F489583

General Info

Members Datasets Scaffolds Average Seq Length
1076 607 875 218

Family's Representative Sequence

Representative Sequence 3300021321|Ga0214542_1021066|Ga0214542_10210665
Length 236
Sequence MTGARAYIRKTGPERDDMTGFGNNGLGPSRRAALTLIGAGALAVGGIVSARAATGDDEVLTEAKVLRDPDTPVAGNPDGNITIVEWSDYNCPYCRKLEPELRQVVQDDGKVRLVMKDWPILGPVSVTAARSALAAKFQGKYHQAHDALIGVSSRLTEPRINELLAAAGVDMDRLKRDLTGHAKDIDAILKRNNEQAEAFGFQGTPSFIVGKYRVPGVLSMTEFEQVIADARKAKMN

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
19 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
20 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
21 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
22 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
23 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
24 2791355199
25 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
26 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
27 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
28 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
29 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
30 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
31 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
32 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
33 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
34 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
35 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
36 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
37 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
38 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
39 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
40 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
41 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
42 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
43 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
44 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
45 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
46 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
47 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
48 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
49 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
50 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
51 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
52 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
53 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
54 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
55 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
56 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
57 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
58 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
59 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
60 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
61 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
62 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
63 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
64 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
65 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
66 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
67 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
68 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
69 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
70 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
71 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
72 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
73 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
74 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
75 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
76 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
77 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
78 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
79 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
80 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
81 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
82 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
83 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
84 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
85 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
86 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
87 2904699407
88 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
89 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
90 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
91 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
92 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
93 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
94 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
95 2922368715
96 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
97 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
98 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
99 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
100 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
101 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
102 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
103 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
104 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
105 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
106 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
107 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
108 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
109 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
110 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
111 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
112 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
113 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
114 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
115 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
116 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
117 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
118 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
119 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
120 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
121 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
122 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
123 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
124 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
125 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
126 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
127 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
128 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
129 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
130 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
131 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
132 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
133 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
134 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
135 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
136 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
137 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
138 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
139 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
140 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
141 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
142 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
143 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
144 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
145 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
146 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
147 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
148 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
149 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
150 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
151 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
152 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
153 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
154 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
155 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
156 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
157 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
158 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
159 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
160 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
161 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
162 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
163 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
164 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
165 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
166 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
167 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
168 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
169 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
170 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
171 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
172 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
173 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
174 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
175 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
176 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
177 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
178 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
179 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
180 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
181 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
182 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
183 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
184 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
185 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
186 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
187 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
188 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
189 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
190 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
191 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
192 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
193 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
194 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
195 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
196 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
197 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
198 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
199 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
200 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
201 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
202 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
203 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
204 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
205 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
206 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
207 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
208 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
209 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
210 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
211 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
212 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
213 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
214 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
215 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
216 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
217 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
218 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
219 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
220 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
221 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
222 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
223 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
224 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
225 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
226 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
227 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
228 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
229 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
230 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
231 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
232 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
233 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
234 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
235 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
236 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
237 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
238 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
239 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
240 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
241 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
242 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
243 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
244 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
245 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
246 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
247 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
248 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
249 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
250 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
251 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
252 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
253 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
254 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
255 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
256 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
257 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
258 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
259 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
260 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
261 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
262 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
263 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
264 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
265 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
266 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
267 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
268 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
269 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
270 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
271 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
272 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
273 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
274 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
275 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
276 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
277 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
278 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
279 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
280 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
281 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
282 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
283 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
284 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
285 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
289 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
292 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
293 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
294 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
345 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
346 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
347 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
348 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
350 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
354 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
355 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
356 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
357 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
358 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
359 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
360 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
361 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
362 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
363 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
364 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
365 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
366 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
367 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
368 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
369 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
370 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
371 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
372 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
373 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
374 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
375 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
376 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
377 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
378 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
379 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
380 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
381 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
382 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
383 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
384 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
385 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
386 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
387 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
388 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
389 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
390 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
391 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
392 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
393 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
394 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
395 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
396 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
397 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
398 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
399 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
400 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
401 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
402 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
403 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
404 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
405 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
406 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
407 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
408 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
409 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
410 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
411 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
412 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
413 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
414 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
415 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
416 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
417 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
418 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
419 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
420 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
421 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
422 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
423 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
424 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
425 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
426 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
427 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
428 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
429 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
430 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
431 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
432 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
433 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
434 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
435 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
436 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
437 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
438 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
439 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
440 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
441 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
442 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
443 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
444 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
445 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
446 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
447 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
448 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
449 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
450 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
451 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
452 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
453 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
454 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
455 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
456 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
457 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
458 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
459 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
460 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
461 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
462 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
463 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
464 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
465 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
466 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
467 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
468 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
469 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
470 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
471 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
472 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
473 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
474 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
475 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
476 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
477 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
478 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
479 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
480 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
481 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
482 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
483 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
484 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
485 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
486 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
487 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
488 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
489 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
490 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
491 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
492 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
493 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
494 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
495 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
496 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
497 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
498 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
499 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
500 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
501 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
502 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
503 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
504 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
505 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
506 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
507 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
508 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
509 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
510 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
511 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
512 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
513 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
514 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
515 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
516 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
517 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
518 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
519 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
520 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
521 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
522 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
523 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
524 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
525 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
526 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
527 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
528 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
529 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
530 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
531 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
532 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
533 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
534 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
535 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
536 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
537 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
538 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
539 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
540 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
541 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
542 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
543 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
544 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
545 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
546 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
547 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
548 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
549 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
550 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
551 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
552 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
553 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
554 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
555 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
556 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
557 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
558 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
559 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
560 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
561 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
562 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
563 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
564 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
565 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
566 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
567 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
568 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
569 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
570 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
571 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
572 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
573 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
574 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
575 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
576 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
577 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
578 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
579 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
580 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
581 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
582 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
583 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
584 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
585 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
586 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
587 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
588 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
589 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
590 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
591 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
592 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
593 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
594 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
595 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
596 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
597 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
598 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
599 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
600 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
601 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
602 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
603 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
604 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
605 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
606 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
607 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.99
Metatranscriptomes 0.56
Isolates 18.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.31
Nodule 15.43
Rhizoplane 5.67
Rhizosphere 54
Stem 0
Stem Tuber 0
Unclassified 10.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006811 3300003203 Bacteria 5249
2 JGI25153J46596_10002547 3300003215 Bacteria 10449
3 JGI25153J46596_10003542 3300003215 Bacteria 8707
4 JGI25153J46596_10004097 3300003215 Bacteria 7925
5 JGI25153J46596_10014855 3300003215 Bacteria 3211
6 rootH1_10016026 3300003323 Bacteria 1867
7 JGI25160J50197_1001680 3300003354 Bacteria 10780
8 JGI25160J50197_1003442 3300003354 Bacteria 7079
9 JGI25160J50197_1005384 3300003354 Bacteria 5338
10 JGI25404J52841_10025272 3300003659 Bacteria 1279
11 JGI25404J52841_10030013 3300003659 Bacteria 1165
12 Ga0055531_10007525 3300003794 Bacteria 5917
13 Ga0055543_1007516 3300004625 Bacteria 2506
14 Ga0065165_1000370 3300005262 Bacteria 73604
15 Ga0065165_1006098 3300005262 Bacteria 6459
16 Ga0065165_1008717 3300005262 Bacteria 4687
17 Ga0070658_10021405 3300005327 Bacteria 5182
18 Ga0070676_10394328 3300005328 Bacteria 961
19 Ga0070683_100042686 3300005329 Bacteria 4176
20 Ga0070683_100139749 3300005329 Bacteria 2294
21 Ga0070683_100521941 3300005329 Bacteria 1135
22 Ga0070670_100124537 3300005331 Bacteria 2224
23 Ga0068869_100013181 3300005334 Bacteria 5491
24 Ga0068869_100064153 3300005334 Bacteria 2701
25 Ga0070680_100019553 3300005336 Bacteria 5369
26 Ga0070680_100079829 3300005336 Bacteria 2697
27 Ga0070680_100104138 3300005336 Bacteria 2358
28 Ga0070680_100221827 3300005336 Bacteria 1596
29 Ga0070682_100110140 3300005337 Bacteria 1834
30 Ga0068868_100063339 3300005338 Bacteria 2933
31 Ga0068868_100284079 3300005338 Bacteria 1401
32 Ga0068868_100658426 3300005338 Bacteria 933
33 Ga0070660_100244847 3300005339 Bacteria 1461
34 Ga0070689_100474764 3300005340 Bacteria 1067
35 Ga0070691_10090375 3300005341 Bacteria 1509
36 Ga0070668_100008756 3300005347 Bacteria 7517
37 Ga0070668_100027658 3300005347 Bacteria 4306
38 Ga0070671_100032245 3300005355 Bacteria 4332
39 Ga0070673_100719100 3300005364 Bacteria 918
40 Ga0070667_100137265 3300005367 Bacteria 2138
41 Ga0070667_100425118 3300005367 Bacteria 1212
42 Ga0070709_10003090 3300005434 Bacteria 8947
43 Ga0070709_10008369 3300005434 Bacteria 5681
44 Ga0070714_100162069 3300005435 Bacteria 2024
45 Ga0070713_100002234 3300005436 Bacteria 12560
46 Ga0070713_100008846 3300005436 Bacteria 7167
47 Ga0070713_101072866 3300005436 Bacteria 778
48 Ga0070710_10000552 3300005437 Bacteria 17723
49 Ga0070710_10172200 3300005437 Bacteria 1349
50 Ga0070701_10348617 3300005438 Bacteria 924
51 Ga0070711_100011221 3300005439 Bacteria 5556
52 Ga0070711_100017038 3300005439 Bacteria 4621
53 Ga0070711_100027986 3300005439 Bacteria 3705
54 Ga0070711_100062871 3300005439 Bacteria 2589
55 Ga0070711_100166520 3300005439 Bacteria 1676
56 Ga0070711_100752190 3300005439 Bacteria 824
57 Ga0070700_100252535 3300005441 Bacteria 1265
58 Ga0070663_100435647 3300005455 Bacteria 1078
59 Ga0070663_100672247 3300005455 Bacteria 878
60 Ga0070678_100012735 3300005456 Bacteria 5243
61 Ga0070678_100029982 3300005456 Bacteria 3732
62 Ga0070678_100164756 3300005456 Bacteria 1800
63 Ga0070678_100862047 3300005456 Bacteria 826
64 Ga0070662_100230394 3300005457 Bacteria 1482
65 Ga0070681_10012819 3300005458 Bacteria 8322
66 Ga0070681_10037527 3300005458 Bacteria 4861
67 Ga0070681_10051933 3300005458 Bacteria 4088
68 Ga0070681_10125936 3300005458 Bacteria 2494
69 Ga0070681_10607547 3300005458 Bacteria 1008
70 Ga0070685_10132407 3300005466 Bacteria 1561
71 Ga0070685_10187510 3300005466 Bacteria 1336
72 Ga0070706_100736318 3300005467 Bacteria 914
73 Ga0070698_100604936 3300005471 Bacteria 1036
74 Ga0070679_100031919 3300005530 Bacteria 5207
75 Ga0070679_100034291 3300005530 Bacteria 5029
76 Ga0070679_100109277 3300005530 Bacteria 2751
77 Ga0070679_100137259 3300005530 Bacteria 2426
78 Ga0070679_100138618 3300005530 Bacteria 2413
79 Ga0070679_100600551 3300005530 Bacteria 1044
80 Ga0070684_100003258 3300005535 Bacteria 12159
81 Ga0068853_100026606 3300005539 Bacteria 4858
82 Ga0068853_100112148 3300005539 Bacteria 2424
83 Ga0070672_100649058 3300005543 Bacteria 922
84 Ga0070696_100164886 3300005546 Bacteria 1635
85 Ga0070693_100262254 3300005547 Bacteria 1150
86 Ga0070665_100028897 3300005548 Bacteria 5581
87 Ga0070665_100045145 3300005548 Bacteria 4425
88 Ga0070665_100071651 3300005548 Bacteria 3472
89 Ga0070665_100135904 3300005548 Bacteria 2461
90 Ga0070665_100136213 3300005548 Bacteria 2458
91 Ga0070665_100161250 3300005548 Bacteria 2245
92 Ga0070665_100472269 3300005548 Bacteria 1265
93 Ga0070665_100554908 3300005548 Bacteria 1161
94 Ga0068855_100015587 3300005563 Bacteria 9146
95 Ga0068855_100073742 3300005563 Bacteria 3965
96 Ga0068855_100188786 3300005563 Bacteria 2326
97 Ga0068855_100217196 3300005563 Bacteria 2146
98 Ga0070664_100249863 3300005564 Bacteria 1594
99 Ga0070664_100516844 3300005564 Bacteria 1102
100 Ga0068857_100125486 3300005577 Bacteria 2313
101 Ga0068857_100264142 3300005577 Bacteria 1580
102 Ga0068856_100013570 3300005614 Bacteria 7888
103 Ga0068856_100152081 3300005614 Bacteria 2324
104 Ga0068856_100253525 3300005614 Bacteria 1775
105 Ga0068856_100255228 3300005614 Bacteria 1768
106 Ga0068856_100467549 3300005614 Bacteria 1282
107 Ga0068856_100832796 3300005614 Bacteria 942
108 Ga0070702_100269391 3300005615 Bacteria 1164
109 Ga0070702_100437731 3300005615 Bacteria 945
110 Ga0070702_100510897 3300005615 Bacteria 884
111 Ga0068852_100002075 3300005616 Bacteria 13685
112 Ga0068852_100185761 3300005616 Bacteria 1958
113 Ga0068859_100127861 3300005617 Bacteria 2611
114 Ga0068859_100538127 3300005617 Bacteria 1263
115 Ga0068864_100182468 3300005618 Bacteria 1919
116 Ga0068864_100257270 3300005618 Bacteria 1623
117 Ga0068861_100139299 3300005719 Bacteria 1978
118 Ga0068861_100151333 3300005719 Bacteria 1904
119 Ga0068851_10113048 3300005834 Bacteria 1451
120 Ga0068863_100776274 3300005841 Bacteria 955
121 Ga0068858_100150433 3300005842 Bacteria 2189
122 Ga0068858_100721009 3300005842 Bacteria 971
123 Ga0068860_100084953 3300005843 Bacteria 3010
124 Ga0068860_100215672 3300005843 Bacteria 1862
125 Ga0068860_100238488 3300005843 Bacteria 1768
126 Ga0068862_100158116 3300005844 Bacteria 2021
127 Ga0068862_100373845 3300005844 Bacteria 1327
128 Ga0068862_100569757 3300005844 Bacteria 1083
129 Ga0081455_10003156 3300005937 Bacteria 19144
130 Ga0081455_10006663 3300005937 Bacteria 12343
131 Ga0081455_10007464 3300005937 Bacteria 11515
132 Ga0081455_10073137 3300005937 Bacteria 2835
133 Ga0081540_1001341 3300005983 Bacteria 21422
134 Ga0081540_1002121 3300005983 Bacteria 16515
135 Ga0081540_1012706 3300005983 Bacteria 5523
136 Ga0081540_1018462 3300005983 Bacteria 4276
137 Ga0081540_1073482 3300005983 Bacteria 1571
138 Ga0081540_1100945 3300005983 Bacteria 1243
139 Ga0081540_1120509 3300005983 Bacteria 1090
140 Ga0081540_1120511 3300005983 Bacteria 1090
141 Ga0081539_10000729 3300005985 Bacteria 65907
142 Ga0081539_10091157 3300005985 Bacteria 1575
143 Ga0081539_10125163 3300005985 Bacteria 1271
144 Ga0070717_10001026 3300006028 Bacteria 18703
145 Ga0070717_10237647 3300006028 Bacteria 1606
146 Ga0075365_10033553 3300006038 Bacteria 3309
147 Ga0075365_10046161 3300006038 Bacteria 2860
148 Ga0075368_10008533 3300006042 Bacteria 3653
149 Ga0075368_10102393 3300006042 Bacteria 1177
150 Ga0075368_10103345 3300006042 Bacteria 1172
151 Ga0075368_10127023 3300006042 Bacteria 1058
152 Ga0075363_100003880 3300006048 Bacteria 6449
153 Ga0075363_100013422 3300006048 Bacteria 3971
154 Ga0075363_100060796 3300006048 Bacteria 2035
155 Ga0075363_100163594 3300006048 Bacteria 1261
156 Ga0075364_10039240 3300006051 Bacteria 3069
157 Ga0070716_100069962 3300006173 Bacteria 2059
158 Ga0070716_100073994 3300006173 Bacteria 2011
159 Ga0070716_100585493 3300006173 Bacteria 837
160 Ga0070712_100044616 3300006175 Bacteria 3057
161 Ga0070712_100502818 3300006175 Bacteria 1016
162 Ga0070712_100840602 3300006175 Bacteria 789
163 Ga0075367_10098911 3300006178 Bacteria 1781
164 Ga0075367_10110452 3300006178 Bacteria 1687
165 Ga0075367_10330846 3300006178 Bacteria 960
166 Ga0075369_10028877 3300006186 Bacteria 2327
167 Ga0075366_10008044 3300006195 Bacteria 5844
168 Ga0075366_10071534 3300006195 Bacteria 2066
169 Ga0075366_10094649 3300006195 Bacteria 1791
170 Ga0097621_100234276 3300006237 Bacteria 1603
171 Ga0097621_100239636 3300006237 Bacteria 1585
172 Ga0075370_10028282 3300006353 Bacteria 3115
173 Ga0075370_10042444 3300006353 Bacteria 2570
174 Ga0075370_10116584 3300006353 Bacteria 1553
175 Ga0075370_10132901 3300006353 Bacteria 1452
176 Ga0075370_10216835 3300006353 Bacteria 1130
177 Ga0075428_100622896 3300006844 Bacteria 1152
178 Ga0075434_100092226 3300006871 Bacteria 3031
179 Ga0075434_100826714 3300006871 Bacteria 942
180 Ga0068865_100069342 3300006881 Bacteria 2495
181 Ga0068865_100316538 3300006881 Bacteria 1254
182 Ga0075436_100134933 3300006914 Bacteria 1732
183 Ga0097620_100127864 3300006931 Bacteria 2611
184 Ga0097620_100538168 3300006931 Bacteria 1263
185 Ga0099824_1002047 3300006942 Bacteria 29222
186 Ga0099824_1018951 3300006942 Bacteria 5500
187 Ga0099822_1004737 3300006943 Bacteria 17740
188 Ga0099822_1063565 3300006943 Bacteria 1165
189 Ga0099823_1071205 3300006944 Bacteria 1538
190 Ga0075435_100109533 3300007076 Bacteria 2296
191 Ga0099794_10112341 3300007265 Bacteria 1366
192 Ga0099795_10017558 3300007788 Bacteria 2284
193 Ga0099795_10161517 3300007788 Bacteria 925
194 Ga0105240_10002295 3300009093 Bacteria 30967
195 Ga0105240_10053247 3300009093 Bacteria 5081
196 Ga0105240_10183475 3300009093 Bacteria 2467
197 Ga0105240_10218361 3300009093 Bacteria 2223
198 Ga0105240_10251298 3300009093 Bacteria 2045
199 Ga0105240_10266078 3300009093 Bacteria 1976
200 Ga0105240_10672889 3300009093 Bacteria 1132
201 Ga0111539_10182022 3300009094 Bacteria 2454
202 Ga0111539_10395278 3300009094 Bacteria 1610
203 Ga0105245_10037331 3300009098 Bacteria 4319
204 Ga0105245_10340923 3300009098 Bacteria 1482
205 Ga0105245_10904070 3300009098 Bacteria 924
206 Ga0105243_10994056 3300009148 Bacteria 841
207 Ga0105241_10012898 3300009174 Bacteria 6131
208 Ga0105241_10046174 3300009174 Bacteria 3307
209 Ga0105241_10066451 3300009174 Bacteria 2788
210 Ga0105241_10444899 3300009174 Bacteria 1145
211 Ga0105242_10234670 3300009176 Bacteria 1646
212 Ga0105242_10458835 3300009176 Bacteria 1203
213 Ga0105248_10042923 3300009177 Bacteria 5071
214 Ga0105248_10144863 3300009177 Bacteria 2681
215 Ga0105248_10211185 3300009177 Bacteria 2187
216 Ga0105237_10002301 3300009545 Bacteria 23744
217 Ga0105237_10006999 3300009545 Bacteria 12427
218 Ga0105237_10026831 3300009545 Bacteria 5887
219 Ga0105237_10080389 3300009545 Bacteria 3250
220 Ga0105237_10259204 3300009545 Bacteria 1741
221 Ga0105237_10346620 3300009545 Bacteria 1489
222 Ga0105237_10358448 3300009545 Bacteria 1463
223 Ga0105237_10430729 3300009545 Bacteria 1325
224 Ga0105237_10807367 3300009545 Bacteria 945
225 Ga0105238_10018488 3300009551 Bacteria 7091
226 Ga0105238_10063133 3300009551 Bacteria 3704
227 Ga0105238_10112590 3300009551 Bacteria 2701
228 Ga0105238_10247537 3300009551 Bacteria 1760
229 Ga0105238_10345957 3300009551 Bacteria 1475
230 Ga0105238_10422128 3300009551 Bacteria 1328
231 Ga0105249_10165545 3300009553 Bacteria 2140
232 Ga0105249_10395205 3300009553 Bacteria 1412
233 Ga0105249_11331530 3300009553 Bacteria 790
234 Ga0105239_10025401 3300010375 Bacteria 6522
235 Ga0105239_10083534 3300010375 Bacteria 3517
236 Ga0105239_10142048 3300010375 Bacteria 2676
237 Ga0105239_10321091 3300010375 Bacteria 1746
238 Ga0105239_11309354 3300010375 Bacteria 836
239 Ga0105246_10114789 3300011119 Bacteria 1985
240 Ga0105246_10484397 3300011119 Bacteria 1047
241 Ga0157370_10061670 3300013104 Bacteria 3559
242 Ga0157370_10497971 3300013104 Bacteria 1119
243 Ga0157369_10017488 3300013105 Bacteria 8058
244 Ga0157369_10102904 3300013105 Bacteria 3042
245 Ga0157369_10570470 3300013105 Bacteria 1169
246 Ga0157374_10191301 3300013296 Bacteria 2002
247 Ga0157378_10057612 3300013297 Bacteria 3463
248 Ga0157378_10146176 3300013297 Bacteria 2199
249 Ga0157378_10573750 3300013297 Bacteria 1136
250 Ga0163162_10155709 3300013306 Bacteria 2405
251 Ga0163162_10362366 3300013306 Bacteria 1583
252 Ga0163162_10475004 3300013306 Bacteria 1382
253 Ga0157372_10118851 3300013307 Bacteria 3033
254 Ga0157375_10069051 3300013308 Bacteria 3538
255 Ga0157375_10076159 3300013308 Bacteria 3381
256 Ga0157375_10137987 3300013308 Bacteria 2564
257 Ga0157375_10541055 3300013308 Bacteria 1327
258 Ga0157375_10784330 3300013308 Bacteria 1102
259 Ga0163163_10002774 3300014325 Bacteria 14789
260 Ga0163163_10043948 3300014325 Bacteria 4382
261 Ga0163163_10129093 3300014325 Bacteria 2567
262 Ga0163163_10183688 3300014325 Bacteria 2139
263 Ga0163163_10203230 3300014325 Bacteria 2030
264 Ga0163163_10910132 3300014325 Bacteria 943
265 Ga0157377_10044206 3300014745 Bacteria 2483
266 Ga0157379_10192263 3300014968 Bacteria 1844
267 Ga0157379_10255394 3300014968 Bacteria 1592
268 Ga0157379_10609805 3300014968 Bacteria 1019
269 Ga0157376_10086282 3300014969 Bacteria 2706
270 Ga0157376_10179560 3300014969 Bacteria 1934
271 Ga0157376_10321788 3300014969 Bacteria 1471
272 Ga0157376_10537824 3300014969 Bacteria 1154
273 Ga0163161_10171094 3300017792 Bacteria 1661
274 Ga0163161_10299170 3300017792 Bacteria 1267
275 Ga0163161_10338303 3300017792 Bacteria 1193
276 Ga0197907_11157109 3300020069 Bacteria 1476
277 Ga0206355_1507511 3300020076 Bacteria 1302
278 Ga0206350_10389318 3300020080 Bacteria 991
279 Ga0206353_10556866 3300020082 Bacteria 959
280 Ga0214544_1000003 3300021320 Bacteria 643752
281 Ga0214542_1000003 3300021321 Bacteria 435700
282 Ga0214542_1021066 3300021321 Bacteria 4603
283 Ga0214545_1000004 3300021324 Bacteria 453352
284 Ga0214545_1021274 3300021324 Bacteria 4909
285 Ga0214543_1000007 3300021327 Bacteria 414744
286 Ga0213876_10002755 3300021384 Bacteria 10233
287 Ga0213876_10094238 3300021384 Bacteria 1586
288 Ga0213875_10130551 3300021388 Bacteria 1175
289 Ga0224712_10107802 3300022467 Bacteria 1191
290 Ga0209563_100438 3300025230 Bacteria 14431
291 Ga0209677_103197 3300025253 Bacteria 5489
292 Ga0209148_1000267 3300025254 Bacteria 81839
293 Ga0209233_1012874 3300025261 Bacteria 2408
294 Ga0209455_1001737 3300025272 Bacteria 9272
295 Ga0209673_1013733 3300025273 Bacteria 3180
296 Ga0209564_1010432 3300025295 Bacteria 4282
297 Ga0209758_1000030 3300025297 Bacteria 509217
298 Ga0209758_1000277 3300025297 Bacteria 102106
299 Ga0209758_1000711 3300025297 Bacteria 49164
300 Ga0209758_1000893 3300025297 Bacteria 40627
301 Ga0209758_1001645 3300025297 Bacteria 25366
302 Ga0209758_1002462 3300025297 Bacteria 18855
303 Ga0209758_1005049 3300025297 Bacteria 10483
304 Ga0209758_1050686 3300025297 Bacteria 1453
305 Ga0207426_1000271 3300025302 Bacteria 108392
306 Ga0207426_1001517 3300025302 Bacteria 18935
307 Ga0207426_1008000 3300025302 Bacteria 4342
308 Ga0209257_1000662 3300025304 Bacteria 54143
309 Ga0209257_1015967 3300025304 Bacteria 3073
310 Ga0207653_10004044 3300025885 Bacteria 4615
311 Ga0207692_10001302 3300025898 Bacteria 9295
312 Ga0207692_10075621 3300025898 Bacteria 1787
313 Ga0207692_10250024 3300025898 Bacteria 1062
314 Ga0207710_10028157 3300025900 Bacteria 2438
315 Ga0207688_10033353 3300025901 Bacteria 2847
316 Ga0207688_10069981 3300025901 Bacteria 1989
317 Ga0207680_10231384 3300025903 Bacteria 1270
318 Ga0207647_10008109 3300025904 Bacteria 7549
319 Ga0207647_10211960 3300025904 Bacteria 1118
320 Ga0207699_10023510 3300025906 Bacteria 3355
321 Ga0207699_10045183 3300025906 Bacteria 2569
322 Ga0207645_10084865 3300025907 Bacteria 2033
323 Ga0207684_10261744 3300025910 Bacteria 1492
324 Ga0207707_10000438 3300025912 Bacteria 43316
325 Ga0207707_10136890 3300025912 Bacteria 2141
326 Ga0207707_10669633 3300025912 Bacteria 873
327 Ga0207695_10000059 3300025913 Bacteria 363920
328 Ga0207695_10027002 3300025913 Bacteria 6397
329 Ga0207695_10043272 3300025913 Bacteria 4800
330 Ga0207695_10218834 3300025913 Bacteria 1812
331 Ga0207671_10001109 3300025914 Bacteria 32478
332 Ga0207671_10035801 3300025914 Bacteria 3681
333 Ga0207671_10069327 3300025914 Bacteria 2629
334 Ga0207671_10162971 3300025914 Bacteria 1727
335 Ga0207671_10173745 3300025914 Bacteria 1674
336 Ga0207693_10027888 3300025915 Bacteria 4463
337 Ga0207693_10104554 3300025915 Bacteria 2221
338 Ga0207693_10114267 3300025915 Bacteria 2118
339 Ga0207693_10235143 3300025915 Bacteria 1439
340 Ga0207693_10463230 3300025915 Bacteria 990
341 Ga0207663_10017392 3300025916 Bacteria 4006
342 Ga0207663_10030104 3300025916 Bacteria 3197
343 Ga0207663_10095514 3300025916 Bacteria 1983
344 Ga0207660_10017792 3300025917 Bacteria 4730
345 Ga0207660_10087395 3300025917 Bacteria 2303
346 Ga0207660_10183018 3300025917 Bacteria 1628
347 Ga0207660_10219447 3300025917 Bacteria 1492
348 Ga0207660_10619273 3300025917 Bacteria 882
349 Ga0207657_10275808 3300025919 Bacteria 1336
350 Ga0207657_10506158 3300025919 Bacteria 946
351 Ga0207652_10047083 3300025921 Bacteria 3683
352 Ga0207652_10518673 3300025921 Bacteria 1072
353 Ga0207694_10173320 3300025924 Bacteria 1747
354 Ga0207694_10356417 3300025924 Bacteria 1211
355 Ga0207650_10158200 3300025925 Bacteria 1793
356 Ga0207659_10263324 3300025926 Bacteria 1403
357 Ga0207700_10067007 3300025928 Bacteria 2746
358 Ga0207700_10234026 3300025928 Bacteria 1563
359 Ga0207700_10634800 3300025928 Bacteria 952
360 Ga0207664_10021535 3300025929 Bacteria 4797
361 Ga0207644_10018254 3300025931 Bacteria 4744
362 Ga0207644_10334329 3300025931 Bacteria 1227
363 Ga0207644_10743095 3300025931 Bacteria 819
364 Ga0207706_10059147 3300025933 Bacteria 3375
365 Ga0207706_10134929 3300025933 Bacteria 2171
366 Ga0207706_10499489 3300025933 Bacteria 1050
367 Ga0207686_10200241 3300025934 Bacteria 1430
368 Ga0207686_10225341 3300025934 Bacteria 1356
369 Ga0207670_10389508 3300025936 Bacteria 1112
370 Ga0207669_10478717 3300025937 Bacteria 992
371 Ga0207669_10624750 3300025937 Bacteria 878
372 Ga0207704_10265709 3300025938 Bacteria 1296
373 Ga0207665_10014858 3300025939 Bacteria 5119
374 Ga0207665_10061914 3300025939 Bacteria 2538
375 Ga0207665_10380452 3300025939 Bacteria 1071
376 Ga0207691_10197132 3300025940 Bacteria 1754
377 Ga0207711_10018230 3300025941 Bacteria 5835
378 Ga0207711_10276472 3300025941 Bacteria 1546
379 Ga0207711_10876686 3300025941 Bacteria 835
380 Ga0207689_10080482 3300025942 Bacteria 2678
381 Ga0207689_10208165 3300025942 Bacteria 1615
382 Ga0207661_10000959 3300025944 Bacteria 18985
383 Ga0207661_10412760 3300025944 Bacteria 1225
384 Ga0207679_10401124 3300025945 Bacteria 1206
385 Ga0207667_10044714 3300025949 Bacteria 4691
386 Ga0207667_10086148 3300025949 Bacteria 3251
387 Ga0207667_10101512 3300025949 Bacteria 2967
388 Ga0207667_10406284 3300025949 Bacteria 1386
389 Ga0207668_10060395 3300025972 Bacteria 2660
390 Ga0207668_10069357 3300025972 Bacteria 2510
391 Ga0207668_10095673 3300025972 Bacteria 2192
392 Ga0207668_10124091 3300025972 Bacteria 1960
393 Ga0207668_10425960 3300025972 Bacteria 1127
394 Ga0207658_10678577 3300025986 Bacteria 930
395 Ga0207677_10461146 3300026023 Bacteria 1091
396 Ga0207703_10050557 3300026035 Bacteria 3365
397 Ga0207703_10181953 3300026035 Bacteria 1855
398 Ga0207639_10023427 3300026041 Bacteria 4459
399 Ga0207639_10160589 3300026041 Bacteria 1893
400 Ga0207639_10163367 3300026041 Bacteria 1879
401 Ga0207639_10267758 3300026041 Bacteria 1497
402 Ga0207678_10021386 3300026067 Bacteria 5673
403 Ga0207678_10023768 3300026067 Bacteria 5359
404 Ga0207678_10025320 3300026067 Bacteria 5180
405 Ga0207678_10040824 3300026067 Bacteria 4022
406 Ga0207678_10052328 3300026067 Bacteria 3523
407 Ga0207678_10064507 3300026067 Bacteria 3147
408 Ga0207678_10698805 3300026067 Bacteria 892
409 Ga0207708_10433723 3300026075 Bacteria 1092
410 Ga0207708_10513717 3300026075 Bacteria 1006
411 Ga0207702_10106927 3300026078 Bacteria 2480
412 Ga0207702_10186192 3300026078 Bacteria 1915
413 Ga0207702_10380959 3300026078 Bacteria 1356
414 Ga0207702_10436225 3300026078 Bacteria 1269
415 Ga0207648_10042881 3300026089 Bacteria 3973
416 Ga0207648_10704914 3300026089 Bacteria 935
417 Ga0207676_10128955 3300026095 Bacteria 2147
418 Ga0207676_10163439 3300026095 Bacteria 1932
419 Ga0207676_10614381 3300026095 Bacteria 1046
420 Ga0207674_10055839 3300026116 Bacteria 4013
421 Ga0207674_10057340 3300026116 Bacteria 3948
422 Ga0207674_10084699 3300026116 Bacteria 3167
423 Ga0207674_10310289 3300026116 Bacteria 1527
424 Ga0207675_100031542 3300026118 Bacteria 4936
425 Ga0207675_100279247 3300026118 Bacteria 1623
426 Ga0207675_100354860 3300026118 Bacteria 1438
427 Ga0207683_10008695 3300026121 Bacteria 8677
428 Ga0207683_10032517 3300026121 Bacteria 4531
429 Ga0207683_10135169 3300026121 Bacteria 2219
430 Ga0207683_10450052 3300026121 Bacteria 1187
431 Ga0207683_10470438 3300026121 Bacteria 1159
432 Ga0207698_10013446 3300026142 Bacteria 5400
433 Ga0207698_10166178 3300026142 Bacteria 1937
434 Ga0207698_10371088 3300026142 Bacteria 1358
435 Ga0207698_11005794 3300026142 Bacteria 844
436 Ga0207698_11336862 3300026142 Bacteria 731
437 Ga0209389_1000055 3300027296 Bacteria 108798
438 Ga0209389_1000494 3300027296 Bacteria 23661
439 Ga0209589_1000005 3300027357 Bacteria 530958
440 Ga0209589_1000024 3300027357 Bacteria 169886
441 Ga0209489_100005 3300027361 Bacteria 530958
442 Ga0209489_100123 3300027361 Bacteria 113105
443 Ga0209489_103769 3300027361 Bacteria 28981
444 Ga0209700_100006 3300027363 Bacteria 530958
445 Ga0209700_100420 3300027363 Bacteria 77617
446 Ga0209588_1014950 3300027671 Bacteria 2383
447 Ga0209588_1031471 3300027671 Bacteria 1698
448 Ga0209813_10024296 3300027866 Bacteria 1732
449 Ga0268266_10000638 3300028379 Bacteria 47680
450 Ga0268266_10001364 3300028379 Bacteria 29475
451 Ga0268266_10030958 3300028379 Bacteria 4544
452 Ga0268266_10070131 3300028379 Bacteria 3037
453 Ga0268266_10085353 3300028379 Bacteria 2758
454 Ga0268266_10117632 3300028379 Bacteria 2362
455 Ga0268266_10366104 3300028379 Bacteria 1357
456 Ga0268266_10712521 3300028379 Bacteria 967
457 Ga0268266_10768309 3300028379 Bacteria 930
458 Ga0268266_10774729 3300028379 Bacteria 926
459 Ga0268266_10848742 3300028379 Bacteria 883
460 Ga0268265_10178216 3300028380 Bacteria 1824
461 Ga0268265_10396337 3300028380 Bacteria 1274
462 Ga0268265_10678065 3300028380 Bacteria 993
463 Ga0268265_10770230 3300028380 Bacteria 935
464 Ga0268264_10000051 3300028381 Bacteria 321565
465 Ga0268264_10295742 3300028381 Bacteria 1522
466 Ga0265337_1006988 3300028556 Bacteria 4274
467 Ga0265334_10005278 3300028573 Bacteria 5652
468 Ga0265318_10031122 3300028577 Bacteria 2071
469 Ga0265323_10000560 3300028653 Bacteria 20568
470 Ga0265336_10000550 3300028666 Bacteria 21394
471 Ga0307517_10000856 3300028786 Bacteria 51999
472 Ga0307515_10027090 3300028794 Bacteria 9818
473 Ga0265338_10000231 3300028800 Bacteria 103805
474 Ga0265324_10005806 3300029957 Bacteria 5250
475 Ga0265339_10034239 3300031249 Bacteria 2855
476 Ga0307513_10125136 3300031456 Bacteria 2528
477 Ga0307509_10085186 3300031507 Bacteria 3253
478 Ga0307508_10014562 3300031616 Bacteria 7175
479 Ga0307508_10567299 3300031616 Bacteria 734
480 Ga0265314_10069773 3300031711 Bacteria 2357
481 Ga0265342_10003396 3300031712 Bacteria 13107
482 Ga0307516_10011176 3300031730 Bacteria 9797
483 Ga0307405_10374919 3300031731 Bacteria 1106
484 Ga0307413_10103325 3300031824 Bacteria 1889
485 Ga0307409_100119908 3300031995 Bacteria 2225
486 Ga0307416_100286859 3300032002 Bacteria 1627
487 Ga0307415_100143022 3300032126 Bacteria 1830
488 Ga0307510_10004951 3300033180 Bacteria 15758
489 Ga0307510_10022034 3300033180 Bacteria 7406
490 Ga0307510_10121417 3300033180 Bacteria 2316
491 Ga0316215_1002564 3300033544 Bacteria 1719
492 Ga0373934_0076806 3300035086 Bacteria 1340
493 Ga0373949_0020331 3300035090 Bacteria 1518
494 Ga0373952_0006580 3300035092 Bacteria 2152
495 Ga0373945_0209184 3300035116 Bacteria 812
496 Ga0373954_0052727 3300035118 Bacteria 1911
497 Ga0373956_0087974 3300035119 Bacteria 1431
498 Ga0373960_0132987 3300035121 Bacteria 836
499 Ga0373943_0157391 3300035170 Bacteria 1235
500 Ga0373943_0234201 3300035170 Bacteria 1027
501 Ga0373955_0108257 3300035172 Bacteria 1604
502 Ga0373955_0122209 3300035172 Bacteria 1514
503 Ga0373924_0027656 3300035410 Bacteria 2256
504 Ga0373931_0008723 3300035691 Bacteria 4824
505 Ga0373935_0557741 3300035692 Bacteria 835
506 Ga0373927_0012565 3300035695 Bacteria 5638
507 Ga0373927_0263187 3300035695 Bacteria 1134
508 Ga0373927_0363133 3300035695 Bacteria 954
509 Ga0373933_0000018 3300035724 Bacteria 98044
510 Ga0373937_0069895 3300036401 Bacteria 3238
511 Ga0373937_0227646 3300036401 Bacteria 1755
512 Ga0372808_020869 3300036459 Bacteria 942
513 Ga0373925_0401179 3300037068 Bacteria 1118
514 Ga0373925_0639533 3300037068 Bacteria 876
515 Ga0395899_0050587 3300037312 Bacteria 3085
516 Ga0395899_0443317 3300037312 Bacteria 852
517 Ga0395900_0001051 3300037418 Bacteria 35383
518 Ga0395900_0169700 3300037418 Bacteria 2222
519 Ga0395900_0265761 3300037418 Bacteria 1711
520 Ga0395900_0399957 3300037418 Bacteria 1338
521 Ga0395898_0001503 3300037466 Bacteria 32214
522 Ga0395898_0004875 3300037466 Bacteria 14570
523 Ga0395898_0532852 3300037466 Bacteria 1116
524 Ga0395905_0064717 3300037471 Bacteria 3422
525 Ga0395905_0109320 3300037471 Bacteria 2596
526 Ga0395905_0134424 3300037471 Bacteria 2326
527 Ga0436364_0238267 3300037853 Bacteria 846
528 Ga0436364_0310036 3300037853 Bacteria 2843
529 Ga0395901_0051645 3300038443 Bacteria 4275
530 Ga0395901_0061578 3300038443 Bacteria 3905
531 Ga0395901_0092858 3300038443 Bacteria 3159
532 Ga0395901_0371972 3300038443 Bacteria 1472
533 Ga0436365_0093274 3300039437 Bacteria 81442
534 Ga0436365_0372041 3300039437 Bacteria 3768
535 Ga0436365_1021233 3300039437 Bacteria 861
536 Ga0436363_0554977 3300039450 Bacteria 1279
537 Ga0436363_1689393 3300039450 Bacteria 959
538 Ga0436362_0626323 3300039453 Bacteria 7982
539 Ga0451789_0919161 3300041443 Bacteria 1052
540 Ga0451833_0031051 3300041491 Bacteria 1104
541 Ga0466969_0026762 3300044656 Bacteria 2957
542 Ga0466972_0000124 3300044658 Bacteria 65163
543 Ga0466972_0002537 3300044658 Bacteria 9032
544 Ga0466965_0026765 3300044683 Bacteria 2796
545 Ga0466965_0318596 3300044683 Bacteria 847
546 Ga0466966_0000411 3300044684 Bacteria 27522
547 Ga0466961_0000065 3300044693 Bacteria 63259
548 Ga0466961_0254334 3300044693 Bacteria 1078
549 Ga0466963_0027444 3300044694 Bacteria 3646
550 Ga0466968_0006334 3300044735 Bacteria 4457
551 Ga0466968_0215322 3300044735 Bacteria 903
552 Ga0466970_0089040 3300044765 Bacteria 1674
553 Ga0466970_0143814 3300044765 Bacteria 1315
554 Ga0466960_0001481 3300044901 Bacteria 8559
555 Ga0466960_0139165 3300044901 Bacteria 1288
556 Ga0466960_0220761 3300044901 Bacteria 1043
557 Ga0466959_0000634 3300045049 Bacteria 20407
558 Ga0466959_0275904 3300045049 Bacteria 1155
559 Ga0466958_0031405 3300045836 Bacteria 3157
560 Ga0495603_0082839 3300046455 Bacteria 1879
561 Ga0495603_0132329 3300046455 Bacteria 1452
562 Ga0495603_0300832 3300046455 Bacteria 921
563 Ga0495629_0003519 3300046459 Bacteria 11838
564 Ga0495629_0206705 3300046459 Bacteria 1357
565 Ga0495638_0011267 3300046460 Bacteria 6167
566 Ga0495638_0085181 3300046460 Bacteria 1912
567 Ga0495641_0062004 3300046461 Bacteria 1687
568 Ga0495651_0017692 3300046462 Bacteria 5518
569 Ga0495651_0424287 3300046462 Bacteria 864
570 Ga0495580_0092623 3300046472 Bacteria 2104
571 Ga0495639_0056409 3300046475 Bacteria 1793
572 Ga0495639_0061813 3300046475 Bacteria 1718
573 Ga0495664_0011915 3300046477 Bacteria 4914
574 Ga0495584_0131529 3300046491 Bacteria 1270
575 Ga0495585_0283872 3300046492 Bacteria 818
576 Ga0495594_0065555 3300046499 Bacteria 2014
577 Ga0495596_0092262 3300046500 Bacteria 1176
578 Ga0495583_0044422 3300046506 Bacteria 2062
579 Ga0495606_0065243 3300046507 Bacteria 2314
580 Ga0495606_0160809 3300046507 Bacteria 1310
581 Ga0495610_0078267 3300046512 Bacteria 1525
582 Ga0495616_0057328 3300046513 Bacteria 1921
583 Ga0495616_0084560 3300046513 Bacteria 1512
584 Ga0495616_0253094 3300046513 Bacteria 756
585 Ga0495618_0141248 3300046514 Bacteria 1540
586 Ga0495620_0020979 3300046515 Bacteria 3180
587 Ga0495643_0045119 3300046522 Bacteria 2393
588 Ga0495648_0008955 3300046524 Bacteria 7820
589 Ga0495648_0218345 3300046524 Bacteria 942
590 Ga0495666_0133388 3300046526 Bacteria 1160
591 Ga0495652_0089784 3300046529 Bacteria 2515
592 Ga0495652_0122342 3300046529 Bacteria 2073
593 Ga0495652_0391588 3300046529 Bacteria 986
594 Ga0495652_0457905 3300046529 Bacteria 892
595 Ga0495654_0129733 3300046530 Bacteria 1133
596 Ga0495640_0027614 3300046533 Bacteria 4091
597 Ga0495640_0081673 3300046533 Bacteria 2148
598 Ga0495640_0087035 3300046533 Bacteria 2067
599 Ga0495586_0158427 3300046535 Bacteria 1276
600 Ga0495587_0269474 3300046536 Bacteria 955
601 Ga0495609_0090829 3300046538 Bacteria 1328
602 Ga0495645_0017494 3300046543 Bacteria 5135
603 Ga0495645_0163321 3300046543 Bacteria 1538
604 Ga0495622_0014799 3300046557 Bacteria 3626
605 Ga0495622_0265165 3300046557 Bacteria 753
606 Ga0495667_0044811 3300046559 Bacteria 2929
607 Ga0495668_0084179 3300046616 Bacteria 1744
608 Ga0495668_0379536 3300046616 Bacteria 776
609 Ga0495634_0056964 3300046642 Bacteria 2610
610 Ga0495611_0244628 3300046648 Bacteria 832
611 Ga0495625_0225233 3300046660 Bacteria 1227
612 Ga0495635_0158351 3300046663 Bacteria 1541
613 Ga0495635_0366258 3300046663 Bacteria 960
614 Ga0495588_0001353 3300046674 Bacteria 10458
615 Ga0495657_0002384 3300046675 Bacteria 15809
616 Ga0495657_0014532 3300046675 Bacteria 5776
617 Ga0495599_0004607 3300046678 Bacteria 8178
618 Ga0495599_0065022 3300046678 Bacteria 2279
619 Ga0495599_0067383 3300046678 Bacteria 2236
620 Ga0495623_0010248 3300046679 Bacteria 6064
621 Ga0495623_0320794 3300046679 Bacteria 851
622 Ga0495646_0113582 3300046680 Bacteria 1540
623 Ga0495646_0120906 3300046680 Bacteria 1482
624 Ga0495613_0062464 3300046689 Bacteria 2726
625 Ga0495613_0274008 3300046689 Bacteria 1173
626 Ga0495613_0756129 3300046689 Bacteria 637
627 Ga0495624_0067145 3300046690 Bacteria 2238
628 Ga0495624_0110799 3300046690 Bacteria 1688
629 Ga0495670_0115431 3300046691 Bacteria 1392
630 Ga0495671_0043951 3300046692 Bacteria 2241
631 Ga0495671_0072278 3300046692 Bacteria 1694
632 Ga0495671_0286670 3300046692 Bacteria 793
633 Ga0495649_0024307 3300046694 Bacteria 3379
634 Ga0495600_0210544 3300046809 Bacteria 1246
635 Ga0495660_0076880 3300046810 Bacteria 1758
636 Ga0495581_0014180 3300047315 Bacteria 4620
637 Ga0495581_0041048 3300047315 Bacteria 2677
638 Ga0495604_0002741 3300047317 Bacteria 14128
639 Ga0495604_0006835 3300047317 Bacteria 9039
640 Ga0495674_0018428 3300047319 Bacteria 6499
641 Ga0495672_0017605 3300047320 Bacteria 4776
642 Ga0495672_0050250 3300047320 Bacteria 2463
643 Ga0495676_0055266 3300047321 Bacteria 3149
644 Ga0495676_0102528 3300047321 Bacteria 2114
645 Ga0495676_0374195 3300047321 Bacteria 949
646 Ga0495680_0001876 3300047322 Bacteria 22116
647 Ga0495680_0085161 3300047322 Bacteria 2380
648 Ga0495687_016979 3300047443 Bacteria 3645
649 Ga0495675_0007387 3300047444 Bacteria 6766
650 Ga0495685_082541 3300047447 Bacteria 1070
651 Ga0495673_0060041 3300047469 Bacteria 1632
652 Ga0495673_0061680 3300047469 Bacteria 1604
653 Ga0495673_0108676 3300047469 Bacteria 1112
654 Ga0495684_0012933 3300047471 Bacteria 6442
655 Ga0495684_0436988 3300047471 Bacteria 912
656 Ga0495686_0114233 3300047472 Bacteria 1616
657 Ga0495686_0147890 3300047472 Bacteria 1381
658 Ga0495686_0179200 3300047472 Bacteria 1229
659 Ga0495593_0079436 3300047673 Bacteria 1698
660 Ga0495602_0134279 3300048088 Bacteria 1968
661 Ga0495602_0543596 3300048088 Bacteria 806
662 Ga0496101_0055034 3300048904 Bacteria 2873
663 Ga0496101_0149898 3300048904 Bacteria 1783
664 Ga0496101_0559044 3300048904 Bacteria 905
665 Ga0496102_0107971 3300048905 Bacteria 2592
666 Ga0496102_0125274 3300048905 Bacteria 2401
667 Ga0496102_0134420 3300048905 Bacteria 2317
668 Ga0496102_0252451 3300048905 Bacteria 1663
669 Ga0496103_0080553 3300048906 Bacteria 2047
670 Ga0496103_0338198 3300048906 Bacteria 968
671 Ga0496103_0629569 3300048906 Bacteria 682
672 Ga0496104_0009070 3300048907 Bacteria 8843
673 Ga0496104_0024225 3300048907 Bacteria 5582
674 Ga0496104_0037936 3300048907 Bacteria 4506
675 Ga0496104_0068302 3300048907 Bacteria 3377
676 Ga0496104_0103508 3300048907 Bacteria 2727
677 Ga0496104_0375050 3300048907 Bacteria 1335
678 Ga0496105_0022832 3300048908 Bacteria 5070
679 Ga0496105_0039456 3300048908 Bacteria 3892
680 Ga0496105_0099088 3300048908 Bacteria 2407
681 Ga0496105_0589435 3300048908 Bacteria 864
682 Ga0496106_0026873 3300048909 Bacteria 4286
683 Ga0496106_0038587 3300048909 Bacteria 3575
684 Ga0496106_0264939 3300048909 Bacteria 1375
685 Ga0496106_0271437 3300048909 Bacteria 1358
686 Ga0496106_0285674 3300048909 Bacteria 1322
687 Ga0496107_0011974 3300048910 Bacteria 6054
688 Ga0496107_0164616 3300048910 Bacteria 1644
689 Ga0496107_0237925 3300048910 Bacteria 1355
690 Ga0496107_0709954 3300048910 Bacteria 739
691 Ga0496108_0012004 3300048911 Bacteria 7048
692 Ga0496108_0013488 3300048911 Bacteria 6669
693 Ga0496108_0080117 3300048911 Bacteria 2766
694 Ga0496108_0243202 3300048911 Bacteria 1565
695 Ga0496108_0467421 3300048911 Bacteria 1102
696 Ga0496109_0023442 3300048912 Bacteria 5480
697 Ga0496109_0222517 3300048912 Bacteria 1775
698 Ga0496109_0275200 3300048912 Bacteria 1586
699 Ga0496109_0296979 3300048912 Bacteria 1523
700 Ga0496109_0721487 3300048912 Bacteria 934
701 Ga0496109_0893173 3300048912 Bacteria 826
702 Ga0496110_0015719 3300048913 Bacteria 6306
703 Ga0496110_0015752 3300048913 Bacteria 6301
704 Ga0496110_0980438 3300048913 Bacteria 752
705 Ga0496111_0056301 3300048914 Bacteria 2845
706 Ga0496111_0152814 3300048914 Bacteria 1712
707 Ga0496111_0583484 3300048914 Bacteria 819
708 Ga0496112_0045698 3300048915 Bacteria 4293
709 Ga0496112_0053279 3300048915 Bacteria 3973
710 Ga0496112_0242029 3300048915 Bacteria 1756
711 Ga0496112_0704478 3300048915 Bacteria 937
712 Ga0496112_0938372 3300048915 Bacteria 786
713 Ga0496113_0004044 3300048916 Bacteria 8931
714 Ga0496113_0055910 3300048916 Bacteria 2960
715 Ga0496113_0297442 3300048916 Bacteria 1292
716 Ga0496113_0534347 3300048916 Bacteria 941
717 Ga0496114_0014145 3300048917 Bacteria 6399
718 Ga0496114_0121968 3300048917 Bacteria 2242
719 Ga0496115_0005405 3300048918 Bacteria 9289
720 Ga0496115_0032960 3300048918 Bacteria 4089
721 Ga0496115_0069485 3300048918 Bacteria 2853
722 Ga0496116_0028887 3300048919 Bacteria 4009
723 Ga0496116_0032538 3300048919 Bacteria 3715
724 Ga0496116_0242663 3300048919 Bacteria 904
725 Ga0496117_0061833 3300048920 Bacteria 2571
726 Ga0496117_0071741 3300048920 Bacteria 2319
727 Ga0496117_0301026 3300048920 Bacteria 849
728 Ga0496118_0002445 3300048921 Bacteria 25000
729 Ga0496119_0015983 3300048922 Bacteria 5739
730 Ga0496119_0069417 3300048922 Bacteria 2071
731 Ga0496119_0215489 3300048922 Bacteria 985
732 Ga0496120_0035858 3300048923 Bacteria 2958
733 Ga0496121_0000452 3300048924 Bacteria 80796
734 Ga0496121_0000571 3300048924 Bacteria 69504
735 Ga0496121_0024152 3300048924 Bacteria 5823
736 Ga0496121_0043447 3300048924 Bacteria 3891
737 Ga0496121_0050510 3300048924 Bacteria 3512
738 Ga0496121_0051348 3300048924 Bacteria 3473
739 Ga0496121_0071559 3300048924 Bacteria 2788
740 Ga0496121_0114848 3300048924 Bacteria 2045
741 Ga0496121_0322890 3300048924 Bacteria 1039
742 Ga0496122_0205725 3300048925 Bacteria 1146
743 Ga0496124_0000267 3300048927 Bacteria 101138
744 Ga0496124_0026050 3300048927 Bacteria 5280
745 Ga0496124_0053485 3300048927 Bacteria 3422
746 Ga0496125_0043745 3300048928 Bacteria 3796
747 Ga0496125_0059362 3300048928 Bacteria 3083
748 Ga0496125_0069134 3300048928 Bacteria 2773
749 Ga0496126_0015704 3300048929 Bacteria 7609
750 Ga0496126_0035587 3300048929 Bacteria 4665
751 Ga0496126_0052619 3300048929 Bacteria 3699
752 Ga0496126_0059836 3300048929 Bacteria 3429
753 Ga0496126_0071503 3300048929 Bacteria 3088
754 Ga0496126_0355971 3300048929 Bacteria 1196
755 Ga0496126_0366683 3300048929 Bacteria 1175
756 Ga0496126_0580061 3300048929 Bacteria 886
757 Ga0496126_0676636 3300048929 Bacteria 804
758 Ga0495682_0014877 3300049460 Bacteria 2948
759 Ga0495682_0139946 3300049460 Bacteria 864
760 Ga0501069_0480989 3300049585 Bacteria 740
761 Ga0501071_0175538 3300049587 Bacteria 1605
762 Ga0501076_0123356 3300049592 Bacteria 2098
763 Ga0501080_0060360 3300049742 Bacteria 3530
764 Ga0501035_0618962 3300049822 Bacteria 881
765 nmdc:mga03683_133639_c1 3300050489 Bacteria 1111
766 nmdc:mga03683_184261_c1 3300050489 Bacteria 953
767 nmdc:mga03n38_155829_c1 3300050490 Bacteria 1153
768 nmdc:mga03n38_208_c1 3300050490 Bacteria 12446
769 nmdc:mga03n38_58574_c1 3300050490 Bacteria 1746
770 nmdc:mga00v17_145883_c1 3300050491 Bacteria 1519
771 nmdc:mga00v17_439992_c1 3300050491 Bacteria 847
772 nmdc:mga00v17_55068_c1 3300050491 Bacteria 2428
773 nmdc:mga0yw44_14616_c1 3300050492 Bacteria 4175
774 nmdc:mga0yw44_223543_c1 3300050492 Bacteria 1248
775 nmdc:mga0yw44_557513_c1 3300050492 Bacteria 778
776 nmdc:mga0yw44_66485_c1 3300050492 Bacteria 2225
777 nmdc:mga0k408_122214_c1 3300050493 Bacteria 1543
778 nmdc:mga0k408_211493_c1 3300050493 Bacteria 1158
779 nmdc:mga0k408_4612_c1 3300050493 Bacteria 5915
780 nmdc:mga06z11_118063_c1 3300050494 Bacteria 1477
781 nmdc:mga06z11_199908_c1 3300050494 Bacteria 1160
782 nmdc:mga06z11_57073_c1 3300050494 Bacteria 2021
783 nmdc:mga06z11_73502_c1 3300050494 Bacteria 1816
784 nmdc:mga04h51_17986_c1 3300050495 Bacteria 2075
785 nmdc:mga04h51_53954_c1 3300050495 Bacteria 1357
786 nmdc:mga07m45_14648_c1 3300050496 Bacteria 4182
787 nmdc:mga07m45_182616_c1 3300050496 Bacteria 1220
788 nmdc:mga07m45_488800_c1 3300050496 Bacteria 713
789 nmdc:mga07m45_74631_c1 3300050496 Bacteria 1932
790 nmdc:mga08y16_211641_c1 3300050511 Bacteria 2008
791 nmdc:mga08y16_527905_c1 3300050511 Bacteria 1196
792 nmdc:mga0n895_1120456_c1 3300050512 Bacteria 764
793 nmdc:mga0n895_21774_c1 3300050512 Bacteria 6000
794 nmdc:mga0rr50_171235_c1 3300050513 Bacteria 1769
795 nmdc:mga08x19_97007_c1 3300050514 Bacteria 1951
796 nmdc:mga0a205_133434_c1 3300050515 Bacteria 2383
797 nmdc:mga0sz30_23037_c2 3300050516 Bacteria 1851
798 nmdc:mga0sz30_55224_c1 3300050516 Bacteria 1690
799 Ga0495612_0053958 3300053078 Bacteria 1655
800 Ga0500610_0158106 3300053079 Bacteria 1130
801 Ga0500635_0006464 3300053080 Bacteria 3131
802 Ga0500635_0062937 3300053080 Bacteria 1299
803 Ga0495655_0014011 3300053083 Bacteria 1672
804 Ga0495619_0007832 3300053085 Bacteria 6762
805 Ga0495619_0514646 3300053085 Bacteria 822
806 Ga0500578_0120031 3300053086 Bacteria 1653
807 Ga0500578_0297900 3300053086 Bacteria 957
808 Ga0500643_000028 3300053087 Bacteria 245672
809 Ga0500644_0052058 3300053088 Bacteria 1408
810 Ga0500646_0064528 3300053090 Bacteria 1085
811 Ga0500647_0018007 3300053091 Bacteria 3267
812 Ga0500583_0022614 3300053092 Bacteria 2636
813 Ga0500651_0038098 3300053093 Bacteria 3029
814 Ga0500566_0000245 3300053094 Bacteria 28976
815 Ga0500566_0002949 3300053094 Bacteria 10161
816 Ga0500566_0069046 3300053094 Bacteria 1986
817 Ga0500641_0027837 3300053096 Bacteria 2203
818 Ga0500641_0065899 3300053096 Bacteria 1516
819 Ga0500650_0092938 3300053098 Bacteria 1412
820 Ga0500650_0114678 3300053098 Bacteria 1257
821 Ga0500555_002075 3300053103 Bacteria 5892
822 Ga0500556_0017153 3300053104 Bacteria 2264
823 Ga0500557_000116 3300053105 Bacteria 22549
824 Ga0500562_044412 3300053108 Bacteria 1183
825 Ga0500569_002793 3300053109 Bacteria 3483
826 Ga0500572_004309 3300053111 Bacteria 3231
827 Ga0500595_000580 3300053119 Bacteria 21802
828 Ga0500595_004072 3300053119 Bacteria 6645
829 Ga0500595_035681 3300053119 Bacteria 1635
830 Ga0500595_058462 3300053119 Bacteria 1172
831 Ga0500607_228960 3300053121 Bacteria 764
832 Ga0500642_0000113 3300053130 Bacteria 37567
833 Ga0500642_0001807 3300053130 Bacteria 6174
834 Ga0500642_0233797 3300053130 Bacteria 848
835 Ga0500655_017624 3300053133 Bacteria 1322
836 Ga0500655_017634 3300053133 Bacteria 1322
837 Ga0500559_0000103 3300053136 Bacteria 66422
838 Ga0500559_0016441 3300053136 Bacteria 3124
839 Ga0500559_0115729 3300053136 Bacteria 1244
840 Ga0500564_180237 3300053138 Bacteria 881
841 Ga0500568_0005758 3300053139 Bacteria 6344
842 Ga0500568_0043749 3300053139 Bacteria 1789
843 Ga0500577_0040536 3300053142 Bacteria 1694
844 Ga0500577_0103682 3300053142 Bacteria 1166
845 Ga0500577_0228024 3300053142 Bacteria 807
846 Ga0500579_184734 3300053143 Bacteria 811
847 Ga0500590_080114 3300053148 Bacteria 1606
848 Ga0500590_083689 3300053148 Bacteria 1563
849 Ga0500603_016640 3300053150 Bacteria 1748
850 Ga0500604_0006950 3300053151 Bacteria 2996
851 Ga0500616_0000046 3300053153 Bacteria 333409
852 Ga0500620_026632 3300053155 Bacteria 1792
853 Ga0500622_0188348 3300053156 Bacteria 947
854 Ga0500633_0131813 3300053160 Bacteria 933
855 Ga0500634_0053113 3300053161 Bacteria 2175
856 Ga0500638_016392 3300053162 Bacteria 3418
857 Ga0500638_042327 3300053162 Bacteria 2212
858 Ga0500638_094379 3300053162 Bacteria 1404
859 Ga0500636_0000054 3300053177 Bacteria 54446
860 Ga0500636_0108981 3300053177 Bacteria 1567
861 Ga0500637_0000303 3300053178 Bacteria 18607
862 Ga0500637_0027373 3300053178 Bacteria 3147
863 Ga0500637_0273034 3300053178 Bacteria 934
864 Ga0500611_005942 3300053727 Bacteria 1749
865 Ga0500625_017426 3300053729 Bacteria 3355
866 Ga0500645_005369 3300053730 Bacteria 4733
867 Ga0500645_048584 3300053730 Bacteria 1242
868 Ga0500552_020370 3300053733 Bacteria 938
869 Ga0500596_005620 3300053735 Bacteria 2185
870 Ga0500596_006582 3300053735 Bacteria 1955
871 Ga0500599_002194 3300053736 Bacteria 2321
872 Ga0500601_000834 3300053737 Bacteria 3791
873 Ga0500661_001086 3300055283 Bacteria 5115
874 Ga0501082_0090266 3300060353 Bacteria 2646
875 Ga0530510_0254120 3300061734 Bacteria 1310

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0000046 Ga0500616_0000046_251326_251988 182
2 3300005937 Ga0081455_10006663 Ga0081455_1000666313 184
3 iso_pu_bacteria 2513237139 2513874131 188
4 iso_pu_bacteria 2824732956 2824736433 188
5 iso_pu_bacteria 2824746037 2824751039 188
6 iso_pu_bacteria 2908775508 2908776828 188
7 3300046680 Ga0495646_0113582 Ga0495646_0113582_20_592 189
8 3300047471 Ga0495684_0436988 Ga0495684_0436988_33_605 189
9 3300048914 Ga0496111_0583484 Ga0496111_0583484_23_604 190
10 3300006353 Ga0075370_10116584 Ga0075370_101165843 198
11 3300007788 Ga0099795_10161517 Ga0099795_101615171 198
12 3300037471 Ga0395905_0134424 Ga0395905_0134424_1395_2027 198
13 3300038443 Ga0395901_0371972 Ga0395901_0371972_701_1333 198
14 3300048904 Ga0496101_0559044 Ga0496101_0559044_159_767 198
15 3300050493 nmdc:mga0k408_211493_c1 nmdc:mga0k408_211493_c1_394_1053 198
16 3300003354 JGI25160J50197_1001680 JGI25160J50197_100168010 199
17 3300003354 JGI25160J50197_1005384 JGI25160J50197_10053845 199
18 3300025302 Ga0207426_1000271 Ga0207426_100027171 199
19 3300053094 Ga0500566_0002949 Ga0500566_0002949_8346_8957 199
20 3300053119 Ga0500595_000580 Ga0500595_000580_10570_11181 199
21 3300053148 Ga0500590_083689 Ga0500590_083689_235_843 199
22 3300053150 Ga0500603_016640 Ga0500603_016640_583_1194 199
23 3300053162 Ga0500638_016392 Ga0500638_016392_2264_2875 199
24 3300053178 Ga0500637_0000303 Ga0500637_0000303_10555_11166 199
25 3300055283 Ga0500661_001086 Ga0500661_001086_1457_2068 199
26 3300005577 Ga0068857_100125486 Ga0068857_1001254863 200
27 3300025914 Ga0207671_10173745 Ga0207671_101737453 200
28 3300025924 Ga0207694_10173320 Ga0207694_101733203 200
29 3300026116 Ga0207674_10055839 Ga0207674_100558393 200
30 3300026142 Ga0207698_11005794 Ga0207698_110057941 200
31 3300048919 Ga0496116_0242663 Ga0496116_0242663_245_865 200
32 3300048924 Ga0496121_0114848 Ga0496121_0114848_85_756 200
33 3300049587 Ga0501071_0175538 Ga0501071_0175538_16_621 200
34 3300049592 Ga0501076_0123356 Ga0501076_0123356_25_630 200
35 3300050489 nmdc:mga03683_133639_c1 nmdc:mga03683_133639_c1_128_748 200
36 3300050494 nmdc:mga06z11_199908_c1 nmdc:mga06z11_199908_c1_336_956 200
37 3300050495 nmdc:mga04h51_53954_c1 nmdc:mga04h51_53954_c1_510_1130 200
38 3300050496 nmdc:mga07m45_488800_c1 nmdc:mga07m45_488800_c1_43_663 200
39 3300026142 Ga0207698_11336862 Ga0207698_113368621 201
40 3300046689 Ga0495613_0756129 Ga0495613_0756129_13_627 201
41 3300046692 Ga0495671_0043951 Ga0495671_0043951_1287_1895 201
42 3300050511 nmdc:mga08y16_211641_c1 nmdc:mga08y16_211641_c1_1364_1972 201
43 3300053088 Ga0500644_0052058 Ga0500644_0052058_664_1272 201
44 3300053098 Ga0500650_0114678 Ga0500650_0114678_214_822 201
45 3300053130 Ga0500642_0233797 Ga0500642_0233797_10_618 201
46 3300053133 Ga0500655_017624 Ga0500655_017624_687_1295 201
47 3300053160 Ga0500633_0131813 Ga0500633_0131813_50_658 201
48 3300003215 JGI25153J46596_10004097 JGI25153J46596_100040977 202
49 3300025297 Ga0209758_1000277 Ga0209758_100027738 202
50 3300026095 Ga0207676_10614381 Ga0207676_106143812 202
51 3300031730 Ga0307516_10011176 Ga0307516_1001117610 202
52 3300033544 Ga0316215_1002564 Ga0316215_10025641 202
53 3300035692 Ga0373935_0557741 Ga0373935_0557741_213_824 202
54 3300036459 Ga0372808_020869 Ga0372808_020869_59_673 202
55 3300046616 Ga0495668_0379536 Ga0495668_0379536_15_626 202
56 iso_pu_bacteria 2841957949 2841963878 202
57 iso_pu_bacteria 2847930680 2847931928 202
58 iso_pu_bacteria 2874620515 2874621914 202
59 iso_pu_bacteria 2904666416 2904669493 202
60 3300046809 Ga0495600_0210544 Ga0495600_0210544_310_930 203
61 3300048929 Ga0496126_0052619 Ga0496126_0052619_390_1067 203
62 iso_pu_bacteria 2728368998 2728748321 204
63 3300025254 Ga0209148_1000267 Ga0209148_100026767 205
64 3300025261 Ga0209233_1012874 Ga0209233_10128744 205
65 3300025272 Ga0209455_1001737 Ga0209455_10017377 205
66 3300038443 Ga0395901_0061578 Ga0395901_0061578_2537_3202 205
67 3300037312 Ga0395899_0050587 Ga0395899_0050587_1698_2366 206
68 3300037418 Ga0395900_0001051 Ga0395900_0001051_382_1050 206
69 3300037466 Ga0395898_0001503 Ga0395898_0001503_2199_2867 206
70 3300037853 Ga0436364_0238267 Ga0436364_0238267_108_740 206
71 3300038443 Ga0395901_0092858 Ga0395901_0092858_793_1461 206
72 3300046477 Ga0495664_0011915 Ga0495664_0011915_1555_2187 206
73 3300046533 Ga0495640_0081673 Ga0495640_0081673_829_1461 206
74 3300046543 Ga0495645_0163321 Ga0495645_0163321_620_1252 206
75 3300046663 Ga0495635_0158351 Ga0495635_0158351_835_1467 206
76 3300046675 Ga0495657_0002384 Ga0495657_0002384_7252_7884 206
77 3300046678 Ga0495599_0004607 Ga0495599_0004607_3158_3790 206
78 3300046679 Ga0495623_0010248 Ga0495623_0010248_2975_3607 206
79 3300046680 Ga0495646_0120906 Ga0495646_0120906_607_1239 206
80 3300047317 Ga0495604_0002741 Ga0495604_0002741_11756_12388 206
81 3300047322 Ga0495680_0001876 Ga0495680_0001876_13555_14187 206
82 3300047444 Ga0495675_0007387 Ga0495675_0007387_879_1511 206
83 3300048088 Ga0495602_0134279 Ga0495602_0134279_207_839 206
84 3300048906 Ga0496103_0629569 Ga0496103_0629569_23_655 206
85 3300048928 Ga0496125_0059362 Ga0496125_0059362_269_901 206
86 3300050491 nmdc:mga00v17_55068_c1 nmdc:mga00v17_55068_c1_1607_2239 206
87 3300053177 Ga0500636_0108981 Ga0500636_0108981_95_727 206
88 3300010375 Ga0105239_10321091 Ga0105239_103210912 207
89 3300044694 Ga0466963_0027444 Ga0466963_0027444_128_763 207
90 3300046491 Ga0495584_0131529 Ga0495584_0131529_471_1106 207
91 3300046513 Ga0495616_0057328 Ga0495616_0057328_701_1336 207
92 3300047443 Ga0495687_016979 Ga0495687_016979_932_1567 207
93 3300048912 Ga0496109_0023442 Ga0496109_0023442_1508_2143 207
94 3300048915 Ga0496112_0938372 Ga0496112_0938372_63_698 207
95 3300048916 Ga0496113_0055910 Ga0496113_0055910_1056_1691 207
96 3300048922 Ga0496119_0069417 Ga0496119_0069417_772_1407 207
97 3300050490 nmdc:mga03n38_58574_c1 nmdc:mga03n38_58574_c1_306_941 207
98 3300050494 nmdc:mga06z11_73502_c1 nmdc:mga06z11_73502_c1_790_1425 207
99 3300053083 Ga0495655_0014011 Ga0495655_0014011_482_1117 207
100 3300005336 Ga0070680_100221827 Ga0070680_1002218272 208
101 3300005439 Ga0070711_100166520 Ga0070711_1001665201 208
102 3300005458 Ga0070681_10051933 Ga0070681_100519333 208
103 3300005530 Ga0070679_100137259 Ga0070679_1001372592 208
104 3300005563 Ga0068855_100217196 Ga0068855_1002171963 208
105 3300006173 Ga0070716_100585493 Ga0070716_1005854932 208
106 3300009545 Ga0105237_10080389 Ga0105237_100803892 208
107 3300009551 Ga0105238_10018488 Ga0105238_100184888 208
108 3300009551 Ga0105238_10422128 Ga0105238_104221281 208
109 3300010375 Ga0105239_10142048 Ga0105239_101420482 208
110 3300013296 Ga0157374_10191301 Ga0157374_101913012 208
111 3300021384 Ga0213876_10094238 Ga0213876_100942382 208
112 3300021388 Ga0213875_10130551 Ga0213875_101305511 208
113 3300025924 Ga0207694_10356417 Ga0207694_103564172 208
114 3300025949 Ga0207667_10086148 Ga0207667_100861484 208
115 3300026078 Ga0207702_10436225 Ga0207702_104362252 208
116 3300026116 Ga0207674_10310289 Ga0207674_103102892 208
117 3300028556 Ga0265337_1006988 Ga0265337_10069884 208
118 3300028573 Ga0265334_10005278 Ga0265334_100052782 208
119 3300028577 Ga0265318_10031122 Ga0265318_100311223 208
120 3300028653 Ga0265323_10000560 Ga0265323_1000056014 208
121 3300028666 Ga0265336_10000550 Ga0265336_1000055016 208
122 3300028800 Ga0265338_10000231 Ga0265338_1000023193 208
123 3300029957 Ga0265324_10005806 Ga0265324_100058063 208
124 3300037418 Ga0395900_0399957 Ga0395900_0399957_211_846 208
125 3300037853 Ga0436364_0310036 Ga0436364_0310036_2097_2732 208
126 3300039437 Ga0436365_0372041 Ga0436365_0372041_2276_2908 208
127 3300039450 Ga0436363_1689393 Ga0436363_1689393_65_697 208
128 iso_pu_bacteria 2906643746 2906645793 208
129 iso_pu_bacteria 3005483717 3005490881 208
130 iso_pu_bacteria 3005587118 3005593200 208
131 3300006051 Ga0075364_10039240 Ga0075364_100392402 209
132 3300006186 Ga0075369_10028877 Ga0075369_100288773 209
133 3300026067 Ga0207678_10040824 Ga0207678_100408244 209
134 3300035695 Ga0373927_0263187 Ga0373927_0263187_42_701 209
135 3300039437 Ga0436365_1021233 Ga0436365_1021233_163_798 209
136 iso_pu_bacteria 2513237104 2513716656 209
137 iso_pu_bacteria 2824704595 2824710856 209
138 iso_pu_bacteria 2824753945 2824761521 209
139 iso_pu_bacteria 2824763712 2824765064 209
140 iso_pu_bacteria 2879083081 2879091162 209
141 iso_pu_bacteria 2881364244 2881364580 209
142 iso_pu_bacteria 2904711408 2904716497 209
143 iso_pu_bacteria 2906626472 2906629677 209
144 iso_pu_bacteria 2941531003 2941532050 209
145 iso_pu_bacteria 8016583857 8016587521 209
146 3300009148 Ga0105243_10994056 Ga0105243_109940561 210
147 3300053093 Ga0500651_0038098 Ga0500651_0038098_2331_2978 210
148 3300053109 Ga0500569_002793 Ga0500569_002793_495_1142 210
149 3300053119 Ga0500595_035681 Ga0500595_035681_560_1207 210
150 3300053133 Ga0500655_017634 Ga0500655_017634_335_982 210
151 3300053142 Ga0500577_0228024 Ga0500577_0228024_60_707 210
152 iso_pu_bacteria 2508501009 2508545909 210
153 iso_pu_bacteria 2511231028 2511400264 210
154 iso_pu_bacteria 2513237092 2513624280 210
155 iso_pu_bacteria 2513237094 2513638767 210
156 iso_pu_bacteria 2513237102 2513701643 210
157 iso_pu_bacteria 2513237161 2514010104 210
158 iso_pu_bacteria 2517093001 2517103029 210
159 iso_pu_bacteria 2524023205 2524438868 210
160 iso_pu_bacteria 2528768022 2528849486 210
161 iso_pu_bacteria 2617270735 2617350256 210
162 iso_pu_bacteria 2744054633 2745080371 210
163 iso_pu_bacteria 2791355196 2793059257 210
164 iso_pu_bacteria 2802429603 2805920850 210
165 iso_pu_bacteria 2816332527 2818240632 210
166 iso_pu_bacteria 2824600985 2824607602 210
167 iso_pu_bacteria 2824609381 2824615346 210
168 iso_pu_bacteria 2824617872 2824618797 210
169 iso_pu_bacteria 2824626560 2824628903 210
170 iso_pu_bacteria 2824635225 2824638414 210
171 iso_pu_bacteria 2824644064 2824648046 210
172 iso_pu_bacteria 2824653114 2824657967 210
173 iso_pu_bacteria 2824661429 2824665883 210
174 iso_pu_bacteria 2824671348 2824675853 210
175 iso_pu_bacteria 2824679649 2824681638 210
176 iso_pu_bacteria 2824687955 2824692814 210
177 iso_pu_bacteria 2824696289 2824699391 210
178 iso_pu_bacteria 2824714736 2824722615 210
179 iso_pu_bacteria 2824723954 2824726005 210
180 iso_pu_bacteria 2824773399 2824778047 210
181 iso_pu_bacteria 2838122688 2838125984 210
182 iso_pu_bacteria 2841941048 2841942621 210
183 iso_pu_bacteria 2841949485 2841953027 210
184 iso_pu_bacteria 2841966195 2841970947 210
185 iso_pu_bacteria 2841974524 2841977795 210
186 iso_pu_bacteria 2841983080 2841984643 210
187 iso_pu_bacteria 2842038055 2842041636 210
188 iso_pu_bacteria 2842045827 2842049678 210
189 iso_pu_bacteria 2844315083 2844321468 210
190 iso_pu_bacteria 2847939898 2847943168 210
191 iso_pu_bacteria 2849076700 2849076908 210
192 iso_pu_bacteria 2857509624 2857514828 210
193 iso_pu_bacteria 2874590934 2874595375 210
194 iso_pu_bacteria 2874612657 2874620424 210
195 iso_pu_bacteria 2874628541 2874629592 210
196 iso_pu_bacteria 2874645413 2874651801 210
197 iso_pu_bacteria 2876771140 2876775569 210
198 iso_pu_bacteria 2876818435 2876823561 210
199 iso_pu_bacteria 2879074833 2879079660 210
200 iso_pu_bacteria 2879099564 2879104443 210
201 iso_pu_bacteria 2879127579 2879133936 210
202 iso_pu_bacteria 2879142872 2879145069 210
203 iso_pu_bacteria 2881665667 2881673323 210
204 iso_pu_bacteria 2885366525 2885374340 210
205 iso_pu_bacteria 2885409591 2885413720 210
206 iso_pu_bacteria 2888378607 2888387312 210
207 iso_pu_bacteria 2888388044 2888391395 210
208 iso_pu_bacteria 2888419890 2888426991 210
209 iso_pu_bacteria 2903727486 2903727953 210
210 iso_pu_bacteria 2906602504 2906602563 210
211 iso_pu_bacteria 2922368715 2922370260 210
212 iso_pu_bacteria 2922393267 2922400120 210
213 iso_pu_bacteria 2929615660 2929622687 210
214 iso_pu_bacteria 2929624759 2929632210 210
215 iso_pu_bacteria 2932784394 2932789975 210
216 iso_pu_bacteria 2932794094 2932800652 210
217 iso_pu_bacteria 2932801729 2932808383 210
218 iso_pu_bacteria 2932809354 2932815517 210
219 iso_pu_bacteria 2932818245 2932824907 210
220 iso_pu_bacteria 2932828146 2932829169 210
221 iso_pu_bacteria 2933577622 2933584682 210
222 iso_pu_bacteria 2935616580 2935617644 210
223 iso_pu_bacteria 2935638405 2935643689 210
224 iso_pu_bacteria 2935665750 2935671001 210
225 iso_pu_bacteria 2935675223 2935681644 210
226 iso_pu_bacteria 2935684952 2935692621 210
227 iso_pu_bacteria 2935694250 2935702607 210
228 iso_pu_bacteria 2935703347 2935711895 210
229 iso_pu_bacteria 2935713505 2935721239 210
230 iso_pu_bacteria 2935722832 2935730767 210
231 iso_pu_bacteria 2935732158 2935739929 210
232 iso_pu_bacteria 2935741537 2935748967 210
233 iso_pu_bacteria 2935750917 2935758837 210
234 iso_pu_bacteria 2935760218 2935767101 210
235 iso_pu_bacteria 2935769743 2935774863 210
236 iso_pu_bacteria 2935777560 2935779951 210
237 iso_pu_bacteria 2935785616 2935792219 210
238 iso_pu_bacteria 2935793552 2935798612 210
239 iso_pu_bacteria 2935801545 2935806866 210
240 iso_pu_bacteria 2935810662 2935818869 210
241 iso_pu_bacteria 2935827899 2935834374 210
242 iso_pu_bacteria 2935837841 2935843901 210
243 iso_pu_bacteria 2935855204 2935856857 210
244 iso_pu_bacteria 2935864058 2935868384 210
245 iso_pu_bacteria 2935873716 2935879694 210
246 iso_pu_bacteria 2935883170 2935883490 210
247 iso_pu_bacteria 2935959822 2935965322 210
248 iso_pu_bacteria 2935992306 2935997200 210
249 iso_pu_bacteria 2936002035 2936009947 210
250 iso_pu_bacteria 2936037263 2936045445 210
251 iso_pu_bacteria 2940556831 2940564573 210
252 iso_pu_bacteria 2941538514 2941545149 210
253 iso_pu_bacteria 3005506211 3005506527 210
254 iso_pu_bacteria 3005710791 3005717572 210
255 iso_pu_bacteria 3005718088 3005724621 210
256 iso_pu_bacteria 8016511872 8016519043 210
257 iso_pu_bacteria 8016522445 8016525261 210
258 iso_pu_bacteria 8016530956 8016538843 210
259 iso_pu_bacteria 8016539877 8016543126 210
260 iso_pu_bacteria 8016548790 8016550163 210
261 iso_pu_bacteria 8016557553 8016558572 210
262 iso_pu_bacteria 8016575299 8016581183 210
263 iso_pu_bacteria 8016595262 8016596555 210
264 iso_pu_bacteria 8016613128 8016619222 210
265 iso_pu_bacteria 8016622563 8016630377 210
266 iso_pu_bacteria 8017057580 8017057653 210
267 iso_pu_bacteria 8019538911 8019541311 210
268 iso_pu_bacteria 8019547302 8019549320 210
269 iso_pu_bacteria 8019576017 8019578165 210
270 iso_pu_bacteria 8019586578 8019596195 210
271 iso_pu_bacteria 8019597564 8019605499 210
272 iso_pu_bacteria 8019608314 8019613039 210
273 iso_pu_bacteria 8019648815 8019651697 210
274 iso_pu_bacteria 8055742211 8055750570 210
275 iso_pu_bacteria 8056967851 8056975347 210
276 3300005456 Ga0070678_100029982 Ga0070678_1000299824 211
277 3300005614 Ga0068856_100832796 Ga0068856_1008327961 211
278 3300005618 Ga0068864_100182468 Ga0068864_1001824682 211
279 3300005719 Ga0068861_100139299 Ga0068861_1001392993 211
280 3300005844 Ga0068862_100569757 Ga0068862_1005697572 211
281 3300006881 Ga0068865_100069342 Ga0068865_1000693423 211
282 3300009093 Ga0105240_10053247 Ga0105240_100532475 211
283 3300009094 Ga0111539_10182022 Ga0111539_101820222 211
284 3300009551 Ga0105238_10247537 Ga0105238_102475373 211
285 3300011119 Ga0105246_10114789 Ga0105246_101147893 211
286 3300013104 Ga0157370_10497971 Ga0157370_104979712 211
287 3300013105 Ga0157369_10017488 Ga0157369_100174885 211
288 3300013105 Ga0157369_10102904 Ga0157369_101029043 211
289 3300013307 Ga0157372_10118851 Ga0157372_101188514 211
290 3300025914 Ga0207671_10035801 Ga0207671_100358013 211
291 3300025938 Ga0207704_10265709 Ga0207704_102657092 211
292 3300025942 Ga0207689_10208165 Ga0207689_102081653 211
293 3300026118 Ga0207675_100354860 Ga0207675_1003548602 211
294 3300026121 Ga0207683_10135169 Ga0207683_101351694 211
295 3300028380 Ga0268265_10770230 Ga0268265_107702301 211
296 3300028381 Ga0268264_10000051 Ga0268264_10000051180 211
297 3300037418 Ga0395900_0265761 Ga0395900_0265761_41_691 211
298 3300037466 Ga0395898_0004875 Ga0395898_0004875_6396_7046 211
299 3300038443 Ga0395901_0051645 Ga0395901_0051645_131_781 211
300 3300053096 Ga0500641_0065899 Ga0500641_0065899_748_1425 211
301 iso_pu_bacteria 2876761206 2876763622 211
302 iso_pu_bacteria 8006926726 8006928330 211
303 3300005338 Ga0068868_100284079 Ga0068868_1002840792 212
304 3300005340 Ga0070689_100474764 Ga0070689_1004747642 212
305 3300025936 Ga0207670_10389508 Ga0207670_103895082 212
306 3300031711 Ga0265314_10069773 Ga0265314_100697733 212
307 3300031712 Ga0265342_10003396 Ga0265342_1000339615 212
308 3300044683 Ga0466965_0318596 Ga0466965_0318596_108_761 212
309 3300044693 Ga0466961_0254334 Ga0466961_0254334_87_764 212
310 3300044901 Ga0466960_0220761 Ga0466960_0220761_372_1025 212
311 3300045836 Ga0466958_0031405 Ga0466958_0031405_2187_2864 212
312 3300048929 Ga0496126_0035587 Ga0496126_0035587_1653_2318 212
313 3300053085 Ga0495619_0007832 Ga0495619_0007832_1013_1660 212
314 iso_pu_bacteria 2791355197 2793070197 212
315 iso_pu_bacteria 2904699407 2904711305 212
316 iso_pu_bacteria 2908756301 2908757590 212
317 iso_pu_bacteria 2935630451 2935632986 212
318 iso_pu_bacteria 2941507105 2941509712 212
319 iso_pu_bacteria 2941515067 2941517541 212
320 iso_pu_bacteria 2941523033 2941526506 212
321 iso_pu_bacteria 8006933436 8006937312 212
322 iso_pu_bacteria 8006973647 8006977344 212
323 3300005617 Ga0068859_100127861 Ga0068859_1001278612 213
324 3300005844 Ga0068862_100158116 Ga0068862_1001581162 213
325 3300006844 Ga0075428_100622896 Ga0075428_1006228962 213
326 3300006871 Ga0075434_100092226 Ga0075434_1000922263 213
327 3300006914 Ga0075436_100134933 Ga0075436_1001349333 213
328 3300006931 Ga0097620_100127864 Ga0097620_1001278642 213
329 3300006944 Ga0099823_1071205 Ga0099823_10712051 213
330 3300013308 Ga0157375_10541055 Ga0157375_105410552 213
331 3300027296 Ga0209389_1000494 Ga0209389_100049410 213
332 3300027361 Ga0209489_103769 Ga0209489_10376917 213
333 3300027363 Ga0209700_100420 Ga0209700_10042064 213
334 3300028380 Ga0268265_10396337 Ga0268265_103963372 213
335 3300033180 Ga0307510_10022034 Ga0307510_100220344 213
336 3300037312 Ga0395899_0443317 Ga0395899_0443317_33_689 213
337 3300037418 Ga0395900_0169700 Ga0395900_0169700_183_839 213
338 3300037466 Ga0395898_0532852 Ga0395898_0532852_436_1092 213
339 3300037471 Ga0395905_0064717 Ga0395905_0064717_2045_2701 213
340 3300044658 Ga0466972_0000124 Ga0466972_0000124_37735_38391 213
341 3300044658 Ga0466972_0002537 Ga0466972_0002537_5334_5993 213
342 3300044735 Ga0466968_0006334 Ga0466968_0006334_2075_2734 213
343 3300044735 Ga0466968_0215322 Ga0466968_0215322_200_856 213
344 3300044765 Ga0466970_0089040 Ga0466970_0089040_385_1041 213
345 3300044901 Ga0466960_0001481 Ga0466960_0001481_2620_3279 213
346 3300046460 Ga0495638_0085181 Ga0495638_0085181_320_997 213
347 3300046543 Ga0495645_0017494 Ga0495645_0017494_3124_3798 213
348 3300046660 Ga0495625_0225233 Ga0495625_0225233_235_894 213
349 3300046678 Ga0495599_0065022 Ga0495599_0065022_889_1563 213
350 3300050489 nmdc:mga03683_184261_c1 nmdc:mga03683_184261_c1_92_766 213
351 3300050512 nmdc:mga0n895_21774_c1 nmdc:mga0n895_21774_c1_4205_4864 213
352 3300050514 nmdc:mga08x19_97007_c1 nmdc:mga08x19_97007_c1_414_1073 213
353 3300053078 Ga0495612_0053958 Ga0495612_0053958_845_1519 213
354 3300053098 Ga0500650_0092938 Ga0500650_0092938_499_1176 213
355 3300053142 Ga0500577_0040536 Ga0500577_0040536_71_748 213
356 3300003215 JGI25153J46596_10002547 JGI25153J46596_1000254711 214
357 3300003215 JGI25153J46596_10003542 JGI25153J46596_100035425 214
358 3300003354 JGI25160J50197_1003442 JGI25160J50197_10034423 214
359 3300003794 Ga0055531_10007525 Ga0055531_100075256 214
360 3300004625 Ga0055543_1007516 Ga0055543_10075163 214
361 3300005262 Ga0065165_1000370 Ga0065165_10003706 214
362 3300005262 Ga0065165_1006098 Ga0065165_10060985 214
363 3300005262 Ga0065165_1008717 Ga0065165_10087173 214
364 3300005327 Ga0070658_10021405 Ga0070658_100214059 214
365 3300005328 Ga0070676_10394328 Ga0070676_103943282 214
366 3300005329 Ga0070683_100521941 Ga0070683_1005219412 214
367 3300005331 Ga0070670_100124537 Ga0070670_1001245373 214
368 3300005334 Ga0068869_100013181 Ga0068869_1000131815 214
369 3300005337 Ga0070682_100110140 Ga0070682_1001101401 214
370 3300005338 Ga0068868_100063339 Ga0068868_1000633394 214
371 3300005347 Ga0070668_100008756 Ga0070668_1000087567 214
372 3300005347 Ga0070668_100027658 Ga0070668_1000276587 214
373 3300005355 Ga0070671_100032245 Ga0070671_1000322451 214
374 3300005364 Ga0070673_100719100 Ga0070673_1007191001 214
375 3300005367 Ga0070667_100137265 Ga0070667_1001372652 214
376 3300005434 Ga0070709_10008369 Ga0070709_100083695 214
377 3300005436 Ga0070713_100008846 Ga0070713_1000088465 214
378 3300005437 Ga0070710_10172200 Ga0070710_101722002 214
379 3300005439 Ga0070711_100017038 Ga0070711_1000170383 214
380 3300005455 Ga0070663_100435647 Ga0070663_1004356471 214
381 3300005456 Ga0070678_100012735 Ga0070678_1000127355 214
382 3300005539 Ga0068853_100112148 Ga0068853_1001121483 214
383 3300005546 Ga0070696_100164886 Ga0070696_1001648863 214
384 3300005548 Ga0070665_100045145 Ga0070665_1000451454 214
385 3300005563 Ga0068855_100073742 Ga0068855_1000737424 214
386 3300005564 Ga0070664_100249863 Ga0070664_1002498631 214
387 3300005614 Ga0068856_100013570 Ga0068856_1000135708 214
388 3300005614 Ga0068856_100255228 Ga0068856_1002552281 214
389 3300005616 Ga0068852_100002075 Ga0068852_10000207511 214
390 3300005616 Ga0068852_100185761 Ga0068852_1001857612 214
391 3300005617 Ga0068859_100538127 Ga0068859_1005381272 214
392 3300005618 Ga0068864_100257270 Ga0068864_1002572702 214
393 3300005842 Ga0068858_100721009 Ga0068858_1007210092 214
394 3300005843 Ga0068860_100084953 Ga0068860_1000849533 214
395 3300005843 Ga0068860_100238488 Ga0068860_1002384882 214
396 3300005985 Ga0081539_10091157 Ga0081539_100911571 214
397 3300006038 Ga0075365_10033553 Ga0075365_100335533 214
398 3300006038 Ga0075365_10046161 Ga0075365_100461614 214
399 3300006042 Ga0075368_10127023 Ga0075368_101270231 214
400 3300006175 Ga0070712_100044616 Ga0070712_1000446164 214
401 3300006178 Ga0075367_10098911 Ga0075367_100989113 214
402 3300006178 Ga0075367_10110452 Ga0075367_101104522 214
403 3300006195 Ga0075366_10008044 Ga0075366_100080449 214
404 3300006353 Ga0075370_10028282 Ga0075370_100282823 214
405 3300006353 Ga0075370_10216835 Ga0075370_102168352 214
406 3300006931 Ga0097620_100538168 Ga0097620_1005381682 214
407 3300006942 Ga0099824_1002047 Ga0099824_100204716 214
408 3300006942 Ga0099824_1018951 Ga0099824_10189517 214
409 3300006943 Ga0099822_1004737 Ga0099822_100473713 214
410 3300006943 Ga0099822_1063565 Ga0099822_10635652 214
411 3300009093 Ga0105240_10002295 Ga0105240_1000229527 214
412 3300009093 Ga0105240_10251298 Ga0105240_102512983 214
413 3300009093 Ga0105240_10672889 Ga0105240_106728891 214
414 3300009094 Ga0111539_10395278 Ga0111539_103952782 214
415 3300009098 Ga0105245_10340923 Ga0105245_103409232 214
416 3300009174 Ga0105241_10012898 Ga0105241_100128985 214
417 3300009174 Ga0105241_10046174 Ga0105241_100461743 214
418 3300009176 Ga0105242_10234670 Ga0105242_102346701 214
419 3300009176 Ga0105242_10458835 Ga0105242_104588351 214
420 3300009177 Ga0105248_10144863 Ga0105248_101448633 214
421 3300009545 Ga0105237_10002301 Ga0105237_1000230113 214
422 3300009545 Ga0105237_10026831 Ga0105237_100268315 214
423 3300009545 Ga0105237_10430729 Ga0105237_104307291 214
424 3300009553 Ga0105249_10395205 Ga0105249_103952053 214
425 3300010375 Ga0105239_10025401 Ga0105239_100254014 214
426 3300010375 Ga0105239_10083534 Ga0105239_100835343 214
427 3300013306 Ga0163162_10155709 Ga0163162_101557093 214
428 3300013308 Ga0157375_10076159 Ga0157375_100761594 214
429 3300014325 Ga0163163_10043948 Ga0163163_100439486 214
430 3300014325 Ga0163163_10183688 Ga0163163_101836882 214
431 3300014325 Ga0163163_10203230 Ga0163163_102032304 214
432 3300014968 Ga0157379_10192263 Ga0157379_101922633 214
433 3300014969 Ga0157376_10179560 Ga0157376_101795602 214
434 3300017792 Ga0163161_10171094 Ga0163161_101710943 214
435 3300021320 Ga0214544_1000003 Ga0214544_1000003349 214
436 3300021321 Ga0214542_1000003 Ga0214542_1000003339 214
437 3300021321 Ga0214542_1021066 Ga0214542_10210665 214
438 3300021324 Ga0214545_1000004 Ga0214545_1000004352 214
439 3300021324 Ga0214545_1021274 Ga0214545_10212745 214
440 3300021327 Ga0214543_1000007 Ga0214543_100000765 214
441 3300025230 Ga0209563_100438 Ga0209563_10043814 214
442 3300025273 Ga0209673_1013733 Ga0209673_10137334 214
443 3300025295 Ga0209564_1010432 Ga0209564_10104327 214
444 3300025297 Ga0209758_1000030 Ga0209758_1000030410 214
445 3300025297 Ga0209758_1000893 Ga0209758_100089329 214
446 3300025297 Ga0209758_1001645 Ga0209758_100164512 214
447 3300025297 Ga0209758_1002462 Ga0209758_10024628 214
448 3300025297 Ga0209758_1050686 Ga0209758_10506863 214
449 3300025302 Ga0207426_1001517 Ga0207426_100151722 214
450 3300025302 Ga0207426_1008000 Ga0207426_10080004 214
451 3300025304 Ga0209257_1000662 Ga0209257_10006628 214
452 3300025304 Ga0209257_1015967 Ga0209257_10159674 214
453 3300025898 Ga0207692_10075621 Ga0207692_100756212 214
454 3300025900 Ga0207710_10028157 Ga0207710_100281573 214
455 3300025904 Ga0207647_10008109 Ga0207647_100081095 214
456 3300025904 Ga0207647_10211960 Ga0207647_102119602 214
457 3300025907 Ga0207645_10084865 Ga0207645_100848652 214
458 3300025913 Ga0207695_10000059 Ga0207695_1000005946 214
459 3300025913 Ga0207695_10218834 Ga0207695_102188342 214
460 3300025914 Ga0207671_10001109 Ga0207671_1000110913 214
461 3300025914 Ga0207671_10162971 Ga0207671_101629713 214
462 3300025915 Ga0207693_10104554 Ga0207693_101045543 214
463 3300025915 Ga0207693_10463230 Ga0207693_104632302 214
464 3300025919 Ga0207657_10275808 Ga0207657_102758082 214
465 3300025925 Ga0207650_10158200 Ga0207650_101582002 214
466 3300025926 Ga0207659_10263324 Ga0207659_102633242 214
467 3300025928 Ga0207700_10234026 Ga0207700_102340261 214
468 3300025931 Ga0207644_10018254 Ga0207644_100182544 214
469 3300025933 Ga0207706_10059147 Ga0207706_100591472 214
470 3300025933 Ga0207706_10134929 Ga0207706_101349293 214
471 3300025933 Ga0207706_10499489 Ga0207706_104994891 214
472 3300025934 Ga0207686_10225341 Ga0207686_102253411 214
473 3300025937 Ga0207669_10624750 Ga0207669_106247502 214
474 3300025939 Ga0207665_10380452 Ga0207665_103804522 214
475 3300025941 Ga0207711_10018230 Ga0207711_100182302 214
476 3300025945 Ga0207679_10401124 Ga0207679_104011241 214
477 3300025949 Ga0207667_10101512 Ga0207667_101015122 214
478 3300025949 Ga0207667_10406284 Ga0207667_104062843 214
479 3300025972 Ga0207668_10060395 Ga0207668_100603951 214
480 3300025972 Ga0207668_10069357 Ga0207668_100693572 214
481 3300025972 Ga0207668_10124091 Ga0207668_101240913 214
482 3300026035 Ga0207703_10050557 Ga0207703_100505573 214
483 3300026035 Ga0207703_10181953 Ga0207703_101819531 214
484 3300026041 Ga0207639_10160589 Ga0207639_101605893 214
485 3300026041 Ga0207639_10163367 Ga0207639_101633673 214
486 3300026067 Ga0207678_10021386 Ga0207678_100213867 214
487 3300026067 Ga0207678_10023768 Ga0207678_100237685 214
488 3300026078 Ga0207702_10106927 Ga0207702_101069273 214
489 3300026089 Ga0207648_10042881 Ga0207648_100428814 214
490 3300026089 Ga0207648_10704914 Ga0207648_107049141 214
491 3300026095 Ga0207676_10128955 Ga0207676_101289553 214
492 3300026116 Ga0207674_10057340 Ga0207674_100573405 214
493 3300026118 Ga0207675_100031542 Ga0207675_1000315425 214
494 3300026118 Ga0207675_100279247 Ga0207675_1002792473 214
495 3300026121 Ga0207683_10008695 Ga0207683_100086956 214
496 3300026121 Ga0207683_10470438 Ga0207683_104704382 214
497 3300026142 Ga0207698_10013446 Ga0207698_100134463 214
498 3300026142 Ga0207698_10371088 Ga0207698_103710883 214
499 3300027296 Ga0209389_1000055 Ga0209389_100005516 214
500 3300027357 Ga0209589_1000005 Ga0209589_1000005245 214
501 3300027357 Ga0209589_1000024 Ga0209589_1000024112 214
502 3300027361 Ga0209489_100005 Ga0209489_100005245 214
503 3300027361 Ga0209489_100123 Ga0209489_100123109 214
504 3300027363 Ga0209700_100006 Ga0209700_100006245 214
505 3300027866 Ga0209813_10024296 Ga0209813_100242961 214
506 3300028379 Ga0268266_10030958 Ga0268266_100309582 214
507 3300028379 Ga0268266_10712521 Ga0268266_107125211 214
508 3300028379 Ga0268266_10774729 Ga0268266_107747291 214
509 3300028380 Ga0268265_10178216 Ga0268265_101782163 214
510 3300031731 Ga0307405_10374919 Ga0307405_103749191 214
511 3300041491 Ga0451833_0031051 Ga0451833_0031051_400_1059 214
512 3300044683 Ga0466965_0026765 Ga0466965_0026765_665_1324 214
513 3300044901 Ga0466960_0139165 Ga0466960_0139165_43_702 214
514 3300046455 Ga0495603_0082839 Ga0495603_0082839_174_833 214
515 3300046460 Ga0495638_0011267 Ga0495638_0011267_1234_1893 214
516 3300046507 Ga0495606_0065243 Ga0495606_0065243_1419_2090 214
517 3300046522 Ga0495643_0045119 Ga0495643_0045119_847_1509 214
518 3300046524 Ga0495648_0218345 Ga0495648_0218345_191_850 214
519 3300046616 Ga0495668_0084179 Ga0495668_0084179_201_863 214
520 3300046674 Ga0495588_0001353 Ga0495588_0001353_9306_9965 214
521 3300046690 Ga0495624_0110799 Ga0495624_0110799_951_1610 214
522 3300046692 Ga0495671_0072278 Ga0495671_0072278_234_893 214
523 3300046692 Ga0495671_0286670 Ga0495671_0286670_55_711 214
524 3300047469 Ga0495673_0060041 Ga0495673_0060041_854_1516 214
525 3300047472 Ga0495686_0147890 Ga0495686_0147890_358_1017 214
526 3300047472 Ga0495686_0179200 Ga0495686_0179200_28_687 214
527 3300048905 Ga0496102_0134420 Ga0496102_0134420_972_1631 214
528 3300048906 Ga0496103_0080553 Ga0496103_0080553_997_1659 214
529 3300048907 Ga0496104_0024225 Ga0496104_0024225_1336_1995 214
530 3300048907 Ga0496104_0103508 Ga0496104_0103508_1024_1686 214
531 3300048908 Ga0496105_0039456 Ga0496105_0039456_904_1566 214
532 3300048909 Ga0496106_0271437 Ga0496106_0271437_90_749 214
533 3300048910 Ga0496107_0011974 Ga0496107_0011974_2667_3326 214
534 3300048911 Ga0496108_0013488 Ga0496108_0013488_2213_2875 214
535 3300048911 Ga0496108_0080117 Ga0496108_0080117_1790_2449 214
536 3300048912 Ga0496109_0222517 Ga0496109_0222517_192_851 214
537 3300048912 Ga0496109_0296979 Ga0496109_0296979_37_714 214
538 3300048913 Ga0496110_0015752 Ga0496110_0015752_1620_2282 214
539 3300048913 Ga0496110_0980438 Ga0496110_0980438_52_711 214
540 3300048914 Ga0496111_0056301 Ga0496111_0056301_723_1382 214
541 3300048915 Ga0496112_0704478 Ga0496112_0704478_74_733 214
542 3300048916 Ga0496113_0297442 Ga0496113_0297442_579_1238 214
543 3300048916 Ga0496113_0534347 Ga0496113_0534347_189_851 214
544 3300048917 Ga0496114_0014145 Ga0496114_0014145_861_1520 214
545 3300048919 Ga0496116_0028887 Ga0496116_0028887_1840_2499 214
546 3300048919 Ga0496116_0032538 Ga0496116_0032538_137_799 214
547 3300048920 Ga0496117_0061833 Ga0496117_0061833_976_1638 214
548 3300048922 Ga0496119_0215489 Ga0496119_0215489_88_747 214
549 3300048924 Ga0496121_0051348 Ga0496121_0051348_475_1134 214
550 3300048924 Ga0496121_0071559 Ga0496121_0071559_755_1414 214
551 3300048925 Ga0496122_0205725 Ga0496122_0205725_407_1066 214
552 3300048929 Ga0496126_0580061 Ga0496126_0580061_62_721 214
553 3300048929 Ga0496126_0676636 Ga0496126_0676636_17_694 214
554 3300050491 nmdc:mga00v17_439992_c1 nmdc:mga00v17_439992_c1_146_823 214
555 3300050492 nmdc:mga0yw44_14616_c1 nmdc:mga0yw44_14616_c1_2312_2971 214
556 3300050492 nmdc:mga0yw44_557513_c1 nmdc:mga0yw44_557513_c1_57_716 214
557 3300050493 nmdc:mga0k408_4612_c1 nmdc:mga0k408_4612_c1_1007_1669 214
558 3300050496 nmdc:mga07m45_14648_c1 nmdc:mga07m45_14648_c1_2359_3021 214
559 3300050511 nmdc:mga08y16_527905_c1 nmdc:mga08y16_527905_c1_95_772 214
560 3300050515 nmdc:mga0a205_133434_c1 nmdc:mga0a205_133434_c1_344_1021 214
561 3300053079 Ga0500610_0158106 Ga0500610_0158106_342_1001 214
562 3300053080 Ga0500635_0006464 Ga0500635_0006464_1151_1804 214
563 3300053086 Ga0500578_0120031 Ga0500578_0120031_701_1360 214
564 3300053086 Ga0500578_0297900 Ga0500578_0297900_242_901 214
565 3300053087 Ga0500643_000028 Ga0500643_000028_165469_166128 214
566 3300053091 Ga0500647_0018007 Ga0500647_0018007_1196_1855 214
567 3300053092 Ga0500583_0022614 Ga0500583_0022614_117_776 214
568 3300053094 Ga0500566_0000245 Ga0500566_0000245_5687_6346 214
569 3300053103 Ga0500555_002075 Ga0500555_002075_1855_2514 214
570 3300053104 Ga0500556_0017153 Ga0500556_0017153_1169_1828 214
571 3300053105 Ga0500557_000116 Ga0500557_000116_3660_4319 214
572 3300053108 Ga0500562_044412 Ga0500562_044412_62_721 214
573 3300053121 Ga0500607_228960 Ga0500607_228960_72_731 214
574 3300053130 Ga0500642_0000113 Ga0500642_0000113_6143_6802 214
575 3300053130 Ga0500642_0001807 Ga0500642_0001807_2237_2896 214
576 3300053138 Ga0500564_180237 Ga0500564_180237_34_693 214
577 3300053151 Ga0500604_0006950 Ga0500604_0006950_1325_1984 214
578 3300053155 Ga0500620_026632 Ga0500620_026632_43_702 214
579 3300053156 Ga0500622_0188348 Ga0500622_0188348_46_705 214
580 3300053177 Ga0500636_0000054 Ga0500636_0000054_45164_45823 214
581 3300053178 Ga0500637_0027373 Ga0500637_0027373_76_729 214
582 3300053729 Ga0500625_017426 Ga0500625_017426_625_1284 214
583 3300053730 Ga0500645_048584 Ga0500645_048584_71_730 214
584 3300053736 Ga0500599_002194 Ga0500599_002194_341_1000 214
585 3300053737 Ga0500601_000834 Ga0500601_000834_53_712 214
586 iso_pu_bacteria 2507262055 2507504485 214
587 iso_pu_bacteria 2508501042 2508694741 214
588 iso_pu_bacteria 2513237095 2513649243 214
589 iso_pu_bacteria 2515154112 2515624338 214
590 iso_pu_bacteria 2617270741 2617374346 214
591 iso_pu_bacteria 2935608549 2935613111 214
592 iso_pu_bacteria 2935648319 2935654067 214
593 iso_pu_bacteria 2935656913 2935662831 214
594 iso_pu_bacteria 2935819856 2935825037 214
595 iso_pu_bacteria 2935847175 2935852256 214
596 iso_pu_bacteria 2935908558 2935910689 214
597 iso_pu_bacteria 2935916978 2935921869 214
598 iso_pu_bacteria 2935926038 2935929992 214
599 iso_pu_bacteria 2935934488 2935937660 214
600 iso_pu_bacteria 2935942939 2935949764 214
601 iso_pu_bacteria 2935951376 2935956860 214
602 iso_pu_bacteria 2935967501 2935970883 214
603 iso_pu_bacteria 2935975950 2935982983 214
604 iso_pu_bacteria 2935984226 2935984370 214
605 iso_pu_bacteria 2936011229 2936016972 214
606 iso_pu_bacteria 2936019824 2936025620 214
607 iso_pu_bacteria 2936028420 2936034462 214
608 iso_pu_bacteria 2936046547 2936052504 214
609 iso_pu_bacteria 2936055302 2936055450 214
610 iso_pu_bacteria 8006994254 8006995426 214
611 iso_pu_bacteria 8016630954 8016636758 214
612 iso_pu_bacteria 8019619141 8019623726 214
613 iso_pu_bacteria 8019629233 8019638308 214
614 iso_pu_bacteria 8019638758 8019641328 214
615 iso_pu_bacteria 8019659431 8019666232 214
616 iso_pu_bacteria 8019668869 8019675734 214
617 iso_pu_bacteria 8019678201 8019680365 214
618 iso_pu_bacteria 8019687851 8019695453 214
619 3300003323 rootH1_10016026 rootH1_100160262 215
620 3300005329 Ga0070683_100042686 Ga0070683_1000426865 215
621 3300005329 Ga0070683_100139749 Ga0070683_1001397492 215
622 3300005336 Ga0070680_100019553 Ga0070680_1000195535 215
623 3300005336 Ga0070680_100079829 Ga0070680_1000798293 215
624 3300005336 Ga0070680_100104138 Ga0070680_1001041383 215
625 3300005341 Ga0070691_10090375 Ga0070691_100903752 215
626 3300005458 Ga0070681_10012819 Ga0070681_100128196 215
627 3300005458 Ga0070681_10125936 Ga0070681_101259362 215
628 3300005530 Ga0070679_100031919 Ga0070679_1000319191 215
629 3300005530 Ga0070679_100109277 Ga0070679_1001092772 215
630 3300005530 Ga0070679_100138618 Ga0070679_1001386181 215
631 3300005530 Ga0070679_100600551 Ga0070679_1006005511 215
632 3300005535 Ga0070684_100003258 Ga0070684_10000325811 215
633 3300005563 Ga0068855_100188786 Ga0068855_1001887861 215
634 3300005577 Ga0068857_100264142 Ga0068857_1002641423 215
635 3300005614 Ga0068856_100152081 Ga0068856_1001520811 215
636 3300005614 Ga0068856_100253525 Ga0068856_1002535252 215
637 3300006173 Ga0070716_100073994 Ga0070716_1000739943 215
638 3300006237 Ga0097621_100239636 Ga0097621_1002396362 215
639 3300009093 Ga0105240_10218361 Ga0105240_102183613 215
640 3300009093 Ga0105240_10266078 Ga0105240_102660782 215
641 3300009545 Ga0105237_10259204 Ga0105237_102592042 215
642 3300009545 Ga0105237_10346620 Ga0105237_103466202 215
643 3300009545 Ga0105237_10807367 Ga0105237_108073671 215
644 3300009551 Ga0105238_10063133 Ga0105238_100631332 215
645 3300009551 Ga0105238_10112590 Ga0105238_101125902 215
646 3300009551 Ga0105238_10345957 Ga0105238_103459571 215
647 3300010375 Ga0105239_11309354 Ga0105239_113093542 215
648 3300013105 Ga0157369_10570470 Ga0157369_105704703 215
649 3300020069 Ga0197907_11157109 Ga0197907_111571092 215
650 3300020076 Ga0206355_1507511 Ga0206355_15075112 215
651 3300020080 Ga0206350_10389318 Ga0206350_103893182 215
652 3300020082 Ga0206353_10556866 Ga0206353_105568661 215
653 3300022467 Ga0224712_10107802 Ga0224712_101078022 215
654 3300025297 Ga0209758_1000711 Ga0209758_100071117 215
655 3300025906 Ga0207699_10023510 Ga0207699_100235102 215
656 3300025912 Ga0207707_10000438 Ga0207707_100004389 215
657 3300025912 Ga0207707_10136890 Ga0207707_101368902 215
658 3300025913 Ga0207695_10027002 Ga0207695_100270025 215
659 3300025914 Ga0207671_10069327 Ga0207671_100693273 215
660 3300025916 Ga0207663_10095514 Ga0207663_100955142 215
661 3300025917 Ga0207660_10017792 Ga0207660_100177922 215
662 3300025917 Ga0207660_10183018 Ga0207660_101830181 215
663 3300025917 Ga0207660_10219447 Ga0207660_102194472 215
664 3300025917 Ga0207660_10619273 Ga0207660_106192732 215
665 3300025921 Ga0207652_10518673 Ga0207652_105186732 215
666 3300025939 Ga0207665_10061914 Ga0207665_100619143 215
667 3300025944 Ga0207661_10000959 Ga0207661_1000095915 215
668 3300025944 Ga0207661_10412760 Ga0207661_104127602 215
669 3300026078 Ga0207702_10186192 Ga0207702_101861922 215
670 3300026116 Ga0207674_10084699 Ga0207674_100846993 215
671 3300026142 Ga0207698_10166178 Ga0207698_101661782 215
672 3300031824 Ga0307413_10103325 Ga0307413_101033253 215
673 3300033180 Ga0307510_10121417 Ga0307510_101214174 215
674 3300035086 Ga0373934_0076806 Ga0373934_0076806_572_1228 215
675 3300035116 Ga0373945_0209184 Ga0373945_0209184_72_728 215
676 3300035118 Ga0373954_0052727 Ga0373954_0052727_1158_1814 215
677 3300035119 Ga0373956_0087974 Ga0373956_0087974_137_793 215
678 3300035170 Ga0373943_0234201 Ga0373943_0234201_148_804 215
679 3300035172 Ga0373955_0122209 Ga0373955_0122209_457_1113 215
680 3300035410 Ga0373924_0027656 Ga0373924_0027656_544_1200 215
681 3300036401 Ga0373937_0227646 Ga0373937_0227646_720_1376 215
682 3300044656 Ga0466969_0026762 Ga0466969_0026762_216_878 215
683 3300044684 Ga0466966_0000411 Ga0466966_0000411_16089_16751 215
684 3300044693 Ga0466961_0000065 Ga0466961_0000065_49566_50228 215
685 3300044765 Ga0466970_0143814 Ga0466970_0143814_169_840 215
686 3300045049 Ga0466959_0000634 Ga0466959_0000634_18201_18863 215
687 3300045049 Ga0466959_0275904 Ga0466959_0275904_273_944 215
688 3300046459 Ga0495629_0003519 Ga0495629_0003519_2984_3655 215
689 3300046459 Ga0495629_0206705 Ga0495629_0206705_88_744 215
690 3300046462 Ga0495651_0017692 Ga0495651_0017692_3859_4530 215
691 3300046475 Ga0495639_0056409 Ga0495639_0056409_189_845 215
692 3300046500 Ga0495596_0092262 Ga0495596_0092262_316_975 215
693 3300046506 Ga0495583_0044422 Ga0495583_0044422_1334_2005 215
694 3300046507 Ga0495606_0160809 Ga0495606_0160809_83_754 215
695 3300046513 Ga0495616_0253094 Ga0495616_0253094_58_729 215
696 3300046514 Ga0495618_0141248 Ga0495618_0141248_827_1483 215
697 3300046524 Ga0495648_0008955 Ga0495648_0008955_4875_5546 215
698 3300046526 Ga0495666_0133388 Ga0495666_0133388_363_1019 215
699 3300046529 Ga0495652_0089784 Ga0495652_0089784_1811_2482 215
700 3300046529 Ga0495652_0122342 Ga0495652_0122342_1292_1948 215
701 3300046533 Ga0495640_0027614 Ga0495640_0027614_119_775 215
702 3300046535 Ga0495586_0158427 Ga0495586_0158427_593_1249 215
703 3300046536 Ga0495587_0269474 Ga0495587_0269474_56_712 215
704 3300046642 Ga0495634_0056964 Ga0495634_0056964_956_1627 215
705 3300046663 Ga0495635_0366258 Ga0495635_0366258_103_759 215
706 3300046675 Ga0495657_0014532 Ga0495657_0014532_2907_3578 215
707 3300046689 Ga0495613_0274008 Ga0495613_0274008_25_696 215
708 3300046690 Ga0495624_0067145 Ga0495624_0067145_83_739 215
709 3300046694 Ga0495649_0024307 Ga0495649_0024307_210_881 215
710 3300047315 Ga0495581_0014180 Ga0495581_0014180_2344_3000 215
711 3300047317 Ga0495604_0006835 Ga0495604_0006835_8190_8861 215
712 3300047319 Ga0495674_0018428 Ga0495674_0018428_4691_5347 215
713 3300047321 Ga0495676_0055266 Ga0495676_0055266_95_766 215
714 3300047471 Ga0495684_0012933 Ga0495684_0012933_4638_5294 215
715 3300047673 Ga0495593_0079436 Ga0495593_0079436_58_714 215
716 3300048905 Ga0496102_0252451 Ga0496102_0252451_312_983 215
717 3300048907 Ga0496104_0009070 Ga0496104_0009070_7078_7749 215
718 3300048908 Ga0496105_0022832 Ga0496105_0022832_4097_4768 215
719 3300048918 Ga0496115_0069485 Ga0496115_0069485_2160_2831 215
720 3300048922 Ga0496119_0015983 Ga0496119_0015983_4132_4803 215
721 3300048923 Ga0496120_0035858 Ga0496120_0035858_310_981 215
722 3300048924 Ga0496121_0024152 Ga0496121_0024152_645_1301 215
723 3300048927 Ga0496124_0053485 Ga0496124_0053485_2539_3210 215
724 3300048928 Ga0496125_0069134 Ga0496125_0069134_1522_2193 215
725 3300048929 Ga0496126_0015704 Ga0496126_0015704_4901_5557 215
726 3300049460 Ga0495682_0014877 Ga0495682_0014877_1399_2070 215
727 3300053119 Ga0500595_058462 Ga0500595_058462_388_1059 215
728 3300053136 Ga0500559_0016441 Ga0500559_0016441_1835_2506 215
729 3300053178 Ga0500637_0273034 Ga0500637_0273034_169_840 215
730 3300053733 Ga0500552_020370 Ga0500552_020370_244_915 215
731 3300005434 Ga0070709_10003090 Ga0070709_100030903 216
732 3300005435 Ga0070714_100162069 Ga0070714_1001620692 216
733 3300005436 Ga0070713_100002234 Ga0070713_10000223413 216
734 3300005436 Ga0070713_101072866 Ga0070713_1010728661 216
735 3300005437 Ga0070710_10000552 Ga0070710_100005525 216
736 3300005439 Ga0070711_100011221 Ga0070711_1000112214 216
737 3300005439 Ga0070711_100062871 Ga0070711_1000628712 216
738 3300005841 Ga0068863_100776274 Ga0068863_1007762742 216
739 3300006028 Ga0070717_10001026 Ga0070717_1000102610 216
740 3300006028 Ga0070717_10237647 Ga0070717_102376472 216
741 3300006048 Ga0075363_100163594 Ga0075363_1001635942 216
742 3300006173 Ga0070716_100069962 Ga0070716_1000699622 216
743 3300006175 Ga0070712_100502818 Ga0070712_1005028181 216
744 3300006353 Ga0075370_10132901 Ga0075370_101329012 216
745 3300025898 Ga0207692_10001302 Ga0207692_100013023 216
746 3300025898 Ga0207692_10250024 Ga0207692_102500241 216
747 3300025906 Ga0207699_10045183 Ga0207699_100451834 216
748 3300025915 Ga0207693_10027888 Ga0207693_100278881 216
749 3300025915 Ga0207693_10114267 Ga0207693_101142673 216
750 3300025915 Ga0207693_10235143 Ga0207693_102351433 216
751 3300025916 Ga0207663_10017392 Ga0207663_100173924 216
752 3300025916 Ga0207663_10030104 Ga0207663_100301044 216
753 3300025928 Ga0207700_10067007 Ga0207700_100670071 216
754 3300025929 Ga0207664_10021535 Ga0207664_100215352 216
755 3300025939 Ga0207665_10014858 Ga0207665_100148584 216
756 3300026075 Ga0207708_10513717 Ga0207708_105137172 216
757 3300031249 Ga0265339_10034239 Ga0265339_100342393 216
758 3300037471 Ga0395905_0109320 Ga0395905_0109320_626_1285 216
759 3300048910 Ga0496107_0164616 Ga0496107_0164616_805_1485 216
760 3300048929 Ga0496126_0366683 Ga0496126_0366683_22_690 216
761 iso_pu_bacteria 2513237101 2513694581 216
762 iso_pu_bacteria 2874604998 2874608911 216
763 3300009098 Ga0105245_10904070 Ga0105245_109040702 217
764 3300009545 Ga0105237_10006999 Ga0105237_100069996 217
765 3300009545 Ga0105237_10358448 Ga0105237_103584483 217
766 3300013297 Ga0157378_10146176 Ga0157378_101461762 217
767 3300021384 Ga0213876_10002755 Ga0213876_100027559 217
768 3300025885 Ga0207653_10004044 Ga0207653_100040445 217
769 3300031616 Ga0307508_10014562 Ga0307508_100145628 217
770 3300035695 Ga0373927_0363133 Ga0373927_0363133_254_919 217
771 3300035724 Ga0373933_0000018 Ga0373933_0000018_26633_27295 217
772 3300037068 Ga0373925_0401179 Ga0373925_0401179_235_900 217
773 3300039437 Ga0436365_0093274 Ga0436365_0093274_51384_52049 217
774 3300039450 Ga0436363_0554977 Ga0436363_0554977_596_1258 217
775 3300039453 Ga0436362_0626323 Ga0436362_0626323_2713_3378 217
776 3300046557 Ga0495622_0265165 Ga0495622_0265165_57_722 217
777 3300046678 Ga0495599_0067383 Ga0495599_0067383_799_1464 217
778 3300046689 Ga0495613_0062464 Ga0495613_0062464_108_773 217
779 3300048909 Ga0496106_0026873 Ga0496106_0026873_953_1618 217
780 3300048921 Ga0496118_0002445 Ga0496118_0002445_21657_22322 217
781 3300048924 Ga0496121_0000452 Ga0496121_0000452_32800_33465 217
782 3300048927 Ga0496124_0000267 Ga0496124_0000267_59010_59675 217
783 3300048929 Ga0496126_0059836 Ga0496126_0059836_829_1494 217
784 3300053080 Ga0500635_0062937 Ga0500635_0062937_124_789 217
785 3300053094 Ga0500566_0069046 Ga0500566_0069046_1185_1850 217
786 3300053136 Ga0500559_0115729 Ga0500559_0115729_400_1065 217
787 3300053148 Ga0500590_080114 Ga0500590_080114_258_923 217
788 3300053162 Ga0500638_042327 Ga0500638_042327_1290_1955 217
789 3300053727 Ga0500611_005942 Ga0500611_005942_448_1125 217
790 3300053735 Ga0500596_006582 Ga0500596_006582_1142_1807 217
791 iso_pu_bacteria 2721755755 2723842398 217
792 iso_pu_bacteria 2791355199 2793078764 217
793 iso_pu_bacteria 2889033259 2889034384 217
794 iso_pu_bacteria 2922361189 2922364836 217
795 iso_pu_bacteria 8006964411 8006965273 217
796 iso_pu_bacteria 8056673599 8056679066 217
797 3300006175 Ga0070712_100840602 Ga0070712_1008406021 218
798 3300046691 Ga0495670_0115431 Ga0495670_0115431_619_1296 218
799 3300053111 Ga0500572_004309 Ga0500572_004309_1787_2452 218
800 3300053136 Ga0500559_0000103 Ga0500559_0000103_17686_18351 218
801 3300053735 Ga0500596_005620 Ga0500596_005620_1037_1702 218
802 iso_pu_bacteria 2876808645 2876812910 218
803 iso_pu_bacteria 2879110137 2879112371 218
804 iso_pu_bacteria 8006984368 8006991605 218
805 3300005548 Ga0070665_100136213 Ga0070665_1001362132 219
806 3300005548 Ga0070665_100472269 Ga0070665_1004722692 219
807 3300005548 Ga0070665_100554908 Ga0070665_1005549081 219
808 3300025253 Ga0209677_103197 Ga0209677_1031974 219
809 3300025928 Ga0207700_10634800 Ga0207700_106348002 219
810 3300028379 Ga0268266_10085353 Ga0268266_100853532 219
811 3300028379 Ga0268266_10366104 Ga0268266_103661042 219
812 3300028379 Ga0268266_10848742 Ga0268266_108487421 219
813 3300031616 Ga0307508_10567299 Ga0307508_105672991 219
814 3300048910 Ga0496107_0237925 Ga0496107_0237925_413_1084 219
815 3300048920 Ga0496117_0071741 Ga0496117_0071741_53_724 219
816 3300048924 Ga0496121_0050510 Ga0496121_0050510_1305_1976 219
817 3300048928 Ga0496125_0043745 Ga0496125_0043745_2342_3013 219
818 3300053096 Ga0500641_0027837 Ga0500641_0027837_422_1102 219
819 3300053139 Ga0500568_0043749 Ga0500568_0043749_1008_1688 219
820 3300003215 JGI25153J46596_10014855 JGI25153J46596_100148552 220
821 3300005539 Ga0068853_100026606 Ga0068853_1000266065 220
822 3300005937 Ga0081455_10073137 Ga0081455_100731374 220
823 3300005983 Ga0081540_1100945 Ga0081540_11009452 220
824 3300006042 Ga0075368_10102393 Ga0075368_101023932 220
825 3300025297 Ga0209758_1005049 Ga0209758_10050499 220
826 3300025901 Ga0207688_10069981 Ga0207688_100699813 220
827 3300025972 Ga0207668_10425960 Ga0207668_104259601 220
828 3300026041 Ga0207639_10023427 Ga0207639_100234275 220
829 3300026067 Ga0207678_10052328 Ga0207678_100523284 220
830 3300031456 Ga0307513_10125136 Ga0307513_101251361 220
831 3300035172 Ga0373955_0108257 Ga0373955_0108257_795_1466 220
832 3300046529 Ga0495652_0391588 Ga0495652_0391588_177_851 220
833 3300046533 Ga0495640_0087035 Ga0495640_0087035_67_738 220
834 3300046559 Ga0495667_0044811 Ga0495667_0044811_904_1587 220
835 3300046679 Ga0495623_0320794 Ga0495623_0320794_63_746 220
836 3300047322 Ga0495680_0085161 Ga0495680_0085161_1042_1713 220
837 3300047469 Ga0495673_0108676 Ga0495673_0108676_399_1076 220
838 3300048088 Ga0495602_0543596 Ga0495602_0543596_59_733 220
839 3300050494 nmdc:mga06z11_57073_c1 nmdc:mga06z11_57073_c1_271_942 220
840 3300053085 Ga0495619_0514646 Ga0495619_0514646_123_794 220
841 3300005339 Ga0070660_100244847 Ga0070660_1002448473 221
842 3300005367 Ga0070667_100425118 Ga0070667_1004251181 221
843 3300005439 Ga0070711_100027986 Ga0070711_1000279864 221
844 3300005441 Ga0070700_100252535 Ga0070700_1002525352 221
845 3300005456 Ga0070678_100862047 Ga0070678_1008620471 221
846 3300005458 Ga0070681_10607547 Ga0070681_106075471 221
847 3300005548 Ga0070665_100028897 Ga0070665_1000288974 221
848 3300005548 Ga0070665_100161250 Ga0070665_1001612503 221
849 3300005614 Ga0068856_100467549 Ga0068856_1004675491 221
850 3300005615 Ga0070702_100437731 Ga0070702_1004377312 221
851 3300005937 Ga0081455_10007464 Ga0081455_100074645 221
852 3300005983 Ga0081540_1012706 Ga0081540_10127065 221
853 3300005985 Ga0081539_10125163 Ga0081539_101251631 221
854 3300006871 Ga0075434_100826714 Ga0075434_1008267141 221
855 3300009174 Ga0105241_10444899 Ga0105241_104448992 221
856 3300013297 Ga0157378_10057612 Ga0157378_100576123 221
857 3300014325 Ga0163163_10002774 Ga0163163_100027748 221
858 3300014968 Ga0157379_10609805 Ga0157379_106098052 221
859 3300014969 Ga0157376_10537824 Ga0157376_105378241 221
860 3300025912 Ga0207707_10669633 Ga0207707_106696332 221
861 3300025919 Ga0207657_10506158 Ga0207657_105061582 221
862 3300026067 Ga0207678_10698805 Ga0207678_106988051 221
863 3300026078 Ga0207702_10380959 Ga0207702_103809591 221
864 3300028379 Ga0268266_10070131 Ga0268266_100701313 221
865 3300028379 Ga0268266_10117632 Ga0268266_101176323 221
866 3300028786 Ga0307517_10000856 Ga0307517_1000085615 221
867 3300028794 Ga0307515_10027090 Ga0307515_100270906 221
868 3300036401 Ga0373937_0069895 Ga0373937_0069895_2332_3009 221
869 3300047320 Ga0495672_0017605 Ga0495672_0017605_2030_2707 221
870 3300047469 Ga0495673_0061680 Ga0495673_0061680_323_997 221
871 3300048905 Ga0496102_0107971 Ga0496102_0107971_300_977 221
872 3300048907 Ga0496104_0037936 Ga0496104_0037936_3763_4440 221
873 3300048909 Ga0496106_0038587 Ga0496106_0038587_1552_2229 221
874 3300048911 Ga0496108_0012004 Ga0496108_0012004_2699_3376 221
875 3300048912 Ga0496109_0893173 Ga0496109_0893173_122_799 221
876 3300048913 Ga0496110_0015719 Ga0496110_0015719_3545_4222 221
877 3300048915 Ga0496112_0053279 Ga0496112_0053279_118_795 221
878 3300048918 Ga0496115_0032960 Ga0496115_0032960_2650_3327 221
879 3300048924 Ga0496121_0322890 Ga0496121_0322890_26_703 221
880 3300049585 Ga0501069_0480989 Ga0501069_0480989_46_714 221
881 3300049742 Ga0501080_0060360 Ga0501080_0060360_523_1191 221
882 3300049822 Ga0501035_0618962 Ga0501035_0618962_100_768 221
883 3300050492 nmdc:mga0yw44_223543_c1 nmdc:mga0yw44_223543_c1_72_743 221
884 3300050494 nmdc:mga06z11_118063_c1 nmdc:mga06z11_118063_c1_422_1099 221
885 3300050512 nmdc:mga0n895_1120456_c1 nmdc:mga0n895_1120456_c1_18_692 221
886 3300060353 Ga0501082_0090266 Ga0501082_0090266_1784_2473 221
887 3300061734 Ga0530510_0254120 Ga0530510_0254120_447_1115 221
888 3300003203 JGI25406J46586_10006811 JGI25406J46586_100068115 222
889 3300003659 JGI25404J52841_10025272 JGI25404J52841_100252722 222
890 3300003659 JGI25404J52841_10030013 JGI25404J52841_100300131 222
891 3300005334 Ga0068869_100064153 Ga0068869_1000641531 222
892 3300005338 Ga0068868_100658426 Ga0068868_1006584261 222
893 3300005438 Ga0070701_10348617 Ga0070701_103486171 222
894 3300005439 Ga0070711_100752190 Ga0070711_1007521901 222
895 3300005455 Ga0070663_100672247 Ga0070663_1006722471 222
896 3300005456 Ga0070678_100164756 Ga0070678_1001647563 222
897 3300005457 Ga0070662_100230394 Ga0070662_1002303941 222
898 3300005458 Ga0070681_10037527 Ga0070681_100375277 222
899 3300005466 Ga0070685_10132407 Ga0070685_101324072 222
900 3300005466 Ga0070685_10187510 Ga0070685_101875101 222
901 3300005467 Ga0070706_100736318 Ga0070706_1007363181 222
902 3300005471 Ga0070698_100604936 Ga0070698_1006049362 222
903 3300005530 Ga0070679_100034291 Ga0070679_1000342911 222
904 3300005543 Ga0070672_100649058 Ga0070672_1006490581 222
905 3300005547 Ga0070693_100262254 Ga0070693_1002622542 222
906 3300005548 Ga0070665_100071651 Ga0070665_1000716514 222
907 3300005548 Ga0070665_100135904 Ga0070665_1001359041 222
908 3300005563 Ga0068855_100015587 Ga0068855_1000155878 222
909 3300005564 Ga0070664_100516844 Ga0070664_1005168441 222
910 3300005615 Ga0070702_100269391 Ga0070702_1002693912 222
911 3300005615 Ga0070702_100510897 Ga0070702_1005108971 222
912 3300005719 Ga0068861_100151333 Ga0068861_1001513333 222
913 3300005834 Ga0068851_10113048 Ga0068851_101130482 222
914 3300005842 Ga0068858_100150433 Ga0068858_1001504332 222
915 3300005843 Ga0068860_100215672 Ga0068860_1002156723 222
916 3300005844 Ga0068862_100373845 Ga0068862_1003738453 222
917 3300005937 Ga0081455_10003156 Ga0081455_1000315612 222
918 3300005983 Ga0081540_1001341 Ga0081540_100134126 222
919 3300005983 Ga0081540_1002121 Ga0081540_100212111 222
920 3300005983 Ga0081540_1018462 Ga0081540_10184623 222
921 3300005983 Ga0081540_1073482 Ga0081540_10734822 222
922 3300005983 Ga0081540_1120509 Ga0081540_11205092 222
923 3300005983 Ga0081540_1120511 Ga0081540_11205112 222
924 3300005985 Ga0081539_10000729 Ga0081539_1000072950 222
925 3300006042 Ga0075368_10008533 Ga0075368_100085333 222
926 3300006042 Ga0075368_10103345 Ga0075368_101033452 222
927 3300006048 Ga0075363_100003880 Ga0075363_1000038803 222
928 3300006048 Ga0075363_100013422 Ga0075363_1000134224 222
929 3300006048 Ga0075363_100060796 Ga0075363_1000607962 222
930 3300006178 Ga0075367_10330846 Ga0075367_103308462 222
931 3300006195 Ga0075366_10071534 Ga0075366_100715342 222
932 3300006195 Ga0075366_10094649 Ga0075366_100946493 222
933 3300006237 Ga0097621_100234276 Ga0097621_1002342762 222
934 3300006353 Ga0075370_10042444 Ga0075370_100424442 222
935 3300006881 Ga0068865_100316538 Ga0068865_1003165382 222
936 3300007076 Ga0075435_100109533 Ga0075435_1001095331 222
937 3300007265 Ga0099794_10112341 Ga0099794_101123412 222
938 3300007788 Ga0099795_10017558 Ga0099795_100175581 222
939 3300009093 Ga0105240_10183475 Ga0105240_101834754 222
940 3300009098 Ga0105245_10037331 Ga0105245_100373315 222
941 3300009174 Ga0105241_10066451 Ga0105241_100664512 222
942 3300009177 Ga0105248_10042923 Ga0105248_100429233 222
943 3300009177 Ga0105248_10211185 Ga0105248_102111852 222
944 3300009553 Ga0105249_10165545 Ga0105249_101655453 222
945 3300009553 Ga0105249_11331530 Ga0105249_113315301 222
946 3300011119 Ga0105246_10484397 Ga0105246_104843972 222
947 3300013104 Ga0157370_10061670 Ga0157370_100616702 222
948 3300013297 Ga0157378_10573750 Ga0157378_105737502 222
949 3300013306 Ga0163162_10362366 Ga0163162_103623662 222
950 3300013306 Ga0163162_10475004 Ga0163162_104750042 222
951 3300013308 Ga0157375_10069051 Ga0157375_100690513 222
952 3300013308 Ga0157375_10137987 Ga0157375_101379874 222
953 3300013308 Ga0157375_10784330 Ga0157375_107843301 222
954 3300014325 Ga0163163_10129093 Ga0163163_101290932 222
955 3300014325 Ga0163163_10910132 Ga0163163_109101321 222
956 3300014745 Ga0157377_10044206 Ga0157377_100442064 222
957 3300014968 Ga0157379_10255394 Ga0157379_102553942 222
958 3300014969 Ga0157376_10086282 Ga0157376_100862822 222
959 3300014969 Ga0157376_10321788 Ga0157376_103217881 222
960 3300017792 Ga0163161_10299170 Ga0163161_102991702 222
961 3300017792 Ga0163161_10338303 Ga0163161_103383033 222
962 3300025901 Ga0207688_10033353 Ga0207688_100333532 222
963 3300025903 Ga0207680_10231384 Ga0207680_102313842 222
964 3300025910 Ga0207684_10261744 Ga0207684_102617442 222
965 3300025913 Ga0207695_10043272 Ga0207695_100432723 222
966 3300025917 Ga0207660_10087395 Ga0207660_100873954 222
967 3300025921 Ga0207652_10047083 Ga0207652_100470836 222
968 3300025931 Ga0207644_10334329 Ga0207644_103343292 222
969 3300025931 Ga0207644_10743095 Ga0207644_107430951 222
970 3300025934 Ga0207686_10200241 Ga0207686_102002412 222
971 3300025937 Ga0207669_10478717 Ga0207669_104787172 222
972 3300025940 Ga0207691_10197132 Ga0207691_101971323 222
973 3300025941 Ga0207711_10276472 Ga0207711_102764723 222
974 3300025941 Ga0207711_10876686 Ga0207711_108766862 222
975 3300025942 Ga0207689_10080482 Ga0207689_100804823 222
976 3300025949 Ga0207667_10044714 Ga0207667_100447147 222
977 3300025972 Ga0207668_10095673 Ga0207668_100956732 222
978 3300025986 Ga0207658_10678577 Ga0207658_106785771 222
979 3300026023 Ga0207677_10461146 Ga0207677_104611462 222
980 3300026041 Ga0207639_10267758 Ga0207639_102677582 222
981 3300026067 Ga0207678_10025320 Ga0207678_100253205 222
982 3300026067 Ga0207678_10064507 Ga0207678_100645074 222
983 3300026075 Ga0207708_10433723 Ga0207708_104337232 222
984 3300026095 Ga0207676_10163439 Ga0207676_101634391 222
985 3300026121 Ga0207683_10032517 Ga0207683_100325172 222
986 3300026121 Ga0207683_10450052 Ga0207683_104500522 222
987 3300027671 Ga0209588_1014950 Ga0209588_10149503 222
988 3300027671 Ga0209588_1031471 Ga0209588_10314712 222
989 3300028379 Ga0268266_10000638 Ga0268266_100006382 222
990 3300028379 Ga0268266_10001364 Ga0268266_1000136427 222
991 3300028379 Ga0268266_10768309 Ga0268266_107683091 222
992 3300028380 Ga0268265_10678065 Ga0268265_106780651 222
993 3300028381 Ga0268264_10295742 Ga0268264_102957422 222
994 3300031507 Ga0307509_10085186 Ga0307509_100851864 222
995 3300031995 Ga0307409_100119908 Ga0307409_1001199081 222
996 3300032002 Ga0307416_100286859 Ga0307416_1002868592 222
997 3300032126 Ga0307415_100143022 Ga0307415_1001430223 222
998 3300033180 Ga0307510_10004951 Ga0307510_1000495112 222
999 3300035090 Ga0373949_0020331 Ga0373949_0020331_356_1033 222
1000 3300035092 Ga0373952_0006580 Ga0373952_0006580_617_1294 222
1001 3300035121 Ga0373960_0132987 Ga0373960_0132987_34_705 222
1002 3300035170 Ga0373943_0157391 Ga0373943_0157391_454_1125 222
1003 3300035691 Ga0373931_0008723 Ga0373931_0008723_1320_1997 222
1004 3300035695 Ga0373927_0012565 Ga0373927_0012565_1054_1731 222
1005 3300037068 Ga0373925_0639533 Ga0373925_0639533_159_836 222
1006 3300041443 Ga0451789_0919161 Ga0451789_0919161_291_962 222
1007 3300046455 Ga0495603_0132329 Ga0495603_0132329_288_962 222
1008 3300046455 Ga0495603_0300832 Ga0495603_0300832_124_795 222
1009 3300046461 Ga0495641_0062004 Ga0495641_0062004_946_1617 222
1010 3300046462 Ga0495651_0424287 Ga0495651_0424287_171_851 222
1011 3300046472 Ga0495580_0092623 Ga0495580_0092623_91_768 222
1012 3300046475 Ga0495639_0061813 Ga0495639_0061813_864_1541 222
1013 3300046492 Ga0495585_0283872 Ga0495585_0283872_90_761 222
1014 3300046499 Ga0495594_0065555 Ga0495594_0065555_75_752 222
1015 3300046512 Ga0495610_0078267 Ga0495610_0078267_163_834 222
1016 3300046513 Ga0495616_0084560 Ga0495616_0084560_265_936 222
1017 3300046515 Ga0495620_0020979 Ga0495620_0020979_1558_2229 222
1018 3300046529 Ga0495652_0457905 Ga0495652_0457905_52_735 222
1019 3300046530 Ga0495654_0129733 Ga0495654_0129733_126_797 222
1020 3300046538 Ga0495609_0090829 Ga0495609_0090829_133_804 222
1021 3300046557 Ga0495622_0014799 Ga0495622_0014799_2739_3416 222
1022 3300046648 Ga0495611_0244628 Ga0495611_0244628_39_710 222
1023 3300046810 Ga0495660_0076880 Ga0495660_0076880_633_1304 222
1024 3300047315 Ga0495581_0041048 Ga0495581_0041048_553_1224 222
1025 3300047320 Ga0495672_0050250 Ga0495672_0050250_1455_2138 222
1026 3300047321 Ga0495676_0102528 Ga0495676_0102528_1414_2091 222
1027 3300047321 Ga0495676_0374195 Ga0495676_0374195_117_788 222
1028 3300047447 Ga0495685_082541 Ga0495685_082541_17_694 222
1029 3300047472 Ga0495686_0114233 Ga0495686_0114233_64_735 222
1030 3300048904 Ga0496101_0055034 Ga0496101_0055034_1459_2136 222
1031 3300048904 Ga0496101_0149898 Ga0496101_0149898_921_1598 222
1032 3300048905 Ga0496102_0125274 Ga0496102_0125274_231_908 222
1033 3300048906 Ga0496103_0338198 Ga0496103_0338198_177_848 222
1034 3300048907 Ga0496104_0068302 Ga0496104_0068302_314_991 222
1035 3300048907 Ga0496104_0375050 Ga0496104_0375050_453_1130 222
1036 3300048908 Ga0496105_0099088 Ga0496105_0099088_181_858 222
1037 3300048908 Ga0496105_0589435 Ga0496105_0589435_163_834 222
1038 3300048909 Ga0496106_0264939 Ga0496106_0264939_618_1295 222
1039 3300048909 Ga0496106_0285674 Ga0496106_0285674_40_717 222
1040 3300048910 Ga0496107_0709954 Ga0496107_0709954_12_680 222
1041 3300048911 Ga0496108_0243202 Ga0496108_0243202_473_1144 222
1042 3300048911 Ga0496108_0467421 Ga0496108_0467421_207_884 222
1043 3300048912 Ga0496109_0275200 Ga0496109_0275200_896_1573 222
1044 3300048912 Ga0496109_0721487 Ga0496109_0721487_48_719 222
1045 3300048914 Ga0496111_0152814 Ga0496111_0152814_196_873 222
1046 3300048915 Ga0496112_0045698 Ga0496112_0045698_3527_4204 222
1047 3300048915 Ga0496112_0242029 Ga0496112_0242029_168_845 222
1048 3300048916 Ga0496113_0004044 Ga0496113_0004044_5952_6629 222
1049 3300048917 Ga0496114_0121968 Ga0496114_0121968_1392_2069 222
1050 3300048918 Ga0496115_0005405 Ga0496115_0005405_2501_3178 222
1051 3300048920 Ga0496117_0301026 Ga0496117_0301026_145_816 222
1052 3300048924 Ga0496121_0000571 Ga0496121_0000571_67822_68505 222
1053 3300048924 Ga0496121_0043447 Ga0496121_0043447_3024_3701 222
1054 3300048927 Ga0496124_0026050 Ga0496124_0026050_1477_2148 222
1055 3300048929 Ga0496126_0071503 Ga0496126_0071503_1147_1827 222
1056 3300048929 Ga0496126_0355971 Ga0496126_0355971_149_820 222
1057 3300049460 Ga0495682_0139946 Ga0495682_0139946_46_717 222
1058 3300050490 nmdc:mga03n38_155829_c1 nmdc:mga03n38_155829_c1_189_866 222
1059 3300050490 nmdc:mga03n38_208_c1 nmdc:mga03n38_208_c1_3130_3807 222
1060 3300050491 nmdc:mga00v17_145883_c1 nmdc:mga00v17_145883_c1_169_846 222
1061 3300050492 nmdc:mga0yw44_66485_c1 nmdc:mga0yw44_66485_c1_1158_1835 222
1062 3300050493 nmdc:mga0k408_122214_c1 nmdc:mga0k408_122214_c1_793_1470 222
1063 3300050495 nmdc:mga04h51_17986_c1 nmdc:mga04h51_17986_c1_674_1351 222
1064 3300050496 nmdc:mga07m45_182616_c1 nmdc:mga07m45_182616_c1_327_1004 222
1065 3300050496 nmdc:mga07m45_74631_c1 nmdc:mga07m45_74631_c1_623_1294 222
1066 3300050513 nmdc:mga0rr50_171235_c1 nmdc:mga0rr50_171235_c1_636_1307 222
1067 3300050516 nmdc:mga0sz30_23037_c2 nmdc:mga0sz30_23037_c2_92_769 222
1068 3300050516 nmdc:mga0sz30_55224_c1 nmdc:mga0sz30_55224_c1_611_1282 222
1069 3300053090 Ga0500646_0064528 Ga0500646_0064528_178_849 222
1070 3300053119 Ga0500595_004072 Ga0500595_004072_3007_3678 222
1071 3300053139 Ga0500568_0005758 Ga0500568_0005758_4972_5655 222
1072 3300053142 Ga0500577_0103682 Ga0500577_0103682_426_1097 222
1073 3300053143 Ga0500579_184734 Ga0500579_184734_56_727 222
1074 3300053161 Ga0500634_0053113 Ga0500634_0053113_1369_2046 222
1075 3300053162 Ga0500638_094379 Ga0500638_094379_494_1165 222
1076 3300053730 Ga0500645_005369 Ga0500645_005369_3230_3907 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

82

228

0.96

PF13098

Thioredoxin_2

Thioredoxin-like domain

75

227

0.92

PF13462

Thioredoxin_4

Thioredoxin

67

229

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.9675 46 217
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.9458 46 217
4gxz-assembly3.cif.gz_C crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium 0.8956 48 215
6eez-assembly1.cif.gz_A crystal structure of the thiol-disulfide exchange protein alpha-dsba2 from wolbachia pipientis 0.8889 38 214
5nyl-assembly2.cif.gz_B crystal structure of an atypical poplar thioredoxin-like2.1 active site mutant 0.8849 66 102
ID Description Score Start End Superfamily
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9445 40 218 3.40.30.10
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9284 40 218 3.40.30.10
af_I1K367_67_180_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9235 66 102 3.40.30.10
af_Q7XSQ7_19_127_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8906 66 102 3.40.30.10
af_Q8LCH9_1_124_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8842 66 102 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7U8KRA5-F1-model_v4 deleted 0.9797 46 217
AF-A0A7W0XMI2-F1-model_v4 DsbA family protein 0.9694 59 216 GO:0016491
AF-T0HJ65-F1-model_v4 Thioredoxin domain-containing protein 0.969 67 216 GO:0016491
AF-A0A529PRT1-F1-model_v4 Disulfide bond formation protein DsbA 0.9683 48 218 GO:0016491
AF-A0A2E9X9V3-F1-model_v4 Thioredoxin domain-containing protein 0.9662 48 222 GO:0015036

Feature Viewer

pLDDT pTM Quality
84.13 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map