268266_10774729 | 3300028379 | Bacteria | 926 |
| 459 | Ga0268266_10848742 | 3300028379 | Bacteria | 883 |
| 460 | Ga0268265_10178216 | 3300028380 | Bacteria | 1824 |
| 461 | Ga0268265_10396337 | 3300028380 | Bacteria | 1274 |
| 462 | Ga0268265_10678065 | 3300028380 | Bacteria | 993 |
| 463 | Ga0268265_10770230 | 3300028380 | Bacteria | 935 |
| 464 | Ga0268264_10000051 | 3300028381 | Bacteria | 321565 |
| 465 | Ga0268264_10295742 | 3300028381 | Bacteria | 1522 |
| 466 | Ga0265337_1006988 | 3300028556 | Bacteria | 4274 |
| 467 | Ga0265334_10005278 | 3300028573 | Bacteria | 5652 |
| 468 | Ga0265318_10031122 | 3300028577 | Bacteria | 2071 |
| 469 | Ga0265323_10000560 | 3300028653 | Bacteria | 20568 |
| 470 | Ga0265336_10000550 | 3300028666 | Bacteria | 21394 |
| 471 | Ga0307517_10000856 | 3300028786 | Bacteria | 51999 |
| 472 | Ga0307515_10027090 | 3300028794 | Bacteria | 9818 |
| 473 | Ga0265338_10000231 | 3300028800 | Bacteria | 103805 |
| 474 | Ga0265324_10005806 | 3300029957 | Bacteria | 5250 |
| 475 | Ga0265339_10034239 | 3300031249 | Bacteria | 2855 |
| 476 | Ga0307513_10125136 | 3300031456 | Bacteria | 2528 |
| 477 | Ga0307509_10085186 | 3300031507 | Bacteria | 3253 |
| 478 | Ga0307508_10014562 | 3300031616 | Bacteria | 7175 |
| 479 | Ga0307508_10567299 | 3300031616 | Bacteria | 734 |
| 480 | Ga0265314_10069773 | 3300031711 | Bacteria | 2357 |
| 481 | Ga0265342_10003396 | 3300031712 | Bacteria | 13107 |
| 482 | Ga0307516_10011176 | 3300031730 | Bacteria | 9797 |
| 483 | Ga0307405_10374919 | 3300031731 | Bacteria | 1106 |
| 484 | Ga0307413_10103325 | 3300031824 | Bacteria | 1889 |
| 485 | Ga0307409_100119908 | 3300031995 | Bacteria | 2225 |
| 486 | Ga0307416_100286859 | 3300032002 | Bacteria | 1627 |
| 487 | Ga0307415_100143022 | 3300032126 | Bacteria | 1830 |
| 488 | Ga0307510_10004951 | 3300033180 | Bacteria | 15758 |
| 489 | Ga0307510_10022034 | 3300033180 | Bacteria | 7406 |
| 490 | Ga0307510_10121417 | 3300033180 | Bacteria | 2316 |
| 491 | Ga0316215_1002564 | 3300033544 | Bacteria | 1719 |
| 492 | Ga0373934_0076806 | 3300035086 | Bacteria | 1340 |
| 493 | Ga0373949_0020331 | 3300035090 | Bacteria | 1518 |
| 494 | Ga0373952_0006580 | 3300035092 | Bacteria | 2152 |
| 495 | Ga0373945_0209184 | 3300035116 | Bacteria | 812 |
| 496 | Ga0373954_0052727 | 3300035118 | Bacteria | 1911 |
| 497 | Ga0373956_0087974 | 3300035119 | Bacteria | 1431 |
| 498 | Ga0373960_0132987 | 3300035121 | Bacteria | 836 |
| 499 | Ga0373943_0157391 | 3300035170 | Bacteria | 1235 |
| 500 | Ga0373943_0234201 | 3300035170 | Bacteria | 1027 |
| 501 | Ga0373955_0108257 | 3300035172 | Bacteria | 1604 |
| 502 | Ga0373955_0122209 | 3300035172 | Bacteria | 1514 |
| 503 | Ga0373924_0027656 | 3300035410 | Bacteria | 2256 |
| 504 | Ga0373931_0008723 | 3300035691 | Bacteria | 4824 |
| 505 | Ga0373935_0557741 | 3300035692 | Bacteria | 835 |
| 506 | Ga0373927_0012565 | 3300035695 | Bacteria | 5638 |
| 507 | Ga0373927_0263187 | 3300035695 | Bacteria | 1134 |
| 508 | Ga0373927_0363133 | 3300035695 | Bacteria | 954 |
| 509 | Ga0373933_0000018 | 3300035724 | Bacteria | 98044 |
| 510 | Ga0373937_0069895 | 3300036401 | Bacteria | 3238 |
| 511 | Ga0373937_0227646 | 3300036401 | Bacteria | 1755 |
| 512 | Ga0372808_020869 | 3300036459 | Bacteria | 942 |
| 513 | Ga0373925_0401179 | 3300037068 | Bacteria | 1118 |
| 514 | Ga0373925_0639533 | 3300037068 | Bacteria | 876 |
| 515 | Ga0395899_0050587 | 3300037312 | Bacteria | 3085 |
| 516 | Ga0395899_0443317 | 3300037312 | Bacteria | 852 |
| 517 | Ga0395900_0001051 | 3300037418 | Bacteria | 35383 |
| 518 | Ga0395900_0169700 | 3300037418 | Bacteria | 2222 |
| 519 | Ga0395900_0265761 | 3300037418 | Bacteria | 1711 |
| 520 | Ga0395900_0399957 | 3300037418 | Bacteria | 1338 |
| 521 | Ga0395898_0001503 | 3300037466 | Bacteria | 32214 |
| 522 | Ga0395898_0004875 | 3300037466 | Bacteria | 14570 |
| 523 | Ga0395898_0532852 | 3300037466 | Bacteria | 1116 |
| 524 | Ga0395905_0064717 | 3300037471 | Bacteria | 3422 |
| 525 | Ga0395905_0109320 | 3300037471 | Bacteria | 2596 |
| 526 | Ga0395905_0134424 | 3300037471 | Bacteria | 2326 |
| 527 | Ga0436364_0238267 | 3300037853 | Bacteria | 846 |
| 528 | Ga0436364_0310036 | 3300037853 | Bacteria | 2843 |
| 529 | Ga0395901_0051645 | 3300038443 | Bacteria | 4275 |
| 530 | Ga0395901_0061578 | 3300038443 | Bacteria | 3905 |
| 531 | Ga0395901_0092858 | 3300038443 | Bacteria | 3159 |
| 532 | Ga0395901_0371972 | 3300038443 | Bacteria | 1472 |
| 533 | Ga0436365_0093274 | 3300039437 | Bacteria | 81442 |
| 534 | Ga0436365_0372041 | 3300039437 | Bacteria | 3768 |
| 535 | Ga0436365_1021233 | 3300039437 | Bacteria | 861 |
| 536 | Ga0436363_0554977 | 3300039450 | Bacteria | 1279 |
| 537 | Ga0436363_1689393 | 3300039450 | Bacteria | 959 |
| 538 | Ga0436362_0626323 | 3300039453 | Bacteria | 7982 |
| 539 | Ga0451789_0919161 | 3300041443 | Bacteria | 1052 |
| 540 | Ga0451833_0031051 | 3300041491 | Bacteria | 1104 |
| 541 | Ga0466969_0026762 | 3300044656 | Bacteria | 2957 |
| 542 | Ga0466972_0000124 | 3300044658 | Bacteria | 65163 |
| 543 | Ga0466972_0002537 | 3300044658 | Bacteria | 9032 |
| 544 | Ga0466965_0026765 | 3300044683 | Bacteria | 2796 |
| 545 | Ga0466965_0318596 | 3300044683 | Bacteria | 847 |
| 546 | Ga0466966_0000411 | 3300044684 | Bacteria | 27522 |
| 547 | Ga0466961_0000065 | 3300044693 | Bacteria | 63259 |
| 548 | Ga0466961_0254334 | 3300044693 | Bacteria | 1078 |
| 549 | Ga0466963_0027444 | 3300044694 | Bacteria | 3646 |
| 550 | Ga0466968_0006334 | 3300044735 | Bacteria | 4457 |
| 551 | Ga0466968_0215322 | 3300044735 | Bacteria | 903 |
| 552 | Ga0466970_0089040 | 3300044765 | Bacteria | 1674 |
| 553 | Ga0466970_0143814 | 3300044765 | Bacteria | 1315 |
| 554 | Ga0466960_0001481 | 3300044901 | Bacteria | 8559 |
| 555 | Ga0466960_0139165 | 3300044901 | Bacteria | 1288 |
| 556 | Ga0466960_0220761 | 3300044901 | Bacteria | 1043 |
| 557 | Ga0466959_0000634 | 3300045049 | Bacteria | 20407 |
| 558 | Ga0466959_0275904 | 3300045049 | Bacteria | 1155 |
| 559 | Ga0466958_0031405 | 3300045836 | Bacteria | 3157 |
| 560 | Ga0495603_0082839 | 3300046455 | Bacteria | 1879 |
| 561 | Ga0495603_0132329 | 3300046455 | Bacteria | 1452 |
| 562 | Ga0495603_0300832 | 3300046455 | Bacteria | 921 |
| 563 | Ga0495629_0003519 | 3300046459 | Bacteria | 11838 |
| 564 | Ga0495629_0206705 | 3300046459 | Bacteria | 1357 |
| 565 | Ga0495638_0011267 | 3300046460 | Bacteria | 6167 |
| 566 | Ga0495638_0085181 | 3300046460 | Bacteria | 1912 |
| 567 | Ga0495641_0062004 | 3300046461 | Bacteria | 1687 |
| 568 | Ga0495651_0017692 | 3300046462 | Bacteria | 5518 |
| 569 | Ga0495651_0424287 | 3300046462 | Bacteria | 864 |
| 570 | Ga0495580_0092623 | 3300046472 | Bacteria | 2104 |
| 571 | Ga0495639_0056409 | 3300046475 | Bacteria | 1793 |
| 572 | Ga0495639_0061813 | 3300046475 | Bacteria | 1718 |
| 573 | Ga0495664_0011915 | 3300046477 | Bacteria | 4914 |
| 574 | Ga0495584_0131529 | 3300046491 | Bacteria | 1270 |
| 575 | Ga0495585_0283872 | 3300046492 | Bacteria | 818 |
| 576 | Ga0495594_0065555 | 3300046499 | Bacteria | 2014 |
| 577 | Ga0495596_0092262 | 3300046500 | Bacteria | 1176 |
| 578 | Ga0495583_0044422 | 3300046506 | Bacteria | 2062 |
| 579 | Ga0495606_0065243 | 3300046507 | Bacteria | 2314 |
| 580 | Ga0495606_0160809 | 3300046507 | Bacteria | 1310 |
| 581 | Ga0495610_0078267 | 3300046512 | Bacteria | 1525 |
| 582 | Ga0495616_0057328 | 3300046513 | Bacteria | 1921 |
| 583 | Ga0495616_0084560 | 3300046513 | Bacteria | 1512 |
| 584 | Ga0495616_0253094 | 3300046513 | Bacteria | 756 |
| 585 | Ga0495618_0141248 | 3300046514 | Bacteria | 1540 |
| 586 | Ga0495620_0020979 | 3300046515 | Bacteria | 3180 |
| 587 | Ga0495643_0045119 | 3300046522 | Bacteria | 2393 |
| 588 | Ga0495648_0008955 | 3300046524 | Bacteria | 7820 |
| 589 | Ga0495648_0218345 | 3300046524 | Bacteria | 942 |
| 590 | Ga0495666_0133388 | 3300046526 | Bacteria | 1160 |
| 591 | Ga0495652_0089784 | 3300046529 | Bacteria | 2515 |
| 592 | Ga0495652_0122342 | 3300046529 | Bacteria | 2073 |
| 593 | Ga0495652_0391588 | 3300046529 | Bacteria | 986 |
| 594 | Ga0495652_0457905 | 3300046529 | Bacteria | 892 |
| 595 | Ga0495654_0129733 | 3300046530 | Bacteria | 1133 |
| 596 | Ga0495640_0027614 | 3300046533 | Bacteria | 4091 |
| 597 | Ga0495640_0081673 | 3300046533 | Bacteria | 2148 |
| 598 | Ga0495640_0087035 | 3300046533 | Bacteria | 2067 |
| 599 | Ga0495586_0158427 | 3300046535 | Bacteria | 1276 |
| 600 | Ga0495587_0269474 | 3300046536 | Bacteria | 955 |
| 601 | Ga0495609_0090829 | 3300046538 | Bacteria | 1328 |
| 602 | Ga0495645_0017494 | 3300046543 | Bacteria | 5135 |
| 603 | Ga0495645_0163321 | 3300046543 | Bacteria | 1538 |
| 604 | Ga0495622_0014799 | 3300046557 | Bacteria | 3626 |
| 605 | Ga0495622_0265165 | 3300046557 | Bacteria | 753 |
| 606 | Ga0495667_0044811 | 3300046559 | Bacteria | 2929 |
| 607 | Ga0495668_0084179 | 3300046616 | Bacteria | 1744 |
| 608 | Ga0495668_0379536 | 3300046616 | Bacteria | 776 |
| 609 | Ga0495634_0056964 | 3300046642 | Bacteria | 2610 |
| 610 | Ga0495611_0244628 | 3300046648 | Bacteria | 832 |
| 611 | Ga0495625_0225233 | 3300046660 | Bacteria | 1227 |
| 612 | Ga0495635_0158351 | 3300046663 | Bacteria | 1541 |
| 613 | Ga0495635_0366258 | 3300046663 | Bacteria | 960 |
| 614 | Ga0495588_0001353 | 3300046674 | Bacteria | 10458 |
| 615 | Ga0495657_0002384 | 3300046675 | Bacteria | 15809 |
| 616 | Ga0495657_0014532 | 3300046675 | Bacteria | 5776 |
| 617 | Ga0495599_0004607 | 3300046678 | Bacteria | 8178 |
| 618 | Ga0495599_0065022 | 3300046678 | Bacteria | 2279 |
| 619 | Ga0495599_0067383 | 3300046678 | Bacteria | 2236 |
| 620 | Ga0495623_0010248 | 3300046679 | Bacteria | 6064 |
| 621 | Ga0495623_0320794 | 3300046679 | Bacteria | 851 |
| 622 | Ga0495646_0113582 | 3300046680 | Bacteria | 1540 |
| 623 | Ga0495646_0120906 | 3300046680 | Bacteria | 1482 |
| 624 | Ga0495613_0062464 | 3300046689 | Bacteria | 2726 |
| 625 | Ga0495613_0274008 | 3300046689 | Bacteria | 1173 |
| 626 | Ga0495613_0756129 | 3300046689 | Bacteria | 637 |
| 627 | Ga0495624_0067145 | 3300046690 | Bacteria | 2238 |
| 628 | Ga0495624_0110799 | 3300046690 | Bacteria | 1688 |
| 629 | Ga0495670_0115431 | 3300046691 | Bacteria | 1392 |
| 630 | Ga0495671_0043951 | 3300046692 | Bacteria | 2241 |
| 631 | Ga0495671_0072278 | 3300046692 | Bacteria | 1694 |
| 632 | Ga0495671_0286670 | 3300046692 | Bacteria | 793 |
| 633 | Ga0495649_0024307 | 3300046694 | Bacteria | 3379 |
| 634 | Ga0495600_0210544 | 3300046809 | Bacteria | 1246 |
| 635 | Ga0495660_0076880 | 3300046810 | Bacteria | 1758 |
| 636 | Ga0495581_0014180 | 3300047315 | Bacteria | 4620 |
| 637 | Ga0495581_0041048 | 3300047315 | Bacteria | 2677 |
| 638 | Ga0495604_0002741 | 3300047317 | Bacteria | 14128 |
| 639 | Ga0495604_0006835 | 3300047317 | Bacteria | 9039 |
| 640 | Ga0495674_0018428 | 3300047319 | Bacteria | 6499 |
| 641 | Ga0495672_0017605 | 3300047320 | Bacteria | 4776 |
| 642 | Ga0495672_0050250 | 3300047320 | Bacteria | 2463 |
| 643 | Ga0495676_0055266 | 3300047321 | Bacteria | 3149 |
| 644 | Ga0495676_0102528 | 3300047321 | Bacteria | 2114 |
| 645 | Ga0495676_0374195 | 3300047321 | Bacteria | 949 |
| 646 | Ga0495680_0001876 | 3300047322 | Bacteria | 22116 |
| 647 | Ga0495680_0085161 | 3300047322 | Bacteria | 2380 |
| 648 | Ga0495687_016979 | 3300047443 | Bacteria | 3645 |
| 649 | Ga0495675_0007387 | 3300047444 | Bacteria | 6766 |
| 650 | Ga0495685_082541 | 3300047447 | Bacteria | 1070 |
| 651 | Ga0495673_0060041 | 3300047469 | Bacteria | 1632 |
| 652 | Ga0495673_0061680 | 3300047469 | Bacteria | 1604 |
| 653 | Ga0495673_0108676 | 3300047469 | Bacteria | 1112 |
| 654 | Ga0495684_0012933 | 3300047471 | Bacteria | 6442 |
| 655 | Ga0495684_0436988 | 3300047471 | Bacteria | 912 |
| 656 | Ga0495686_0114233 | 3300047472 | Bacteria | 1616 |
| 657 | Ga0495686_0147890 | 3300047472 | Bacteria | 1381 |
| 658 | Ga0495686_0179200 | 3300047472 | Bacteria | 1229 |
| 659 | Ga0495593_0079436 | 3300047673 | Bacteria | 1698 |
| 660 | Ga0495602_0134279 | 3300048088 | Bacteria | 1968 |
| 661 | Ga0495602_0543596 | 3300048088 | Bacteria | 806 |
| 662 | Ga0496101_0055034 | 3300048904 | Bacteria | 2873 |
| 663 | Ga0496101_0149898 | 3300048904 | Bacteria | 1783 |
| 664 | Ga0496101_0559044 | 3300048904 | Bacteria | 905 |
| 665 | Ga0496102_0107971 | 3300048905 | Bacteria | 2592 |
| 666 | Ga0496102_0125274 | 3300048905 | Bacteria | 2401 |
| 667 | Ga0496102_0134420 | 3300048905 | Bacteria | 2317 |
| 668 | Ga0496102_0252451 | 3300048905 | Bacteria | 1663 |
| 669 | Ga0496103_0080553 | 3300048906 | Bacteria | 2047 |
| 670 | Ga0496103_0338198 | 3300048906 | Bacteria | 968 |
| 671 | Ga0496103_0629569 | 3300048906 | Bacteria | 682 |
| 672 | Ga0496104_0009070 | 3300048907 | Bacteria | 8843 |
| 673 | Ga0496104_0024225 | 3300048907 | Bacteria | 5582 |
| 674 | Ga0496104_0037936 | 3300048907 | Bacteria | 4506 |
| 675 | Ga0496104_0068302 | 3300048907 | Bacteria | 3377 |
| 676 | Ga0496104_0103508 | 3300048907 | Bacteria | 2727 |
| 677 | Ga0496104_0375050 | 3300048907 | Bacteria | 1335 |
| 678 | Ga0496105_0022832 | 3300048908 | Bacteria | 5070 |
| 679 | Ga0496105_0039456 | 3300048908 | Bacteria | 3892 |
| 680 | Ga0496105_0099088 | 3300048908 | Bacteria | 2407 |
| 681 | Ga0496105_0589435 | 3300048908 | Bacteria | 864 |
| 682 | Ga0496106_0026873 | 3300048909 | Bacteria | 4286 |
| 683 | Ga0496106_0038587 | 3300048909 | Bacteria | 3575 |
| 684 | Ga0496106_0264939 | 3300048909 | Bacteria | 1375 |
| 685 | Ga0496106_0271437 | 3300048909 | Bacteria | 1358 |
| 686 | Ga0496106_0285674 | 3300048909 | Bacteria | 1322 |
| 687 | Ga0496107_0011974 | 3300048910 | Bacteria | 6054 |
| 688 | Ga0496107_0164616 | 3300048910 | Bacteria | 1644 |
| 689 | Ga0496107_0237925 | 3300048910 | Bacteria | 1355 |
| 690 | Ga0496107_0709954 | 3300048910 | Bacteria | 739 |
| 691 | Ga0496108_0012004 | 3300048911 | Bacteria | 7048 |
| 692 | Ga0496108_0013488 | 3300048911 | Bacteria | 6669 |
| 693 | Ga0496108_0080117 | 3300048911 | Bacteria | 2766 |
| 694 | Ga0496108_0243202 | 3300048911 | Bacteria | 1565 |
| 695 | Ga0496108_0467421 | 3300048911 | Bacteria | 1102 |
| 696 | Ga0496109_0023442 | 3300048912 | Bacteria | 5480 |
| 697 | Ga0496109_0222517 | 3300048912 | Bacteria | 1775 |
| 698 | Ga0496109_0275200 | 3300048912 | Bacteria | 1586 |
| 699 | Ga0496109_0296979 | 3300048912 | Bacteria | 1523 |
| 700 | Ga0496109_0721487 | 3300048912 | Bacteria | 934 |
| 701 | Ga0496109_0893173 | 3300048912 | Bacteria | 826 |
| 702 | Ga0496110_0015719 | 3300048913 | Bacteria | 6306 |
| 703 | Ga0496110_0015752 | 3300048913 | Bacteria | 6301 |
| 704 | Ga0496110_0980438 | 3300048913 | Bacteria | 752 |
| 705 | Ga0496111_0056301 | 3300048914 | Bacteria | 2845 |
| 706 | Ga0496111_0152814 | 3300048914 | Bacteria | 1712 |
| 707 | Ga0496111_0583484 | 3300048914 | Bacteria | 819 |
| 708 | Ga0496112_0045698 | 3300048915 | Bacteria | 4293 |
| 709 | Ga0496112_0053279 | 3300048915 | Bacteria | 3973 |
| 710 | Ga0496112_0242029 | 3300048915 | Bacteria | 1756 |
| 711 | Ga0496112_0704478 | 3300048915 | Bacteria | 937 |
| 712 | Ga0496112_0938372 | 3300048915 | Bacteria | 786 |
| 713 | Ga0496113_0004044 | 3300048916 | Bacteria | 8931 |
| 714 | Ga0496113_0055910 | 3300048916 | Bacteria | 2960 |
| 715 | Ga0496113_0297442 | 3300048916 | Bacteria | 1292 |
| 716 | Ga0496113_0534347 | 3300048916 | Bacteria | 941 |
| 717 | Ga0496114_0014145 | 3300048917 | Bacteria | 6399 |
| 718 | Ga0496114_0121968 | 3300048917 | Bacteria | 2242 |
| 719 | Ga0496115_0005405 | 3300048918 | Bacteria | 9289 |
| 720 | Ga0496115_0032960 | 3300048918 | Bacteria | 4089 |
| 721 | Ga0496115_0069485 | 3300048918 | Bacteria | 2853 |
| 722 | Ga0496116_0028887 | 3300048919 | Bacteria | 4009 |
| 723 | Ga0496116_0032538 | 3300048919 | Bacteria | 3715 |
| 724 | Ga0496116_0242663 | 3300048919 | Bacteria | 904 |
| 725 | Ga0496117_0061833 | 3300048920 | Bacteria | 2571 |
| 726 | Ga0496117_0071741 | 3300048920 | Bacteria | 2319 |
| 727 | Ga0496117_0301026 | 3300048920 | Bacteria | 849 |
| 728 | Ga0496118_0002445 | 3300048921 | Bacteria | 25000 |
| 729 | Ga0496119_0015983 | 3300048922 | Bacteria | 5739 |
| 730 | Ga0496119_0069417 | 3300048922 | Bacteria | 2071 |
| 731 | Ga0496119_0215489 | 3300048922 | Bacteria | 985 |
| 732 | Ga0496120_0035858 | 3300048923 | Bacteria | 2958 |
| 733 | Ga0496121_0000452 | 3300048924 | Bacteria | 80796 |
| 734 | Ga0496121_0000571 | 3300048924 | Bacteria | 69504 |
| 735 | Ga0496121_0024152 | 3300048924 | Bacteria | 5823 |
| 736 | Ga0496121_0043447 | 3300048924 | Bacteria | 3891 |
| 737 | Ga0496121_0050510 | 3300048924 | Bacteria | 3512 |
| 738 | Ga0496121_0051348 | 3300048924 | Bacteria | 3473 |
| 739 | Ga0496121_0071559 | 3300048924 | Bacteria | 2788 |
| 740 | Ga0496121_0114848 | 3300048924 | Bacteria | 2045 |
| 741 | Ga0496121_0322890 | 3300048924 | Bacteria | 1039 |
| 742 | Ga0496122_0205725 | 3300048925 | Bacteria | 1146 |
| 743 | Ga0496124_0000267 | 3300048927 | Bacteria | 101138 |
| 744 | Ga0496124_0026050 | 3300048927 | Bacteria | 5280 |
| 745 | Ga0496124_0053485 | 3300048927 | Bacteria | 3422 |
| 746 | Ga0496125_0043745 | 3300048928 | Bacteria | 3796 |
| 747 | Ga0496125_0059362 | 3300048928 | Bacteria | 3083 |
| 748 | Ga0496125_0069134 | 3300048928 | Bacteria | 2773 |
| 749 | Ga0496126_0015704 | 3300048929 | Bacteria | 7609 |
| 750 | Ga0496126_0035587 | 3300048929 | Bacteria | 4665 |
| 751 | Ga0496126_0052619 | 3300048929 | Bacteria | 3699 |
| 752 | Ga0496126_0059836 | 3300048929 | Bacteria | 3429 |
| 753 | Ga0496126_0071503 | 3300048929 | Bacteria | 3088 |
| 754 | Ga0496126_0355971 | 3300048929 | Bacteria | 1196 |
| 755 | Ga0496126_0366683 | 3300048929 | Bacteria | 1175 |
| 756 | Ga0496126_0580061 | 3300048929 | Bacteria | 886 |
| 757 | Ga0496126_0676636 | 3300048929 | Bacteria | 804 |
| 758 | Ga0495682_0014877 | 3300049460 | Bacteria | 2948 |
| 759 | Ga0495682_0139946 | 3300049460 | Bacteria | 864 |
| 760 | Ga0501069_0480989 | 3300049585 | Bacteria | 740 |
| 761 | Ga0501071_0175538 | 3300049587 | Bacteria | 1605 |
| 762 | Ga0501076_0123356 | 3300049592 | Bacteria | 2098 |
| 763 | Ga0501080_0060360 | 3300049742 | Bacteria | 3530 |
| 764 | Ga0501035_0618962 | 3300049822 | Bacteria | 881 |
| 765 | nmdc:mga03683_133639_c1 | 3300050489 | Bacteria | 1111 |
| 766 | nmdc:mga03683_184261_c1 | 3300050489 | Bacteria | 953 |
| 767 | nmdc:mga03n38_155829_c1 | 3300050490 | Bacteria | 1153 |
| 768 | nmdc:mga03n38_208_c1 | 3300050490 | Bacteria | 12446 |
| 769 | nmdc:mga03n38_58574_c1 | 3300050490 | Bacteria | 1746 |
| 770 | nmdc:mga00v17_145883_c1 | 3300050491 | Bacteria | 1519 |
| 771 | nmdc:mga00v17_439992_c1 | 3300050491 | Bacteria | 847 |
| 772 | nmdc:mga00v17_55068_c1 | 3300050491 | Bacteria | 2428 |
| 773 | nmdc:mga0yw44_14616_c1 | 3300050492 | Bacteria | 4175 |
| 774 | nmdc:mga0yw44_223543_c1 | 3300050492 | Bacteria | 1248 |
| 775 | nmdc:mga0yw44_557513_c1 | 3300050492 | Bacteria | 778 |
| 776 | nmdc:mga0yw44_66485_c1 | 3300050492 | Bacteria | 2225 |
| 777 | nmdc:mga0k408_122214_c1 | 3300050493 | Bacteria | 1543 |
| 778 | nmdc:mga0k408_211493_c1 | 3300050493 | Bacteria | 1158 |
| 779 | nmdc:mga0k408_4612_c1 | 3300050493 | Bacteria | 5915 |
| 780 | nmdc:mga06z11_118063_c1 | 3300050494 | Bacteria | 1477 |
| 781 | nmdc:mga06z11_199908_c1 | 3300050494 | Bacteria | 1160 |
| 782 | nmdc:mga06z11_57073_c1 | 3300050494 | Bacteria | 2021 |
| 783 | nmdc:mga06z11_73502_c1 | 3300050494 | Bacteria | 1816 |
| 784 | nmdc:mga04h51_17986_c1 | 3300050495 | Bacteria | 2075 |
| 785 | nmdc:mga04h51_53954_c1 | 3300050495 | Bacteria | 1357 |
| 786 | nmdc:mga07m45_14648_c1 | 3300050496 | Bacteria | 4182 |
| 787 | nmdc:mga07m45_182616_c1 | 3300050496 | Bacteria | 1220 |
| 788 | nmdc:mga07m45_488800_c1 | 3300050496 | Bacteria | 713 |
| 789 | nmdc:mga07m45_74631_c1 | 3300050496 | Bacteria | 1932 |
| 790 | nmdc:mga08y16_211641_c1 | 3300050511 | Bacteria | 2008 |
| 791 | nmdc:mga08y16_527905_c1 | 3300050511 | Bacteria | 1196 |
| 792 | nmdc:mga0n895_1120456_c1 | 3300050512 | Bacteria | 764 |
| 793 | nmdc:mga0n895_21774_c1 | 3300050512 | Bacteria | 6000 |
| 794 | nmdc:mga0rr50_171235_c1 | 3300050513 | Bacteria | 1769 |
| 795 | nmdc:mga08x19_97007_c1 | 3300050514 | Bacteria | 1951 |
| 796 | nmdc:mga0a205_133434_c1 | 3300050515 | Bacteria | 2383 |
| 797 | nmdc:mga0sz30_23037_c2 | 3300050516 | Bacteria | 1851 |
| 798 | nmdc:mga0sz30_55224_c1 | 3300050516 | Bacteria | 1690 |
| 799 | Ga0495612_0053958 | 3300053078 | Bacteria | 1655 |
| 800 | Ga0500610_0158106 | 3300053079 | Bacteria | 1130 |
| 801 | Ga0500635_0006464 | 3300053080 | Bacteria | 3131 |
| 802 | Ga0500635_0062937 | 3300053080 | Bacteria | 1299 |
| 803 | Ga0495655_0014011 | 3300053083 | Bacteria | 1672 |
| 804 | Ga0495619_0007832 | 3300053085 | Bacteria | 6762 |
| 805 | Ga0495619_0514646 | 3300053085 | Bacteria | 822 |
| 806 | Ga0500578_0120031 | 3300053086 | Bacteria | 1653 |
| 807 | Ga0500578_0297900 | 3300053086 | Bacteria | 957 |
| 808 | Ga0500643_000028 | 3300053087 | Bacteria | 245672 |
| 809 | Ga0500644_0052058 | 3300053088 | Bacteria | 1408 |
| 810 | Ga0500646_0064528 | 3300053090 | Bacteria | 1085 |
| 811 | Ga0500647_0018007 | 3300053091 | Bacteria | 3267 |
| 812 | Ga0500583_0022614 | 3300053092 | Bacteria | 2636 |
| 813 | Ga0500651_0038098 | 3300053093 | Bacteria | 3029 |
| 814 | Ga0500566_0000245 | 3300053094 | Bacteria | 28976 |
| 815 | Ga0500566_0002949 | 3300053094 | Bacteria | 10161 |
| 816 | Ga0500566_0069046 | 3300053094 | Bacteria | 1986 |
| 817 | Ga0500641_0027837 | 3300053096 | Bacteria | 2203 |
| 818 | Ga0500641_0065899 | 3300053096 | Bacteria | 1516 |
| 819 | Ga0500650_0092938 | 3300053098 | Bacteria | 1412 |
| 820 | Ga0500650_0114678 | 3300053098 | Bacteria | 1257 |
| 821 | Ga0500555_002075 | 3300053103 | Bacteria | 5892 |
| 822 | Ga0500556_0017153 | 3300053104 | Bacteria | 2264 |
| 823 | Ga0500557_000116 | 3300053105 | Bacteria | 22549 |
| 824 | Ga0500562_044412 | 3300053108 | Bacteria | 1183 |
| 825 | Ga0500569_002793 | 3300053109 | Bacteria | 3483 |
| 826 | Ga0500572_004309 | 3300053111 | Bacteria | 3231 |
| 827 | Ga0500595_000580 | 3300053119 | Bacteria | 21802 |
| 828 | Ga0500595_004072 | 3300053119 | Bacteria | 6645 |
| 829 | Ga0500595_035681 | 3300053119 | Bacteria | 1635 |
| 830 | Ga0500595_058462 | 3300053119 | Bacteria | 1172 |
| 831 | Ga0500607_228960 | 3300053121 | Bacteria | 764 |
| 832 | Ga0500642_0000113 | 3300053130 | Bacteria | 37567 |
| 833 | Ga0500642_0001807 | 3300053130 | Bacteria | 6174 |
| 834 | Ga0500642_0233797 | 3300053130 | Bacteria | 848 |
| 835 | Ga0500655_017624 | 3300053133 | Bacteria | 1322 |
| 836 | Ga0500655_017634 | 3300053133 | Bacteria | 1322 |
| 837 | Ga0500559_0000103 | 3300053136 | Bacteria | 66422 |
| 838 | Ga0500559_0016441 | 3300053136 | Bacteria | 3124 |
| 839 | Ga0500559_0115729 | 3300053136 | Bacteria | 1244 |
| 840 | Ga0500564_180237 | 3300053138 | Bacteria | 881 |
| 841 | Ga0500568_0005758 | 3300053139 | Bacteria | 6344 |
| 842 | Ga0500568_0043749 | 3300053139 | Bacteria | 1789 |
| 843 | Ga0500577_0040536 | 3300053142 | Bacteria | 1694 |
| 844 | Ga0500577_0103682 | 3300053142 | Bacteria | 1166 |
| 845 | Ga0500577_0228024 | 3300053142 | Bacteria | 807 |
| 846 | Ga0500579_184734 | 3300053143 | Bacteria | 811 |
| 847 | Ga0500590_080114 | 3300053148 | Bacteria | 1606 |
| 848 | Ga0500590_083689 | 3300053148 | Bacteria | 1563 |
| 849 | Ga0500603_016640 | 3300053150 | Bacteria | 1748 |
| 850 | Ga0500604_0006950 | 3300053151 | Bacteria | 2996 |
| 851 | Ga0500616_0000046 | 3300053153 | Bacteria | 333409 |
| 852 | Ga0500620_026632 | 3300053155 | Bacteria | 1792 |
| 853 | Ga0500622_0188348 | 3300053156 | Bacteria | 947 |
| 854 | Ga0500633_0131813 | 3300053160 | Bacteria | 933 |
| 855 | Ga0500634_0053113 | 3300053161 | Bacteria | 2175 |
| 856 | Ga0500638_016392 | 3300053162 | Bacteria | 3418 |
| 857 | Ga0500638_042327 | 3300053162 | Bacteria | 2212 |
| 858 | Ga0500638_094379 | 3300053162 | Bacteria | 1404 |
| 859 | Ga0500636_0000054 | 3300053177 | Bacteria | 54446 |
| 860 | Ga0500636_0108981 | 3300053177 | Bacteria | 1567 |
| 861 | Ga0500637_0000303 | 3300053178 | Bacteria | 18607 |
| 862 | Ga0500637_0027373 | 3300053178 | Bacteria | 3147 |
| 863 | Ga0500637_0273034 | 3300053178 | Bacteria | 934 |
| 864 | Ga0500611_005942 | 3300053727 | Bacteria | 1749 |
| 865 | Ga0500625_017426 | 3300053729 | Bacteria | 3355 |
| 866 | Ga0500645_005369 | 3300053730 | Bacteria | 4733 |
| 867 | Ga0500645_048584 | 3300053730 | Bacteria | 1242 |
| 868 | Ga0500552_020370 | 3300053733 | Bacteria | 938 |
| 869 | Ga0500596_005620 | 3300053735 | Bacteria | 2185 |
| 870 | Ga0500596_006582 | 3300053735 | Bacteria | 1955 |
| 871 | Ga0500599_002194 | 3300053736 | Bacteria | 2321 |
| 872 | Ga0500601_000834 | 3300053737 | Bacteria | 3791 |
| 873 | Ga0500661_001086 | 3300055283 | Bacteria | 5115 |
| 874 | Ga0501082_0090266 | 3300060353 | Bacteria | 2646 |
| 875 | Ga0530510_0254120 | 3300061734 | Bacteria | 1310 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053153 | Ga0500616_0000046 | Ga0500616_0000046_251326_251988 | 182 |
| 2 | 3300005937 | Ga0081455_10006663 | Ga0081455_1000666313 | 184 |
| 3 | iso_pu_bacteria | 2513237139 | 2513874131 | 188 |
| 4 | iso_pu_bacteria | 2824732956 | 2824736433 | 188 |
| 5 | iso_pu_bacteria | 2824746037 | 2824751039 | 188 |
| 6 | iso_pu_bacteria | 2908775508 | 2908776828 | 188 |
| 7 | 3300046680 | Ga0495646_0113582 | Ga0495646_0113582_20_592 | 189 |
| 8 | 3300047471 | Ga0495684_0436988 | Ga0495684_0436988_33_605 | 189 |
| 9 | 3300048914 | Ga0496111_0583484 | Ga0496111_0583484_23_604 | 190 |
| 10 | 3300006353 | Ga0075370_10116584 | Ga0075370_101165843 | 198 |
| 11 | 3300007788 | Ga0099795_10161517 | Ga0099795_101615171 | 198 |
| 12 | 3300037471 | Ga0395905_0134424 | Ga0395905_0134424_1395_2027 | 198 |
| 13 | 3300038443 | Ga0395901_0371972 | Ga0395901_0371972_701_1333 | 198 |
| 14 | 3300048904 | Ga0496101_0559044 | Ga0496101_0559044_159_767 | 198 |
| 15 | 3300050493 | nmdc:mga0k408_211493_c1 | nmdc:mga0k408_211493_c1_394_1053 | 198 |
| 16 | 3300003354 | JGI25160J50197_1001680 | JGI25160J50197_100168010 | 199 |
| 17 | 3300003354 | JGI25160J50197_1005384 | JGI25160J50197_10053845 | 199 |
| 18 | 3300025302 | Ga0207426_1000271 | Ga0207426_100027171 | 199 |
| 19 | 3300053094 | Ga0500566_0002949 | Ga0500566_0002949_8346_8957 | 199 |
| 20 | 3300053119 | Ga0500595_000580 | Ga0500595_000580_10570_11181 | 199 |
| 21 | 3300053148 | Ga0500590_083689 | Ga0500590_083689_235_843 | 199 |
| 22 | 3300053150 | Ga0500603_016640 | Ga0500603_016640_583_1194 | 199 |
| 23 | 3300053162 | Ga0500638_016392 | Ga0500638_016392_2264_2875 | 199 |
| 24 | 3300053178 | Ga0500637_0000303 | Ga0500637_0000303_10555_11166 | 199 |
| 25 | 3300055283 | Ga0500661_001086 | Ga0500661_001086_1457_2068 | 199 |
| 26 | 3300005577 | Ga0068857_100125486 | Ga0068857_1001254863 | 200 |
| 27 | 3300025914 | Ga0207671_10173745 | Ga0207671_101737453 | 200 |
| 28 | 3300025924 | Ga0207694_10173320 | Ga0207694_101733203 | 200 |
| 29 | 3300026116 | Ga0207674_10055839 | Ga0207674_100558393 | 200 |
| 30 | 3300026142 | Ga0207698_11005794 | Ga0207698_110057941 | 200 |
| 31 | 3300048919 | Ga0496116_0242663 | Ga0496116_0242663_245_865 | 200 |
| 32 | 3300048924 | Ga0496121_0114848 | Ga0496121_0114848_85_756 | 200 |
| 33 | 3300049587 | Ga0501071_0175538 | Ga0501071_0175538_16_621 | 200 |
| 34 | 3300049592 | Ga0501076_0123356 | Ga0501076_0123356_25_630 | 200 |
| 35 | 3300050489 | nmdc:mga03683_133639_c1 | nmdc:mga03683_133639_c1_128_748 | 200 |
| 36 | 3300050494 | nmdc:mga06z11_199908_c1 | nmdc:mga06z11_199908_c1_336_956 | 200 |
| 37 | 3300050495 | nmdc:mga04h51_53954_c1 | nmdc:mga04h51_53954_c1_510_1130 | 200 |
| 38 | 3300050496 | nmdc:mga07m45_488800_c1 | nmdc:mga07m45_488800_c1_43_663 | 200 |
| 39 | 3300026142 | Ga0207698_11336862 | Ga0207698_113368621 | 201 |
| 40 | 3300046689 | Ga0495613_0756129 | Ga0495613_0756129_13_627 | 201 |
| 41 | 3300046692 | Ga0495671_0043951 | Ga0495671_0043951_1287_1895 | 201 |
| 42 | 3300050511 | nmdc:mga08y16_211641_c1 | nmdc:mga08y16_211641_c1_1364_1972 | 201 |
| 43 | 3300053088 | Ga0500644_0052058 | Ga0500644_0052058_664_1272 | 201 |
| 44 | 3300053098 | Ga0500650_0114678 | Ga0500650_0114678_214_822 | 201 |
| 45 | 3300053130 | Ga0500642_0233797 | Ga0500642_0233797_10_618 | 201 |
| 46 | 3300053133 | Ga0500655_017624 | Ga0500655_017624_687_1295 | 201 |
| 47 | 3300053160 | Ga0500633_0131813 | Ga0500633_0131813_50_658 | 201 |
| 48 | 3300003215 | JGI25153J46596_10004097 | JGI25153J46596_100040977 | 202 |
| 49 | 3300025297 | Ga0209758_1000277 | Ga0209758_100027738 | 202 |
| 50 | 3300026095 | Ga0207676_10614381 | Ga0207676_106143812 | 202 |
| 51 | 3300031730 | Ga0307516_10011176 | Ga0307516_1001117610 | 202 |
| 52 | 3300033544 | Ga0316215_1002564 | Ga0316215_10025641 | 202 |
| 53 | 3300035692 | Ga0373935_0557741 | Ga0373935_0557741_213_824 | 202 |
| 54 | 3300036459 | Ga0372808_020869 | Ga0372808_020869_59_673 | 202 |
| 55 | 3300046616 | Ga0495668_0379536 | Ga0495668_0379536_15_626 | 202 |
| 56 | iso_pu_bacteria | 2841957949 | 2841963878 | 202 |
| 57 | iso_pu_bacteria | 2847930680 | 2847931928 | 202 |
| 58 | iso_pu_bacteria | 2874620515 | 2874621914 | 202 |
| 59 | iso_pu_bacteria | 2904666416 | 2904669493 | 202 |
| 60 | 3300046809 | Ga0495600_0210544 | Ga0495600_0210544_310_930 | 203 |
| 61 | 3300048929 | Ga0496126_0052619 | Ga0496126_0052619_390_1067 | 203 |
| 62 | iso_pu_bacteria | 2728368998 | 2728748321 | 204 |
| 63 | 3300025254 | Ga0209148_1000267 | Ga0209148_100026767 | 205 |
| 64 | 3300025261 | Ga0209233_1012874 | Ga0209233_10128744 | 205 |
| 65 | 3300025272 | Ga0209455_1001737 | Ga0209455_10017377 | 205 |
| 66 | 3300038443 | Ga0395901_0061578 | Ga0395901_0061578_2537_3202 | 205 |
| 67 | 3300037312 | Ga0395899_0050587 | Ga0395899_0050587_1698_2366 | 206 |
| 68 | 3300037418 | Ga0395900_0001051 | Ga0395900_0001051_382_1050 | 206 |
| 69 | 3300037466 | Ga0395898_0001503 | Ga0395898_0001503_2199_2867 | 206 |
| 70 | 3300037853 | Ga0436364_0238267 | Ga0436364_0238267_108_740 | 206 |
| 71 | 3300038443 | Ga0395901_0092858 | Ga0395901_0092858_793_1461 | 206 |
| 72 | 3300046477 | Ga0495664_0011915 | Ga0495664_0011915_1555_2187 | 206 |
| 73 | 3300046533 | Ga0495640_0081673 | Ga0495640_0081673_829_1461 | 206 |
| 74 | 3300046543 | Ga0495645_0163321 | Ga0495645_0163321_620_1252 | 206 |
| 75 | 3300046663 | Ga0495635_0158351 | Ga0495635_0158351_835_1467 | 206 |
| 76 | 3300046675 | Ga0495657_0002384 | Ga0495657_0002384_7252_7884 | 206 |
| 77 | 3300046678 | Ga0495599_0004607 | Ga0495599_0004607_3158_3790 | 206 |
| 78 | 3300046679 | Ga0495623_0010248 | Ga0495623_0010248_2975_3607 | 206 |
| 79 | 3300046680 | Ga0495646_0120906 | Ga0495646_0120906_607_1239 | 206 |
| 80 | 3300047317 | Ga0495604_0002741 | Ga0495604_0002741_11756_12388 | 206 |
| 81 | 3300047322 | Ga0495680_0001876 | Ga0495680_0001876_13555_14187 | 206 |
| 82 | 3300047444 | Ga0495675_0007387 | Ga0495675_0007387_879_1511 | 206 |
| 83 | 3300048088 | Ga0495602_0134279 | Ga0495602_0134279_207_839 | 206 |
| 84 | 3300048906 | Ga0496103_0629569 | Ga0496103_0629569_23_655 | 206 |
| 85 | 3300048928 | Ga0496125_0059362 | Ga0496125_0059362_269_901 | 206 |
| 86 | 3300050491 | nmdc:mga00v17_55068_c1 | nmdc:mga00v17_55068_c1_1607_2239 | 206 |
| 87 | 3300053177 | Ga0500636_0108981 | Ga0500636_0108981_95_727 | 206 |
| 88 | 3300010375 | Ga0105239_10321091 | Ga0105239_103210912 | 207 |
| 89 | 3300044694 | Ga0466963_0027444 | Ga0466963_0027444_128_763 | 207 |
| 90 | 3300046491 | Ga0495584_0131529 | Ga0495584_0131529_471_1106 | 207 |
| 91 | 3300046513 | Ga0495616_0057328 | Ga0495616_0057328_701_1336 | 207 |
| 92 | 3300047443 | Ga0495687_016979 | Ga0495687_016979_932_1567 | 207 |
| 93 | 3300048912 | Ga0496109_0023442 | Ga0496109_0023442_1508_2143 | 207 |
| 94 | 3300048915 | Ga0496112_0938372 | Ga0496112_0938372_63_698 | 207 |
| 95 | 3300048916 | Ga0496113_0055910 | Ga0496113_0055910_1056_1691 | 207 |
| 96 | 3300048922 | Ga0496119_0069417 | Ga0496119_0069417_772_1407 | 207 |
| 97 | 3300050490 | nmdc:mga03n38_58574_c1 | nmdc:mga03n38_58574_c1_306_941 | 207 |
| 98 | 3300050494 | nmdc:mga06z11_73502_c1 | nmdc:mga06z11_73502_c1_790_1425 | 207 |
| 99 | 3300053083 | Ga0495655_0014011 | Ga0495655_0014011_482_1117 | 207 |
| 100 | 3300005336 | Ga0070680_100221827 | Ga0070680_1002218272 | 208 |
| 101 | 3300005439 | Ga0070711_100166520 | Ga0070711_1001665201 | 208 |
| 102 | 3300005458 | Ga0070681_10051933 | Ga0070681_100519333 | 208 |
| 103 | 3300005530 | Ga0070679_100137259 | Ga0070679_1001372592 | 208 |
| 104 | 3300005563 | Ga0068855_100217196 | Ga0068855_1002171963 | 208 |
| 105 | 3300006173 | Ga0070716_100585493 | Ga0070716_1005854932 | 208 |
| 106 | 3300009545 | Ga0105237_10080389 | Ga0105237_100803892 | 208 |
| 107 | 3300009551 | Ga0105238_10018488 | Ga0105238_100184888 | 208 |
| 108 | 3300009551 | Ga0105238_10422128 | Ga0105238_104221281 | 208 |
| 109 | 3300010375 | Ga0105239_10142048 | Ga0105239_101420482 | 208 |
| 110 | 3300013296 | Ga0157374_10191301 | Ga0157374_101913012 | 208 |
| 111 | 3300021384 | Ga0213876_10094238 | Ga0213876_100942382 | 208 |
| 112 | 3300021388 | Ga0213875_10130551 | Ga0213875_101305511 | 208 |
| 113 | 3300025924 | Ga0207694_10356417 | Ga0207694_103564172 | 208 |
| 114 | 3300025949 | Ga0207667_10086148 | Ga0207667_100861484 | 208 |
| 115 | 3300026078 | Ga0207702_10436225 | Ga0207702_104362252 | 208 |
| 116 | 3300026116 | Ga0207674_10310289 | Ga0207674_103102892 | 208 |
| 117 | 3300028556 | Ga0265337_1006988 | Ga0265337_10069884 | 208 |
| 118 | 3300028573 | Ga0265334_10005278 | Ga0265334_100052782 | 208 |
| 119 | 3300028577 | Ga0265318_10031122 | Ga0265318_100311223 | 208 |
| 120 | 3300028653 | Ga0265323_10000560 | Ga0265323_1000056014 | 208 |
| 121 | 3300028666 | Ga0265336_10000550 | Ga0265336_1000055016 | 208 |
| 122 | 3300028800 | Ga0265338_10000231 | Ga0265338_1000023193 | 208 |
| 123 | 3300029957 | Ga0265324_10005806 | Ga0265324_100058063 | 208 |
| 124 | 3300037418 | Ga0395900_0399957 | Ga0395900_0399957_211_846 | 208 |
| 125 | 3300037853 | Ga0436364_0310036 | Ga0436364_0310036_2097_2732 | 208 |
| 126 | 3300039437 | Ga0436365_0372041 | Ga0436365_0372041_2276_2908 | 208 |
| 127 | 3300039450 | Ga0436363_1689393 | Ga0436363_1689393_65_697 | 208 |
| 128 | iso_pu_bacteria | 2906643746 | 2906645793 | 208 |
| 129 | iso_pu_bacteria | 3005483717 | 3005490881 | 208 |
| 130 | iso_pu_bacteria | 3005587118 | 3005593200 | 208 |
| 131 | 3300006051 | Ga0075364_10039240 | Ga0075364_100392402 | 209 |
| 132 | 3300006186 | Ga0075369_10028877 | Ga0075369_100288773 | 209 |
| 133 | 3300026067 | Ga0207678_10040824 | Ga0207678_100408244 | 209 |
| 134 | 3300035695 | Ga0373927_0263187 | Ga0373927_0263187_42_701 | 209 |
| 135 | 3300039437 | Ga0436365_1021233 | Ga0436365_1021233_163_798 | 209 |
| 136 | iso_pu_bacteria | 2513237104 | 2513716656 | 209 |
| 137 | iso_pu_bacteria | 2824704595 | 2824710856 | 209 |
| 138 | iso_pu_bacteria | 2824753945 | 2824761521 | 209 |
| 139 | iso_pu_bacteria | 2824763712 | 2824765064 | 209 |
| 140 | iso_pu_bacteria | 2879083081 | 2879091162 | 209 |
| 141 | iso_pu_bacteria | 2881364244 | 2881364580 | 209 |
| 142 | iso_pu_bacteria | 2904711408 | 2904716497 | 209 |
| 143 | iso_pu_bacteria | 2906626472 | 2906629677 | 209 |
| 144 | iso_pu_bacteria | 2941531003 | 2941532050 | 209 |
| 145 | iso_pu_bacteria | 8016583857 | 8016587521 | 209 |
| 146 | 3300009148 | Ga0105243_10994056 | Ga0105243_109940561 | 210 |
| 147 | 3300053093 | Ga0500651_0038098 | Ga0500651_0038098_2331_2978 | 210 |
| 148 | 3300053109 | Ga0500569_002793 | Ga0500569_002793_495_1142 | 210 |
| 149 | 3300053119 | Ga0500595_035681 | Ga0500595_035681_560_1207 | 210 |
| 150 | 3300053133 | Ga0500655_017634 | Ga0500655_017634_335_982 | 210 |
| 151 | 3300053142 | Ga0500577_0228024 | Ga0500577_0228024_60_707 | 210 |
| 152 | iso_pu_bacteria | 2508501009 | 2508545909 | 210 |
| 153 | iso_pu_bacteria | 2511231028 | 2511400264 | 210 |
| 154 | iso_pu_bacteria | 2513237092 | 2513624280 | 210 |
| 155 | iso_pu_bacteria | 2513237094 | 2513638767 | 210 |
| 156 | iso_pu_bacteria | 2513237102 | 2513701643 | 210 |
| 157 | iso_pu_bacteria | 2513237161 | 2514010104 | 210 |
| 158 | iso_pu_bacteria | 2517093001 | 2517103029 | 210 |
| 159 | iso_pu_bacteria | 2524023205 | 2524438868 | 210 |
| 160 | iso_pu_bacteria | 2528768022 | 2528849486 | 210 |
| 161 | iso_pu_bacteria | 2617270735 | 2617350256 | 210 |
| 162 | iso_pu_bacteria | 2744054633 | 2745080371 | 210 |
| 163 | iso_pu_bacteria | 2791355196 | 2793059257 | 210 |
| 164 | iso_pu_bacteria | 2802429603 | 2805920850 | 210 |
| 165 | iso_pu_bacteria | 2816332527 | 2818240632 | 210 |
| 166 | iso_pu_bacteria | 2824600985 | 2824607602 | 210 |
| 167 | iso_pu_bacteria | 2824609381 | 2824615346 | 210 |
| 168 | iso_pu_bacteria | 2824617872 | 2824618797 | 210 |
| 169 | iso_pu_bacteria | 2824626560 | 2824628903 | 210 |
| 170 | iso_pu_bacteria | 2824635225 | 2824638414 | 210 |
| 171 | iso_pu_bacteria | 2824644064 | 2824648046 | 210 |
| 172 | iso_pu_bacteria | 2824653114 | 2824657967 | 210 |
| 173 | iso_pu_bacteria | 2824661429 | 2824665883 | 210 |
| 174 | iso_pu_bacteria | 2824671348 | 2824675853 | 210 |
| 175 | iso_pu_bacteria | 2824679649 | 2824681638 | 210 |
| 176 | iso_pu_bacteria | 2824687955 | 2824692814 | 210 |
| 177 | iso_pu_bacteria | 2824696289 | 2824699391 | 210 |
| 178 | iso_pu_bacteria | 2824714736 | 2824722615 | 210 |
| 179 | iso_pu_bacteria | 2824723954 | 2824726005 | 210 |
| 180 | iso_pu_bacteria | 2824773399 | 2824778047 | 210 |
| 181 | iso_pu_bacteria | 2838122688 | 2838125984 | 210 |
| 182 | iso_pu_bacteria | 2841941048 | 2841942621 | 210 |
| 183 | iso_pu_bacteria | 2841949485 | 2841953027 | 210 |
| 184 | iso_pu_bacteria | 2841966195 | 2841970947 | 210 |
| 185 | iso_pu_bacteria | 2841974524 | 2841977795 | 210 |
| 186 | iso_pu_bacteria | 2841983080 | 2841984643 | 210 |
| 187 | iso_pu_bacteria | 2842038055 | 2842041636 | 210 |
| 188 | iso_pu_bacteria | 2842045827 | 2842049678 | 210 |
| 189 | iso_pu_bacteria | 2844315083 | 2844321468 | 210 |
| 190 | iso_pu_bacteria | 2847939898 | 2847943168 | 210 |
| 191 | iso_pu_bacteria | 2849076700 | 2849076908 | 210 |
| 192 | iso_pu_bacteria | 2857509624 | 2857514828 | 210 |
| 193 | iso_pu_bacteria | 2874590934 | 2874595375 | 210 |
| 194 | iso_pu_bacteria | 2874612657 | 2874620424 | 210 |
| 195 | iso_pu_bacteria | 2874628541 | 2874629592 | 210 |
| 196 | iso_pu_bacteria | 2874645413 | 2874651801 | 210 |
| 197 | iso_pu_bacteria | 2876771140 | 2876775569 | 210 |
| 198 | iso_pu_bacteria | 2876818435 | 2876823561 | 210 |
| 199 | iso_pu_bacteria | 2879074833 | 2879079660 | 210 |
| 200 | iso_pu_bacteria | 2879099564 | 2879104443 | 210 |
| 201 | iso_pu_bacteria | 2879127579 | 2879133936 | 210 |
| 202 | iso_pu_bacteria | 2879142872 | 2879145069 | 210 |
| 203 | iso_pu_bacteria | 2881665667 | 2881673323 | 210 |
| 204 | iso_pu_bacteria | 2885366525 | 2885374340 | 210 |
| 205 | iso_pu_bacteria | 2885409591 | 2885413720 | 210 |
| 206 | iso_pu_bacteria | 2888378607 | 2888387312 | 210 |
| 207 | iso_pu_bacteria | 2888388044 | 2888391395 | 210 |
| 208 | iso_pu_bacteria | 2888419890 | 2888426991 | 210 |
| 209 | iso_pu_bacteria | 2903727486 | 2903727953 | 210 |
| 210 | iso_pu_bacteria | 2906602504 | 2906602563 | 210 |
| 211 | iso_pu_bacteria | 2922368715 | 2922370260 | 210 |
| 212 | iso_pu_bacteria | 2922393267 | 2922400120 | 210 |
| 213 | iso_pu_bacteria | 2929615660 | 2929622687 | 210 |
| 214 | iso_pu_bacteria | 2929624759 | 2929632210 | 210 |
| 215 | iso_pu_bacteria | 2932784394 | 2932789975 | 210 |
| 216 | iso_pu_bacteria | 2932794094 | 2932800652 | 210 |
| 217 | iso_pu_bacteria | 2932801729 | 2932808383 | 210 |
| 218 | iso_pu_bacteria | 2932809354 | 2932815517 | 210 |
| 219 | iso_pu_bacteria | 2932818245 | 2932824907 | 210 |
| 220 | iso_pu_bacteria | 2932828146 | 2932829169 | 210 |
| 221 | iso_pu_bacteria | 2933577622 | 2933584682 | 210 |
| 222 | iso_pu_bacteria | 2935616580 | 2935617644 | 210 |
| 223 | iso_pu_bacteria | 2935638405 | 2935643689 | 210 |
| 224 | iso_pu_bacteria | 2935665750 | 2935671001 | 210 |
| 225 | iso_pu_bacteria | 2935675223 | 2935681644 | 210 |
| 226 | iso_pu_bacteria | 2935684952 | 2935692621 | 210 |
| 227 | iso_pu_bacteria | 2935694250 | 2935702607 | 210 |
| 228 | iso_pu_bacteria | 2935703347 | 2935711895 | 210 |
| 229 | iso_pu_bacteria | 2935713505 | 2935721239 | 210 |
| 230 | iso_pu_bacteria | 2935722832 | 2935730767 | 210 |
| 231 | iso_pu_bacteria | 2935732158 | 2935739929 | 210 |
| 232 | iso_pu_bacteria | 2935741537 | 2935748967 | 210 |
| 233 | iso_pu_bacteria | 2935750917 | 2935758837 | 210 |
| 234 | iso_pu_bacteria | 2935760218 | 2935767101 | 210 |
| 235 | iso_pu_bacteria | 2935769743 | 2935774863 | 210 |
| 236 | iso_pu_bacteria | 2935777560 | 2935779951 | 210 |
| 237 | iso_pu_bacteria | 2935785616 | 2935792219 | 210 |
| 238 | iso_pu_bacteria | 2935793552 | 2935798612 | 210 |
| 239 | iso_pu_bacteria | 2935801545 | 2935806866 | 210 |
| 240 | iso_pu_bacteria | 2935810662 | 2935818869 | 210 |
| 241 | iso_pu_bacteria | 2935827899 | 2935834374 | 210 |
| 242 | iso_pu_bacteria | 2935837841 | 2935843901 | 210 |
| 243 | iso_pu_bacteria | 2935855204 | 2935856857 | 210 |
| 244 | iso_pu_bacteria | 2935864058 | 2935868384 | 210 |
| 245 | iso_pu_bacteria | 2935873716 | 2935879694 | 210 |
| 246 | iso_pu_bacteria | 2935883170 | 2935883490 | 210 |
| 247 | iso_pu_bacteria | 2935959822 | 2935965322 | 210 |
| 248 | iso_pu_bacteria | 2935992306 | 2935997200 | 210 |
| 249 | iso_pu_bacteria | 2936002035 | 2936009947 | 210 |
| 250 | iso_pu_bacteria | 2936037263 | 2936045445 | 210 |
| 251 | iso_pu_bacteria | 2940556831 | 2940564573 | 210 |
| 252 | iso_pu_bacteria | 2941538514 | 2941545149 | 210 |
| 253 | iso_pu_bacteria | 3005506211 | 3005506527 | 210 |
| 254 | iso_pu_bacteria | 3005710791 | 3005717572 | 210 |
| 255 | iso_pu_bacteria | 3005718088 | 3005724621 | 210 |
| 256 | iso_pu_bacteria | 8016511872 | 8016519043 | 210 |
| 257 | iso_pu_bacteria | 8016522445 | 8016525261 | 210 |
| 258 | iso_pu_bacteria | 8016530956 | 8016538843 | 210 |
| 259 | iso_pu_bacteria | 8016539877 | 8016543126 | 210 |
| 260 | iso_pu_bacteria | 8016548790 | 8016550163 | 210 |
| 261 | iso_pu_bacteria | 8016557553 | 8016558572 | 210 |
| 262 | iso_pu_bacteria | 8016575299 | 8016581183 | 210 |
| 263 | iso_pu_bacteria | 8016595262 | 8016596555 | 210 |
| 264 | iso_pu_bacteria | 8016613128 | 8016619222 | 210 |
| 265 | iso_pu_bacteria | 8016622563 | 8016630377 | 210 |
| 266 | iso_pu_bacteria | 8017057580 | 8017057653 | 210 |
| 267 | iso_pu_bacteria | 8019538911 | 8019541311 | 210 |
| 268 | iso_pu_bacteria | 8019547302 | 8019549320 | 210 |
| 269 | iso_pu_bacteria | 8019576017 | 8019578165 | 210 |
| 270 | iso_pu_bacteria | 8019586578 | 8019596195 | 210 |
| 271 | iso_pu_bacteria | 8019597564 | 8019605499 | 210 |
| 272 | iso_pu_bacteria | 8019608314 | 8019613039 | 210 |
| 273 | iso_pu_bacteria | 8019648815 | 8019651697 | 210 |
| 274 | iso_pu_bacteria | 8055742211 | 8055750570 | 210 |
| 275 | iso_pu_bacteria | 8056967851 | 8056975347 | 210 |
| 276 | 3300005456 | Ga0070678_100029982 | Ga0070678_1000299824 | 211 |
| 277 | 3300005614 | Ga0068856_100832796 | Ga0068856_1008327961 | 211 |
| 278 | 3300005618 | Ga0068864_100182468 | Ga0068864_1001824682 | 211 |
| 279 | 3300005719 | Ga0068861_100139299 | Ga0068861_1001392993 | 211 |
| 280 | 3300005844 | Ga0068862_100569757 | Ga0068862_1005697572 | 211 |
| 281 | 3300006881 | Ga0068865_100069342 | Ga0068865_1000693423 | 211 |
| 282 | 3300009093 | Ga0105240_10053247 | Ga0105240_100532475 | 211 |
| 283 | 3300009094 | Ga0111539_10182022 | Ga0111539_101820222 | 211 |
| 284 | 3300009551 | Ga0105238_10247537 | Ga0105238_102475373 | 211 |
| 285 | 3300011119 | Ga0105246_10114789 | Ga0105246_101147893 | 211 |
| 286 | 3300013104 | Ga0157370_10497971 | Ga0157370_104979712 | 211 |
| 287 | 3300013105 | Ga0157369_10017488 | Ga0157369_100174885 | 211 |
| 288 | 3300013105 | Ga0157369_10102904 | Ga0157369_101029043 | 211 |
| 289 | 3300013307 | Ga0157372_10118851 | Ga0157372_101188514 | 211 |
| 290 | 3300025914 | Ga0207671_10035801 | Ga0207671_100358013 | 211 |
| 291 | 3300025938 | Ga0207704_10265709 | Ga0207704_102657092 | 211 |
| 292 | 3300025942 | Ga0207689_10208165 | Ga0207689_102081653 | 211 |
| 293 | 3300026118 | Ga0207675_100354860 | Ga0207675_1003548602 | 211 |
| 294 | 3300026121 | Ga0207683_10135169 | Ga0207683_101351694 | 211 |
| 295 | 3300028380 | Ga0268265_10770230 | Ga0268265_107702301 | 211 |
| 296 | 3300028381 | Ga0268264_10000051 | Ga0268264_10000051180 | 211 |
| 297 | 3300037418 | Ga0395900_0265761 | Ga0395900_0265761_41_691 | 211 |
| 298 | 3300037466 | Ga0395898_0004875 | Ga0395898_0004875_6396_7046 | 211 |
| 299 | 3300038443 | Ga0395901_0051645 | Ga0395901_0051645_131_781 | 211 |
| 300 | 3300053096 | Ga0500641_0065899 | Ga0500641_0065899_748_1425 | 211 |
| 301 | iso_pu_bacteria | 2876761206 | 2876763622 | 211 |
| 302 | iso_pu_bacteria | 8006926726 | 8006928330 | 211 |
| 303 | 3300005338 | Ga0068868_100284079 | Ga0068868_1002840792 | 212 |
| 304 | 3300005340 | Ga0070689_100474764 | Ga0070689_1004747642 | 212 |
| 305 | 3300025936 | Ga0207670_10389508 | Ga0207670_103895082 | 212 |
| 306 | 3300031711 | Ga0265314_10069773 | Ga0265314_100697733 | 212 |
| 307 | 3300031712 | Ga0265342_10003396 | Ga0265342_1000339615 | 212 |
| 308 | 3300044683 | Ga0466965_0318596 | Ga0466965_0318596_108_761 | 212 |
| 309 | 3300044693 | Ga0466961_0254334 | Ga0466961_0254334_87_764 | 212 |
| 310 | 3300044901 | Ga0466960_0220761 | Ga0466960_0220761_372_1025 | 212 |
| 311 | 3300045836 | Ga0466958_0031405 | Ga0466958_0031405_2187_2864 | 212 |
| 312 | 3300048929 | Ga0496126_0035587 | Ga0496126_0035587_1653_2318 | 212 |
| 313 | 3300053085 | Ga0495619_0007832 | Ga0495619_0007832_1013_1660 | 212 |
| 314 | iso_pu_bacteria | 2791355197 | 2793070197 | 212 |
| 315 | iso_pu_bacteria | 2904699407 | 2904711305 | 212 |
| 316 | iso_pu_bacteria | 2908756301 | 2908757590 | 212 |
| 317 | iso_pu_bacteria | 2935630451 | 2935632986 | 212 |
| 318 | iso_pu_bacteria | 2941507105 | 2941509712 | 212 |
| 319 | iso_pu_bacteria | 2941515067 | 2941517541 | 212 |
| 320 | iso_pu_bacteria | 2941523033 | 2941526506 | 212 |
| 321 | iso_pu_bacteria | 8006933436 | 8006937312 | 212 |
| 322 | iso_pu_bacteria | 8006973647 | 8006977344 | 212 |
| 323 | 3300005617 | Ga0068859_100127861 | Ga0068859_1001278612 | 213 |
| 324 | 3300005844 | Ga0068862_100158116 | Ga0068862_1001581162 | 213 |
| 325 | 3300006844 | Ga0075428_100622896 | Ga0075428_1006228962 | 213 |
| 326 | 3300006871 | Ga0075434_100092226 | Ga0075434_1000922263 | 213 |
| 327 | 3300006914 | Ga0075436_100134933 | Ga0075436_1001349333 | 213 |
| 328 | 3300006931 | Ga0097620_100127864 | Ga0097620_1001278642 | 213 |
| 329 | 3300006944 | Ga0099823_1071205 | Ga0099823_10712051 | 213 |
| 330 | 3300013308 | Ga0157375_10541055 | Ga0157375_105410552 | 213 |
| 331 | 3300027296 | Ga0209389_1000494 | Ga0209389_100049410 | 213 |
| 332 | 3300027361 | Ga0209489_103769 | Ga0209489_10376917 | 213 |
| 333 | 3300027363 | Ga0209700_100420 | Ga0209700_10042064 | 213 |
| 334 | 3300028380 | Ga0268265_10396337 | Ga0268265_103963372 | 213 |
| 335 | 3300033180 | Ga0307510_10022034 | Ga0307510_100220344 | 213 |
| 336 | 3300037312 | Ga0395899_0443317 | Ga0395899_0443317_33_689 | 213 |
| 337 | 3300037418 | Ga0395900_0169700 | Ga0395900_0169700_183_839 | 213 |
| 338 | 3300037466 | Ga0395898_0532852 | Ga0395898_0532852_436_1092 | 213 |
| 339 | 3300037471 | Ga0395905_0064717 | Ga0395905_0064717_2045_2701 | 213 |
| 340 | 3300044658 | Ga0466972_0000124 | Ga0466972_0000124_37735_38391 | 213 |
| 341 | 3300044658 | Ga0466972_0002537 | Ga0466972_0002537_5334_5993 | 213 |
| 342 | 3300044735 | Ga0466968_0006334 | Ga0466968_0006334_2075_2734 | 213 |
| 343 | 3300044735 | Ga0466968_0215322 | Ga0466968_0215322_200_856 | 213 |
| 344 | 3300044765 | Ga0466970_0089040 | Ga0466970_0089040_385_1041 | 213 |
| 345 | 3300044901 | Ga0466960_0001481 | Ga0466960_0001481_2620_3279 | 213 |
| 346 | 3300046460 | Ga0495638_0085181 | Ga0495638_0085181_320_997 | 213 |
| 347 | 3300046543 | Ga0495645_0017494 | Ga0495645_0017494_3124_3798 | 213 |
| 348 | 3300046660 | Ga0495625_0225233 | Ga0495625_0225233_235_894 | 213 |
| 349 | 3300046678 | Ga0495599_0065022 | Ga0495599_0065022_889_1563 | 213 |
| 350 | 3300050489 | nmdc:mga03683_184261_c1 | nmdc:mga03683_184261_c1_92_766 | 213 |
| 351 | 3300050512 | nmdc:mga0n895_21774_c1 | nmdc:mga0n895_21774_c1_4205_4864 | 213 |
| 352 | 3300050514 | nmdc:mga08x19_97007_c1 | nmdc:mga08x19_97007_c1_414_1073 | 213 |
| 353 | 3300053078 | Ga0495612_0053958 | Ga0495612_0053958_845_1519 | 213 |
| 354 | 3300053098 | Ga0500650_0092938 | Ga0500650_0092938_499_1176 | 213 |
| 355 | 3300053142 | Ga0500577_0040536 | Ga0500577_0040536_71_748 | 213 |
| 356 | 3300003215 | JGI25153J46596_10002547 | JGI25153J46596_1000254711 | 214 |
| 357 | 3300003215 | JGI25153J46596_10003542 | JGI25153J46596_100035425 | 214 |
| 358 | 3300003354 | JGI25160J50197_1003442 | JGI25160J50197_10034423 | 214 |
| 359 | 3300003794 | Ga0055531_10007525 | Ga0055531_100075256 | 214 |
| 360 | 3300004625 | Ga0055543_1007516 | Ga0055543_10075163 | 214 |
| 361 | 3300005262 | Ga0065165_1000370 | Ga0065165_10003706 | 214 |
| 362 | 3300005262 | Ga0065165_1006098 | Ga0065165_10060985 | 214 |
| 363 | 3300005262 | Ga0065165_1008717 | Ga0065165_10087173 | 214 |
| 364 | 3300005327 | Ga0070658_10021405 | Ga0070658_100214059 | 214 |
| 365 | 3300005328 | Ga0070676_10394328 | Ga0070676_103943282 | 214 |
| 366 | 3300005329 | Ga0070683_100521941 | Ga0070683_1005219412 | 214 |
| 367 | 3300005331 | Ga0070670_100124537 | Ga0070670_1001245373 | 214 |
| 368 | 3300005334 | Ga0068869_100013181 | Ga0068869_1000131815 | 214 |
| 369 | 3300005337 | Ga0070682_100110140 | Ga0070682_1001101401 | 214 |
| 370 | 3300005338 | Ga0068868_100063339 | Ga0068868_1000633394 | 214 |
| 371 | 3300005347 | Ga0070668_100008756 | Ga0070668_1000087567 | 214 |
| 372 | 3300005347 | Ga0070668_100027658 | Ga0070668_1000276587 | 214 |
| 373 | 3300005355 | Ga0070671_100032245 | Ga0070671_1000322451 | 214 |
| 374 | 3300005364 | Ga0070673_100719100 | Ga0070673_1007191001 | 214 |
| 375 | 3300005367 | Ga0070667_100137265 | Ga0070667_1001372652 | 214 |
| 376 | 3300005434 | Ga0070709_10008369 | Ga0070709_100083695 | 214 |
| 377 | 3300005436 | Ga0070713_100008846 | Ga0070713_1000088465 | 214 |
| 378 | 3300005437 | Ga0070710_10172200 | Ga0070710_101722002 | 214 |
| 379 | 3300005439 | Ga0070711_100017038 | Ga0070711_1000170383 | 214 |
| 380 | 3300005455 | Ga0070663_100435647 | Ga0070663_1004356471 | 214 |
| 381 | 3300005456 | Ga0070678_100012735 | Ga0070678_1000127355 | 214 |
| 382 | 3300005539 | Ga0068853_100112148 | Ga0068853_1001121483 | 214 |
| 383 | 3300005546 | Ga0070696_100164886 | Ga0070696_1001648863 | 214 |
| 384 | 3300005548 | Ga0070665_100045145 | Ga0070665_1000451454 | 214 |
| 385 | 3300005563 | Ga0068855_100073742 | Ga0068855_1000737424 | 214 |
| 386 | 3300005564 | Ga0070664_100249863 | Ga0070664_1002498631 | 214 |
| 387 | 3300005614 | Ga0068856_100013570 | Ga0068856_1000135708 | 214 |
| 388 | 3300005614 | Ga0068856_100255228 | Ga0068856_1002552281 | 214 |
| 389 | 3300005616 | Ga0068852_100002075 | Ga0068852_10000207511 | 214 |
| 390 | 3300005616 | Ga0068852_100185761 | Ga0068852_1001857612 | 214 |
| 391 | 3300005617 | Ga0068859_100538127 | Ga0068859_1005381272 | 214 |
| 392 | 3300005618 | Ga0068864_100257270 | Ga0068864_1002572702 | 214 |
| 393 | 3300005842 | Ga0068858_100721009 | Ga0068858_1007210092 | 214 |
| 394 | 3300005843 | Ga0068860_100084953 | Ga0068860_1000849533 | 214 |
| 395 | 3300005843 | Ga0068860_100238488 | Ga0068860_1002384882 | 214 |
| 396 | 3300005985 | Ga0081539_10091157 | Ga0081539_100911571 | 214 |
| 397 | 3300006038 | Ga0075365_10033553 | Ga0075365_100335533 | 214 |
| 398 | 3300006038 | Ga0075365_10046161 | Ga0075365_100461614 | 214 |
| 399 | 3300006042 | Ga0075368_10127023 | Ga0075368_101270231 | 214 |
| 400 | 3300006175 | Ga0070712_100044616 | Ga0070712_1000446164 | 214 |
| 401 | 3300006178 | Ga0075367_10098911 | Ga0075367_100989113 | 214 |
| 402 | 3300006178 | Ga0075367_10110452 | Ga0075367_101104522 | 214 |
| 403 | 3300006195 | Ga0075366_10008044 | Ga0075366_100080449 | 214 |
| 404 | 3300006353 | Ga0075370_10028282 | Ga0075370_100282823 | 214 |
| 405 | 3300006353 | Ga0075370_10216835 | Ga0075370_102168352 | 214 |
| 406 | 3300006931 | Ga0097620_100538168 | Ga0097620_1005381682 | 214 |
| 407 | 3300006942 | Ga0099824_1002047 | Ga0099824_100204716 | 214 |
| 408 | 3300006942 | Ga0099824_1018951 | Ga0099824_10189517 | 214 |
| 409 | 3300006943 | Ga0099822_1004737 | Ga0099822_100473713 | 214 |
| 410 | 3300006943 | Ga0099822_1063565 | Ga0099822_10635652 | 214 |
| 411 | 3300009093 | Ga0105240_10002295 | Ga0105240_1000229527 | 214 |
| 412 | 3300009093 | Ga0105240_10251298 | Ga0105240_102512983 | 214 |
| 413 | 3300009093 | Ga0105240_10672889 | Ga0105240_106728891 | 214 |
| 414 | 3300009094 | Ga0111539_10395278 | Ga0111539_103952782 | 214 |
| 415 | 3300009098 | Ga0105245_10340923 | Ga0105245_103409232 | 214 |
| 416 | 3300009174 | Ga0105241_10012898 | Ga0105241_100128985 | 214 |
| 417 | 3300009174 | Ga0105241_10046174 | Ga0105241_100461743 | 214 |
| 418 | 3300009176 | Ga0105242_10234670 | Ga0105242_102346701 | 214 |
| 419 | 3300009176 | Ga0105242_10458835 | Ga0105242_104588351 | 214 |
| 420 | 3300009177 | Ga0105248_10144863 | Ga0105248_101448633 | 214 |
| 421 | 3300009545 | Ga0105237_10002301 | Ga0105237_1000230113 | 214 |
| 422 | 3300009545 | Ga0105237_10026831 | Ga0105237_100268315 | 214 |
| 423 | 3300009545 | Ga0105237_10430729 | Ga0105237_104307291 | 214 |
| 424 | 3300009553 | Ga0105249_10395205 | Ga0105249_103952053 | 214 |
| 425 | 3300010375 | Ga0105239_10025401 | Ga0105239_100254014 | 214 |
| 426 | 3300010375 | Ga0105239_10083534 | Ga0105239_100835343 | 214 |
| 427 | 3300013306 | Ga0163162_10155709 | Ga0163162_101557093 | 214 |
| 428 | 3300013308 | Ga0157375_10076159 | Ga0157375_100761594 | 214 |
| 429 | 3300014325 | Ga0163163_10043948 | Ga0163163_100439486 | 214 |
| 430 | 3300014325 | Ga0163163_10183688 | Ga0163163_101836882 | 214 |
| 431 | 3300014325 | Ga0163163_10203230 | Ga0163163_102032304 | 214 |
| 432 | 3300014968 | Ga0157379_10192263 | Ga0157379_101922633 | 214 |
| 433 | 3300014969 | Ga0157376_10179560 | Ga0157376_101795602 | 214 |
| 434 | 3300017792 | Ga0163161_10171094 | Ga0163161_101710943 | 214 |
| 435 | 3300021320 | Ga0214544_1000003 | Ga0214544_1000003349 | 214 |
| 436 | 3300021321 | Ga0214542_1000003 | Ga0214542_1000003339 | 214 |
| 437 | 3300021321 | Ga0214542_1021066 | Ga0214542_10210665 | 214 |
| 438 | 3300021324 | Ga0214545_1000004 | Ga0214545_1000004352 | 214 |
| 439 | 3300021324 | Ga0214545_1021274 | Ga0214545_10212745 | 214 |
| 440 | 3300021327 | Ga0214543_1000007 | Ga0214543_100000765 | 214 |
| 441 | 3300025230 | Ga0209563_100438 | Ga0209563_10043814 | 214 |
| 442 | 3300025273 | Ga0209673_1013733 | Ga0209673_10137334 | 214 |
| 443 | 3300025295 | Ga0209564_1010432 | Ga0209564_10104327 | 214 |
| 444 | 3300025297 | Ga0209758_1000030 | Ga0209758_1000030410 | 214 |
| 445 | 3300025297 | Ga0209758_1000893 | Ga0209758_100089329 | 214 |
| 446 | 3300025297 | Ga0209758_1001645 | Ga0209758_100164512 | 214 |
| 447 | 3300025297 | Ga0209758_1002462 | Ga0209758_10024628 | 214 |
| 448 | 3300025297 | Ga0209758_1050686 | Ga0209758_10506863 | 214 |
| 449 | 3300025302 | Ga0207426_1001517 | Ga0207426_100151722 | 214 |
| 450 | 3300025302 | Ga0207426_1008000 | Ga0207426_10080004 | 214 |
| 451 | 3300025304 | Ga0209257_1000662 | Ga0209257_10006628 | 214 |
| 452 | 3300025304 | Ga0209257_1015967 | Ga0209257_10159674 | 214 |
| 453 | 3300025898 | Ga0207692_10075621 | Ga0207692_100756212 | 214 |
| 454 | 3300025900 | Ga0207710_10028157 | Ga0207710_100281573 | 214 |
| 455 | 3300025904 | Ga0207647_10008109 | Ga0207647_100081095 | 214 |
| 456 | 3300025904 | Ga0207647_10211960 | Ga0207647_102119602 | 214 |
| 457 | 3300025907 | Ga0207645_10084865 | Ga0207645_100848652 | 214 |
| 458 | 3300025913 | Ga0207695_10000059 | Ga0207695_1000005946 | 214 |
| 459 | 3300025913 | Ga0207695_10218834 | Ga0207695_102188342 | 214 |
| 460 | 3300025914 | Ga0207671_10001109 | Ga0207671_1000110913 | 214 |
| 461 | 3300025914 | Ga0207671_10162971 | Ga0207671_101629713 | 214 |
| 462 | 3300025915 | Ga0207693_10104554 | Ga0207693_101045543 | 214 |
| 463 | 3300025915 | Ga0207693_10463230 | Ga0207693_104632302 | 214 |
| 464 | 3300025919 | Ga0207657_10275808 | Ga0207657_102758082 | 214 |
| 465 | 3300025925 | Ga0207650_10158200 | Ga0207650_101582002 | 214 |
| 466 | 3300025926 | Ga0207659_10263324 | Ga0207659_102633242 | 214 |
| 467 | 3300025928 | Ga0207700_10234026 | Ga0207700_102340261 | 214 |
| 468 | 3300025931 | Ga0207644_10018254 | Ga0207644_100182544 | 214 |
| 469 | 3300025933 | Ga0207706_10059147 | Ga0207706_100591472 | 214 |
| 470 | 3300025933 | Ga0207706_10134929 | Ga0207706_101349293 | 214 |
| 471 | 3300025933 | Ga0207706_10499489 | Ga0207706_104994891 | 214 |
| 472 | 3300025934 | Ga0207686_10225341 | Ga0207686_102253411 | 214 |
| 473 | 3300025937 | Ga0207669_10624750 | Ga0207669_106247502 | 214 |
| 474 | 3300025939 | Ga0207665_10380452 | Ga0207665_103804522 | 214 |
| 475 | 3300025941 | Ga0207711_10018230 | Ga0207711_100182302 | 214 |
| 476 | 3300025945 | Ga0207679_10401124 | Ga0207679_104011241 | 214 |
| 477 | 3300025949 | Ga0207667_10101512 | Ga0207667_101015122 | 214 |
| 478 | 3300025949 | Ga0207667_10406284 | Ga0207667_104062843 | 214 |
| 479 | 3300025972 | Ga0207668_10060395 | Ga0207668_100603951 | 214 |
| 480 | 3300025972 | Ga0207668_10069357 | Ga0207668_100693572 | 214 |
| 481 | 3300025972 | Ga0207668_10124091 | Ga0207668_101240913 | 214 |
| 482 | 3300026035 | Ga0207703_10050557 | Ga0207703_100505573 | 214 |
| 483 | 3300026035 | Ga0207703_10181953 | Ga0207703_101819531 | 214 |
| 484 | 3300026041 | Ga0207639_10160589 | Ga0207639_101605893 | 214 |
| 485 | 3300026041 | Ga0207639_10163367 | Ga0207639_101633673 | 214 |
| 486 | 3300026067 | Ga0207678_10021386 | Ga0207678_100213867 | 214 |
| 487 | 3300026067 | Ga0207678_10023768 | Ga0207678_100237685 | 214 |
| 488 | 3300026078 | Ga0207702_10106927 | Ga0207702_101069273 | 214 |
| 489 | 3300026089 | Ga0207648_10042881 | Ga0207648_100428814 | 214 |
| 490 | 3300026089 | Ga0207648_10704914 | Ga0207648_107049141 | 214 |
| 491 | 3300026095 | Ga0207676_10128955 | Ga0207676_101289553 | 214 |
| 492 | 3300026116 | Ga0207674_10057340 | Ga0207674_100573405 | 214 |
| 493 | 3300026118 | Ga0207675_100031542 | Ga0207675_1000315425 | 214 |
| 494 | 3300026118 | Ga0207675_100279247 | Ga0207675_1002792473 | 214 |
| 495 | 3300026121 | Ga0207683_10008695 | Ga0207683_100086956 | 214 |
| 496 | 3300026121 | Ga0207683_10470438 | Ga0207683_104704382 | 214 |
| 497 | 3300026142 | Ga0207698_10013446 | Ga0207698_100134463 | 214 |
| 498 | 3300026142 | Ga0207698_10371088 | Ga0207698_103710883 | 214 |
| 499 | 3300027296 | Ga0209389_1000055 | Ga0209389_100005516 | 214 |
| 500 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005245 | 214 |
| 501 | 3300027357 | Ga0209589_1000024 | Ga0209589_1000024112 | 214 |
| 502 | 3300027361 | Ga0209489_100005 | Ga0209489_100005245 | 214 |
| 503 | 3300027361 | Ga0209489_100123 | Ga0209489_100123109 | 214 |
| 504 | 3300027363 | Ga0209700_100006 | Ga0209700_100006245 | 214 |
| 505 | 3300027866 | Ga0209813_10024296 | Ga0209813_100242961 | 214 |
| 506 | 3300028379 | Ga0268266_10030958 | Ga0268266_100309582 | 214 |
| 507 | 3300028379 | Ga0268266_10712521 | Ga0268266_107125211 | 214 |
| 508 | 3300028379 | Ga0268266_10774729 | Ga0268266_107747291 | 214 |
| 509 | 3300028380 | Ga0268265_10178216 | Ga0268265_101782163 | 214 |
| 510 | 3300031731 | Ga0307405_10374919 | Ga0307405_103749191 | 214 |
| 511 | 3300041491 | Ga0451833_0031051 | Ga0451833_0031051_400_1059 | 214 |
| 512 | 3300044683 | Ga0466965_0026765 | Ga0466965_0026765_665_1324 | 214 |
| 513 | 3300044901 | Ga0466960_0139165 | Ga0466960_0139165_43_702 | 214 |
| 514 | 3300046455 | Ga0495603_0082839 | Ga0495603_0082839_174_833 | 214 |
| 515 | 3300046460 | Ga0495638_0011267 | Ga0495638_0011267_1234_1893 | 214 |
| 516 | 3300046507 | Ga0495606_0065243 | Ga0495606_0065243_1419_2090 | 214 |
| 517 | 3300046522 | Ga0495643_0045119 | Ga0495643_0045119_847_1509 | 214 |
| 518 | 3300046524 | Ga0495648_0218345 | Ga0495648_0218345_191_850 | 214 |
| 519 | 3300046616 | Ga0495668_0084179 | Ga0495668_0084179_201_863 | 214 |
| 520 | 3300046674 | Ga0495588_0001353 | Ga0495588_0001353_9306_9965 | 214 |
| 521 | 3300046690 | Ga0495624_0110799 | Ga0495624_0110799_951_1610 | 214 |
| 522 | 3300046692 | Ga0495671_0072278 | Ga0495671_0072278_234_893 | 214 |
| 523 | 3300046692 | Ga0495671_0286670 | Ga0495671_0286670_55_711 | 214 |
| 524 | 3300047469 | Ga0495673_0060041 | Ga0495673_0060041_854_1516 | 214 |
| 525 | 3300047472 | Ga0495686_0147890 | Ga0495686_0147890_358_1017 | 214 |
| 526 | 3300047472 | Ga0495686_0179200 | Ga0495686_0179200_28_687 | 214 |
| 527 | 3300048905 | Ga0496102_0134420 | Ga0496102_0134420_972_1631 | 214 |
| 528 | 3300048906 | Ga0496103_0080553 | Ga0496103_0080553_997_1659 | 214 |
| 529 | 3300048907 | Ga0496104_0024225 | Ga0496104_0024225_1336_1995 | 214 |
| 530 | 3300048907 | Ga0496104_0103508 | Ga0496104_0103508_1024_1686 | 214 |
| 531 | 3300048908 | Ga0496105_0039456 | Ga0496105_0039456_904_1566 | 214 |
| 532 | 3300048909 | Ga0496106_0271437 | Ga0496106_0271437_90_749 | 214 |
| 533 | 3300048910 | Ga0496107_0011974 | Ga0496107_0011974_2667_3326 | 214 |
| 534 | 3300048911 | Ga0496108_0013488 | Ga0496108_0013488_2213_2875 | 214 |
| 535 | 3300048911 | Ga0496108_0080117 | Ga0496108_0080117_1790_2449 | 214 |
| 536 | 3300048912 | Ga0496109_0222517 | Ga0496109_0222517_192_851 | 214 |
| 537 | 3300048912 | Ga0496109_0296979 | Ga0496109_0296979_37_714 | 214 |
| 538 | 3300048913 | Ga0496110_0015752 | Ga0496110_0015752_1620_2282 | 214 |
| 539 | 3300048913 | Ga0496110_0980438 | Ga0496110_0980438_52_711 | 214 |
| 540 | 3300048914 | Ga0496111_0056301 | Ga0496111_0056301_723_1382 | 214 |
| 541 | 3300048915 | Ga0496112_0704478 | Ga0496112_0704478_74_733 | 214 |
| 542 | 3300048916 | Ga0496113_0297442 | Ga0496113_0297442_579_1238 | 214 |
| 543 | 3300048916 | Ga0496113_0534347 | Ga0496113_0534347_189_851 | 214 |
| 544 | 3300048917 | Ga0496114_0014145 | Ga0496114_0014145_861_1520 | 214 |
| 545 | 3300048919 | Ga0496116_0028887 | Ga0496116_0028887_1840_2499 | 214 |
| 546 | 3300048919 | Ga0496116_0032538 | Ga0496116_0032538_137_799 | 214 |
| 547 | 3300048920 | Ga0496117_0061833 | Ga0496117_0061833_976_1638 | 214 |
| 548 | 3300048922 | Ga0496119_0215489 | Ga0496119_0215489_88_747 | 214 |
| 549 | 3300048924 | Ga0496121_0051348 | Ga0496121_0051348_475_1134 | 214 |
| 550 | 3300048924 | Ga0496121_0071559 | Ga0496121_0071559_755_1414 | 214 |
| 551 | 3300048925 | Ga0496122_0205725 | Ga0496122_0205725_407_1066 | 214 |
| 552 | 3300048929 | Ga0496126_0580061 | Ga0496126_0580061_62_721 | 214 |
| 553 | 3300048929 | Ga0496126_0676636 | Ga0496126_0676636_17_694 | 214 |
| 554 | 3300050491 | nmdc:mga00v17_439992_c1 | nmdc:mga00v17_439992_c1_146_823 | 214 |
| 555 | 3300050492 | nmdc:mga0yw44_14616_c1 | nmdc:mga0yw44_14616_c1_2312_2971 | 214 |
| 556 | 3300050492 | nmdc:mga0yw44_557513_c1 | nmdc:mga0yw44_557513_c1_57_716 | 214 |
| 557 | 3300050493 | nmdc:mga0k408_4612_c1 | nmdc:mga0k408_4612_c1_1007_1669 | 214 |
| 558 | 3300050496 | nmdc:mga07m45_14648_c1 | nmdc:mga07m45_14648_c1_2359_3021 | 214 |
| 559 | 3300050511 | nmdc:mga08y16_527905_c1 | nmdc:mga08y16_527905_c1_95_772 | 214 |
| 560 | 3300050515 | nmdc:mga0a205_133434_c1 | nmdc:mga0a205_133434_c1_344_1021 | 214 |
| 561 | 3300053079 | Ga0500610_0158106 | Ga0500610_0158106_342_1001 | 214 |
| 562 | 3300053080 | Ga0500635_0006464 | Ga0500635_0006464_1151_1804 | 214 |
| 563 | 3300053086 | Ga0500578_0120031 | Ga0500578_0120031_701_1360 | 214 |
| 564 | 3300053086 | Ga0500578_0297900 | Ga0500578_0297900_242_901 | 214 |
| 565 | 3300053087 | Ga0500643_000028 | Ga0500643_000028_165469_166128 | 214 |
| 566 | 3300053091 | Ga0500647_0018007 | Ga0500647_0018007_1196_1855 | 214 |
| 567 | 3300053092 | Ga0500583_0022614 | Ga0500583_0022614_117_776 | 214 |
| 568 | 3300053094 | Ga0500566_0000245 | Ga0500566_0000245_5687_6346 | 214 |
| 569 | 3300053103 | Ga0500555_002075 | Ga0500555_002075_1855_2514 | 214 |
| 570 | 3300053104 | Ga0500556_0017153 | Ga0500556_0017153_1169_1828 | 214 |
| 571 | 3300053105 | Ga0500557_000116 | Ga0500557_000116_3660_4319 | 214 |
| 572 | 3300053108 | Ga0500562_044412 | Ga0500562_044412_62_721 | 214 |
| 573 | 3300053121 | Ga0500607_228960 | Ga0500607_228960_72_731 | 214 |
| 574 | 3300053130 | Ga0500642_0000113 | Ga0500642_0000113_6143_6802 | 214 |
| 575 | 3300053130 | Ga0500642_0001807 | Ga0500642_0001807_2237_2896 | 214 |
| 576 | 3300053138 | Ga0500564_180237 | Ga0500564_180237_34_693 | 214 |
| 577 | 3300053151 | Ga0500604_0006950 | Ga0500604_0006950_1325_1984 | 214 |
| 578 | 3300053155 | Ga0500620_026632 | Ga0500620_026632_43_702 | 214 |
| 579 | 3300053156 | Ga0500622_0188348 | Ga0500622_0188348_46_705 | 214 |
| 580 | 3300053177 | Ga0500636_0000054 | Ga0500636_0000054_45164_45823 | 214 |
| 581 | 3300053178 | Ga0500637_0027373 | Ga0500637_0027373_76_729 | 214 |
| 582 | 3300053729 | Ga0500625_017426 | Ga0500625_017426_625_1284 | 214 |
| 583 | 3300053730 | Ga0500645_048584 | Ga0500645_048584_71_730 | 214 |
| 584 | 3300053736 | Ga0500599_002194 | Ga0500599_002194_341_1000 | 214 |
| 585 | 3300053737 | Ga0500601_000834 | Ga0500601_000834_53_712 | 214 |
| 586 | iso_pu_bacteria | 2507262055 | 2507504485 | 214 |
| 587 | iso_pu_bacteria | 2508501042 | 2508694741 | 214 |
| 588 | iso_pu_bacteria | 2513237095 | 2513649243 | 214 |
| 589 | iso_pu_bacteria | 2515154112 | 2515624338 | 214 |
| 590 | iso_pu_bacteria | 2617270741 | 2617374346 | 214 |
| 591 | iso_pu_bacteria | 2935608549 | 2935613111 | 214 |
| 592 | iso_pu_bacteria | 2935648319 | 2935654067 | 214 |
| 593 | iso_pu_bacteria | 2935656913 | 2935662831 | 214 |
| 594 | iso_pu_bacteria | 2935819856 | 2935825037 | 214 |
| 595 | iso_pu_bacteria | 2935847175 | 2935852256 | 214 |
| 596 | iso_pu_bacteria | 2935908558 | 2935910689 | 214 |
| 597 | iso_pu_bacteria | 2935916978 | 2935921869 | 214 |
| 598 | iso_pu_bacteria | 2935926038 | 2935929992 | 214 |
| 599 | iso_pu_bacteria | 2935934488 | 2935937660 | 214 |
| 600 | iso_pu_bacteria | 2935942939 | 2935949764 | 214 |
| 601 | iso_pu_bacteria | 2935951376 | 2935956860 | 214 |
| 602 | iso_pu_bacteria | 2935967501 | 2935970883 | 214 |
| 603 | iso_pu_bacteria | 2935975950 | 2935982983 | 214 |
| 604 | iso_pu_bacteria | 2935984226 | 2935984370 | 214 |
| 605 | iso_pu_bacteria | 2936011229 | 2936016972 | 214 |
| 606 | iso_pu_bacteria | 2936019824 | 2936025620 | 214 |
| 607 | iso_pu_bacteria | 2936028420 | 2936034462 | 214 |
| 608 | iso_pu_bacteria | 2936046547 | 2936052504 | 214 |
| 609 | iso_pu_bacteria | 2936055302 | 2936055450 | 214 |
| 610 | iso_pu_bacteria | 8006994254 | 8006995426 | 214 |
| 611 | iso_pu_bacteria | 8016630954 | 8016636758 | 214 |
| 612 | iso_pu_bacteria | 8019619141 | 8019623726 | 214 |
| 613 | iso_pu_bacteria | 8019629233 | 8019638308 | 214 |
| 614 | iso_pu_bacteria | 8019638758 | 8019641328 | 214 |
| 615 | iso_pu_bacteria | 8019659431 | 8019666232 | 214 |
| 616 | iso_pu_bacteria | 8019668869 | 8019675734 | 214 |
| 617 | iso_pu_bacteria | 8019678201 | 8019680365 | 214 |
| 618 | iso_pu_bacteria | 8019687851 | 8019695453 | 214 |
| 619 | 3300003323 | rootH1_10016026 | rootH1_100160262 | 215 |
| 620 | 3300005329 | Ga0070683_100042686 | Ga0070683_1000426865 | 215 |
| 621 | 3300005329 | Ga0070683_100139749 | Ga0070683_1001397492 | 215 |
| 622 | 3300005336 | Ga0070680_100019553 | Ga0070680_1000195535 | 215 |
| 623 | 3300005336 | Ga0070680_100079829 | Ga0070680_1000798293 | 215 |
| 624 | 3300005336 | Ga0070680_100104138 | Ga0070680_1001041383 | 215 |
| 625 | 3300005341 | Ga0070691_10090375 | Ga0070691_100903752 | 215 |
| 626 | 3300005458 | Ga0070681_10012819 | Ga0070681_100128196 | 215 |
| 627 | 3300005458 | Ga0070681_10125936 | Ga0070681_101259362 | 215 |
| 628 | 3300005530 | Ga0070679_100031919 | Ga0070679_1000319191 | 215 |
| 629 | 3300005530 | Ga0070679_100109277 | Ga0070679_1001092772 | 215 |
| 630 | 3300005530 | Ga0070679_100138618 | Ga0070679_1001386181 | 215 |
| 631 | 3300005530 | Ga0070679_100600551 | Ga0070679_1006005511 | 215 |
| 632 | 3300005535 | Ga0070684_100003258 | Ga0070684_10000325811 | 215 |
| 633 | 3300005563 | Ga0068855_100188786 | Ga0068855_1001887861 | 215 |
| 634 | 3300005577 | Ga0068857_100264142 | Ga0068857_1002641423 | 215 |
| 635 | 3300005614 | Ga0068856_100152081 | Ga0068856_1001520811 | 215 |
| 636 | 3300005614 | Ga0068856_100253525 | Ga0068856_1002535252 | 215 |
| 637 | 3300006173 | Ga0070716_100073994 | Ga0070716_1000739943 | 215 |
| 638 | 3300006237 | Ga0097621_100239636 | Ga0097621_1002396362 | 215 |
| 639 | 3300009093 | Ga0105240_10218361 | Ga0105240_102183613 | 215 |
| 640 | 3300009093 | Ga0105240_10266078 | Ga0105240_102660782 | 215 |
| 641 | 3300009545 | Ga0105237_10259204 | Ga0105237_102592042 | 215 |
| 642 | 3300009545 | Ga0105237_10346620 | Ga0105237_103466202 | 215 |
| 643 | 3300009545 | Ga0105237_10807367 | Ga0105237_108073671 | 215 |
| 644 | 3300009551 | Ga0105238_10063133 | Ga0105238_100631332 | 215 |
| 645 | 3300009551 | Ga0105238_10112590 | Ga0105238_101125902 | 215 |
| 646 | 3300009551 | Ga0105238_10345957 | Ga0105238_103459571 | 215 |
| 647 | 3300010375 | Ga0105239_11309354 | Ga0105239_113093542 | 215 |
| 648 | 3300013105 | Ga0157369_10570470 | Ga0157369_105704703 | 215 |
| 649 | 3300020069 | Ga0197907_11157109 | Ga0197907_111571092 | 215 |
| 650 | 3300020076 | Ga0206355_1507511 | Ga0206355_15075112 | 215 |
| 651 | 3300020080 | Ga0206350_10389318 | Ga0206350_103893182 | 215 |
| 652 | 3300020082 | Ga0206353_10556866 | Ga0206353_105568661 | 215 |
| 653 | 3300022467 | Ga0224712_10107802 | Ga0224712_101078022 | 215 |
| 654 | 3300025297 | Ga0209758_1000711 | Ga0209758_100071117 | 215 |
| 655 | 3300025906 | Ga0207699_10023510 | Ga0207699_100235102 | 215 |
| 656 | 3300025912 | Ga0207707_10000438 | Ga0207707_100004389 | 215 |
| 657 | 3300025912 | Ga0207707_10136890 | Ga0207707_101368902 | 215 |
| 658 | 3300025913 | Ga0207695_10027002 | Ga0207695_100270025 | 215 |
| 659 | 3300025914 | Ga0207671_10069327 | Ga0207671_100693273 | 215 |
| 660 | 3300025916 | Ga0207663_10095514 | Ga0207663_100955142 | 215 |
| 661 | 3300025917 | Ga0207660_10017792 | Ga0207660_100177922 | 215 |
| 662 | 3300025917 | Ga0207660_10183018 | Ga0207660_101830181 | 215 |
| 663 | 3300025917 | Ga0207660_10219447 | Ga0207660_102194472 | 215 |
| 664 | 3300025917 | Ga0207660_10619273 | Ga0207660_106192732 | 215 |
| 665 | 3300025921 | Ga0207652_10518673 | Ga0207652_105186732 | 215 |
| 666 | 3300025939 | Ga0207665_10061914 | Ga0207665_100619143 | 215 |
| 667 | 3300025944 | Ga0207661_10000959 | Ga0207661_1000095915 | 215 |
| 668 | 3300025944 | Ga0207661_10412760 | Ga0207661_104127602 | 215 |
| 669 | 3300026078 | Ga0207702_10186192 | Ga0207702_101861922 | 215 |
| 670 | 3300026116 | Ga0207674_10084699 | Ga0207674_100846993 | 215 |
| 671 | 3300026142 | Ga0207698_10166178 | Ga0207698_101661782 | 215 |
| 672 | 3300031824 | Ga0307413_10103325 | Ga0307413_101033253 | 215 |
| 673 | 3300033180 | Ga0307510_10121417 | Ga0307510_101214174 | 215 |
| 674 | 3300035086 | Ga0373934_0076806 | Ga0373934_0076806_572_1228 | 215 |
| 675 | 3300035116 | Ga0373945_0209184 | Ga0373945_0209184_72_728 | 215 |
| 676 | 3300035118 | Ga0373954_0052727 | Ga0373954_0052727_1158_1814 | 215 |
| 677 | 3300035119 | Ga0373956_0087974 | Ga0373956_0087974_137_793 | 215 |
| 678 | 3300035170 | Ga0373943_0234201 | Ga0373943_0234201_148_804 | 215 |
| 679 | 3300035172 | Ga0373955_0122209 | Ga0373955_0122209_457_1113 | 215 |
| 680 | 3300035410 | Ga0373924_0027656 | Ga0373924_0027656_544_1200 | 215 |
| 681 | 3300036401 | Ga0373937_0227646 | Ga0373937_0227646_720_1376 | 215 |
| 682 | 3300044656 | Ga0466969_0026762 | Ga0466969_0026762_216_878 | 215 |
| 683 | 3300044684 | Ga0466966_0000411 | Ga0466966_0000411_16089_16751 | 215 |
| 684 | 3300044693 | Ga0466961_0000065 | Ga0466961_0000065_49566_50228 | 215 |
| 685 | 3300044765 | Ga0466970_0143814 | Ga0466970_0143814_169_840 | 215 |
| 686 | 3300045049 | Ga0466959_0000634 | Ga0466959_0000634_18201_18863 | 215 |
| 687 | 3300045049 | Ga0466959_0275904 | Ga0466959_0275904_273_944 | 215 |
| 688 | 3300046459 | Ga0495629_0003519 | Ga0495629_0003519_2984_3655 | 215 |
| 689 | 3300046459 | Ga0495629_0206705 | Ga0495629_0206705_88_744 | 215 |
| 690 | 3300046462 | Ga0495651_0017692 | Ga0495651_0017692_3859_4530 | 215 |
| 691 | 3300046475 | Ga0495639_0056409 | Ga0495639_0056409_189_845 | 215 |
| 692 | 3300046500 | Ga0495596_0092262 | Ga0495596_0092262_316_975 | 215 |
| 693 | 3300046506 | Ga0495583_0044422 | Ga0495583_0044422_1334_2005 | 215 |
| 694 | 3300046507 | Ga0495606_0160809 | Ga0495606_0160809_83_754 | 215 |
| 695 | 3300046513 | Ga0495616_0253094 | Ga0495616_0253094_58_729 | 215 |
| 696 | 3300046514 | Ga0495618_0141248 | Ga0495618_0141248_827_1483 | 215 |
| 697 | 3300046524 | Ga0495648_0008955 | Ga0495648_0008955_4875_5546 | 215 |
| 698 | 3300046526 | Ga0495666_0133388 | Ga0495666_0133388_363_1019 | 215 |
| 699 | 3300046529 | Ga0495652_0089784 | Ga0495652_0089784_1811_2482 | 215 |
| 700 | 3300046529 | Ga0495652_0122342 | Ga0495652_0122342_1292_1948 | 215 |
| 701 | 3300046533 | Ga0495640_0027614 | Ga0495640_0027614_119_775 | 215 |
| 702 | 3300046535 | Ga0495586_0158427 | Ga0495586_0158427_593_1249 | 215 |
| 703 | 3300046536 | Ga0495587_0269474 | Ga0495587_0269474_56_712 | 215 |
| 704 | 3300046642 | Ga0495634_0056964 | Ga0495634_0056964_956_1627 | 215 |
| 705 | 3300046663 | Ga0495635_0366258 | Ga0495635_0366258_103_759 | 215 |
| 706 | 3300046675 | Ga0495657_0014532 | Ga0495657_0014532_2907_3578 | 215 |
| 707 | 3300046689 | Ga0495613_0274008 | Ga0495613_0274008_25_696 | 215 |
| 708 | 3300046690 | Ga0495624_0067145 | Ga0495624_0067145_83_739 | 215 |
| 709 | 3300046694 | Ga0495649_0024307 | Ga0495649_0024307_210_881 | 215 |
| 710 | 3300047315 | Ga0495581_0014180 | Ga0495581_0014180_2344_3000 | 215 |
| 711 | 3300047317 | Ga0495604_0006835 | Ga0495604_0006835_8190_8861 | 215 |
| 712 | 3300047319 | Ga0495674_0018428 | Ga0495674_0018428_4691_5347 | 215 |
| 713 | 3300047321 | Ga0495676_0055266 | Ga0495676_0055266_95_766 | 215 |
| 714 | 3300047471 | Ga0495684_0012933 | Ga0495684_0012933_4638_5294 | 215 |
| 715 | 3300047673 | Ga0495593_0079436 | Ga0495593_0079436_58_714 | 215 |
| 716 | 3300048905 | Ga0496102_0252451 | Ga0496102_0252451_312_983 | 215 |
| 717 | 3300048907 | Ga0496104_0009070 | Ga0496104_0009070_7078_7749 | 215 |
| 718 | 3300048908 | Ga0496105_0022832 | Ga0496105_0022832_4097_4768 | 215 |
| 719 | 3300048918 | Ga0496115_0069485 | Ga0496115_0069485_2160_2831 | 215 |
| 720 | 3300048922 | Ga0496119_0015983 | Ga0496119_0015983_4132_4803 | 215 |
| 721 | 3300048923 | Ga0496120_0035858 | Ga0496120_0035858_310_981 | 215 |
| 722 | 3300048924 | Ga0496121_0024152 | Ga0496121_0024152_645_1301 | 215 |
| 723 | 3300048927 | Ga0496124_0053485 | Ga0496124_0053485_2539_3210 | 215 |
| 724 | 3300048928 | Ga0496125_0069134 | Ga0496125_0069134_1522_2193 | 215 |
| 725 | 3300048929 | Ga0496126_0015704 | Ga0496126_0015704_4901_5557 | 215 |
| 726 | 3300049460 | Ga0495682_0014877 | Ga0495682_0014877_1399_2070 | 215 |
| 727 | 3300053119 | Ga0500595_058462 | Ga0500595_058462_388_1059 | 215 |
| 728 | 3300053136 | Ga0500559_0016441 | Ga0500559_0016441_1835_2506 | 215 |
| 729 | 3300053178 | Ga0500637_0273034 | Ga0500637_0273034_169_840 | 215 |
| 730 | 3300053733 | Ga0500552_020370 | Ga0500552_020370_244_915 | 215 |
| 731 | 3300005434 | Ga0070709_10003090 | Ga0070709_100030903 | 216 |
| 732 | 3300005435 | Ga0070714_100162069 | Ga0070714_1001620692 | 216 |
| 733 | 3300005436 | Ga0070713_100002234 | Ga0070713_10000223413 | 216 |
| 734 | 3300005436 | Ga0070713_101072866 | Ga0070713_1010728661 | 216 |
| 735 | 3300005437 | Ga0070710_10000552 | Ga0070710_100005525 | 216 |
| 736 | 3300005439 | Ga0070711_100011221 | Ga0070711_1000112214 | 216 |
| 737 | 3300005439 | Ga0070711_100062871 | Ga0070711_1000628712 | 216 |
| 738 | 3300005841 | Ga0068863_100776274 | Ga0068863_1007762742 | 216 |
| 739 | 3300006028 | Ga0070717_10001026 | Ga0070717_1000102610 | 216 |
| 740 | 3300006028 | Ga0070717_10237647 | Ga0070717_102376472 | 216 |
| 741 | 3300006048 | Ga0075363_100163594 | Ga0075363_1001635942 | 216 |
| 742 | 3300006173 | Ga0070716_100069962 | Ga0070716_1000699622 | 216 |
| 743 | 3300006175 | Ga0070712_100502818 | Ga0070712_1005028181 | 216 |
| 744 | 3300006353 | Ga0075370_10132901 | Ga0075370_101329012 | 216 |
| 745 | 3300025898 | Ga0207692_10001302 | Ga0207692_100013023 | 216 |
| 746 | 3300025898 | Ga0207692_10250024 | Ga0207692_102500241 | 216 |
| 747 | 3300025906 | Ga0207699_10045183 | Ga0207699_100451834 | 216 |
| 748 | 3300025915 | Ga0207693_10027888 | Ga0207693_100278881 | 216 |
| 749 | 3300025915 | Ga0207693_10114267 | Ga0207693_101142673 | 216 |
| 750 | 3300025915 | Ga0207693_10235143 | Ga0207693_102351433 | 216 |
| 751 | 3300025916 | Ga0207663_10017392 | Ga0207663_100173924 | 216 |
| 752 | 3300025916 | Ga0207663_10030104 | Ga0207663_100301044 | 216 |
| 753 | 3300025928 | Ga0207700_10067007 | Ga0207700_100670071 | 216 |
| 754 | 3300025929 | Ga0207664_10021535 | Ga0207664_100215352 | 216 |
| 755 | 3300025939 | Ga0207665_10014858 | Ga0207665_100148584 | 216 |
| 756 | 3300026075 | Ga0207708_10513717 | Ga0207708_105137172 | 216 |
| 757 | 3300031249 | Ga0265339_10034239 | Ga0265339_100342393 | 216 |
| 758 | 3300037471 | Ga0395905_0109320 | Ga0395905_0109320_626_1285 | 216 |
| 759 | 3300048910 | Ga0496107_0164616 | Ga0496107_0164616_805_1485 | 216 |
| 760 | 3300048929 | Ga0496126_0366683 | Ga0496126_0366683_22_690 | 216 |
| 761 | iso_pu_bacteria | 2513237101 | 2513694581 | 216 |
| 762 | iso_pu_bacteria | 2874604998 | 2874608911 | 216 |
| 763 | 3300009098 | Ga0105245_10904070 | Ga0105245_109040702 | 217 |
| 764 | 3300009545 | Ga0105237_10006999 | Ga0105237_100069996 | 217 |
| 765 | 3300009545 | Ga0105237_10358448 | Ga0105237_103584483 | 217 |
| 766 | 3300013297 | Ga0157378_10146176 | Ga0157378_101461762 | 217 |
| 767 | 3300021384 | Ga0213876_10002755 | Ga0213876_100027559 | 217 |
| 768 | 3300025885 | Ga0207653_10004044 | Ga0207653_100040445 | 217 |
| 769 | 3300031616 | Ga0307508_10014562 | Ga0307508_100145628 | 217 |
| 770 | 3300035695 | Ga0373927_0363133 | Ga0373927_0363133_254_919 | 217 |
| 771 | 3300035724 | Ga0373933_0000018 | Ga0373933_0000018_26633_27295 | 217 |
| 772 | 3300037068 | Ga0373925_0401179 | Ga0373925_0401179_235_900 | 217 |
| 773 | 3300039437 | Ga0436365_0093274 | Ga0436365_0093274_51384_52049 | 217 |
| 774 | 3300039450 | Ga0436363_0554977 | Ga0436363_0554977_596_1258 | 217 |
| 775 | 3300039453 | Ga0436362_0626323 | Ga0436362_0626323_2713_3378 | 217 |
| 776 | 3300046557 | Ga0495622_0265165 | Ga0495622_0265165_57_722 | 217 |
| 777 | 3300046678 | Ga0495599_0067383 | Ga0495599_0067383_799_1464 | 217 |
| 778 | 3300046689 | Ga0495613_0062464 | Ga0495613_0062464_108_773 | 217 |
| 779 | 3300048909 | Ga0496106_0026873 | Ga0496106_0026873_953_1618 | 217 |
| 780 | 3300048921 | Ga0496118_0002445 | Ga0496118_0002445_21657_22322 | 217 |
| 781 | 3300048924 | Ga0496121_0000452 | Ga0496121_0000452_32800_33465 | 217 |
| 782 | 3300048927 | Ga0496124_0000267 | Ga0496124_0000267_59010_59675 | 217 |
| 783 | 3300048929 | Ga0496126_0059836 | Ga0496126_0059836_829_1494 | 217 |
| 784 | 3300053080 | Ga0500635_0062937 | Ga0500635_0062937_124_789 | 217 |
| 785 | 3300053094 | Ga0500566_0069046 | Ga0500566_0069046_1185_1850 | 217 |
| 786 | 3300053136 | Ga0500559_0115729 | Ga0500559_0115729_400_1065 | 217 |
| 787 | 3300053148 | Ga0500590_080114 | Ga0500590_080114_258_923 | 217 |
| 788 | 3300053162 | Ga0500638_042327 | Ga0500638_042327_1290_1955 | 217 |
| 789 | 3300053727 | Ga0500611_005942 | Ga0500611_005942_448_1125 | 217 |
| 790 | 3300053735 | Ga0500596_006582 | Ga0500596_006582_1142_1807 | 217 |
| 791 | iso_pu_bacteria | 2721755755 | 2723842398 | 217 |
| 792 | iso_pu_bacteria | 2791355199 | 2793078764 | 217 |
| 793 | iso_pu_bacteria | 2889033259 | 2889034384 | 217 |
| 794 | iso_pu_bacteria | 2922361189 | 2922364836 | 217 |
| 795 | iso_pu_bacteria | 8006964411 | 8006965273 | 217 |
| 796 | iso_pu_bacteria | 8056673599 | 8056679066 | 217 |
| 797 | 3300006175 | Ga0070712_100840602 | Ga0070712_1008406021 | 218 |
| 798 | 3300046691 | Ga0495670_0115431 | Ga0495670_0115431_619_1296 | 218 |
| 799 | 3300053111 | Ga0500572_004309 | Ga0500572_004309_1787_2452 | 218 |
| 800 | 3300053136 | Ga0500559_0000103 | Ga0500559_0000103_17686_18351 | 218 |
| 801 | 3300053735 | Ga0500596_005620 | Ga0500596_005620_1037_1702 | 218 |
| 802 | iso_pu_bacteria | 2876808645 | 2876812910 | 218 |
| 803 | iso_pu_bacteria | 2879110137 | 2879112371 | 218 |
| 804 | iso_pu_bacteria | 8006984368 | 8006991605 | 218 |
| 805 | 3300005548 | Ga0070665_100136213 | Ga0070665_1001362132 | 219 |
| 806 | 3300005548 | Ga0070665_100472269 | Ga0070665_1004722692 | 219 |
| 807 | 3300005548 | Ga0070665_100554908 | Ga0070665_1005549081 | 219 |
| 808 | 3300025253 | Ga0209677_103197 | Ga0209677_1031974 | 219 |
| 809 | 3300025928 | Ga0207700_10634800 | Ga0207700_106348002 | 219 |
| 810 | 3300028379 | Ga0268266_10085353 | Ga0268266_100853532 | 219 |
| 811 | 3300028379 | Ga0268266_10366104 | Ga0268266_103661042 | 219 |
| 812 | 3300028379 | Ga0268266_10848742 | Ga0268266_108487421 | 219 |
| 813 | 3300031616 | Ga0307508_10567299 | Ga0307508_105672991 | 219 |
| 814 | 3300048910 | Ga0496107_0237925 | Ga0496107_0237925_413_1084 | 219 |
| 815 | 3300048920 | Ga0496117_0071741 | Ga0496117_0071741_53_724 | 219 |
| 816 | 3300048924 | Ga0496121_0050510 | Ga0496121_0050510_1305_1976 | 219 |
| 817 | 3300048928 | Ga0496125_0043745 | Ga0496125_0043745_2342_3013 | 219 |
| 818 | 3300053096 | Ga0500641_0027837 | Ga0500641_0027837_422_1102 | 219 |
| 819 | 3300053139 | Ga0500568_0043749 | Ga0500568_0043749_1008_1688 | 219 |
| 820 | 3300003215 | JGI25153J46596_10014855 | JGI25153J46596_100148552 | 220 |
| 821 | 3300005539 | Ga0068853_100026606 | Ga0068853_1000266065 | 220 |
| 822 | 3300005937 | Ga0081455_10073137 | Ga0081455_100731374 | 220 |
| 823 | 3300005983 | Ga0081540_1100945 | Ga0081540_11009452 | 220 |
| 824 | 3300006042 | Ga0075368_10102393 | Ga0075368_101023932 | 220 |
| 825 | 3300025297 | Ga0209758_1005049 | Ga0209758_10050499 | 220 |
| 826 | 3300025901 | Ga0207688_10069981 | Ga0207688_100699813 | 220 |
| 827 | 3300025972 | Ga0207668_10425960 | Ga0207668_104259601 | 220 |
| 828 | 3300026041 | Ga0207639_10023427 | Ga0207639_100234275 | 220 |
| 829 | 3300026067 | Ga0207678_10052328 | Ga0207678_100523284 | 220 |
| 830 | 3300031456 | Ga0307513_10125136 | Ga0307513_101251361 | 220 |
| 831 | 3300035172 | Ga0373955_0108257 | Ga0373955_0108257_795_1466 | 220 |
| 832 | 3300046529 | Ga0495652_0391588 | Ga0495652_0391588_177_851 | 220 |
| 833 | 3300046533 | Ga0495640_0087035 | Ga0495640_0087035_67_738 | 220 |
| 834 | 3300046559 | Ga0495667_0044811 | Ga0495667_0044811_904_1587 | 220 |
| 835 | 3300046679 | Ga0495623_0320794 | Ga0495623_0320794_63_746 | 220 |
| 836 | 3300047322 | Ga0495680_0085161 | Ga0495680_0085161_1042_1713 | 220 |
| 837 | 3300047469 | Ga0495673_0108676 | Ga0495673_0108676_399_1076 | 220 |
| 838 | 3300048088 | Ga0495602_0543596 | Ga0495602_0543596_59_733 | 220 |
| 839 | 3300050494 | nmdc:mga06z11_57073_c1 | nmdc:mga06z11_57073_c1_271_942 | 220 |
| 840 | 3300053085 | Ga0495619_0514646 | Ga0495619_0514646_123_794 | 220 |
| 841 | 3300005339 | Ga0070660_100244847 | Ga0070660_1002448473 | 221 |
| 842 | 3300005367 | Ga0070667_100425118 | Ga0070667_1004251181 | 221 |
| 843 | 3300005439 | Ga0070711_100027986 | Ga0070711_1000279864 | 221 |
| 844 | 3300005441 | Ga0070700_100252535 | Ga0070700_1002525352 | 221 |
| 845 | 3300005456 | Ga0070678_100862047 | Ga0070678_1008620471 | 221 |
| 846 | 3300005458 | Ga0070681_10607547 | Ga0070681_106075471 | 221 |
| 847 | 3300005548 | Ga0070665_100028897 | Ga0070665_1000288974 | 221 |
| 848 | 3300005548 | Ga0070665_100161250 | Ga0070665_1001612503 | 221 |
| 849 | 3300005614 | Ga0068856_100467549 | Ga0068856_1004675491 | 221 |
| 850 | 3300005615 | Ga0070702_100437731 | Ga0070702_1004377312 | 221 |
| 851 | 3300005937 | Ga0081455_10007464 | Ga0081455_100074645 | 221 |
| 852 | 3300005983 | Ga0081540_1012706 | Ga0081540_10127065 | 221 |
| 853 | 3300005985 | Ga0081539_10125163 | Ga0081539_101251631 | 221 |
| 854 | 3300006871 | Ga0075434_100826714 | Ga0075434_1008267141 | 221 |
| 855 | 3300009174 | Ga0105241_10444899 | Ga0105241_104448992 | 221 |
| 856 | 3300013297 | Ga0157378_10057612 | Ga0157378_100576123 | 221 |
| 857 | 3300014325 | Ga0163163_10002774 | Ga0163163_100027748 | 221 |
| 858 | 3300014968 | Ga0157379_10609805 | Ga0157379_106098052 | 221 |
| 859 | 3300014969 | Ga0157376_10537824 | Ga0157376_105378241 | 221 |
| 860 | 3300025912 | Ga0207707_10669633 | Ga0207707_106696332 | 221 |
| 861 | 3300025919 | Ga0207657_10506158 | Ga0207657_105061582 | 221 |
| 862 | 3300026067 | Ga0207678_10698805 | Ga0207678_106988051 | 221 |
| 863 | 3300026078 | Ga0207702_10380959 | Ga0207702_103809591 | 221 |
| 864 | 3300028379 | Ga0268266_10070131 | Ga0268266_100701313 | 221 |
| 865 | 3300028379 | Ga0268266_10117632 | Ga0268266_101176323 | 221 |
| 866 | 3300028786 | Ga0307517_10000856 | Ga0307517_1000085615 | 221 |
| 867 | 3300028794 | Ga0307515_10027090 | Ga0307515_100270906 | 221 |
| 868 | 3300036401 | Ga0373937_0069895 | Ga0373937_0069895_2332_3009 | 221 |
| 869 | 3300047320 | Ga0495672_0017605 | Ga0495672_0017605_2030_2707 | 221 |
| 870 | 3300047469 | Ga0495673_0061680 | Ga0495673_0061680_323_997 | 221 |
| 871 | 3300048905 | Ga0496102_0107971 | Ga0496102_0107971_300_977 | 221 |
| 872 | 3300048907 | Ga0496104_0037936 | Ga0496104_0037936_3763_4440 | 221 |
| 873 | 3300048909 | Ga0496106_0038587 | Ga0496106_0038587_1552_2229 | 221 |
| 874 | 3300048911 | Ga0496108_0012004 | Ga0496108_0012004_2699_3376 | 221 |
| 875 | 3300048912 | Ga0496109_0893173 | Ga0496109_0893173_122_799 | 221 |
| 876 | 3300048913 | Ga0496110_0015719 | Ga0496110_0015719_3545_4222 | 221 |
| 877 | 3300048915 | Ga0496112_0053279 | Ga0496112_0053279_118_795 | 221 |
| 878 | 3300048918 | Ga0496115_0032960 | Ga0496115_0032960_2650_3327 | 221 |
| 879 | 3300048924 | Ga0496121_0322890 | Ga0496121_0322890_26_703 | 221 |
| 880 | 3300049585 | Ga0501069_0480989 | Ga0501069_0480989_46_714 | 221 |
| 881 | 3300049742 | Ga0501080_0060360 | Ga0501080_0060360_523_1191 | 221 |
| 882 | 3300049822 | Ga0501035_0618962 | Ga0501035_0618962_100_768 | 221 |
| 883 | 3300050492 | nmdc:mga0yw44_223543_c1 | nmdc:mga0yw44_223543_c1_72_743 | 221 |
| 884 | 3300050494 | nmdc:mga06z11_118063_c1 | nmdc:mga06z11_118063_c1_422_1099 | 221 |
| 885 | 3300050512 | nmdc:mga0n895_1120456_c1 | nmdc:mga0n895_1120456_c1_18_692 | 221 |
| 886 | 3300060353 | Ga0501082_0090266 | Ga0501082_0090266_1784_2473 | 221 |
| 887 | 3300061734 | Ga0530510_0254120 | Ga0530510_0254120_447_1115 | 221 |
| 888 | 3300003203 | JGI25406J46586_10006811 | JGI25406J46586_100068115 | 222 |
| 889 | 3300003659 | JGI25404J52841_10025272 | JGI25404J52841_100252722 | 222 |
| 890 | 3300003659 | JGI25404J52841_10030013 | JGI25404J52841_100300131 | 222 |
| 891 | 3300005334 | Ga0068869_100064153 | Ga0068869_1000641531 | 222 |
| 892 | 3300005338 | Ga0068868_100658426 | Ga0068868_1006584261 | 222 |
| 893 | 3300005438 | Ga0070701_10348617 | Ga0070701_103486171 | 222 |
| 894 | 3300005439 | Ga0070711_100752190 | Ga0070711_1007521901 | 222 |
| 895 | 3300005455 | Ga0070663_100672247 | Ga0070663_1006722471 | 222 |
| 896 | 3300005456 | Ga0070678_100164756 | Ga0070678_1001647563 | 222 |
| 897 | 3300005457 | Ga0070662_100230394 | Ga0070662_1002303941 | 222 |
| 898 | 3300005458 | Ga0070681_10037527 | Ga0070681_100375277 | 222 |
| 899 | 3300005466 | Ga0070685_10132407 | Ga0070685_101324072 | 222 |
| 900 | 3300005466 | Ga0070685_10187510 | Ga0070685_101875101 | 222 |
| 901 | 3300005467 | Ga0070706_100736318 | Ga0070706_1007363181 | 222 |
| 902 | 3300005471 | Ga0070698_100604936 | Ga0070698_1006049362 | 222 |
| 903 | 3300005530 | Ga0070679_100034291 | Ga0070679_1000342911 | 222 |
| 904 | 3300005543 | Ga0070672_100649058 | Ga0070672_1006490581 | 222 |
| 905 | 3300005547 | Ga0070693_100262254 | Ga0070693_1002622542 | 222 |
| 906 | 3300005548 | Ga0070665_100071651 | Ga0070665_1000716514 | 222 |
| 907 | 3300005548 | Ga0070665_100135904 | Ga0070665_1001359041 | 222 |
| 908 | 3300005563 | Ga0068855_100015587 | Ga0068855_1000155878 | 222 |
| 909 | 3300005564 | Ga0070664_100516844 | Ga0070664_1005168441 | 222 |
| 910 | 3300005615 | Ga0070702_100269391 | Ga0070702_1002693912 | 222 |
| 911 | 3300005615 | Ga0070702_100510897 | Ga0070702_1005108971 | 222 |
| 912 | 3300005719 | Ga0068861_100151333 | Ga0068861_1001513333 | 222 |
| 913 | 3300005834 | Ga0068851_10113048 | Ga0068851_101130482 | 222 |
| 914 | 3300005842 | Ga0068858_100150433 | Ga0068858_1001504332 | 222 |
| 915 | 3300005843 | Ga0068860_100215672 | Ga0068860_1002156723 | 222 |
| 916 | 3300005844 | Ga0068862_100373845 | Ga0068862_1003738453 | 222 |
| 917 | 3300005937 | Ga0081455_10003156 | Ga0081455_1000315612 | 222 |
| 918 | 3300005983 | Ga0081540_1001341 | Ga0081540_100134126 | 222 |
| 919 | 3300005983 | Ga0081540_1002121 | Ga0081540_100212111 | 222 |
| 920 | 3300005983 | Ga0081540_1018462 | Ga0081540_10184623 | 222 |
| 921 | 3300005983 | Ga0081540_1073482 | Ga0081540_10734822 | 222 |
| 922 | 3300005983 | Ga0081540_1120509 | Ga0081540_11205092 | 222 |
| 923 | 3300005983 | Ga0081540_1120511 | Ga0081540_11205112 | 222 |
| 924 | 3300005985 | Ga0081539_10000729 | Ga0081539_1000072950 | 222 |
| 925 | 3300006042 | Ga0075368_10008533 | Ga0075368_100085333 | 222 |
| 926 | 3300006042 | Ga0075368_10103345 | Ga0075368_101033452 | 222 |
| 927 | 3300006048 | Ga0075363_100003880 | Ga0075363_1000038803 | 222 |
| 928 | 3300006048 | Ga0075363_100013422 | Ga0075363_1000134224 | 222 |
| 929 | 3300006048 | Ga0075363_100060796 | Ga0075363_1000607962 | 222 |
| 930 | 3300006178 | Ga0075367_10330846 | Ga0075367_103308462 | 222 |
| 931 | 3300006195 | Ga0075366_10071534 | Ga0075366_100715342 | 222 |
| 932 | 3300006195 | Ga0075366_10094649 | Ga0075366_100946493 | 222 |
| 933 | 3300006237 | Ga0097621_100234276 | Ga0097621_1002342762 | 222 |
| 934 | 3300006353 | Ga0075370_10042444 | Ga0075370_100424442 | 222 |
| 935 | 3300006881 | Ga0068865_100316538 | Ga0068865_1003165382 | 222 |
| 936 | 3300007076 | Ga0075435_100109533 | Ga0075435_1001095331 | 222 |
| 937 | 3300007265 | Ga0099794_10112341 | Ga0099794_101123412 | 222 |
| 938 | 3300007788 | Ga0099795_10017558 | Ga0099795_100175581 | 222 |
| 939 | 3300009093 | Ga0105240_10183475 | Ga0105240_101834754 | 222 |
| 940 | 3300009098 | Ga0105245_10037331 | Ga0105245_100373315 | 222 |
| 941 | 3300009174 | Ga0105241_10066451 | Ga0105241_100664512 | 222 |
| 942 | 3300009177 | Ga0105248_10042923 | Ga0105248_100429233 | 222 |
| 943 | 3300009177 | Ga0105248_10211185 | Ga0105248_102111852 | 222 |
| 944 | 3300009553 | Ga0105249_10165545 | Ga0105249_101655453 | 222 |
| 945 | 3300009553 | Ga0105249_11331530 | Ga0105249_113315301 | 222 |
| 946 | 3300011119 | Ga0105246_10484397 | Ga0105246_104843972 | 222 |
| 947 | 3300013104 | Ga0157370_10061670 | Ga0157370_100616702 | 222 |
| 948 | 3300013297 | Ga0157378_10573750 | Ga0157378_105737502 | 222 |
| 949 | 3300013306 | Ga0163162_10362366 | Ga0163162_103623662 | 222 |
| 950 | 3300013306 | Ga0163162_10475004 | Ga0163162_104750042 | 222 |
| 951 | 3300013308 | Ga0157375_10069051 | Ga0157375_100690513 | 222 |
| 952 | 3300013308 | Ga0157375_10137987 | Ga0157375_101379874 | 222 |
| 953 | 3300013308 | Ga0157375_10784330 | Ga0157375_107843301 | 222 |
| 954 | 3300014325 | Ga0163163_10129093 | Ga0163163_101290932 | 222 |
| 955 | 3300014325 | Ga0163163_10910132 | Ga0163163_109101321 | 222 |
| 956 | 3300014745 | Ga0157377_10044206 | Ga0157377_100442064 | 222 |
| 957 | 3300014968 | Ga0157379_10255394 | Ga0157379_102553942 | 222 |
| 958 | 3300014969 | Ga0157376_10086282 | Ga0157376_100862822 | 222 |
| 959 | 3300014969 | Ga0157376_10321788 | Ga0157376_103217881 | 222 |
| 960 | 3300017792 | Ga0163161_10299170 | Ga0163161_102991702 | 222 |
| 961 | 3300017792 | Ga0163161_10338303 | Ga0163161_103383033 | 222 |
| 962 | 3300025901 | Ga0207688_10033353 | Ga0207688_100333532 | 222 |
| 963 | 3300025903 | Ga0207680_10231384 | Ga0207680_102313842 | 222 |
| 964 | 3300025910 | Ga0207684_10261744 | Ga0207684_102617442 | 222 |
| 965 | 3300025913 | Ga0207695_10043272 | Ga0207695_100432723 | 222 |
| 966 | 3300025917 | Ga0207660_10087395 | Ga0207660_100873954 | 222 |
| 967 | 3300025921 | Ga0207652_10047083 | Ga0207652_100470836 | 222 |
| 968 | 3300025931 | Ga0207644_10334329 | Ga0207644_103343292 | 222 |
| 969 | 3300025931 | Ga0207644_10743095 | Ga0207644_107430951 | 222 |
| 970 | 3300025934 | Ga0207686_10200241 | Ga0207686_102002412 | 222 |
| 971 | 3300025937 | Ga0207669_10478717 | Ga0207669_104787172 | 222 |
| 972 | 3300025940 | Ga0207691_10197132 | Ga0207691_101971323 | 222 |
| 973 | 3300025941 | Ga0207711_10276472 | Ga0207711_102764723 | 222 |
| 974 | 3300025941 | Ga0207711_10876686 | Ga0207711_108766862 | 222 |
| 975 | 3300025942 | Ga0207689_10080482 | Ga0207689_100804823 | 222 |
| 976 | 3300025949 | Ga0207667_10044714 | Ga0207667_100447147 | 222 |
| 977 | 3300025972 | Ga0207668_10095673 | Ga0207668_100956732 | 222 |
| 978 | 3300025986 | Ga0207658_10678577 | Ga0207658_106785771 | 222 |
| 979 | 3300026023 | Ga0207677_10461146 | Ga0207677_104611462 | 222 |
| 980 | 3300026041 | Ga0207639_10267758 | Ga0207639_102677582 | 222 |
| 981 | 3300026067 | Ga0207678_10025320 | Ga0207678_100253205 | 222 |
| 982 | 3300026067 | Ga0207678_10064507 | Ga0207678_100645074 | 222 |
| 983 | 3300026075 | Ga0207708_10433723 | Ga0207708_104337232 | 222 |
| 984 | 3300026095 | Ga0207676_10163439 | Ga0207676_101634391 | 222 |
| 985 | 3300026121 | Ga0207683_10032517 | Ga0207683_100325172 | 222 |
| 986 | 3300026121 | Ga0207683_10450052 | Ga0207683_104500522 | 222 |
| 987 | 3300027671 | Ga0209588_1014950 | Ga0209588_10149503 | 222 |
| 988 | 3300027671 | Ga0209588_1031471 | Ga0209588_10314712 | 222 |
| 989 | 3300028379 | Ga0268266_10000638 | Ga0268266_100006382 | 222 |
| 990 | 3300028379 | Ga0268266_10001364 | Ga0268266_1000136427 | 222 |
| 991 | 3300028379 | Ga0268266_10768309 | Ga0268266_107683091 | 222 |
| 992 | 3300028380 | Ga0268265_10678065 | Ga0268265_106780651 | 222 |
| 993 | 3300028381 | Ga0268264_10295742 | Ga0268264_102957422 | 222 |
| 994 | 3300031507 | Ga0307509_10085186 | Ga0307509_100851864 | 222 |
| 995 | 3300031995 | Ga0307409_100119908 | Ga0307409_1001199081 | 222 |
| 996 | 3300032002 | Ga0307416_100286859 | Ga0307416_1002868592 | 222 |
| 997 | 3300032126 | Ga0307415_100143022 | Ga0307415_1001430223 | 222 |
| 998 | 3300033180 | Ga0307510_10004951 | Ga0307510_1000495112 | 222 |
| 999 | 3300035090 | Ga0373949_0020331 | Ga0373949_0020331_356_1033 | 222 |
| 1000 | 3300035092 | Ga0373952_0006580 | Ga0373952_0006580_617_1294 | 222 |
| 1001 | 3300035121 | Ga0373960_0132987 | Ga0373960_0132987_34_705 | 222 |
| 1002 | 3300035170 | Ga0373943_0157391 | Ga0373943_0157391_454_1125 | 222 |
| 1003 | 3300035691 | Ga0373931_0008723 | Ga0373931_0008723_1320_1997 | 222 |
| 1004 | 3300035695 | Ga0373927_0012565 | Ga0373927_0012565_1054_1731 | 222 |
| 1005 | 3300037068 | Ga0373925_0639533 | Ga0373925_0639533_159_836 | 222 |
| 1006 | 3300041443 | Ga0451789_0919161 | Ga0451789_0919161_291_962 | 222 |
| 1007 | 3300046455 | Ga0495603_0132329 | Ga0495603_0132329_288_962 | 222 |
| 1008 | 3300046455 | Ga0495603_0300832 | Ga0495603_0300832_124_795 | 222 |
| 1009 | 3300046461 | Ga0495641_0062004 | Ga0495641_0062004_946_1617 | 222 |
| 1010 | 3300046462 | Ga0495651_0424287 | Ga0495651_0424287_171_851 | 222 |
| 1011 | 3300046472 | Ga0495580_0092623 | Ga0495580_0092623_91_768 | 222 |
| 1012 | 3300046475 | Ga0495639_0061813 | Ga0495639_0061813_864_1541 | 222 |
| 1013 | 3300046492 | Ga0495585_0283872 | Ga0495585_0283872_90_761 | 222 |
| 1014 | 3300046499 | Ga0495594_0065555 | Ga0495594_0065555_75_752 | 222 |
| 1015 | 3300046512 | Ga0495610_0078267 | Ga0495610_0078267_163_834 | 222 |
| 1016 | 3300046513 | Ga0495616_0084560 | Ga0495616_0084560_265_936 | 222 |
| 1017 | 3300046515 | Ga0495620_0020979 | Ga0495620_0020979_1558_2229 | 222 |
| 1018 | 3300046529 | Ga0495652_0457905 | Ga0495652_0457905_52_735 | 222 |
| 1019 | 3300046530 | Ga0495654_0129733 | Ga0495654_0129733_126_797 | 222 |
| 1020 | 3300046538 | Ga0495609_0090829 | Ga0495609_0090829_133_804 | 222 |
| 1021 | 3300046557 | Ga0495622_0014799 | Ga0495622_0014799_2739_3416 | 222 |
| 1022 | 3300046648 | Ga0495611_0244628 | Ga0495611_0244628_39_710 | 222 |
| 1023 | 3300046810 | Ga0495660_0076880 | Ga0495660_0076880_633_1304 | 222 |
| 1024 | 3300047315 | Ga0495581_0041048 | Ga0495581_0041048_553_1224 | 222 |
| 1025 | 3300047320 | Ga0495672_0050250 | Ga0495672_0050250_1455_2138 | 222 |
| 1026 | 3300047321 | Ga0495676_0102528 | Ga0495676_0102528_1414_2091 | 222 |
| 1027 | 3300047321 | Ga0495676_0374195 | Ga0495676_0374195_117_788 | 222 |
| 1028 | 3300047447 | Ga0495685_082541 | Ga0495685_082541_17_694 | 222 |
| 1029 | 3300047472 | Ga0495686_0114233 | Ga0495686_0114233_64_735 | 222 |
| 1030 | 3300048904 | Ga0496101_0055034 | Ga0496101_0055034_1459_2136 | 222 |
| 1031 | 3300048904 | Ga0496101_0149898 | Ga0496101_0149898_921_1598 | 222 |
| 1032 | 3300048905 | Ga0496102_0125274 | Ga0496102_0125274_231_908 | 222 |
| 1033 | 3300048906 | Ga0496103_0338198 | Ga0496103_0338198_177_848 | 222 |
| 1034 | 3300048907 | Ga0496104_0068302 | Ga0496104_0068302_314_991 | 222 |
| 1035 | 3300048907 | Ga0496104_0375050 | Ga0496104_0375050_453_1130 | 222 |
| 1036 | 3300048908 | Ga0496105_0099088 | Ga0496105_0099088_181_858 | 222 |
| 1037 | 3300048908 | Ga0496105_0589435 | Ga0496105_0589435_163_834 | 222 |
| 1038 | 3300048909 | Ga0496106_0264939 | Ga0496106_0264939_618_1295 | 222 |
| 1039 | 3300048909 | Ga0496106_0285674 | Ga0496106_0285674_40_717 | 222 |
| 1040 | 3300048910 | Ga0496107_0709954 | Ga0496107_0709954_12_680 | 222 |
| 1041 | 3300048911 | Ga0496108_0243202 | Ga0496108_0243202_473_1144 | 222 |
| 1042 | 3300048911 | Ga0496108_0467421 | Ga0496108_0467421_207_884 | 222 |
| 1043 | 3300048912 | Ga0496109_0275200 | Ga0496109_0275200_896_1573 | 222 |
| 1044 | 3300048912 | Ga0496109_0721487 | Ga0496109_0721487_48_719 | 222 |
| 1045 | 3300048914 | Ga0496111_0152814 | Ga0496111_0152814_196_873 | 222 |
| 1046 | 3300048915 | Ga0496112_0045698 | Ga0496112_0045698_3527_4204 | 222 |
| 1047 | 3300048915 | Ga0496112_0242029 | Ga0496112_0242029_168_845 | 222 |
| 1048 | 3300048916 | Ga0496113_0004044 | Ga0496113_0004044_5952_6629 | 222 |
| 1049 | 3300048917 | Ga0496114_0121968 | Ga0496114_0121968_1392_2069 | 222 |
| 1050 | 3300048918 | Ga0496115_0005405 | Ga0496115_0005405_2501_3178 | 222 |
| 1051 | 3300048920 | Ga0496117_0301026 | Ga0496117_0301026_145_816 | 222 |
| 1052 | 3300048924 | Ga0496121_0000571 | Ga0496121_0000571_67822_68505 | 222 |
| 1053 | 3300048924 | Ga0496121_0043447 | Ga0496121_0043447_3024_3701 | 222 |
| 1054 | 3300048927 | Ga0496124_0026050 | Ga0496124_0026050_1477_2148 | 222 |
| 1055 | 3300048929 | Ga0496126_0071503 | Ga0496126_0071503_1147_1827 | 222 |
| 1056 | 3300048929 | Ga0496126_0355971 | Ga0496126_0355971_149_820 | 222 |
| 1057 | 3300049460 | Ga0495682_0139946 | Ga0495682_0139946_46_717 | 222 |
| 1058 | 3300050490 | nmdc:mga03n38_155829_c1 | nmdc:mga03n38_155829_c1_189_866 | 222 |
| 1059 | 3300050490 | nmdc:mga03n38_208_c1 | nmdc:mga03n38_208_c1_3130_3807 | 222 |
| 1060 | 3300050491 | nmdc:mga00v17_145883_c1 | nmdc:mga00v17_145883_c1_169_846 | 222 |
| 1061 | 3300050492 | nmdc:mga0yw44_66485_c1 | nmdc:mga0yw44_66485_c1_1158_1835 | 222 |
| 1062 | 3300050493 | nmdc:mga0k408_122214_c1 | nmdc:mga0k408_122214_c1_793_1470 | 222 |
| 1063 | 3300050495 | nmdc:mga04h51_17986_c1 | nmdc:mga04h51_17986_c1_674_1351 | 222 |
| 1064 | 3300050496 | nmdc:mga07m45_182616_c1 | nmdc:mga07m45_182616_c1_327_1004 | 222 |
| 1065 | 3300050496 | nmdc:mga07m45_74631_c1 | nmdc:mga07m45_74631_c1_623_1294 | 222 |
| 1066 | 3300050513 | nmdc:mga0rr50_171235_c1 | nmdc:mga0rr50_171235_c1_636_1307 | 222 |
| 1067 | 3300050516 | nmdc:mga0sz30_23037_c2 | nmdc:mga0sz30_23037_c2_92_769 | 222 |
| 1068 | 3300050516 | nmdc:mga0sz30_55224_c1 | nmdc:mga0sz30_55224_c1_611_1282 | 222 |
| 1069 | 3300053090 | Ga0500646_0064528 | Ga0500646_0064528_178_849 | 222 |
| 1070 | 3300053119 | Ga0500595_004072 | Ga0500595_004072_3007_3678 | 222 |
| 1071 | 3300053139 | Ga0500568_0005758 | Ga0500568_0005758_4972_5655 | 222 |
| 1072 | 3300053142 | Ga0500577_0103682 | Ga0500577_0103682_426_1097 | 222 |
| 1073 | 3300053143 | Ga0500579_184734 | Ga0500579_184734_56_727 | 222 |
| 1074 | 3300053161 | Ga0500634_0053113 | Ga0500634_0053113_1369_2046 | 222 |
| 1075 | 3300053162 | Ga0500638_094379 | Ga0500638_094379_494_1165 | 222 |
| 1076 | 3300053730 | Ga0500645_005369 | Ga0500645_005369_3230_3907 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gyk-assembly4.cif.gz_D | the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 | 0.9675 | 46 | 217 |
| 3gyk-assembly4.cif.gz_D | the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 | 0.9458 | 46 | 217 |
| 4gxz-assembly3.cif.gz_C | crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium | 0.8956 | 48 | 215 |
| 6eez-assembly1.cif.gz_A | crystal structure of the thiol-disulfide exchange protein alpha-dsba2 from wolbachia pipientis | 0.8889 | 38 | 214 |
| 5nyl-assembly2.cif.gz_B | crystal structure of an atypical poplar thioredoxin-like2.1 active site mutant | 0.8849 | 66 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gykA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9445 | 40 | 218 | 3.40.30.10 |
| 3gykA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9284 | 40 | 218 | 3.40.30.10 |
| af_I1K367_67_180_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9235 | 66 | 102 | 3.40.30.10 |
| af_Q7XSQ7_19_127_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8906 | 66 | 102 | 3.40.30.10 |
| af_Q8LCH9_1_124_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8842 | 66 | 102 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U8KRA5-F1-model_v4 | deleted | 0.9797 | 46 | 217 |
|
| AF-A0A7W0XMI2-F1-model_v4 | DsbA family protein | 0.9694 | 59 | 216 |
GO:0016491
|
| AF-T0HJ65-F1-model_v4 | Thioredoxin domain-containing protein | 0.969 | 67 | 216 |
GO:0016491
|
| AF-A0A529PRT1-F1-model_v4 | Disulfide bond formation protein DsbA | 0.9683 | 48 | 218 |
GO:0016491
|
| AF-A0A2E9X9V3-F1-model_v4 | Thioredoxin domain-containing protein | 0.9662 | 48 | 222 |
GO:0015036
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar