F489596
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1077 | 408 | 2154 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10079604|Ga0065704_100796044 |
| Length | 198 |
| Sequence | MLAPWQPLLEWWFGWGTSPQAVADEMSTLWFGKHHDAEAQALFGDLVEHALTGGLEEWQQSPQGWLGLLILLDQLPRMIYRDTPRAFEGDRRAQVVAMQGLQKGWDYQLLPIQRVFVLLVLEHAEVLDWQNLCVERYQMLLDEQPEANRRLFEGFLDYAEQHQRVIARFGRFPHRNLMLERPSTSEEMDFLLEPGSRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 19 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 20 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 21 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 22 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 23 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 24 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 25 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 32 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 33 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 40 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 41 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 42 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 43 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 50 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 62 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 63 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 66 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 68 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 69 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 70 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 71 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 72 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 73 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 74 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 75 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 76 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 77 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 78 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 79 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 80 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 81 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 82 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 83 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 84 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 85 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 86 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 87 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 88 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 89 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 90 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 91 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 92 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 93 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 94 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 95 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 96 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 97 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 98 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 99 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 100 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 101 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 102 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 103 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 104 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 105 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 106 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 107 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 108 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 109 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 110 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 111 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 112 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 113 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 114 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 115 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 116 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 117 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 118 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 119 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 120 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 210 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 211 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 212 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 213 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 214 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 215 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 216 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 217 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 224 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 225 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 226 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 227 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 228 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 229 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 230 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 231 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 232 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 233 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 234 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 235 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 236 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 237 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 238 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 239 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 240 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 241 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 242 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 243 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 244 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 245 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 246 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 247 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 248 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 249 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 250 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 251 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 252 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 253 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 254 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 255 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 256 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 257 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 258 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 259 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 260 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 261 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 262 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 263 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 264 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 265 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 266 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 267 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 268 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 269 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 270 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 271 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 272 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 273 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 274 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 275 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 276 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 277 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 278 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 279 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 280 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 281 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 282 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 283 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 284 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 285 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 286 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 287 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 288 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 289 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 290 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 291 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 292 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 293 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 294 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 295 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 296 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 297 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 298 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 299 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 300 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 301 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 302 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 303 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 304 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 305 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 306 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 307 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 308 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 309 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 310 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 311 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 312 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 313 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 314 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 315 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 316 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 317 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 318 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 319 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 320 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 321 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 322 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 323 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 324 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 325 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 326 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 327 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 328 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 329 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 330 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 331 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 332 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 333 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 334 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 335 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 336 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 337 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 338 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 339 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 340 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 341 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 342 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 343 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 344 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 345 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 346 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 347 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 348 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 349 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 350 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 351 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 352 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 353 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 354 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 355 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 356 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 357 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 358 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 359 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 360 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 361 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 362 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 363 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 364 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 365 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 366 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 367 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 368 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 369 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 370 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 371 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 372 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 373 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 374 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 375 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 376 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 377 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 378 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 379 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 380 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 381 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 382 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 383 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 384 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 385 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 386 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 387 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 388 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 389 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 390 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 391 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 392 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 393 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 394 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 395 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 396 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 397 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 398 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 399 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 400 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 401 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 402 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 403 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 404 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 405 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 406 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 407 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 408 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.29 |
| Metatranscriptomes | 0 |
| Isolates | 16.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.74 |
| Nodule | 2.88 |
| Rhizoplane | 6.78 |
| Rhizosphere | 75.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10079604 | 3300005289 | Bacteria | 4119 |
| 2 | MRS2a_Contig_52 | 2124908027 | Bacteria | 34043 |
| 3 | SwRhRL2b_contig_1475603 | 2162886007 | Bacteria | 952 |
| 4 | MRS1b_contig_2669205 | 2162886011 | Bacteria | 2215 |
| 5 | JGI25162J39368_1000129 | 3300002737 | Bacteria | 83712 |
| 6 | JGI25163J39215_1001408 | 3300002771 | Bacteria | 4027 |
| 7 | JGI25163J39215_1001444 | 3300002771 | Bacteria | 3909 |
| 8 | JGI25164J39214_1000076 | 3300002772 | Bacteria | 95821 |
| 9 | JGI25164J39214_1000101 | 3300002772 | Bacteria | 83715 |
| 10 | JGI25165J46597_1000150 | 3300003214 | Bacteria | 115430 |
| 11 | JGI25165J46597_1000180 | 3300003214 | Bacteria | 95821 |
| 12 | Ga0055536_1000312 | 3300003781 | Bacteria | 36538 |
| 13 | Ga0055536_1003306 | 3300003781 | Bacteria | 8724 |
| 14 | Ga0055536_1021229 | 3300003781 | Bacteria | 1977 |
| 15 | Ga0055530_10000404 | 3300003791 | Bacteria | 38699 |
| 16 | Ga0055530_10003582 | 3300003791 | Bacteria | 8724 |
| 17 | Ga0055530_10003672 | 3300003791 | Bacteria | 8572 |
| 18 | Ga0055540_1000339 | 3300003792 | Bacteria | 40092 |
| 19 | Ga0055540_1002883 | 3300003792 | Bacteria | 8724 |
| 20 | Ga0055540_1002945 | 3300003792 | Bacteria | 8563 |
| 21 | Ga0055531_10000238 | 3300003794 | Bacteria | 60414 |
| 22 | Ga0065714_10002970 | 3300005288 | Bacteria | 9705 |
| 23 | Ga0065714_10009649 | 3300005288 | Bacteria | 3854 |
| 24 | Ga0065714_10013965 | 3300005288 | Bacteria | 1968 |
| 25 | Ga0065714_10065496 | 3300005288 | Bacteria | 9739 |
| 26 | Ga0065714_10105677 | 3300005288 | Bacteria | 1562 |
| 27 | Ga0065714_10236865 | 3300005288 | Bacteria | 799 |
| 28 | Ga0065704_10071810 | 3300005289 | Bacteria | 9874 |
| 29 | Ga0065704_10132020 | 3300005289 | Bacteria | 1616 |
| 30 | Ga0065704_10252860 | 3300005289 | Bacteria | 985 |
| 31 | Ga0065704_10336932 | 3300005289 | Bacteria | 829 |
| 32 | Ga0065712_10011023 | 3300005290 | Bacteria | 1890 |
| 33 | Ga0070669_100000233 | 3300005353 | Bacteria | 46639 |
| 34 | Ga0070662_100050060 | 3300005457 | Bacteria | 3013 |
| 35 | Ga0070665_100851998 | 3300005548 | Bacteria | 924 |
| 36 | Ga0075364_10382202 | 3300006051 | Bacteria | 960 |
| 37 | Ga0075364_10435456 | 3300006051 | Bacteria | 896 |
| 38 | Ga0075432_10001952 | 3300006058 | Bacteria | 6850 |
| 39 | Ga0075432_10061096 | 3300006058 | Bacteria | 1341 |
| 40 | Ga0075432_10074320 | 3300006058 | Bacteria | 1224 |
| 41 | Ga0075432_10133939 | 3300006058 | Bacteria | 940 |
| 42 | Ga0075362_10170789 | 3300006177 | Bacteria | 1050 |
| 43 | Ga0075436_100070423 | 3300006914 | Bacteria | 2418 |
| 44 | Ga0075436_100403642 | 3300006914 | Bacteria | 990 |
| 45 | Ga0099823_1007118 | 3300006944 | Bacteria | 11327 |
| 46 | Ga0099823_1088359 | 3300006944 | Bacteria | 1089 |
| 47 | Ga0079104_1000423 | 3300006946 | Bacteria | 48297 |
| 48 | Ga0079104_1001202 | 3300006946 | Bacteria | 18420 |
| 49 | Ga0079104_1082988 | 3300006946 | Bacteria | 657 |
| 50 | Ga0099826_10031348 | 3300006948 | Bacteria | 3847 |
| 51 | Ga0105251_10057788 | 3300009011 | Bacteria | 1833 |
| 52 | Ga0105251_10065668 | 3300009011 | Bacteria | 1698 |
| 53 | Ga0105251_10209644 | 3300009011 | Bacteria | 877 |
| 54 | Ga0105244_10008644 | 3300009036 | Bacteria | 6342 |
| 55 | Ga0105244_10009518 | 3300009036 | Bacteria | 5968 |
| 56 | Ga0105244_10009952 | 3300009036 | Bacteria | 5797 |
| 57 | Ga0105244_10013527 | 3300009036 | Bacteria | 4764 |
| 58 | Ga0105244_10016561 | 3300009036 | Bacteria | 4195 |
| 59 | Ga0105244_10039366 | 3300009036 | Bacteria | 2461 |
| 60 | Ga0105244_10072826 | 3300009036 | Bacteria | 1711 |
| 61 | Ga0105244_10087337 | 3300009036 | Bacteria | 1537 |
| 62 | Ga0105244_10093106 | 3300009036 | Bacteria | 1480 |
| 63 | Ga0105244_10221878 | 3300009036 | Bacteria | 886 |
| 64 | Ga0105250_10001638 | 3300009092 | Bacteria | 11927 |
| 65 | Ga0105250_10018379 | 3300009092 | Bacteria | 2832 |
| 66 | Ga0105250_10028488 | 3300009092 | Bacteria | 2249 |
| 67 | Ga0105250_10053860 | 3300009092 | Bacteria | 1614 |
| 68 | Ga0105250_10105964 | 3300009092 | Bacteria | 1149 |
| 69 | Ga0105250_10170766 | 3300009092 | Bacteria | 910 |
| 70 | Ga0105243_10000299 | 3300009148 | Bacteria | 54796 |
| 71 | Ga0105243_10001887 | 3300009148 | Bacteria | 17864 |
| 72 | Ga0105243_10047304 | 3300009148 | Bacteria | 3386 |
| 73 | Ga0105243_10137242 | 3300009148 | Bacteria | 2082 |
| 74 | Ga0105242_10328437 | 3300009176 | Bacteria | 1405 |
| 75 | Ga0105242_11163892 | 3300009176 | Bacteria | 789 |
| 76 | Ga0105246_10002004 | 3300011119 | Bacteria | 12297 |
| 77 | Ga0105246_10101845 | 3300011119 | Bacteria | 2093 |
| 78 | Ga0157345_1001666 | 3300012498 | Bacteria | 1559 |
| 79 | Ga0157347_1031758 | 3300012502 | Bacteria | 664 |
| 80 | Ga0157373_10000945 | 3300013100 | Bacteria | 22511 |
| 81 | Ga0157373_10147580 | 3300013100 | Bacteria | 1654 |
| 82 | Ga0157373_10177542 | 3300013100 | Bacteria | 1499 |
| 83 | Ga0157371_10004002 | 3300013102 | Bacteria | 13059 |
| 84 | Ga0157371_10005478 | 3300013102 | Bacteria | 10690 |
| 85 | Ga0157371_10012849 | 3300013102 | Bacteria | 6377 |
| 86 | Ga0157371_10304475 | 3300013102 | Bacteria | 1154 |
| 87 | Ga0157371_10361784 | 3300013102 | Bacteria | 1057 |
| 88 | Ga0157371_10623606 | 3300013102 | Bacteria | 803 |
| 89 | Ga0157370_10023954 | 3300013104 | Bacteria | 6052 |
| 90 | Ga0157370_10056033 | 3300013104 | Bacteria | 3753 |
| 91 | Ga0157370_10112108 | 3300013104 | Bacteria | 2550 |
| 92 | Ga0157370_10265443 | 3300013104 | Bacteria | 1586 |
| 93 | Ga0157370_10526386 | 3300013104 | Bacteria | 1085 |
| 94 | Ga0157370_10559520 | 3300013104 | Bacteria | 1048 |
| 95 | Ga0157369_10068916 | 3300013105 | Bacteria | 3801 |
| 96 | Ga0157369_10108625 | 3300013105 | Bacteria | 2950 |
| 97 | Ga0157369_10538158 | 3300013105 | Bacteria | 1208 |
| 98 | Ga0157369_10643160 | 3300013105 | Bacteria | 1094 |
| 99 | Ga0163162_10023363 | 3300013306 | Bacteria | 6102 |
| 100 | Ga0163162_10313239 | 3300013306 | Bacteria | 1702 |
| 101 | Ga0157372_10105826 | 3300013307 | Bacteria | 3218 |
| 102 | Ga0182008_10003739 | 3300014497 | Bacteria | 9067 |
| 103 | Ga0182008_10007470 | 3300014497 | Bacteria | 6031 |
| 104 | Ga0182008_10008836 | 3300014497 | Bacteria | 5468 |
| 105 | Ga0182008_10023268 | 3300014497 | Bacteria | 3167 |
| 106 | Ga0182008_10026929 | 3300014497 | Bacteria | 2914 |
| 107 | Ga0182008_10046317 | 3300014497 | Bacteria | 2162 |
| 108 | Ga0182008_10084800 | 3300014497 | Bacteria | 1560 |
| 109 | Ga0182008_10207141 | 3300014497 | Bacteria | 999 |
| 110 | Ga0182008_10365040 | 3300014497 | Bacteria | 769 |
| 111 | Ga0182006_1000753 | 3300015261 | Bacteria | 22122 |
| 112 | Ga0182006_1005124 | 3300015261 | Bacteria | 6297 |
| 113 | Ga0182006_1020800 | 3300015261 | Bacteria | 2745 |
| 114 | Ga0182006_1026552 | 3300015261 | Bacteria | 2369 |
| 115 | Ga0182006_1044318 | 3300015261 | Bacteria | 1735 |
| 116 | Ga0182006_1058122 | 3300015261 | Bacteria | 1468 |
| 117 | Ga0182007_10001061 | 3300015262 | Bacteria | 14989 |
| 118 | Ga0182007_10040384 | 3300015262 | Bacteria | 1558 |
| 119 | Ga0182007_10057015 | 3300015262 | Bacteria | 1282 |
| 120 | Ga0182007_10136843 | 3300015262 | Bacteria | 827 |
| 121 | Ga0182005_1002918 | 3300015265 | Bacteria | 5939 |
| 122 | Ga0182005_1021781 | 3300015265 | Bacteria | 1757 |
| 123 | Ga0182005_1023237 | 3300015265 | Bacteria | 1696 |
| 124 | Ga0182005_1036292 | 3300015265 | Bacteria | 1340 |
| 125 | Ga0163161_10016885 | 3300017792 | Bacteria | 5102 |
| 126 | Ga0163161_10029907 | 3300017792 | Bacteria | 3873 |
| 127 | Ga0163161_10036066 | 3300017792 | Bacteria | 3541 |
| 128 | Ga0163161_10151877 | 3300017792 | Bacteria | 1760 |
| 129 | Ga0163161_10708586 | 3300017792 | Bacteria | 839 |
| 130 | Ga0209760_100080 | 3300025207 | Bacteria | 77279 |
| 131 | Ga0209760_100159 | 3300025207 | Bacteria | 40609 |
| 132 | Ga0209563_102899 | 3300025230 | Bacteria | 3712 |
| 133 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 134 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 135 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 136 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 137 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 138 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 139 | Ga0209675_1007415 | 3300025291 | Bacteria | 4210 |
| 140 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 141 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 142 | Ga0209676_1000208 | 3300025292 | Bacteria | 130879 |
| 143 | Ga0209676_1000519 | 3300025292 | Bacteria | 60439 |
| 144 | Ga0209676_1008270 | 3300025292 | Bacteria | 4673 |
| 145 | Ga0209676_1011363 | 3300025292 | Bacteria | 3598 |
| 146 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 147 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 148 | Ga0209050_1000381 | 3300025298 | Bacteria | 83623 |
| 149 | Ga0209050_1004298 | 3300025298 | Bacteria | 9733 |
| 150 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 151 | Ga0209051_1000039 | 3300025303 | Bacteria | 319632 |
| 152 | Ga0209051_1000047 | 3300025303 | Bacteria | 293227 |
| 153 | Ga0209051_1000080 | 3300025303 | Bacteria | 199694 |
| 154 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 155 | Ga0209257_1025113 | 3300025304 | Bacteria | 2044 |
| 156 | Ga0207696_1000057 | 3300025711 | Bacteria | 249404 |
| 157 | Ga0207696_1000074 | 3300025711 | Bacteria | 215333 |
| 158 | Ga0207696_1001528 | 3300025711 | Bacteria | 12402 |
| 159 | Ga0207696_1001618 | 3300025711 | Bacteria | 11910 |
| 160 | Ga0207696_1001785 | 3300025711 | Bacteria | 11107 |
| 161 | Ga0207696_1012979 | 3300025711 | Bacteria | 2925 |
| 162 | Ga0207696_1021497 | 3300025711 | Bacteria | 2065 |
| 163 | Ga0207696_1024317 | 3300025711 | Bacteria | 1901 |
| 164 | Ga0207655_1001007 | 3300025728 | Bacteria | 28675 |
| 165 | Ga0207655_1001190 | 3300025728 | Bacteria | 25175 |
| 166 | Ga0207655_1001386 | 3300025728 | Bacteria | 22646 |
| 167 | Ga0207655_1002635 | 3300025728 | Bacteria | 14206 |
| 168 | Ga0207655_1004551 | 3300025728 | Bacteria | 9772 |
| 169 | Ga0207655_1008767 | 3300025728 | Bacteria | 6367 |
| 170 | Ga0207655_1008967 | 3300025728 | Bacteria | 6273 |
| 171 | Ga0207655_1009044 | 3300025728 | Bacteria | 6237 |
| 172 | Ga0207655_1014720 | 3300025728 | Bacteria | 4400 |
| 173 | Ga0207655_1025214 | 3300025728 | Bacteria | 2892 |
| 174 | Ga0207655_1029864 | 3300025728 | Bacteria | 2544 |
| 175 | Ga0207655_1030573 | 3300025728 | Bacteria | 2502 |
| 176 | Ga0207655_1042014 | 3300025728 | Bacteria | 1952 |
| 177 | Ga0207655_1158757 | 3300025728 | Bacteria | 709 |
| 178 | Ga0207713_1002649 | 3300025735 | Bacteria | 12860 |
| 179 | Ga0207713_1002650 | 3300025735 | Bacteria | 12853 |
| 180 | Ga0207713_1008684 | 3300025735 | Bacteria | 5807 |
| 181 | Ga0207713_1015567 | 3300025735 | Bacteria | 3897 |
| 182 | Ga0207713_1018900 | 3300025735 | Bacteria | 3394 |
| 183 | Ga0207713_1020907 | 3300025735 | Bacteria | 3152 |
| 184 | Ga0207713_1035758 | 3300025735 | Bacteria | 2140 |
| 185 | Ga0207713_1036589 | 3300025735 | Bacteria | 2104 |
| 186 | Ga0207713_1036810 | 3300025735 | Bacteria | 2095 |
| 187 | Ga0207713_1041267 | 3300025735 | Bacteria | 1927 |
| 188 | Ga0207713_1048553 | 3300025735 | Bacteria | 1708 |
| 189 | Ga0207713_1152342 | 3300025735 | Bacteria | 745 |
| 190 | Ga0207681_10003730 | 3300025923 | Bacteria | 9469 |
| 191 | Ga0207706_10150088 | 3300025933 | Bacteria | 2050 |
| 192 | Ga0207686_10240835 | 3300025934 | Bacteria | 1316 |
| 193 | Ga0207686_10693268 | 3300025934 | Bacteria | 809 |
| 194 | Ga0207709_10000451 | 3300025935 | Bacteria | 38328 |
| 195 | Ga0207709_10001143 | 3300025935 | Bacteria | 19344 |
| 196 | Ga0207709_10014819 | 3300025935 | Bacteria | 4310 |
| 197 | Ga0207709_10235104 | 3300025935 | Bacteria | 1330 |
| 198 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 199 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 200 | Ga0209281_1008220 | 3300027111 | Bacteria | 2553 |
| 201 | Ga0209281_1037826 | 3300027111 | Bacteria | 827 |
| 202 | Ga0209281_1039692 | 3300027111 | Bacteria | 798 |
| 203 | Ga0209389_1000190 | 3300027296 | Bacteria | 46313 |
| 204 | Ga0209389_1073805 | 3300027296 | Bacteria | 1800 |
| 205 | Ga0209371_1000630 | 3300027312 | Bacteria | 31210 |
| 206 | Ga0209371_1057069 | 3300027312 | Bacteria | 729 |
| 207 | Ga0209999_1035782 | 3300027543 | Bacteria | 926 |
| 208 | Ga0207428_10068561 | 3300027907 | Bacteria | 2790 |
| 209 | Ga0207428_10086363 | 3300027907 | Bacteria | 2442 |
| 210 | Ga0207428_10173455 | 3300027907 | Bacteria | 1632 |
| 211 | Ga0207428_10188003 | 3300027907 | Bacteria | 1558 |
| 212 | Ga0207428_10461898 | 3300027907 | Bacteria | 925 |
| 213 | Ga0268266_10010145 | 3300028379 | Bacteria | 8256 |
| 214 | Ga0268266_10051944 | 3300028379 | Bacteria | 3519 |
| 215 | Ga0268256_1000273 | 3300030500 | Bacteria | 53445 |
| 216 | Ga0268256_1063969 | 3300030500 | Bacteria | 729 |
| 217 | Ga0307511_10145036 | 3300030521 | Bacteria | 1382 |
| 218 | Ga0316177_1034781 | 3300030731 | Bacteria | 1906 |
| 219 | Ga0316177_1094337 | 3300030731 | Bacteria | 753 |
| 220 | Ga0314311_1075429 | 3300030733 | Bacteria | 7772 |
| 221 | Ga0316179_1046502 | 3300030734 | Bacteria | 2906 |
| 222 | Ga0316178_1102168 | 3300030735 | Bacteria | 42019 |
| 223 | Ga0316181_1032700 | 3300030744 | Bacteria | 1561 |
| 224 | Ga0316181_1121023 | 3300030744 | Bacteria | 6205 |
| 225 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 226 | Ga0307408_100012498 | 3300031548 | Bacteria | 5627 |
| 227 | Ga0307408_100235261 | 3300031548 | Bacteria | 1502 |
| 228 | Ga0307408_100247501 | 3300031548 | Bacteria | 1468 |
| 229 | Ga0307408_100270026 | 3300031548 | Bacteria | 1411 |
| 230 | Ga0307408_100473090 | 3300031548 | Bacteria | 1091 |
| 231 | Ga0307516_10150724 | 3300031730 | Bacteria | 2086 |
| 232 | Ga0307405_10008242 | 3300031731 | Bacteria | 5270 |
| 233 | Ga0307405_10208162 | 3300031731 | Bacteria | 1426 |
| 234 | Ga0307405_11060458 | 3300031731 | Bacteria | 694 |
| 235 | Ga0307406_10075207 | 3300031901 | Bacteria | 2227 |
| 236 | Ga0307406_10449820 | 3300031901 | Bacteria | 1033 |
| 237 | Ga0307412_10019210 | 3300031911 | Bacteria | 4132 |
| 238 | Ga0307412_10022176 | 3300031911 | Bacteria | 3889 |
| 239 | Ga0307412_10074041 | 3300031911 | Bacteria | 2332 |
| 240 | Ga0307412_10383636 | 3300031911 | Bacteria | 1138 |
| 241 | Ga0307409_100098675 | 3300031995 | Bacteria | 2416 |
| 242 | Ga0307416_100603663 | 3300032002 | Bacteria | 1177 |
| 243 | Ga0307416_100732095 | 3300032002 | Bacteria | 1080 |
| 244 | Ga0307414_10026090 | 3300032004 | Bacteria | 3755 |
| 245 | Ga0307414_10180202 | 3300032004 | Bacteria | 1698 |
| 246 | Ga0307411_10017361 | 3300032005 | Bacteria | 4098 |
| 247 | Ga0307411_10020058 | 3300032005 | Bacteria | 3878 |
| 248 | Ga0307411_10269808 | 3300032005 | Bacteria | 1348 |
| 249 | Ga0307510_10062849 | 3300033180 | Bacteria | 3788 |
| 250 | Ga0237819_01489 | 3300038705 | Bacteria | 6005 |
| 251 | Ga0439436_0023073 | 3300041404 | Bacteria | 1841 |
| 252 | Ga0439438_001802 | 3300041405 | Bacteria | 9402 |
| 253 | Ga0439438_003654 | 3300041405 | Bacteria | 6145 |
| 254 | Ga0439438_004828 | 3300041405 | Bacteria | 5080 |
| 255 | Ga0439438_005738 | 3300041405 | Bacteria | 4514 |
| 256 | Ga0439438_016022 | 3300041405 | Bacteria | 2188 |
| 257 | Ga0439438_016104 | 3300041405 | Bacteria | 2180 |
| 258 | Ga0439438_018083 | 3300041405 | Bacteria | 2014 |
| 259 | Ga0439438_036906 | 3300041405 | Bacteria | 1279 |
| 260 | Ga0439438_091702 | 3300041405 | Bacteria | 739 |
| 261 | Ga0439447_002676 | 3300041407 | Bacteria | 6451 |
| 262 | Ga0439447_003145 | 3300041407 | Bacteria | 5885 |
| 263 | Ga0439447_004670 | 3300041407 | Bacteria | 4667 |
| 264 | Ga0439447_023317 | 3300041407 | Bacteria | 1614 |
| 265 | Ga0439447_023670 | 3300041407 | Bacteria | 1597 |
| 266 | Ga0439447_034585 | 3300041407 | Bacteria | 1255 |
| 267 | Ga0439447_037076 | 3300041407 | Bacteria | 1202 |
| 268 | Ga0439447_040885 | 3300041407 | Bacteria | 1130 |
| 269 | Ga0439466_0001279 | 3300041411 | Bacteria | 9786 |
| 270 | Ga0439466_0002609 | 3300041411 | Bacteria | 7054 |
| 271 | Ga0439466_0007307 | 3300041411 | Bacteria | 4183 |
| 272 | Ga0439466_0012672 | 3300041411 | Bacteria | 3099 |
| 273 | Ga0439466_0017279 | 3300041411 | Bacteria | 2600 |
| 274 | Ga0439466_0019640 | 3300041411 | Bacteria | 2417 |
| 275 | Ga0439466_0019683 | 3300041411 | Bacteria | 2414 |
| 276 | Ga0439466_0034938 | 3300041411 | Bacteria | 1702 |
| 277 | Ga0439466_0045757 | 3300041411 | Bacteria | 1446 |
| 278 | Ga0439466_0067547 | 3300041411 | Bacteria | 1143 |
| 279 | Ga0439465_0049967 | 3300041413 | Bacteria | 1367 |
| 280 | Ga0439465_0159963 | 3300041413 | Bacteria | 807 |
| 281 | Ga0451841_0662075 | 3300041498 | Bacteria | 947 |
| 282 | Ga0439442_065256 | 3300042002 | Bacteria | 773 |
| 283 | Ga0439445_0024078 | 3300042004 | Bacteria | 1545 |
| 284 | Ga0439432_000595 | 3300042006 | Bacteria | 13598 |
| 285 | Ga0439432_000775 | 3300042006 | Bacteria | 11997 |
| 286 | Ga0439432_006348 | 3300042006 | Bacteria | 4229 |
| 287 | Ga0439432_013395 | 3300042006 | Bacteria | 2789 |
| 288 | Ga0439432_103675 | 3300042006 | Bacteria | 849 |
| 289 | Ga0439451_000219 | 3300042009 | Bacteria | 10960 |
| 290 | Ga0439451_002362 | 3300042009 | Bacteria | 3820 |
| 291 | Ga0439451_021435 | 3300042009 | Bacteria | 1303 |
| 292 | Ga0439451_029436 | 3300042009 | Bacteria | 1105 |
| 293 | Ga0439451_036052 | 3300042009 | Bacteria | 994 |
| 294 | Ga0439451_054542 | 3300042009 | Bacteria | 800 |
| 295 | Ga0439452_000786 | 3300042010 | Bacteria | 15052 |
| 296 | Ga0439452_000858 | 3300042010 | Bacteria | 14069 |
| 297 | Ga0439452_000882 | 3300042010 | Bacteria | 13826 |
| 298 | Ga0439452_002364 | 3300042010 | Bacteria | 7004 |
| 299 | Ga0439452_003489 | 3300042010 | Bacteria | 5498 |
| 300 | Ga0439452_007333 | 3300042010 | Bacteria | 3384 |
| 301 | Ga0439452_019195 | 3300042010 | Bacteria | 1811 |
| 302 | Ga0439452_053247 | 3300042010 | Bacteria | 921 |
| 303 | Ga0439456_001434 | 3300042013 | Bacteria | 4790 |
| 304 | Ga0439456_013110 | 3300042013 | Bacteria | 1723 |
| 305 | Ga0439456_034888 | 3300042013 | Bacteria | 1084 |
| 306 | Ga0439456_037733 | 3300042013 | Bacteria | 1043 |
| 307 | Ga0439456_103814 | 3300042013 | Bacteria | 644 |
| 308 | Ga0439463_000059 | 3300042016 | Bacteria | 23483 |
| 309 | Ga0439463_000975 | 3300042016 | Bacteria | 7795 |
| 310 | Ga0439463_023114 | 3300042016 | Bacteria | 1557 |
| 311 | Ga0439463_024566 | 3300042016 | Bacteria | 1510 |
| 312 | Ga0439463_039072 | 3300042016 | Bacteria | 1205 |
| 313 | Ga0450911_000355 | 3300042115 | Bacteria | 15573 |
| 314 | Ga0450911_008084 | 3300042115 | Bacteria | 1506 |
| 315 | Ga0450919_003787 | 3300042121 | Bacteria | 1876 |
| 316 | Ga0450922_002212 | 3300042124 | Bacteria | 1840 |
| 317 | Ga0450922_013753 | 3300042124 | Bacteria | 793 |
| 318 | Ga0450923_000363 | 3300042125 | Bacteria | 4730 |
| 319 | Ga0450923_027521 | 3300042125 | Bacteria | 1143 |
| 320 | Ga0450900_010246 | 3300042136 | Bacteria | 1199 |
| 321 | Ga0450902_006084 | 3300042137 | Bacteria | 1840 |
| 322 | Ga0450902_007993 | 3300042137 | Bacteria | 1644 |
| 323 | Ga0450902_013193 | 3300042137 | Bacteria | 1330 |
| 324 | Ga0450902_019776 | 3300042137 | Bacteria | 1109 |
| 325 | Ga0450902_023966 | 3300042137 | Bacteria | 1014 |
| 326 | Ga0450903_014745 | 3300042138 | Bacteria | 1235 |
| 327 | Ga0450904_001666 | 3300042139 | Bacteria | 2980 |
| 328 | Ga0450904_009174 | 3300042139 | Bacteria | 975 |
| 329 | Ga0450904_014253 | 3300042139 | Bacteria | 792 |
| 330 | Ga0450905_002901 | 3300042142 | Bacteria | 2231 |
| 331 | Ga0450905_034651 | 3300042142 | Bacteria | 788 |
| 332 | Ga0450906_014183 | 3300042145 | Bacteria | 1461 |
| 333 | Ga0450906_035512 | 3300042145 | Bacteria | 879 |
| 334 | Ga0450907_000751 | 3300042146 | Bacteria | 8228 |
| 335 | Ga0450907_005713 | 3300042146 | Bacteria | 2094 |
| 336 | Ga0450907_005795 | 3300042146 | Bacteria | 2077 |
| 337 | Ga0450910_012410 | 3300042147 | Bacteria | 1231 |
| 338 | Ga0450910_020715 | 3300042147 | Bacteria | 992 |
| 339 | Ga0439446_0000081 | 3300042156 | Bacteria | 15751 |
| 340 | Ga0439446_0009359 | 3300042156 | Bacteria | 2622 |
| 341 | Ga0439446_0065059 | 3300042156 | Bacteria | 1108 |
| 342 | Ga0450908_014825 | 3300042184 | Bacteria | 1398 |
| 343 | Ga0450908_018726 | 3300042184 | Bacteria | 1222 |
| 344 | Ga0450909_014786 | 3300042185 | Bacteria | 1149 |
| 345 | Ga0439434_0001340 | 3300042435 | Bacteria | 7096 |
| 346 | Ga0439434_0013350 | 3300042435 | Bacteria | 2438 |
| 347 | Ga0439464_0000180 | 3300042439 | Bacteria | 10873 |
| 348 | Ga0439464_0014826 | 3300042439 | Bacteria | 2099 |
| 349 | Ga0439460_0007942 | 3300042461 | Bacteria | 2669 |
| 350 | Ga0439460_0026436 | 3300042461 | Bacteria | 1623 |
| 351 | Ga0450918_035818 | 3300042531 | Bacteria | 883 |
| 352 | Ga0450893_0011986 | 3300042532 | Bacteria | 1436 |
| 353 | Ga0450901_001588 | 3300042533 | Bacteria | 2570 |
| 354 | Ga0439440_0019024 | 3300042993 | Bacteria | 1527 |
| 355 | Ga0439440_0024970 | 3300042993 | Bacteria | 1373 |
| 356 | Ga0439440_0054586 | 3300042993 | Bacteria | 1006 |
| 357 | Ga0495617_000455 | 3300046452 | Bacteria | 22035 |
| 358 | Ga0495617_008242 | 3300046452 | Bacteria | 3596 |
| 359 | Ga0495617_010516 | 3300046452 | Bacteria | 3170 |
| 360 | Ga0495617_018854 | 3300046452 | Bacteria | 2334 |
| 361 | Ga0495617_027193 | 3300046452 | Bacteria | 1925 |
| 362 | Ga0495617_037441 | 3300046452 | Bacteria | 1624 |
| 363 | Ga0495617_037529 | 3300046452 | Bacteria | 1622 |
| 364 | Ga0495617_052407 | 3300046452 | Bacteria | 1355 |
| 365 | Ga0495627_005394 | 3300046453 | Bacteria | 5160 |
| 366 | Ga0495627_025389 | 3300046453 | Bacteria | 1922 |
| 367 | Ga0495627_045176 | 3300046453 | Bacteria | 1342 |
| 368 | Ga0495627_052872 | 3300046453 | Bacteria | 1217 |
| 369 | Ga0495603_0069851 | 3300046455 | Bacteria | 2065 |
| 370 | Ga0495603_0200734 | 3300046455 | Bacteria | 1152 |
| 371 | Ga0495603_0328673 | 3300046455 | Bacteria | 877 |
| 372 | Ga0495603_0336349 | 3300046455 | Bacteria | 866 |
| 373 | Ga0495590_0003662 | 3300046457 | Bacteria | 6255 |
| 374 | Ga0495590_0005324 | 3300046457 | Bacteria | 5109 |
| 375 | Ga0495590_0035972 | 3300046457 | Bacteria | 1728 |
| 376 | Ga0495590_0043579 | 3300046457 | Bacteria | 1564 |
| 377 | Ga0495590_0072389 | 3300046457 | Bacteria | 1210 |
| 378 | Ga0495590_0154541 | 3300046457 | Bacteria | 832 |
| 379 | Ga0495590_0222446 | 3300046457 | Bacteria | 697 |
| 380 | Ga0495590_0224123 | 3300046457 | Bacteria | 695 |
| 381 | Ga0495591_000668 | 3300046458 | Bacteria | 25300 |
| 382 | Ga0495591_002443 | 3300046458 | Bacteria | 10336 |
| 383 | Ga0495591_004511 | 3300046458 | Bacteria | 6779 |
| 384 | Ga0495591_009614 | 3300046458 | Bacteria | 3824 |
| 385 | Ga0495591_011156 | 3300046458 | Bacteria | 3421 |
| 386 | Ga0495591_019077 | 3300046458 | Bacteria | 2306 |
| 387 | Ga0495591_027027 | 3300046458 | Bacteria | 1774 |
| 388 | Ga0495591_029507 | 3300046458 | Bacteria | 1665 |
| 389 | Ga0495591_044350 | 3300046458 | Bacteria | 1246 |
| 390 | Ga0495591_049763 | 3300046458 | Bacteria | 1150 |
| 391 | Ga0495591_055672 | 3300046458 | Bacteria | 1065 |
| 392 | Ga0495591_082483 | 3300046458 | Bacteria | 817 |
| 393 | Ga0495591_096415 | 3300046458 | Bacteria | 737 |
| 394 | Ga0495629_0123644 | 3300046459 | Bacteria | 1802 |
| 395 | Ga0495638_0012439 | 3300046460 | Bacteria | 5834 |
| 396 | Ga0495638_0028218 | 3300046460 | Bacteria | 3625 |
| 397 | Ga0495638_0035196 | 3300046460 | Bacteria | 3193 |
| 398 | Ga0495638_0061880 | 3300046460 | Bacteria | 2311 |
| 399 | Ga0495638_0068844 | 3300046460 | Bacteria | 2169 |
| 400 | Ga0495638_0084640 | 3300046460 | Bacteria | 1919 |
| 401 | Ga0495638_0095065 | 3300046460 | Bacteria | 1790 |
| 402 | Ga0495638_0098972 | 3300046460 | Bacteria | 1746 |
| 403 | Ga0495638_0115535 | 3300046460 | Bacteria | 1590 |
| 404 | Ga0495638_0162267 | 3300046460 | Bacteria | 1288 |
| 405 | Ga0495638_0196748 | 3300046460 | Bacteria | 1140 |
| 406 | Ga0495638_0258099 | 3300046460 | Bacteria | 957 |
| 407 | Ga0495638_0440320 | 3300046460 | Bacteria | 667 |
| 408 | Ga0495650_0000718 | 3300046471 | Bacteria | 42025 |
| 409 | Ga0495650_0009711 | 3300046471 | Bacteria | 5451 |
| 410 | Ga0495650_0025619 | 3300046471 | Bacteria | 2759 |
| 411 | Ga0495650_0035372 | 3300046471 | Bacteria | 2199 |
| 412 | Ga0495650_0037040 | 3300046471 | Bacteria | 2127 |
| 413 | Ga0495650_0058180 | 3300046471 | Bacteria | 1561 |
| 414 | Ga0495650_0070280 | 3300046471 | Bacteria | 1375 |
| 415 | Ga0495650_0090063 | 3300046471 | Bacteria | 1168 |
| 416 | Ga0495650_0139875 | 3300046471 | Bacteria | 876 |
| 417 | Ga0495650_0187509 | 3300046471 | Bacteria | 724 |
| 418 | Ga0495582_0051045 | 3300046473 | Bacteria | 2280 |
| 419 | Ga0495605_0005176 | 3300046474 | Bacteria | 7598 |
| 420 | Ga0495605_0009136 | 3300046474 | Bacteria | 5576 |
| 421 | Ga0495605_0034883 | 3300046474 | Bacteria | 2544 |
| 422 | Ga0495605_0039788 | 3300046474 | Bacteria | 2353 |
| 423 | Ga0495605_0062241 | 3300046474 | Bacteria | 1783 |
| 424 | Ga0495605_0104383 | 3300046474 | Bacteria | 1299 |
| 425 | Ga0495605_0111678 | 3300046474 | Bacteria | 1246 |
| 426 | Ga0495605_0203645 | 3300046474 | Bacteria | 861 |
| 427 | Ga0495605_0235409 | 3300046474 | Bacteria | 787 |
| 428 | Ga0495639_0001263 | 3300046475 | Bacteria | 11392 |
| 429 | Ga0495639_0023584 | 3300046475 | Bacteria | 2706 |
| 430 | Ga0495639_0088834 | 3300046475 | Bacteria | 1447 |
| 431 | Ga0495584_0003386 | 3300046491 | Bacteria | 8802 |
| 432 | Ga0495584_0007989 | 3300046491 | Bacteria | 5498 |
| 433 | Ga0495584_0009605 | 3300046491 | Bacteria | 4983 |
| 434 | Ga0495584_0009780 | 3300046491 | Bacteria | 4932 |
| 435 | Ga0495584_0012470 | 3300046491 | Bacteria | 4338 |
| 436 | Ga0495584_0016376 | 3300046491 | Bacteria | 3780 |
| 437 | Ga0495584_0026970 | 3300046491 | Bacteria | 2910 |
| 438 | Ga0495584_0052857 | 3300046491 | Bacteria | 2044 |
| 439 | Ga0495584_0065932 | 3300046491 | Bacteria | 1821 |
| 440 | Ga0495584_0085372 | 3300046491 | Bacteria | 1590 |
| 441 | Ga0495584_0286103 | 3300046491 | Bacteria | 837 |
| 442 | Ga0495584_0409651 | 3300046491 | Bacteria | 689 |
| 443 | Ga0495585_0005619 | 3300046492 | Bacteria | 7875 |
| 444 | Ga0495585_0006088 | 3300046492 | Bacteria | 7538 |
| 445 | Ga0495585_0010425 | 3300046492 | Bacteria | 5531 |
| 446 | Ga0495585_0069938 | 3300046492 | Bacteria | 1915 |
| 447 | Ga0495585_0079002 | 3300046492 | Bacteria | 1784 |
| 448 | Ga0495585_0094044 | 3300046492 | Bacteria | 1611 |
| 449 | Ga0495585_0126753 | 3300046492 | Bacteria | 1346 |
| 450 | Ga0495585_0134730 | 3300046492 | Bacteria | 1297 |
| 451 | Ga0495585_0321566 | 3300046492 | Bacteria | 756 |
| 452 | Ga0495594_0135885 | 3300046499 | Bacteria | 1393 |
| 453 | Ga0495594_0149148 | 3300046499 | Bacteria | 1327 |
| 454 | Ga0495594_0278278 | 3300046499 | Bacteria | 953 |
| 455 | Ga0495596_0000545 | 3300046500 | Bacteria | 23624 |
| 456 | Ga0495596_0009976 | 3300046500 | Bacteria | 4156 |
| 457 | Ga0495607_0002719 | 3300046501 | Bacteria | 14112 |
| 458 | Ga0495607_0004529 | 3300046501 | Bacteria | 10203 |
| 459 | Ga0495607_0011725 | 3300046501 | Bacteria | 5816 |
| 460 | Ga0495607_0021554 | 3300046501 | Bacteria | 4053 |
| 461 | Ga0495607_0027707 | 3300046501 | Bacteria | 3500 |
| 462 | Ga0495607_0054926 | 3300046501 | Bacteria | 2293 |
| 463 | Ga0495607_0112956 | 3300046501 | Bacteria | 1437 |
| 464 | Ga0495607_0114085 | 3300046501 | Bacteria | 1428 |
| 465 | Ga0495607_0160168 | 3300046501 | Bacteria | 1144 |
| 466 | Ga0495607_0162951 | 3300046501 | Bacteria | 1131 |
| 467 | Ga0495583_0004153 | 3300046506 | Bacteria | 10584 |
| 468 | Ga0495583_0004386 | 3300046506 | Bacteria | 10129 |
| 469 | Ga0495583_0005841 | 3300046506 | Bacteria | 8210 |
| 470 | Ga0495583_0081461 | 3300046506 | Bacteria | 1405 |
| 471 | Ga0495583_0129364 | 3300046506 | Bacteria | 1057 |
| 472 | Ga0495606_0000447 | 3300046507 | Bacteria | 67335 |
| 473 | Ga0495606_0013954 | 3300046507 | Bacteria | 6302 |
| 474 | Ga0495606_0016616 | 3300046507 | Bacteria | 5601 |
| 475 | Ga0495606_0047624 | 3300046507 | Bacteria | 2824 |
| 476 | Ga0495606_0052345 | 3300046507 | Bacteria | 2655 |
| 477 | Ga0495606_0066377 | 3300046507 | Bacteria | 2288 |
| 478 | Ga0495610_0011082 | 3300046512 | Bacteria | 5536 |
| 479 | Ga0495610_0015733 | 3300046512 | Bacteria | 4385 |
| 480 | Ga0495610_0016575 | 3300046512 | Bacteria | 4234 |
| 481 | Ga0495610_0028275 | 3300046512 | Bacteria | 2967 |
| 482 | Ga0495610_0028769 | 3300046512 | Bacteria | 2935 |
| 483 | Ga0495610_0091376 | 3300046512 | Bacteria | 1379 |
| 484 | Ga0495610_0242977 | 3300046512 | Bacteria | 717 |
| 485 | Ga0495616_0008264 | 3300046513 | Bacteria | 6177 |
| 486 | Ga0495616_0044744 | 3300046513 | Bacteria | 2244 |
| 487 | Ga0495616_0065538 | 3300046513 | Bacteria | 1769 |
| 488 | Ga0495616_0095772 | 3300046513 | Bacteria | 1398 |
| 489 | Ga0495616_0097330 | 3300046513 | Bacteria | 1384 |
| 490 | Ga0495616_0154822 | 3300046513 | Bacteria | 1034 |
| 491 | Ga0495616_0207843 | 3300046513 | Bacteria | 857 |
| 492 | Ga0495620_0000146 | 3300046515 | Bacteria | 57888 |
| 493 | Ga0495620_0001025 | 3300046515 | Bacteria | 17183 |
| 494 | Ga0495620_0007957 | 3300046515 | Bacteria | 5716 |
| 495 | Ga0495620_0011678 | 3300046515 | Bacteria | 4570 |
| 496 | Ga0495620_0033790 | 3300046515 | Bacteria | 2317 |
| 497 | Ga0495620_0084459 | 3300046515 | Bacteria | 1280 |
| 498 | Ga0495620_0148426 | 3300046515 | Bacteria | 914 |
| 499 | Ga0495628_0110833 | 3300046516 | Bacteria | 2111 |
| 500 | Ga0495628_0623214 | 3300046516 | Bacteria | 768 |
| 501 | Ga0495630_0251400 | 3300046517 | Bacteria | 1350 |
| 502 | Ga0495630_0259542 | 3300046517 | Bacteria | 1327 |
| 503 | Ga0495631_0001255 | 3300046518 | Bacteria | 15676 |
| 504 | Ga0495631_0002798 | 3300046518 | Bacteria | 9679 |
| 505 | Ga0495631_0019223 | 3300046518 | Bacteria | 3205 |
| 506 | Ga0495631_0053416 | 3300046518 | Bacteria | 1763 |
| 507 | Ga0495631_0134440 | 3300046518 | Bacteria | 1062 |
| 508 | Ga0495631_0220987 | 3300046518 | Bacteria | 808 |
| 509 | Ga0495632_0000599 | 3300046519 | Bacteria | 33406 |
| 510 | Ga0495632_0001743 | 3300046519 | Bacteria | 17635 |
| 511 | Ga0495632_0008921 | 3300046519 | Bacteria | 6093 |
| 512 | Ga0495632_0010081 | 3300046519 | Bacteria | 5626 |
| 513 | Ga0495632_0018363 | 3300046519 | Bacteria | 3838 |
| 514 | Ga0495632_0026449 | 3300046519 | Bacteria | 3054 |
| 515 | Ga0495632_0065399 | 3300046519 | Bacteria | 1756 |
| 516 | Ga0495632_0106291 | 3300046519 | Bacteria | 1320 |
| 517 | Ga0495632_0114596 | 3300046519 | Bacteria | 1263 |
| 518 | Ga0495632_0136740 | 3300046519 | Bacteria | 1138 |
| 519 | Ga0495632_0186571 | 3300046519 | Bacteria | 948 |
| 520 | Ga0495632_0217171 | 3300046519 | Bacteria | 865 |
| 521 | Ga0495637_0000298 | 3300046520 | Bacteria | 38413 |
| 522 | Ga0495637_0003904 | 3300046520 | Bacteria | 7820 |
| 523 | Ga0495637_0012181 | 3300046520 | Bacteria | 4117 |
| 524 | Ga0495637_0013878 | 3300046520 | Bacteria | 3813 |
| 525 | Ga0495637_0015426 | 3300046520 | Bacteria | 3582 |
| 526 | Ga0495637_0048387 | 3300046520 | Bacteria | 1791 |
| 527 | Ga0495637_0062269 | 3300046520 | Bacteria | 1527 |
| 528 | Ga0495637_0073028 | 3300046520 | Bacteria | 1381 |
| 529 | Ga0495637_0123619 | 3300046520 | Bacteria | 993 |
| 530 | Ga0495637_0141674 | 3300046520 | Bacteria | 912 |
| 531 | Ga0495637_0142833 | 3300046520 | Bacteria | 907 |
| 532 | Ga0495637_0162630 | 3300046520 | Bacteria | 836 |
| 533 | Ga0495643_0010831 | 3300046522 | Bacteria | 5591 |
| 534 | Ga0495643_0011262 | 3300046522 | Bacteria | 5459 |
| 535 | Ga0495643_0031987 | 3300046522 | Bacteria | 2923 |
| 536 | Ga0495644_0001580 | 3300046523 | Bacteria | 9287 |
| 537 | Ga0495644_0014061 | 3300046523 | Bacteria | 3067 |
| 538 | Ga0495648_0002138 | 3300046524 | Bacteria | 18598 |
| 539 | Ga0495648_0013653 | 3300046524 | Bacteria | 5989 |
| 540 | Ga0495648_0017526 | 3300046524 | Bacteria | 5115 |
| 541 | Ga0495648_0029310 | 3300046524 | Bacteria | 3654 |
| 542 | Ga0495648_0067009 | 3300046524 | Bacteria | 2101 |
| 543 | Ga0495648_0081478 | 3300046524 | Bacteria | 1840 |
| 544 | Ga0495648_0088603 | 3300046524 | Bacteria | 1739 |
| 545 | Ga0495648_0099266 | 3300046524 | Bacteria | 1611 |
| 546 | Ga0495648_0112168 | 3300046524 | Bacteria | 1481 |
| 547 | Ga0495648_0228609 | 3300046524 | Bacteria | 912 |
| 548 | Ga0495648_0259869 | 3300046524 | Bacteria | 833 |
| 549 | Ga0495648_0310154 | 3300046524 | Bacteria | 735 |
| 550 | Ga0495648_0372867 | 3300046524 | Bacteria | 645 |
| 551 | Ga0495666_0061660 | 3300046526 | Bacteria | 1791 |
| 552 | Ga0495666_0138443 | 3300046526 | Bacteria | 1135 |
| 553 | Ga0495642_0000662 | 3300046528 | Bacteria | 17247 |
| 554 | Ga0495642_0000940 | 3300046528 | Bacteria | 13633 |
| 555 | Ga0495642_0001149 | 3300046528 | Bacteria | 12168 |
| 556 | Ga0495654_0002507 | 3300046530 | Bacteria | 11794 |
| 557 | Ga0495654_0002748 | 3300046530 | Bacteria | 11095 |
| 558 | Ga0495654_0010159 | 3300046530 | Bacteria | 5131 |
| 559 | Ga0495654_0012918 | 3300046530 | Bacteria | 4478 |
| 560 | Ga0495654_0018632 | 3300046530 | Bacteria | 3635 |
| 561 | Ga0495654_0044760 | 3300046530 | Bacteria | 2187 |
| 562 | Ga0495654_0058885 | 3300046530 | Bacteria | 1851 |
| 563 | Ga0495654_0096779 | 3300046530 | Bacteria | 1363 |
| 564 | Ga0495654_0106946 | 3300046530 | Bacteria | 1280 |
| 565 | Ga0495654_0115897 | 3300046530 | Bacteria | 1217 |
| 566 | Ga0495654_0222893 | 3300046530 | Bacteria | 796 |
| 567 | Ga0495654_0233138 | 3300046530 | Bacteria | 773 |
| 568 | Ga0495654_0255963 | 3300046530 | Bacteria | 727 |
| 569 | Ga0495586_0208552 | 3300046535 | Bacteria | 1108 |
| 570 | Ga0495587_0017674 | 3300046536 | Bacteria | 4427 |
| 571 | Ga0495587_0018153 | 3300046536 | Bacteria | 4362 |
| 572 | Ga0495587_0085731 | 3300046536 | Bacteria | 1823 |
| 573 | Ga0495609_0000283 | 3300046538 | Bacteria | 46879 |
| 574 | Ga0495609_0017903 | 3300046538 | Bacteria | 3287 |
| 575 | Ga0495609_0019921 | 3300046538 | Bacteria | 3101 |
| 576 | Ga0495609_0108960 | 3300046538 | Bacteria | 1196 |
| 577 | Ga0495609_0147849 | 3300046538 | Bacteria | 1000 |
| 578 | Ga0495597_0010035 | 3300046542 | Bacteria | 4646 |
| 579 | Ga0495597_0011165 | 3300046542 | Bacteria | 4360 |
| 580 | Ga0495597_0043007 | 3300046542 | Bacteria | 2012 |
| 581 | Ga0495597_0057791 | 3300046542 | Bacteria | 1696 |
| 582 | Ga0495597_0090738 | 3300046542 | Bacteria | 1297 |
| 583 | Ga0495597_0112472 | 3300046542 | Bacteria | 1140 |
| 584 | Ga0495597_0148068 | 3300046542 | Bacteria | 964 |
| 585 | Ga0495597_0151978 | 3300046542 | Bacteria | 949 |
| 586 | Ga0495597_0178765 | 3300046542 | Bacteria | 858 |
| 587 | Ga0495597_0230716 | 3300046542 | Bacteria | 732 |
| 588 | Ga0495645_0147401 | 3300046543 | Bacteria | 1638 |
| 589 | Ga0495622_0001532 | 3300046557 | Bacteria | 11519 |
| 590 | Ga0495622_0005369 | 3300046557 | Bacteria | 5950 |
| 591 | Ga0495622_0055032 | 3300046557 | Bacteria | 1845 |
| 592 | Ga0495622_0065301 | 3300046557 | Bacteria | 1682 |
| 593 | Ga0495622_0259170 | 3300046557 | Bacteria | 763 |
| 594 | Ga0495633_0003837 | 3300046558 | Bacteria | 9826 |
| 595 | Ga0495633_0105045 | 3300046558 | Bacteria | 1310 |
| 596 | Ga0495633_0109704 | 3300046558 | Bacteria | 1279 |
| 597 | Ga0495633_0182207 | 3300046558 | Bacteria | 967 |
| 598 | Ga0495633_0410903 | 3300046558 | Bacteria | 612 |
| 599 | Ga0495656_0315933 | 3300046615 | Bacteria | 803 |
| 600 | Ga0495668_0004933 | 3300046616 | Bacteria | 9250 |
| 601 | Ga0495668_0064263 | 3300046616 | Bacteria | 2020 |
| 602 | Ga0495634_0021303 | 3300046642 | Bacteria | 4584 |
| 603 | Ga0495611_0001569 | 3300046648 | Bacteria | 11197 |
| 604 | Ga0495611_0029745 | 3300046648 | Bacteria | 2397 |
| 605 | Ga0495611_0063222 | 3300046648 | Bacteria | 1684 |
| 606 | Ga0495611_0141917 | 3300046648 | Bacteria | 1121 |
| 607 | Ga0495611_0246991 | 3300046648 | Bacteria | 827 |
| 608 | Ga0495625_0000086 | 3300046660 | Bacteria | 151735 |
| 609 | Ga0495625_0092577 | 3300046660 | Bacteria | 2088 |
| 610 | Ga0495625_0111308 | 3300046660 | Bacteria | 1871 |
| 611 | Ga0495625_0116247 | 3300046660 | Bacteria | 1824 |
| 612 | Ga0495625_0129075 | 3300046660 | Bacteria | 1713 |
| 613 | Ga0495625_0146515 | 3300046660 | Bacteria | 1589 |
| 614 | Ga0495625_0168088 | 3300046660 | Bacteria | 1465 |
| 615 | Ga0495625_0169332 | 3300046660 | Bacteria | 1459 |
| 616 | Ga0495625_0328260 | 3300046660 | Bacteria | 972 |
| 617 | Ga0495625_0340945 | 3300046660 | Bacteria | 949 |
| 618 | Ga0495635_0055596 | 3300046663 | Bacteria | 2726 |
| 619 | Ga0495635_0089204 | 3300046663 | Bacteria | 2109 |
| 620 | Ga0495659_0000820 | 3300046664 | Bacteria | 11054 |
| 621 | Ga0495659_0002070 | 3300046664 | Bacteria | 6558 |
| 622 | Ga0495659_0072398 | 3300046664 | Bacteria | 1293 |
| 623 | Ga0495661_0000212 | 3300046665 | Bacteria | 67078 |
| 624 | Ga0495661_0001263 | 3300046665 | Bacteria | 21779 |
| 625 | Ga0495661_0019813 | 3300046665 | Bacteria | 4402 |
| 626 | Ga0495661_0124168 | 3300046665 | Bacteria | 1422 |
| 627 | Ga0495661_0157000 | 3300046665 | Bacteria | 1224 |
| 628 | Ga0495661_0172054 | 3300046665 | Bacteria | 1154 |
| 629 | Ga0495661_0186881 | 3300046665 | Bacteria | 1094 |
| 630 | Ga0495661_0199884 | 3300046665 | Bacteria | 1047 |
| 631 | Ga0495661_0239843 | 3300046665 | Bacteria | 930 |
| 632 | Ga0495588_0071064 | 3300046674 | Bacteria | 1809 |
| 633 | Ga0495657_0127527 | 3300046675 | Bacteria | 1597 |
| 634 | Ga0495623_0043351 | 3300046679 | Bacteria | 2863 |
| 635 | Ga0495623_0224125 | 3300046679 | Bacteria | 1069 |
| 636 | Ga0495646_0038226 | 3300046680 | Bacteria | 2964 |
| 637 | Ga0495646_0053319 | 3300046680 | Bacteria | 2438 |
| 638 | Ga0495646_0056240 | 3300046680 | Bacteria | 2359 |
| 639 | Ga0495613_0134739 | 3300046689 | Bacteria | 1767 |
| 640 | Ga0495613_0153347 | 3300046689 | Bacteria | 1642 |
| 641 | Ga0495613_0424188 | 3300046689 | Bacteria | 904 |
| 642 | Ga0495624_0003018 | 3300046690 | Bacteria | 12599 |
| 643 | Ga0495670_0005198 | 3300046691 | Bacteria | 6403 |
| 644 | Ga0495670_0005874 | 3300046691 | Bacteria | 6017 |
| 645 | Ga0495670_0022253 | 3300046691 | Bacteria | 3129 |
| 646 | Ga0495670_0024799 | 3300046691 | Bacteria | 2964 |
| 647 | Ga0495670_0076998 | 3300046691 | Bacteria | 1695 |
| 648 | Ga0495670_0218889 | 3300046691 | Bacteria | 1011 |
| 649 | Ga0495671_0004628 | 3300046692 | Bacteria | 8161 |
| 650 | Ga0495671_0008562 | 3300046692 | Bacteria | 5745 |
| 651 | Ga0495671_0009715 | 3300046692 | Bacteria | 5363 |
| 652 | Ga0495671_0017976 | 3300046692 | Bacteria | 3759 |
| 653 | Ga0495671_0041400 | 3300046692 | Bacteria | 2319 |
| 654 | Ga0495671_0047927 | 3300046692 | Bacteria | 2132 |
| 655 | Ga0495671_0076678 | 3300046692 | Bacteria | 1639 |
| 656 | Ga0495671_0110517 | 3300046692 | Bacteria | 1342 |
| 657 | Ga0495671_0178527 | 3300046692 | Bacteria | 1031 |
| 658 | Ga0495671_0193218 | 3300046692 | Bacteria | 988 |
| 659 | Ga0495671_0225582 | 3300046692 | Bacteria | 906 |
| 660 | Ga0495671_0232033 | 3300046692 | Bacteria | 892 |
| 661 | Ga0495671_0342220 | 3300046692 | Bacteria | 717 |
| 662 | Ga0495649_0001824 | 3300046694 | Bacteria | 15645 |
| 663 | Ga0495649_0012385 | 3300046694 | Bacteria | 4964 |
| 664 | Ga0495649_0031659 | 3300046694 | Bacteria | 2915 |
| 665 | Ga0495649_0046671 | 3300046694 | Bacteria | 2358 |
| 666 | Ga0495649_0064886 | 3300046694 | Bacteria | 1960 |
| 667 | Ga0495649_0065109 | 3300046694 | Bacteria | 1956 |
| 668 | Ga0495649_0083414 | 3300046694 | Bacteria | 1707 |
| 669 | Ga0495649_0090370 | 3300046694 | Bacteria | 1632 |
| 670 | Ga0495649_0142045 | 3300046694 | Bacteria | 1263 |
| 671 | Ga0495649_0191786 | 3300046694 | Bacteria | 1063 |
| 672 | Ga0495649_0354084 | 3300046694 | Bacteria | 741 |
| 673 | Ga0495649_0407064 | 3300046694 | Bacteria | 682 |
| 674 | Ga0495649_0507047 | 3300046694 | Bacteria | 600 |
| 675 | Ga0495589_0000918 | 3300046794 | Bacteria | 18098 |
| 676 | Ga0495589_0002071 | 3300046794 | Bacteria | 11354 |
| 677 | Ga0495589_0006815 | 3300046794 | Bacteria | 6011 |
| 678 | Ga0495589_0015503 | 3300046794 | Bacteria | 3920 |
| 679 | Ga0495589_0021718 | 3300046794 | Bacteria | 3279 |
| 680 | Ga0495589_0041255 | 3300046794 | Bacteria | 2303 |
| 681 | Ga0495589_0140918 | 3300046794 | Bacteria | 1154 |
| 682 | Ga0495600_0061164 | 3300046809 | Bacteria | 2459 |
| 683 | Ga0495600_0178085 | 3300046809 | Bacteria | 1370 |
| 684 | Ga0495660_0021679 | 3300046810 | Bacteria | 3676 |
| 685 | Ga0495660_0081388 | 3300046810 | Bacteria | 1697 |
| 686 | Ga0495660_0089496 | 3300046810 | Bacteria | 1602 |
| 687 | Ga0495660_0094580 | 3300046810 | Bacteria | 1547 |
| 688 | Ga0495660_0107983 | 3300046810 | Bacteria | 1423 |
| 689 | Ga0495660_0110362 | 3300046810 | Bacteria | 1404 |
| 690 | Ga0495660_0168010 | 3300046810 | Bacteria | 1070 |
| 691 | Ga0495660_0264590 | 3300046810 | Bacteria | 792 |
| 692 | Ga0495581_0061855 | 3300047315 | Bacteria | 2163 |
| 693 | Ga0495581_0258372 | 3300047315 | Bacteria | 1019 |
| 694 | Ga0495604_0062389 | 3300047317 | Bacteria | 2847 |
| 695 | Ga0495636_0013407 | 3300047318 | Bacteria | 3253 |
| 696 | Ga0495636_0016829 | 3300047318 | Bacteria | 2924 |
| 697 | Ga0495674_0431563 | 3300047319 | Bacteria | 1060 |
| 698 | Ga0495672_0003884 | 3300047320 | Bacteria | 12561 |
| 699 | Ga0495672_0004360 | 3300047320 | Bacteria | 11624 |
| 700 | Ga0495672_0006960 | 3300047320 | Bacteria | 8600 |
| 701 | Ga0495672_0011630 | 3300047320 | Bacteria | 6197 |
| 702 | Ga0495672_0012419 | 3300047320 | Bacteria | 5942 |
| 703 | Ga0495672_0017506 | 3300047320 | Bacteria | 4793 |
| 704 | Ga0495672_0019239 | 3300047320 | Bacteria | 4508 |
| 705 | Ga0495672_0039236 | 3300047320 | Bacteria | 2880 |
| 706 | Ga0495672_0053952 | 3300047320 | Bacteria | 2352 |
| 707 | Ga0495672_0075740 | 3300047320 | Bacteria | 1891 |
| 708 | Ga0495672_0083248 | 3300047320 | Bacteria | 1777 |
| 709 | Ga0495672_0103027 | 3300047320 | Bacteria | 1544 |
| 710 | Ga0495672_0125285 | 3300047320 | Bacteria | 1359 |
| 711 | Ga0495672_0212981 | 3300047320 | Bacteria | 958 |
| 712 | Ga0495672_0283261 | 3300047320 | Bacteria | 791 |
| 713 | Ga0495676_0000022 | 3300047321 | Bacteria | 163719 |
| 714 | Ga0495676_0058928 | 3300047321 | Bacteria | 3018 |
| 715 | Ga0495680_0002433 | 3300047322 | Bacteria | 19048 |
| 716 | Ga0495680_0036378 | 3300047322 | Bacteria | 3953 |
| 717 | Ga0495680_0091746 | 3300047322 | Bacteria | 2276 |
| 718 | Ga0495680_0165381 | 3300047322 | Bacteria | 1604 |
| 719 | Ga0495680_0459215 | 3300047322 | Bacteria | 870 |
| 720 | Ga0495680_0537051 | 3300047322 | Bacteria | 789 |
| 721 | Ga0495683_0008727 | 3300047323 | Bacteria | 5408 |
| 722 | Ga0495683_0026936 | 3300047323 | Bacteria | 2940 |
| 723 | Ga0495683_0105458 | 3300047323 | Bacteria | 1351 |
| 724 | Ga0495683_0113503 | 3300047323 | Bacteria | 1291 |
| 725 | Ga0495683_0141210 | 3300047323 | Bacteria | 1128 |
| 726 | Ga0495683_0174334 | 3300047323 | Bacteria | 986 |
| 727 | Ga0495683_0343617 | 3300047323 | Bacteria | 631 |
| 728 | Ga0495687_005361 | 3300047443 | Bacteria | 8197 |
| 729 | Ga0495687_031459 | 3300047443 | Bacteria | 2434 |
| 730 | Ga0495687_044748 | 3300047443 | Bacteria | 1921 |
| 731 | Ga0495687_074572 | 3300047443 | Bacteria | 1348 |
| 732 | Ga0495675_0139142 | 3300047444 | Bacteria | 1505 |
| 733 | Ga0495677_0001306 | 3300047445 | Bacteria | 9964 |
| 734 | Ga0495677_0145115 | 3300047445 | Bacteria | 912 |
| 735 | Ga0495679_000212 | 3300047446 | Bacteria | 49948 |
| 736 | Ga0495679_024738 | 3300047446 | Bacteria | 2019 |
| 737 | Ga0495679_029831 | 3300047446 | Bacteria | 1775 |
| 738 | Ga0495679_037239 | 3300047446 | Bacteria | 1531 |
| 739 | Ga0495679_069304 | 3300047446 | Bacteria | 1019 |
| 740 | Ga0495679_101527 | 3300047446 | Bacteria | 798 |
| 741 | Ga0495685_085515 | 3300047447 | Bacteria | 1048 |
| 742 | Ga0495673_0005218 | 3300047469 | Bacteria | 7898 |
| 743 | Ga0495673_0006168 | 3300047469 | Bacteria | 7099 |
| 744 | Ga0495673_0007676 | 3300047469 | Bacteria | 6161 |
| 745 | Ga0495673_0009165 | 3300047469 | Bacteria | 5492 |
| 746 | Ga0495673_0009710 | 3300047469 | Bacteria | 5299 |
| 747 | Ga0495673_0015441 | 3300047469 | Bacteria | 3934 |
| 748 | Ga0495673_0025778 | 3300047469 | Bacteria | 2818 |
| 749 | Ga0495673_0029141 | 3300047469 | Bacteria | 2608 |
| 750 | Ga0495673_0038061 | 3300047469 | Bacteria | 2191 |
| 751 | Ga0495673_0073508 | 3300047469 | Bacteria | 1432 |
| 752 | Ga0495673_0105918 | 3300047469 | Bacteria | 1130 |
| 753 | Ga0495673_0135083 | 3300047469 | Bacteria | 966 |
| 754 | Ga0495673_0150889 | 3300047469 | Bacteria | 898 |
| 755 | Ga0495673_0156760 | 3300047469 | Bacteria | 876 |
| 756 | Ga0495681_0002383 | 3300047470 | Bacteria | 13460 |
| 757 | Ga0495681_0004962 | 3300047470 | Bacteria | 8980 |
| 758 | Ga0495681_0008341 | 3300047470 | Bacteria | 6507 |
| 759 | Ga0495681_0009563 | 3300047470 | Bacteria | 5955 |
| 760 | Ga0495681_0010666 | 3300047470 | Bacteria | 5548 |
| 761 | Ga0495681_0016197 | 3300047470 | Bacteria | 4192 |
| 762 | Ga0495681_0016536 | 3300047470 | Bacteria | 4129 |
| 763 | Ga0495681_0020738 | 3300047470 | Bacteria | 3557 |
| 764 | Ga0495681_0054819 | 3300047470 | Bacteria | 1861 |
| 765 | Ga0495681_0060390 | 3300047470 | Bacteria | 1749 |
| 766 | Ga0495681_0065421 | 3300047470 | Bacteria | 1662 |
| 767 | Ga0495681_0071792 | 3300047470 | Bacteria | 1567 |
| 768 | Ga0495681_0081306 | 3300047470 | Bacteria | 1446 |
| 769 | Ga0495681_0129096 | 3300047470 | Bacteria | 1077 |
| 770 | Ga0495681_0172902 | 3300047470 | Bacteria | 892 |
| 771 | Ga0495684_0510901 | 3300047471 | Bacteria | 824 |
| 772 | Ga0495686_0029158 | 3300047472 | Bacteria | 3591 |
| 773 | Ga0495686_0038370 | 3300047472 | Bacteria | 3063 |
| 774 | Ga0495686_0046754 | 3300047472 | Bacteria | 2734 |
| 775 | Ga0495686_0064955 | 3300047472 | Bacteria | 2257 |
| 776 | Ga0495686_0183861 | 3300047472 | Bacteria | 1209 |
| 777 | Ga0495686_0238883 | 3300047472 | Bacteria | 1025 |
| 778 | Ga0495593_0017925 | 3300047673 | Bacteria | 3984 |
| 779 | Ga0495593_0082252 | 3300047673 | Bacteria | 1664 |
| 780 | Ga0495593_0085393 | 3300047673 | Bacteria | 1628 |
| 781 | Ga0495593_0355268 | 3300047673 | Bacteria | 732 |
| 782 | Ga0495602_0170217 | 3300048088 | Bacteria | 1691 |
| 783 | Ga0495614_0177743 | 3300048089 | Bacteria | 957 |
| 784 | Ga0495626_0000039 | 3300048091 | Bacteria | 175454 |
| 785 | Ga0495626_0000242 | 3300048091 | Bacteria | 63298 |
| 786 | Ga0495626_0001832 | 3300048091 | Bacteria | 15978 |
| 787 | Ga0495626_0003058 | 3300048091 | Bacteria | 10981 |
| 788 | Ga0495626_0007505 | 3300048091 | Bacteria | 6063 |
| 789 | Ga0495626_0024057 | 3300048091 | Bacteria | 2989 |
| 790 | Ga0495626_0052218 | 3300048091 | Bacteria | 1884 |
| 791 | Ga0495626_0063285 | 3300048091 | Bacteria | 1678 |
| 792 | Ga0495626_0207197 | 3300048091 | Bacteria | 801 |
| 793 | Ga0495626_0240986 | 3300048091 | Bacteria | 728 |
| 794 | Ga0496102_0002921 | 3300048905 | Bacteria | 14497 |
| 795 | Ga0496102_0412767 | 3300048905 | Bacteria | 1268 |
| 796 | Ga0496102_0879801 | 3300048905 | Bacteria | 818 |
| 797 | Ga0496103_0199568 | 3300048906 | Bacteria | 1286 |
| 798 | Ga0496105_0199517 | 3300048908 | Bacteria | 1633 |
| 799 | Ga0496106_0383505 | 3300048909 | Bacteria | 1129 |
| 800 | Ga0496110_0069439 | 3300048913 | Bacteria | 3120 |
| 801 | Ga0496110_0384741 | 3300048913 | Bacteria | 1278 |
| 802 | Ga0496110_0387135 | 3300048913 | Bacteria | 1274 |
| 803 | Ga0496110_0661238 | 3300048913 | Bacteria | 945 |
| 804 | Ga0496110_0796049 | 3300048913 | Bacteria | 850 |
| 805 | Ga0496111_0429774 | 3300048914 | Bacteria | 975 |
| 806 | Ga0496112_0595844 | 3300048915 | Bacteria | 1037 |
| 807 | Ga0496114_0318725 | 3300048917 | Bacteria | 1373 |
| 808 | Ga0496115_0338557 | 3300048918 | Bacteria | 1228 |
| 809 | Ga0496116_0000881 | 3300048919 | Bacteria | 37470 |
| 810 | Ga0496116_0004892 | 3300048919 | Bacteria | 12634 |
| 811 | Ga0496116_0005284 | 3300048919 | Bacteria | 12049 |
| 812 | Ga0496116_0053916 | 3300048919 | Bacteria | 2652 |
| 813 | Ga0496116_0095145 | 3300048919 | Bacteria | 1798 |
| 814 | Ga0496116_0102424 | 3300048919 | Bacteria | 1707 |
| 815 | Ga0496117_0000385 | 3300048920 | Bacteria | 75873 |
| 816 | Ga0496117_0002861 | 3300048920 | Bacteria | 20985 |
| 817 | Ga0496117_0008441 | 3300048920 | Bacteria | 9778 |
| 818 | Ga0496117_0015017 | 3300048920 | Bacteria | 6634 |
| 819 | Ga0496117_0021194 | 3300048920 | Bacteria | 5268 |
| 820 | Ga0496117_0049035 | 3300048920 | Bacteria | 3008 |
| 821 | Ga0496117_0065064 | 3300048920 | Bacteria | 2482 |
| 822 | Ga0496117_0140100 | 3300048920 | Bacteria | 1450 |
| 823 | Ga0496117_0173425 | 3300048920 | Bacteria | 1249 |
| 824 | Ga0496117_0221332 | 3300048920 | Bacteria | 1053 |
| 825 | Ga0496118_0009635 | 3300048921 | Bacteria | 9717 |
| 826 | Ga0496118_0053236 | 3300048921 | Bacteria | 3079 |
| 827 | Ga0496118_0089322 | 3300048921 | Bacteria | 2128 |
| 828 | Ga0496118_0104397 | 3300048921 | Bacteria | 1902 |
| 829 | Ga0496118_0133121 | 3300048921 | Bacteria | 1591 |
| 830 | Ga0496118_0160884 | 3300048921 | Bacteria | 1388 |
| 831 | Ga0496118_0203565 | 3300048921 | Bacteria | 1169 |
| 832 | Ga0496118_0206512 | 3300048921 | Bacteria | 1157 |
| 833 | Ga0496118_0388422 | 3300048921 | Bacteria | 729 |
| 834 | Ga0496119_0116846 | 3300048922 | Bacteria | 1471 |
| 835 | Ga0496119_0156893 | 3300048922 | Bacteria | 1214 |
| 836 | Ga0496121_0001650 | 3300048924 | Bacteria | 36892 |
| 837 | Ga0496121_0002827 | 3300048924 | Bacteria | 25645 |
| 838 | Ga0496121_0045727 | 3300048924 | Bacteria | 3758 |
| 839 | Ga0496121_0063687 | 3300048924 | Bacteria | 3010 |
| 840 | Ga0496121_0080979 | 3300048924 | Bacteria | 2571 |
| 841 | Ga0496121_0223445 | 3300048924 | Bacteria | 1324 |
| 842 | Ga0496121_0672401 | 3300048924 | Bacteria | 627 |
| 843 | Ga0496122_0002897 | 3300048925 | Bacteria | 23445 |
| 844 | Ga0496122_0096287 | 3300048925 | Bacteria | 1996 |
| 845 | Ga0496122_0116835 | 3300048925 | Bacteria | 1733 |
| 846 | Ga0496122_0132207 | 3300048925 | Bacteria | 1582 |
| 847 | Ga0496122_0347889 | 3300048925 | Bacteria | 775 |
| 848 | Ga0496123_0000717 | 3300048926 | Bacteria | 54100 |
| 849 | Ga0496123_0027453 | 3300048926 | Bacteria | 4239 |
| 850 | Ga0496123_0081253 | 3300048926 | Bacteria | 1971 |
| 851 | Ga0496123_0103535 | 3300048926 | Bacteria | 1648 |
| 852 | Ga0496123_0174367 | 3300048926 | Bacteria | 1130 |
| 853 | Ga0496124_0001280 | 3300048927 | Bacteria | 38218 |
| 854 | Ga0496124_0015978 | 3300048927 | Bacteria | 7164 |
| 855 | Ga0496124_0019027 | 3300048927 | Bacteria | 6409 |
| 856 | Ga0496124_0024994 | 3300048927 | Bacteria | 5417 |
| 857 | Ga0496124_0025744 | 3300048927 | Bacteria | 5320 |
| 858 | Ga0496124_0041266 | 3300048927 | Bacteria | 3983 |
| 859 | Ga0496124_0273670 | 3300048927 | Bacteria | 1235 |
| 860 | Ga0496124_0279264 | 3300048927 | Bacteria | 1218 |
| 861 | Ga0496124_0306361 | 3300048927 | Bacteria | 1144 |
| 862 | Ga0496124_0484925 | 3300048927 | Bacteria | 833 |
| 863 | Ga0496124_0484971 | 3300048927 | Bacteria | 833 |
| 864 | Ga0496124_0501643 | 3300048927 | Bacteria | 813 |
| 865 | Ga0496124_0520607 | 3300048927 | Bacteria | 792 |
| 866 | Ga0496125_0013483 | 3300048928 | Bacteria | 8029 |
| 867 | Ga0496125_0022065 | 3300048928 | Bacteria | 5920 |
| 868 | Ga0496125_0156909 | 3300048928 | Bacteria | 1553 |
| 869 | Ga0496125_0180253 | 3300048928 | Bacteria | 1409 |
| 870 | Ga0496125_0603207 | 3300048928 | Bacteria | 599 |
| 871 | Ga0496126_0326389 | 3300048929 | Bacteria | 1260 |
| 872 | Ga0495678_001946 | 3300049459 | Bacteria | 14952 |
| 873 | Ga0495678_019529 | 3300049459 | Bacteria | 3020 |
| 874 | Ga0495678_032957 | 3300049459 | Bacteria | 2142 |
| 875 | Ga0495678_039954 | 3300049459 | Bacteria | 1889 |
| 876 | Ga0495678_042971 | 3300049459 | Bacteria | 1798 |
| 877 | Ga0495678_045109 | 3300049459 | Bacteria | 1740 |
| 878 | Ga0495678_057195 | 3300049459 | Bacteria | 1478 |
| 879 | Ga0495678_057220 | 3300049459 | Bacteria | 1478 |
| 880 | Ga0495678_175058 | 3300049459 | Bacteria | 676 |
| 881 | Ga0495682_0035529 | 3300049460 | Bacteria | 1835 |
| 882 | Ga0495682_0036598 | 3300049460 | Bacteria | 1806 |
| 883 | Ga0495682_0045704 | 3300049460 | Bacteria | 1599 |
| 884 | Ga0495682_0076491 | 3300049460 | Bacteria | 1204 |
| 885 | Ga0495682_0077877 | 3300049460 | Bacteria | 1192 |
| 886 | Ga0495682_0089738 | 3300049460 | Bacteria | 1104 |
| 887 | Ga0495682_0185216 | 3300049460 | Bacteria | 739 |
| 888 | Ga0501032_0007380 | 3300049569 | Bacteria | 8028 |
| 889 | Ga0501034_0001845 | 3300049571 | Bacteria | 26903 |
| 890 | Ga0501034_0683379 | 3300049571 | Bacteria | 926 |
| 891 | Ga0501241_011913 | 3300049758 | Bacteria | 1579 |
| 892 | Ga0501269_014228 | 3300049766 | Bacteria | 975 |
| 893 | nmdc:mga03683_305342_c1 | 3300050489 | Bacteria | 747 |
| 894 | nmdc:mga00v17_222156_c1 | 3300050491 | Bacteria | 1223 |
| 895 | nmdc:mga00v17_450395_c1 | 3300050491 | Bacteria | 836 |
| 896 | Ga0500659_0008421 | 3300053135 | Bacteria | 5684 |
| 897 | Ga0500573_0064542 | 3300053140 | Bacteria | 2094 |
| 898 | 2511258454 | 2511231004 | Bacteria | 6669789 |
| 899 | 2511265613 | 2511231006 | Bacteria | 6794709 |
| 900 | 2511269652 | 2511231007 | Bacteria | 6306603 |
| 901 | 2511280592 | 2511231008 | Bacteria | 6624100 |
| 902 | 2511288864 | 2511231010 | Bacteria | 6373152 |
| 903 | 2511293895 | 2511231011 | Bacteria | 6149768 |
| 904 | 2511302327 | 2511231012 | Bacteria | 6738011 |
| 905 | 2511315176 | 2511231014 | Bacteria | 6462302 |
| 906 | 2511322577 | 2511231015 | Bacteria | 6598026 |
| 907 | 2511323634 | 2511231016 | Bacteria | 6704427 |
| 908 | 2511332717 | 2511231017 | Bacteria | 6503007 |
| 909 | 2511337886 | 2511231018 | Bacteria | 6436256 |
| 910 | 2511345095 | 2511231019 | Bacteria | 6520662 |
| 911 | 2511349026 | 2511231020 | Bacteria | 6115223 |
| 912 | 2511355915 | 2511231021 | Bacteria | 7302637 |
| 913 | 2511361407 | 2511231022 | Bacteria | 6719296 |
| 914 | 2511368550 | 2511231023 | Bacteria | 6808468 |
| 915 | 2511411236 | 2511231031 | Bacteria | 6558529 |
| 916 | 2511822355 | 2511231156 | Bacteria | 6845832 |
| 917 | 2512325875 | 2512047018 | Bacteria | 6663241 |
| 918 | 2554818157 | 2554235132 | Bacteria | 6772433 |
| 919 | 2555247803 | 2554235231 | Bacteria | 5215788 |
| 920 | 2555667340 | 2554235341 | Bacteria | 6867980 |
| 921 | 2583789884 | 2582580891 | Bacteria | 6800976 |
| 922 | 2597855582 | 2597489887 | Bacteria | 6666321 |
| 923 | 2599356563 | 2599185160 | Bacteria | 6844013 |
| 924 | 2599363407 | 2599185161 | Bacteria | 6960462 |
| 925 | 2599369641 | 2599185162 | Bacteria | 6957254 |
| 926 | 2599376516 | 2599185163 | Bacteria | 6995158 |
| 927 | 2599381668 | 2599185164 | Bacteria | 6841688 |
| 928 | 2599388188 | 2599185165 | Bacteria | 6843250 |
| 929 | 2599395288 | 2599185166 | Bacteria | 6959206 |
| 930 | 2599407053 | 2599185168 | Bacteria | 6997636 |
| 931 | 2599463396 | 2599185181 | Bacteria | 6844519 |
| 932 | 2599469254 | 2599185182 | Bacteria | 6883168 |
| 933 | 2599485484 | 2599185185 | Bacteria | 6652270 |
| 934 | 2599492413 | 2599185186 | Bacteria | 6831633 |
| 935 | 2599502565 | 2599185188 | Bacteria | 6164180 |
| 936 | 2599613044 | 2599185212 | Bacteria | 6765997 |
| 937 | 2599769311 | 2599185248 | Bacteria | 6696816 |
| 938 | 2599806613 | 2599185257 | Bacteria | 6492581 |
| 939 | 2599888554 | 2599185289 | Bacteria | 6778765 |
| 940 | 2599900197 | 2599185291 | Bacteria | 6775623 |
| 941 | 2599934157 | 2599185300 | Bacteria | 6062622 |
| 942 | 2599943676 | 2599185302 | Bacteria | 5954930 |
| 943 | 2599955986 | 2599185304 | Bacteria | 5951361 |
| 944 | 2599961788 | 2599185305 | Bacteria | 6748700 |
| 945 | 2599966913 | 2599185306 | Bacteria | 6637356 |
| 946 | 2599974400 | 2599185307 | Bacteria | 6194719 |
| 947 | 2599978276 | 2599185308 | Bacteria | 6621546 |
| 948 | 2599984680 | 2599185309 | Bacteria | 5969593 |
| 949 | 2599991167 | 2599185310 | Bacteria | 6014457 |
| 950 | 2599994949 | 2599185311 | Bacteria | 6354990 |
| 951 | 2600002302 | 2599185312 | Bacteria | 5912071 |
| 952 | 2600004764 | 2599185313 | Bacteria | 6658188 |
| 953 | 2600012504 | 2599185314 | Bacteria | 6621749 |
| 954 | 2600018740 | 2599185315 | Bacteria | 6771107 |
| 955 | 2600026734 | 2599185316 | Bacteria | 6320029 |
| 956 | 2600029877 | 2599185317 | Bacteria | 6435722 |
| 957 | 2600034777 | 2599185318 | Bacteria | 6961590 |
| 958 | 2600043902 | 2599185319 | Bacteria | 6637840 |
| 959 | 2600047978 | 2599185320 | Bacteria | 5963263 |
| 960 | 2600055618 | 2599185321 | Bacteria | 6764560 |
| 961 | 2600060298 | 2599185322 | Bacteria | 6763055 |
| 962 | 2600067558 | 2599185323 | Bacteria | 6688755 |
| 963 | 2600071419 | 2599185324 | Bacteria | 6590677 |
| 964 | 2600080409 | 2599185325 | Bacteria | 6324919 |
| 965 | 2600216025 | 2599185356 | Bacteria | 6843884 |
| 966 | 2600359186 | 2600254930 | Bacteria | 6431253 |
| 967 | 2600364959 | 2600254931 | Bacteria | 6734225 |
| 968 | 2600443948 | 2600254954 | Bacteria | 5100516 |
| 969 | 2601776192 | 2600255313 | Bacteria | 6842543 |
| 970 | 2601797752 | 2600255318 | Bacteria | 6383414 |
| 971 | 2602008568 | 2600255389 | Bacteria | 5275336 |
| 972 | 2606076765 | 2603880185 | Bacteria | 6379190 |
| 973 | 2606128821 | 2603880199 | Bacteria | 6377649 |
| 974 | 2608380544 | 2606217733 | Bacteria | 6360972 |
| 975 | 2624478139 | 2623620443 | Bacteria | 6427864 |
| 976 | 2624489684 | 2623620446 | Bacteria | 6500345 |
| 977 | 2643840904 | 2643221565 | Bacteria | 6216018 |
| 978 | 2643954992 | 2643221589 | Bacteria | 6250934 |
| 979 | 2644024629 | 2643221602 | Bacteria | 6249926 |
| 980 | 2644186042 | 2643221633 | Bacteria | 6733554 |
| 981 | 2644282655 | 2643221650 | Bacteria | 7029547 |
| 982 | 2652546623 | 2651869719 | Bacteria | 6047974 |
| 983 | 2671092681 | 2667528170 | Bacteria | 6786960 |
| 984 | 2671100047 | 2667528171 | Bacteria | 6900659 |
| 985 | 2671127243 | 2667528176 | Bacteria | 6724917 |
| 986 | 2671772264 | 2671180172 | Bacteria | 6495783 |
| 987 | 2678260891 | 2675903515 | Bacteria | 6580491 |
| 988 | 2715749128 | 2713897148 | Bacteria | 5883533 |
| 989 | 2715754398 | 2713897149 | Bacteria | 6506249 |
| 990 | 2718632085 | 2718217725 | Bacteria | 5758958 |
| 991 | 2739197947 | 2738543004 | Bacteria | 6381073 |
| 992 | 2739260392 | 2738543015 | Bacteria | 6750701 |
| 993 | 2739311203 | 2738543025 | Bacteria | 6600348 |
| 994 | 2743735000 | 2740892503 | Bacteria | 6855563 |
| 995 | 2745006204 | 2744054620 | Bacteria | 6551379 |
| 996 | 2774119639 | 2773857670 | Bacteria | 6407454 |
| 997 | 2774134661 | 2773857673 | Bacteria | 6513460 |
| 998 | 2784261129 | 2784132063 | Bacteria | 6262788 |
| 999 | 2784316286 | 2784132072 | Bacteria | 6596533 |
| 1000 | 2794598747 | 2791355520 | Bacteria | 5948615 |
| 1001 | 2808856555 | 2808606361 | Bacteria | 6136259 |
| 1002 | 2808922838 | 2808606376 | Bacteria | 6248667 |
| 1003 | 2808932102 | 2808606377 | Bacteria | 6646337 |
| 1004 | 2808936542 | 2808606378 | Bacteria | 6177535 |
| 1005 | 2808939762 | 2808606379 | Bacteria | 5022697 |
| 1006 | 2808944525 | 2808606380 | Bacteria | 6248705 |
| 1007 | 2808954297 | 2808606381 | Bacteria | 6646461 |
| 1008 | 2808955779 | 2808606382 | Bacteria | 6841132 |
| 1009 | 2808964942 | 2808606383 | Bacteria | 6138645 |
| 1010 | 2808999834 | 2808606389 | Bacteria | 6138126 |
| 1011 | 2809217900 | 2808606445 | Bacteria | 6057339 |
| 1012 | 2819657148 | 2818991456 | Bacteria | 6123676 |
| 1013 | 2819705137 | 2818991464 | Bacteria | 6907494 |
| 1014 | 2823425573 | 2823421272 | Bacteria | 5372474 |
| 1015 | 2825654351 | 2825651385 | Bacteria | 6715909 |
| 1016 | 2826582511 | 2826581358 | Bacteria | 5963467 |
| 1017 | 2842817643 | 2842815866 | Bacteria | 5947510 |
| 1018 | 2842834087 | 2842832357 | Bacteria | 5959113 |
| 1019 | 2842846441 | 2842843487 | Bacteria | 6004777 |
| 1020 | 2842851601 | 2842849001 | Bacteria | 5924277 |
| 1021 | 2842859474 | 2842854478 | Bacteria | 6143501 |
| 1022 | 2844667818 | 2844665904 | Bacteria | 6817974 |
| 1023 | 2852660531 | 2852657418 | Bacteria | 6472974 |
| 1024 | 2860343718 | 2860339153 | Bacteria | 6846989 |
| 1025 | 2878030084 | 2878029506 | Bacteria | 6418441 |
| 1026 | 2880231035 | 2880230671 | Bacteria | 6140320 |
| 1027 | 2904519494 | 2904518522 | Bacteria | 6068986 |
| 1028 | 2904552328 | 2904550169 | Bacteria | 6221258 |
| 1029 | 2913037186 | 2913036834 | Bacteria | 6704877 |
| 1030 | 2917071091 | 2917070673 | Bacteria | 6868303 |
| 1031 | 2919066234 | 2919063839 | Bacteria | 6302690 |
| 1032 | 2919389850 | 2919385768 | Bacteria | 5897293 |
| 1033 | 2919459905 | 2919456309 | Bacteria | 6586567 |
| 1034 | 2919486485 | 2919481497 | Bacteria | 6907839 |
| 1035 | 2919488785 | 2919487758 | Bacteria | 5929766 |
| 1036 | 2919502309 | 2919501602 | Bacteria | 5286340 |
| 1037 | 2919699037 | 2919697872 | Bacteria | 6553725 |
| 1038 | 2923153995 | 2923153595 | Bacteria | 6870622 |
| 1039 | 2923589684 | 2923586266 | Bacteria | 6565975 |
| 1040 | 2926063982 | 2926063275 | Bacteria | 5285848 |
| 1041 | 2929144723 | 2929144301 | Bacteria | 6622272 |
| 1042 | 2931371944 | 2931369376 | Bacteria | 6847892 |
| 1043 | 2931398758 | 2931396565 | Bacteria | 7251677 |
| 1044 | 2935358919 | 2935353572 | Unclassified | 6955622 |
| 1045 | 2939641021 | 2939636861 | Bacteria | 6297853 |
| 1046 | 2969304880 | 2969304461 | Bacteria | 6601805 |
| 1047 | 2974293426 | 2974289157 | Bacteria | 6080362 |
| 1048 | 2984292066 | 2984286254 | Bacteria | 6702062 |
| 1049 | 2988732117 | 2988728565 | Bacteria | 6124362 |
| 1050 | 2998140381 | 2998139840 | Bacteria | 6073514 |
| 1051 | 3007398008 | 3007395558 | Bacteria | 6755444 |
| 1052 | 3007419937 | 3007419365 | Bacteria | 7026924 |
| 1053 | 3007517816 | 3007511990 | Bacteria | 6481491 |
| 1054 | 3007619178 | 3007614139 | Bacteria | 6053559 |
| 1055 | 3007625373 | 3007619802 | Bacteria | 6411688 |
| 1056 | 3007724022 | 3007718800 | Bacteria | 5971527 |
| 1057 | 3007805674 | 3007803356 | Bacteria | 5931491 |
| 1058 | 3007857171 | 3007855910 | Bacteria | 5637581 |
| 1059 | 3007864413 | 3007861166 | Bacteria | 6045338 |
| 1060 | 3007871980 | 3007866637 | Bacteria | 5899198 |
| 1061 | 3007875581 | 3007872151 | Bacteria | 5268868 |
| 1062 | 637317737 | 637000220 | Bacteria | 7074893 |
| 1063 | 8015688244 | 8015687852 | Bacteria | 6613826 |
| 1064 | 8019777258 | 8019775933 | Bacteria | 6858656 |
| 1065 | 8030000351 | 8029995093 | Bacteria | 5990776 |
| 1066 | 8034963520 | 8034962539 | Bacteria | 4884839 |
| 1067 | 8052494992 | 8052494512 | Bacteria | 5765634 |
| 1068 | 8055771340 | 8055770955 | Bacteria | 6827675 |
| 1069 | 8055880032 | 8055878733 | Bacteria | 5907058 |
| 1070 | 8056126388 | 8056125926 | Bacteria | 6228218 |
| 1071 | 8056143649 | 8056143049 | Bacteria | 6307666 |
| 1072 | 8056158437 | 8056155041 | Bacteria | 6486948 |
| 1073 | 8056170665 | 8056166840 | Bacteria | 5820959 |
| 1074 | 8056176781 | 8056172158 | Bacteria | 6133900 |
| 1075 | 8056179714 | 8056177738 | Bacteria | 6748268 |
| 1076 | 8056572243 | 8056569372 | Bacteria | 5997322 |
| 1077 | 8057802633 | 8057798959 | Bacteria | 6713499 |
| 1078 | Ga0065704_10079604 | |||
| 1079 | MRS2a_Contig_52 | |||
| 1080 | SwRhRL2b_contig_1475603 | |||
| 1081 | MRS1b_contig_2669205 | |||
| 1082 | JGI25162J39368_1000129 | |||
| 1083 | JGI25163J39215_1001408 | |||
| 1084 | JGI25163J39215_1001444 | |||
| 1085 | JGI25164J39214_1000076 | |||
| 1086 | JGI25164J39214_1000101 | |||
| 1087 | JGI25165J46597_1000150 | |||
| 1088 | JGI25165J46597_1000180 | |||
| 1089 | Ga0055536_1000312 | |||
| 1090 | Ga0055536_1003306 | |||
| 1091 | Ga0055536_1021229 | |||
| 1092 | Ga0055530_10000404 | |||
| 1093 | Ga0055530_10003582 | |||
| 1094 | Ga0055530_10003672 | |||
| 1095 | Ga0055540_1000339 | |||
| 1096 | Ga0055540_1002883 | |||
| 1097 | Ga0055540_1002945 | |||
| 1098 | Ga0055531_10000238 | |||
| 1099 | Ga0065714_10002970 | |||
| 1100 | Ga0065714_10009649 | |||
| 1101 | Ga0065714_10013965 | |||
| 1102 | Ga0065714_10065496 | |||
| 1103 | Ga0065714_10105677 | |||
| 1104 | Ga0065714_10236865 | |||
| 1105 | Ga0065704_10071810 | |||
| 1106 | Ga0065704_10132020 | |||
| 1107 | Ga0065704_10252860 | |||
| 1108 | Ga0065704_10336932 | |||
| 1109 | Ga0065712_10011023 | |||
| 1110 | Ga0070669_100000233 | |||
| 1111 | Ga0070662_100050060 | |||
| 1112 | Ga0070665_100851998 | |||
| 1113 | Ga0075364_10382202 | |||
| 1114 | Ga0075364_10435456 | |||
| 1115 | Ga0075432_10001952 | |||
| 1116 | Ga0075432_10061096 | |||
| 1117 | Ga0075432_10074320 | |||
| 1118 | Ga0075432_10133939 | |||
| 1119 | Ga0075362_10170789 | |||
| 1120 | Ga0075436_100070423 | |||
| 1121 | Ga0075436_100403642 | |||
| 1122 | Ga0099823_1007118 | |||
| 1123 | Ga0099823_1088359 | |||
| 1124 | Ga0079104_1000423 | |||
| 1125 | Ga0079104_1001202 | |||
| 1126 | Ga0079104_1082988 | |||
| 1127 | Ga0099826_10031348 | |||
| 1128 | Ga0105251_10057788 | |||
| 1129 | Ga0105251_10065668 | |||
| 1130 | Ga0105251_10209644 | |||
| 1131 | Ga0105244_10008644 | |||
| 1132 | Ga0105244_10009518 | |||
| 1133 | Ga0105244_10009952 | |||
| 1134 | Ga0105244_10013527 | |||
| 1135 | Ga0105244_10016561 | |||
| 1136 | Ga0105244_10039366 | |||
| 1137 | Ga0105244_10072826 | |||
| 1138 | Ga0105244_10087337 | |||
| 1139 | Ga0105244_10093106 | |||
| 1140 | Ga0105244_10221878 | |||
| 1141 | Ga0105250_10001638 | |||
| 1142 | Ga0105250_10018379 | |||
| 1143 | Ga0105250_10028488 | |||
| 1144 | Ga0105250_10053860 | |||
| 1145 | Ga0105250_10105964 | |||
| 1146 | Ga0105250_10170766 | |||
| 1147 | Ga0105243_10000299 | |||
| 1148 | Ga0105243_10001887 | |||
| 1149 | Ga0105243_10047304 | |||
| 1150 | Ga0105243_10137242 | |||
| 1151 | Ga0105242_10328437 | |||
| 1152 | Ga0105242_11163892 | |||
| 1153 | Ga0105246_10002004 | |||
| 1154 | Ga0105246_10101845 | |||
| 1155 | Ga0157345_1001666 | |||
| 1156 | Ga0157347_1031758 | |||
| 1157 | Ga0157373_10000945 | |||
| 1158 | Ga0157373_10147580 | |||
| 1159 | Ga0157373_10177542 | |||
| 1160 | Ga0157371_10004002 | |||
| 1161 | Ga0157371_10005478 | |||
| 1162 | Ga0157371_10012849 | |||
| 1163 | Ga0157371_10304475 | |||
| 1164 | Ga0157371_10361784 | |||
| 1165 | Ga0157371_10623606 | |||
| 1166 | Ga0157370_10023954 | |||
| 1167 | Ga0157370_10056033 | |||
| 1168 | Ga0157370_10112108 | |||
| 1169 | Ga0157370_10265443 | |||
| 1170 | Ga0157370_10526386 | |||
| 1171 | Ga0157370_10559520 | |||
| 1172 | Ga0157369_10068916 | |||
| 1173 | Ga0157369_10108625 | |||
| 1174 | Ga0157369_10538158 | |||
| 1175 | Ga0157369_10643160 | |||
| 1176 | Ga0163162_10023363 | |||
| 1177 | Ga0163162_10313239 | |||
| 1178 | Ga0157372_10105826 | |||
| 1179 | Ga0182008_10003739 | |||
| 1180 | Ga0182008_10007470 | |||
| 1181 | Ga0182008_10008836 | |||
| 1182 | Ga0182008_10023268 | |||
| 1183 | Ga0182008_10026929 | |||
| 1184 | Ga0182008_10046317 | |||
| 1185 | Ga0182008_10084800 | |||
| 1186 | Ga0182008_10207141 | |||
| 1187 | Ga0182008_10365040 | |||
| 1188 | Ga0182006_1000753 | |||
| 1189 | Ga0182006_1005124 | |||
| 1190 | Ga0182006_1020800 | |||
| 1191 | Ga0182006_1026552 | |||
| 1192 | Ga0182006_1044318 | |||
| 1193 | Ga0182006_1058122 | |||
| 1194 | Ga0182007_10001061 | |||
| 1195 | Ga0182007_10040384 | |||
| 1196 | Ga0182007_10057015 | |||
| 1197 | Ga0182007_10136843 | |||
| 1198 | Ga0182005_1002918 | |||
| 1199 | Ga0182005_1021781 | |||
| 1200 | Ga0182005_1023237 | |||
| 1201 | Ga0182005_1036292 | |||
| 1202 | Ga0163161_10016885 | |||
| 1203 | Ga0163161_10029907 | |||
| 1204 | Ga0163161_10036066 | |||
| 1205 | Ga0163161_10151877 | |||
| 1206 | Ga0163161_10708586 | |||
| 1207 | Ga0209760_100080 | |||
| 1208 | Ga0209760_100159 | |||
| 1209 | Ga0209563_102899 | |||
| 1210 | Ga0207427_100014 | |||
| 1211 | Ga0207427_100016 | |||
| 1212 | Ga0209437_100011 | |||
| 1213 | Ga0209437_100016 | |||
| 1214 | Ga0209233_1000019 | |||
| 1215 | Ga0209233_1000036 | |||
| 1216 | Ga0209675_1007415 | |||
| 1217 | Ga0209676_1000025 | |||
| 1218 | Ga0209676_1000032 | |||
| 1219 | Ga0209676_1000208 | |||
| 1220 | Ga0209676_1000519 | |||
| 1221 | Ga0209676_1008270 | |||
| 1222 | Ga0209676_1011363 | |||
| 1223 | Ga0209050_1000025 | |||
| 1224 | Ga0209050_1000028 | |||
| 1225 | Ga0209050_1000381 | |||
| 1226 | Ga0209050_1004298 | |||
| 1227 | Ga0209051_1000026 | |||
| 1228 | Ga0209051_1000039 | |||
| 1229 | Ga0209051_1000047 | |||
| 1230 | Ga0209051_1000080 | |||
| 1231 | Ga0209257_1000034 | |||
| 1232 | Ga0209257_1025113 | |||
| 1233 | Ga0207696_1000057 | |||
| 1234 | Ga0207696_1000074 | |||
| 1235 | Ga0207696_1001528 | |||
| 1236 | Ga0207696_1001618 | |||
| 1237 | Ga0207696_1001785 | |||
| 1238 | Ga0207696_1012979 | |||
| 1239 | Ga0207696_1021497 | |||
| 1240 | Ga0207696_1024317 | |||
| 1241 | Ga0207655_1001007 | |||
| 1242 | Ga0207655_1001190 | |||
| 1243 | Ga0207655_1001386 | |||
| 1244 | Ga0207655_1002635 | |||
| 1245 | Ga0207655_1004551 | |||
| 1246 | Ga0207655_1008767 | |||
| 1247 | Ga0207655_1008967 | |||
| 1248 | Ga0207655_1009044 | |||
| 1249 | Ga0207655_1014720 | |||
| 1250 | Ga0207655_1025214 | |||
| 1251 | Ga0207655_1029864 | |||
| 1252 | Ga0207655_1030573 | |||
| 1253 | Ga0207655_1042014 | |||
| 1254 | Ga0207655_1158757 | |||
| 1255 | Ga0207713_1002649 | |||
| 1256 | Ga0207713_1002650 | |||
| 1257 | Ga0207713_1008684 | |||
| 1258 | Ga0207713_1015567 | |||
| 1259 | Ga0207713_1018900 | |||
| 1260 | Ga0207713_1020907 | |||
| 1261 | Ga0207713_1035758 | |||
| 1262 | Ga0207713_1036589 | |||
| 1263 | Ga0207713_1036810 | |||
| 1264 | Ga0207713_1041267 | |||
| 1265 | Ga0207713_1048553 | |||
| 1266 | Ga0207713_1152342 | |||
| 1267 | Ga0207681_10003730 | |||
| 1268 | Ga0207706_10150088 | |||
| 1269 | Ga0207686_10240835 | |||
| 1270 | Ga0207686_10693268 | |||
| 1271 | Ga0207709_10000451 | |||
| 1272 | Ga0207709_10001143 | |||
| 1273 | Ga0207709_10014819 | |||
| 1274 | Ga0207709_10235104 | |||
| 1275 | Ga0209281_1000026 | |||
| 1276 | Ga0209281_1000033 | |||
| 1277 | Ga0209281_1008220 | |||
| 1278 | Ga0209281_1037826 | |||
| 1279 | Ga0209281_1039692 | |||
| 1280 | Ga0209389_1000190 | |||
| 1281 | Ga0209389_1073805 | |||
| 1282 | Ga0209371_1000630 | |||
| 1283 | Ga0209371_1057069 | |||
| 1284 | Ga0209999_1035782 | |||
| 1285 | Ga0207428_10068561 | |||
| 1286 | Ga0207428_10086363 | |||
| 1287 | Ga0207428_10173455 | |||
| 1288 | Ga0207428_10188003 | |||
| 1289 | Ga0207428_10461898 | |||
| 1290 | Ga0268266_10010145 | |||
| 1291 | Ga0268266_10051944 | |||
| 1292 | Ga0268256_1000273 | |||
| 1293 | Ga0268256_1063969 | |||
| 1294 | Ga0307511_10145036 | |||
| 1295 | Ga0316177_1034781 | |||
| 1296 | Ga0316177_1094337 | |||
| 1297 | Ga0314311_1075429 | |||
| 1298 | Ga0316179_1046502 | |||
| 1299 | Ga0316178_1102168 | |||
| 1300 | Ga0316181_1032700 | |||
| 1301 | Ga0316181_1121023 | |||
| 1302 | Ga0307408_100000002 | |||
| 1303 | Ga0307408_100012498 | |||
| 1304 | Ga0307408_100235261 | |||
| 1305 | Ga0307408_100247501 | |||
| 1306 | Ga0307408_100270026 | |||
| 1307 | Ga0307408_100473090 | |||
| 1308 | Ga0307516_10150724 | |||
| 1309 | Ga0307405_10008242 | |||
| 1310 | Ga0307405_10208162 | |||
| 1311 | Ga0307405_11060458 | |||
| 1312 | Ga0307406_10075207 | |||
| 1313 | Ga0307406_10449820 | |||
| 1314 | Ga0307412_10019210 | |||
| 1315 | Ga0307412_10022176 | |||
| 1316 | Ga0307412_10074041 | |||
| 1317 | Ga0307412_10383636 | |||
| 1318 | Ga0307409_100098675 | |||
| 1319 | Ga0307416_100603663 | |||
| 1320 | Ga0307416_100732095 | |||
| 1321 | Ga0307414_10026090 | |||
| 1322 | Ga0307414_10180202 | |||
| 1323 | Ga0307411_10017361 | |||
| 1324 | Ga0307411_10020058 | |||
| 1325 | Ga0307411_10269808 | |||
| 1326 | Ga0307510_10062849 | |||
| 1327 | Ga0237819_01489 | |||
| 1328 | Ga0439436_0023073 | |||
| 1329 | Ga0439438_001802 | |||
| 1330 | Ga0439438_003654 | |||
| 1331 | Ga0439438_004828 | |||
| 1332 | Ga0439438_005738 | |||
| 1333 | Ga0439438_016022 | |||
| 1334 | Ga0439438_016104 | |||
| 1335 | Ga0439438_018083 | |||
| 1336 | Ga0439438_036906 | |||
| 1337 | Ga0439438_091702 | |||
| 1338 | Ga0439447_002676 | |||
| 1339 | Ga0439447_003145 | |||
| 1340 | Ga0439447_004670 | |||
| 1341 | Ga0439447_023317 | |||
| 1342 | Ga0439447_023670 | |||
| 1343 | Ga0439447_034585 | |||
| 1344 | Ga0439447_037076 | |||
| 1345 | Ga0439447_040885 | |||
| 1346 | Ga0439466_0001279 | |||
| 1347 | Ga0439466_0002609 | |||
| 1348 | Ga0439466_0007307 | |||
| 1349 | Ga0439466_0012672 | |||
| 1350 | Ga0439466_0017279 | |||
| 1351 | Ga0439466_0019640 | |||
| 1352 | Ga0439466_0019683 | |||
| 1353 | Ga0439466_0034938 | |||
| 1354 | Ga0439466_0045757 | |||
| 1355 | Ga0439466_0067547 | |||
| 1356 | Ga0439465_0049967 | |||
| 1357 | Ga0439465_0159963 | |||
| 1358 | Ga0451841_0662075 | |||
| 1359 | Ga0439442_065256 | |||
| 1360 | Ga0439445_0024078 | |||
| 1361 | Ga0439432_000595 | |||
| 1362 | Ga0439432_000775 | |||
| 1363 | Ga0439432_006348 | |||
| 1364 | Ga0439432_013395 | |||
| 1365 | Ga0439432_103675 | |||
| 1366 | Ga0439451_000219 | |||
| 1367 | Ga0439451_002362 | |||
| 1368 | Ga0439451_021435 | |||
| 1369 | Ga0439451_029436 | |||
| 1370 | Ga0439451_036052 | |||
| 1371 | Ga0439451_054542 | |||
| 1372 | Ga0439452_000786 | |||
| 1373 | Ga0439452_000858 | |||
| 1374 | Ga0439452_000882 | |||
| 1375 | Ga0439452_002364 | |||
| 1376 | Ga0439452_003489 | |||
| 1377 | Ga0439452_007333 | |||
| 1378 | Ga0439452_019195 | |||
| 1379 | Ga0439452_053247 | |||
| 1380 | Ga0439456_001434 | |||
| 1381 | Ga0439456_013110 | |||
| 1382 | Ga0439456_034888 | |||
| 1383 | Ga0439456_037733 | |||
| 1384 | Ga0439456_103814 | |||
| 1385 | Ga0439463_000059 | |||
| 1386 | Ga0439463_000975 | |||
| 1387 | Ga0439463_023114 | |||
| 1388 | Ga0439463_024566 | |||
| 1389 | Ga0439463_039072 | |||
| 1390 | Ga0450911_000355 | |||
| 1391 | Ga0450911_008084 | |||
| 1392 | Ga0450919_003787 | |||
| 1393 | Ga0450922_002212 | |||
| 1394 | Ga0450922_013753 | |||
| 1395 | Ga0450923_000363 | |||
| 1396 | Ga0450923_027521 | |||
| 1397 | Ga0450900_010246 | |||
| 1398 | Ga0450902_006084 | |||
| 1399 | Ga0450902_007993 | |||
| 1400 | Ga0450902_013193 | |||
| 1401 | Ga0450902_019776 | |||
| 1402 | Ga0450902_023966 | |||
| 1403 | Ga0450903_014745 | |||
| 1404 | Ga0450904_001666 | |||
| 1405 | Ga0450904_009174 | |||
| 1406 | Ga0450904_014253 | |||
| 1407 | Ga0450905_002901 | |||
| 1408 | Ga0450905_034651 | |||
| 1409 | Ga0450906_014183 | |||
| 1410 | Ga0450906_035512 | |||
| 1411 | Ga0450907_000751 | |||
| 1412 | Ga0450907_005713 | |||
| 1413 | Ga0450907_005795 | |||
| 1414 | Ga0450910_012410 | |||
| 1415 | Ga0450910_020715 | |||
| 1416 | Ga0439446_0000081 | |||
| 1417 | Ga0439446_0009359 | |||
| 1418 | Ga0439446_0065059 | |||
| 1419 | Ga0450908_014825 | |||
| 1420 | Ga0450908_018726 | |||
| 1421 | Ga0450909_014786 | |||
| 1422 | Ga0439434_0001340 | |||
| 1423 | Ga0439434_0013350 | |||
| 1424 | Ga0439464_0000180 | |||
| 1425 | Ga0439464_0014826 | |||
| 1426 | Ga0439460_0007942 | |||
| 1427 | Ga0439460_0026436 | |||
| 1428 | Ga0450918_035818 | |||
| 1429 | Ga0450893_0011986 | |||
| 1430 | Ga0450901_001588 | |||
| 1431 | Ga0439440_0019024 | |||
| 1432 | Ga0439440_0024970 | |||
| 1433 | Ga0439440_0054586 | |||
| 1434 | Ga0495617_000455 | |||
| 1435 | Ga0495617_008242 | |||
| 1436 | Ga0495617_010516 | |||
| 1437 | Ga0495617_018854 | |||
| 1438 | Ga0495617_027193 | |||
| 1439 | Ga0495617_037441 | |||
| 1440 | Ga0495617_037529 | |||
| 1441 | Ga0495617_052407 | |||
| 1442 | Ga0495627_005394 | |||
| 1443 | Ga0495627_025389 | |||
| 1444 | Ga0495627_045176 | |||
| 1445 | Ga0495627_052872 | |||
| 1446 | Ga0495603_0069851 | |||
| 1447 | Ga0495603_0200734 | |||
| 1448 | Ga0495603_0328673 | |||
| 1449 | Ga0495603_0336349 | |||
| 1450 | Ga0495590_0003662 | |||
| 1451 | Ga0495590_0005324 | |||
| 1452 | Ga0495590_0035972 | |||
| 1453 | Ga0495590_0043579 | |||
| 1454 | Ga0495590_0072389 | |||
| 1455 | Ga0495590_0154541 | |||
| 1456 | Ga0495590_0222446 | |||
| 1457 | Ga0495590_0224123 | |||
| 1458 | Ga0495591_000668 | |||
| 1459 | Ga0495591_002443 | |||
| 1460 | Ga0495591_004511 | |||
| 1461 | Ga0495591_009614 | |||
| 1462 | Ga0495591_011156 | |||
| 1463 | Ga0495591_019077 | |||
| 1464 | Ga0495591_027027 | |||
| 1465 | Ga0495591_029507 | |||
| 1466 | Ga0495591_044350 | |||
| 1467 | Ga0495591_049763 | |||
| 1468 | Ga0495591_055672 | |||
| 1469 | Ga0495591_082483 | |||
| 1470 | Ga0495591_096415 | |||
| 1471 | Ga0495629_0123644 | |||
| 1472 | Ga0495638_0012439 | |||
| 1473 | Ga0495638_0028218 | |||
| 1474 | Ga0495638_0035196 | |||
| 1475 | Ga0495638_0061880 | |||
| 1476 | Ga0495638_0068844 | |||
| 1477 | Ga0495638_0084640 | |||
| 1478 | Ga0495638_0095065 | |||
| 1479 | Ga0495638_0098972 | |||
| 1480 | Ga0495638_0115535 | |||
| 1481 | Ga0495638_0162267 | |||
| 1482 | Ga0495638_0196748 | |||
| 1483 | Ga0495638_0258099 | |||
| 1484 | Ga0495638_0440320 | |||
| 1485 | Ga0495650_0000718 | |||
| 1486 | Ga0495650_0009711 | |||
| 1487 | Ga0495650_0025619 | |||
| 1488 | Ga0495650_0035372 | |||
| 1489 | Ga0495650_0037040 | |||
| 1490 | Ga0495650_0058180 | |||
| 1491 | Ga0495650_0070280 | |||
| 1492 | Ga0495650_0090063 | |||
| 1493 | Ga0495650_0139875 | |||
| 1494 | Ga0495650_0187509 | |||
| 1495 | Ga0495582_0051045 | |||
| 1496 | Ga0495605_0005176 | |||
| 1497 | Ga0495605_0009136 | |||
| 1498 | Ga0495605_0034883 | |||
| 1499 | Ga0495605_0039788 | |||
| 1500 | Ga0495605_0062241 | |||
| 1501 | Ga0495605_0104383 | |||
| 1502 | Ga0495605_0111678 | |||
| 1503 | Ga0495605_0203645 | |||
| 1504 | Ga0495605_0235409 | |||
| 1505 | Ga0495639_0001263 | |||
| 1506 | Ga0495639_0023584 | |||
| 1507 | Ga0495639_0088834 | |||
| 1508 | Ga0495584_0003386 | |||
| 1509 | Ga0495584_0007989 | |||
| 1510 | Ga0495584_0009605 | |||
| 1511 | Ga0495584_0009780 | |||
| 1512 | Ga0495584_0012470 | |||
| 1513 | Ga0495584_0016376 | |||
| 1514 | Ga0495584_0026970 | |||
| 1515 | Ga0495584_0052857 | |||
| 1516 | Ga0495584_0065932 | |||
| 1517 | Ga0495584_0085372 | |||
| 1518 | Ga0495584_0286103 | |||
| 1519 | Ga0495584_0409651 | |||
| 1520 | Ga0495585_0005619 | |||
| 1521 | Ga0495585_0006088 | |||
| 1522 | Ga0495585_0010425 | |||
| 1523 | Ga0495585_0069938 | |||
| 1524 | Ga0495585_0079002 | |||
| 1525 | Ga0495585_0094044 | |||
| 1526 | Ga0495585_0126753 | |||
| 1527 | Ga0495585_0134730 | |||
| 1528 | Ga0495585_0321566 | |||
| 1529 | Ga0495594_0135885 | |||
| 1530 | Ga0495594_0149148 | |||
| 1531 | Ga0495594_0278278 | |||
| 1532 | Ga0495596_0000545 | |||
| 1533 | Ga0495596_0009976 | |||
| 1534 | Ga0495607_0002719 | |||
| 1535 | Ga0495607_0004529 | |||
| 1536 | Ga0495607_0011725 | |||
| 1537 | Ga0495607_0021554 | |||
| 1538 | Ga0495607_0027707 | |||
| 1539 | Ga0495607_0054926 | |||
| 1540 | Ga0495607_0112956 | |||
| 1541 | Ga0495607_0114085 | |||
| 1542 | Ga0495607_0160168 | |||
| 1543 | Ga0495607_0162951 | |||
| 1544 | Ga0495583_0004153 | |||
| 1545 | Ga0495583_0004386 | |||
| 1546 | Ga0495583_0005841 | |||
| 1547 | Ga0495583_0081461 | |||
| 1548 | Ga0495583_0129364 | |||
| 1549 | Ga0495606_0000447 | |||
| 1550 | Ga0495606_0013954 | |||
| 1551 | Ga0495606_0016616 | |||
| 1552 | Ga0495606_0047624 | |||
| 1553 | Ga0495606_0052345 | |||
| 1554 | Ga0495606_0066377 | |||
| 1555 | Ga0495610_0011082 | |||
| 1556 | Ga0495610_0015733 | |||
| 1557 | Ga0495610_0016575 | |||
| 1558 | Ga0495610_0028275 | |||
| 1559 | Ga0495610_0028769 | |||
| 1560 | Ga0495610_0091376 | |||
| 1561 | Ga0495610_0242977 | |||
| 1562 | Ga0495616_0008264 | |||
| 1563 | Ga0495616_0044744 | |||
| 1564 | Ga0495616_0065538 | |||
| 1565 | Ga0495616_0095772 | |||
| 1566 | Ga0495616_0097330 | |||
| 1567 | Ga0495616_0154822 | |||
| 1568 | Ga0495616_0207843 | |||
| 1569 | Ga0495620_0000146 | |||
| 1570 | Ga0495620_0001025 | |||
| 1571 | Ga0495620_0007957 | |||
| 1572 | Ga0495620_0011678 | |||
| 1573 | Ga0495620_0033790 | |||
| 1574 | Ga0495620_0084459 | |||
| 1575 | Ga0495620_0148426 | |||
| 1576 | Ga0495628_0110833 | |||
| 1577 | Ga0495628_0623214 | |||
| 1578 | Ga0495630_0251400 | |||
| 1579 | Ga0495630_0259542 | |||
| 1580 | Ga0495631_0001255 | |||
| 1581 | Ga0495631_0002798 | |||
| 1582 | Ga0495631_0019223 | |||
| 1583 | Ga0495631_0053416 | |||
| 1584 | Ga0495631_0134440 | |||
| 1585 | Ga0495631_0220987 | |||
| 1586 | Ga0495632_0000599 | |||
| 1587 | Ga0495632_0001743 | |||
| 1588 | Ga0495632_0008921 | |||
| 1589 | Ga0495632_0010081 | |||
| 1590 | Ga0495632_0018363 | |||
| 1591 | Ga0495632_0026449 | |||
| 1592 | Ga0495632_0065399 | |||
| 1593 | Ga0495632_0106291 | |||
| 1594 | Ga0495632_0114596 | |||
| 1595 | Ga0495632_0136740 | |||
| 1596 | Ga0495632_0186571 | |||
| 1597 | Ga0495632_0217171 | |||
| 1598 | Ga0495637_0000298 | |||
| 1599 | Ga0495637_0003904 | |||
| 1600 | Ga0495637_0012181 | |||
| 1601 | Ga0495637_0013878 | |||
| 1602 | Ga0495637_0015426 | |||
| 1603 | Ga0495637_0048387 | |||
| 1604 | Ga0495637_0062269 | |||
| 1605 | Ga0495637_0073028 | |||
| 1606 | Ga0495637_0123619 | |||
| 1607 | Ga0495637_0141674 | |||
| 1608 | Ga0495637_0142833 | |||
| 1609 | Ga0495637_0162630 | |||
| 1610 | Ga0495643_0010831 | |||
| 1611 | Ga0495643_0011262 | |||
| 1612 | Ga0495643_0031987 | |||
| 1613 | Ga0495644_0001580 | |||
| 1614 | Ga0495644_0014061 | |||
| 1615 | Ga0495648_0002138 | |||
| 1616 | Ga0495648_0013653 | |||
| 1617 | Ga0495648_0017526 | |||
| 1618 | Ga0495648_0029310 | |||
| 1619 | Ga0495648_0067009 | |||
| 1620 | Ga0495648_0081478 | |||
| 1621 | Ga0495648_0088603 | |||
| 1622 | Ga0495648_0099266 | |||
| 1623 | Ga0495648_0112168 | |||
| 1624 | Ga0495648_0228609 | |||
| 1625 | Ga0495648_0259869 | |||
| 1626 | Ga0495648_0310154 | |||
| 1627 | Ga0495648_0372867 | |||
| 1628 | Ga0495666_0061660 | |||
| 1629 | Ga0495666_0138443 | |||
| 1630 | Ga0495642_0000662 | |||
| 1631 | Ga0495642_0000940 | |||
| 1632 | Ga0495642_0001149 | |||
| 1633 | Ga0495654_0002507 | |||
| 1634 | Ga0495654_0002748 | |||
| 1635 | Ga0495654_0010159 | |||
| 1636 | Ga0495654_0012918 | |||
| 1637 | Ga0495654_0018632 | |||
| 1638 | Ga0495654_0044760 | |||
| 1639 | Ga0495654_0058885 | |||
| 1640 | Ga0495654_0096779 | |||
| 1641 | Ga0495654_0106946 | |||
| 1642 | Ga0495654_0115897 | |||
| 1643 | Ga0495654_0222893 | |||
| 1644 | Ga0495654_0233138 | |||
| 1645 | Ga0495654_0255963 | |||
| 1646 | Ga0495586_0208552 | |||
| 1647 | Ga0495587_0017674 | |||
| 1648 | Ga0495587_0018153 | |||
| 1649 | Ga0495587_0085731 | |||
| 1650 | Ga0495609_0000283 | |||
| 1651 | Ga0495609_0017903 | |||
| 1652 | Ga0495609_0019921 | |||
| 1653 | Ga0495609_0108960 | |||
| 1654 | Ga0495609_0147849 | |||
| 1655 | Ga0495597_0010035 | |||
| 1656 | Ga0495597_0011165 | |||
| 1657 | Ga0495597_0043007 | |||
| 1658 | Ga0495597_0057791 | |||
| 1659 | Ga0495597_0090738 | |||
| 1660 | Ga0495597_0112472 | |||
| 1661 | Ga0495597_0148068 | |||
| 1662 | Ga0495597_0151978 | |||
| 1663 | Ga0495597_0178765 | |||
| 1664 | Ga0495597_0230716 | |||
| 1665 | Ga0495645_0147401 | |||
| 1666 | Ga0495622_0001532 | |||
| 1667 | Ga0495622_0005369 | |||
| 1668 | Ga0495622_0055032 | |||
| 1669 | Ga0495622_0065301 | |||
| 1670 | Ga0495622_0259170 | |||
| 1671 | Ga0495633_0003837 | |||
| 1672 | Ga0495633_0105045 | |||
| 1673 | Ga0495633_0109704 | |||
| 1674 | Ga0495633_0182207 | |||
| 1675 | Ga0495633_0410903 | |||
| 1676 | Ga0495656_0315933 | |||
| 1677 | Ga0495668_0004933 | |||
| 1678 | Ga0495668_0064263 | |||
| 1679 | Ga0495634_0021303 | |||
| 1680 | Ga0495611_0001569 | |||
| 1681 | Ga0495611_0029745 | |||
| 1682 | Ga0495611_0063222 | |||
| 1683 | Ga0495611_0141917 | |||
| 1684 | Ga0495611_0246991 | |||
| 1685 | Ga0495625_0000086 | |||
| 1686 | Ga0495625_0092577 | |||
| 1687 | Ga0495625_0111308 | |||
| 1688 | Ga0495625_0116247 | |||
| 1689 | Ga0495625_0129075 | |||
| 1690 | Ga0495625_0146515 | |||
| 1691 | Ga0495625_0168088 | |||
| 1692 | Ga0495625_0169332 | |||
| 1693 | Ga0495625_0328260 | |||
| 1694 | Ga0495625_0340945 | |||
| 1695 | Ga0495635_0055596 | |||
| 1696 | Ga0495635_0089204 | |||
| 1697 | Ga0495659_0000820 | |||
| 1698 | Ga0495659_0002070 | |||
| 1699 | Ga0495659_0072398 | |||
| 1700 | Ga0495661_0000212 | |||
| 1701 | Ga0495661_0001263 | |||
| 1702 | Ga0495661_0019813 | |||
| 1703 | Ga0495661_0124168 | |||
| 1704 | Ga0495661_0157000 | |||
| 1705 | Ga0495661_0172054 | |||
| 1706 | Ga0495661_0186881 | |||
| 1707 | Ga0495661_0199884 | |||
| 1708 | Ga0495661_0239843 | |||
| 1709 | Ga0495588_0071064 | |||
| 1710 | Ga0495657_0127527 | |||
| 1711 | Ga0495623_0043351 | |||
| 1712 | Ga0495623_0224125 | |||
| 1713 | Ga0495646_0038226 | |||
| 1714 | Ga0495646_0053319 | |||
| 1715 | Ga0495646_0056240 | |||
| 1716 | Ga0495613_0134739 | |||
| 1717 | Ga0495613_0153347 | |||
| 1718 | Ga0495613_0424188 | |||
| 1719 | Ga0495624_0003018 | |||
| 1720 | Ga0495670_0005198 | |||
| 1721 | Ga0495670_0005874 | |||
| 1722 | Ga0495670_0022253 | |||
| 1723 | Ga0495670_0024799 | |||
| 1724 | Ga0495670_0076998 | |||
| 1725 | Ga0495670_0218889 | |||
| 1726 | Ga0495671_0004628 | |||
| 1727 | Ga0495671_0008562 | |||
| 1728 | Ga0495671_0009715 | |||
| 1729 | Ga0495671_0017976 | |||
| 1730 | Ga0495671_0041400 | |||
| 1731 | Ga0495671_0047927 | |||
| 1732 | Ga0495671_0076678 | |||
| 1733 | Ga0495671_0110517 | |||
| 1734 | Ga0495671_0178527 | |||
| 1735 | Ga0495671_0193218 | |||
| 1736 | Ga0495671_0225582 | |||
| 1737 | Ga0495671_0232033 | |||
| 1738 | Ga0495671_0342220 | |||
| 1739 | Ga0495649_0001824 | |||
| 1740 | Ga0495649_0012385 | |||
| 1741 | Ga0495649_0031659 | |||
| 1742 | Ga0495649_0046671 | |||
| 1743 | Ga0495649_0064886 | |||
| 1744 | Ga0495649_0065109 | |||
| 1745 | Ga0495649_0083414 | |||
| 1746 | Ga0495649_0090370 | |||
| 1747 | Ga0495649_0142045 | |||
| 1748 | Ga0495649_0191786 | |||
| 1749 | Ga0495649_0354084 | |||
| 1750 | Ga0495649_0407064 | |||
| 1751 | Ga0495649_0507047 | |||
| 1752 | Ga0495589_0000918 | |||
| 1753 | Ga0495589_0002071 | |||
| 1754 | Ga0495589_0006815 | |||
| 1755 | Ga0495589_0015503 | |||
| 1756 | Ga0495589_0021718 | |||
| 1757 | Ga0495589_0041255 | |||
| 1758 | Ga0495589_0140918 | |||
| 1759 | Ga0495600_0061164 | |||
| 1760 | Ga0495600_0178085 | |||
| 1761 | Ga0495660_0021679 | |||
| 1762 | Ga0495660_0081388 | |||
| 1763 | Ga0495660_0089496 | |||
| 1764 | Ga0495660_0094580 | |||
| 1765 | Ga0495660_0107983 | |||
| 1766 | Ga0495660_0110362 | |||
| 1767 | Ga0495660_0168010 | |||
| 1768 | Ga0495660_0264590 | |||
| 1769 | Ga0495581_0061855 | |||
| 1770 | Ga0495581_0258372 | |||
| 1771 | Ga0495604_0062389 | |||
| 1772 | Ga0495636_0013407 | |||
| 1773 | Ga0495636_0016829 | |||
| 1774 | Ga0495674_0431563 | |||
| 1775 | Ga0495672_0003884 | |||
| 1776 | Ga0495672_0004360 | |||
| 1777 | Ga0495672_0006960 | |||
| 1778 | Ga0495672_0011630 | |||
| 1779 | Ga0495672_0012419 | |||
| 1780 | Ga0495672_0017506 | |||
| 1781 | Ga0495672_0019239 | |||
| 1782 | Ga0495672_0039236 | |||
| 1783 | Ga0495672_0053952 | |||
| 1784 | Ga0495672_0075740 | |||
| 1785 | Ga0495672_0083248 | |||
| 1786 | Ga0495672_0103027 | |||
| 1787 | Ga0495672_0125285 | |||
| 1788 | Ga0495672_0212981 | |||
| 1789 | Ga0495672_0283261 | |||
| 1790 | Ga0495676_0000022 | |||
| 1791 | Ga0495676_0058928 | |||
| 1792 | Ga0495680_0002433 | |||
| 1793 | Ga0495680_0036378 | |||
| 1794 | Ga0495680_0091746 | |||
| 1795 | Ga0495680_0165381 | |||
| 1796 | Ga0495680_0459215 | |||
| 1797 | Ga0495680_0537051 | |||
| 1798 | Ga0495683_0008727 | |||
| 1799 | Ga0495683_0026936 | |||
| 1800 | Ga0495683_0105458 | |||
| 1801 | Ga0495683_0113503 | |||
| 1802 | Ga0495683_0141210 | |||
| 1803 | Ga0495683_0174334 | |||
| 1804 | Ga0495683_0343617 | |||
| 1805 | Ga0495687_005361 | |||
| 1806 | Ga0495687_031459 | |||
| 1807 | Ga0495687_044748 | |||
| 1808 | Ga0495687_074572 | |||
| 1809 | Ga0495675_0139142 | |||
| 1810 | Ga0495677_0001306 | |||
| 1811 | Ga0495677_0145115 | |||
| 1812 | Ga0495679_000212 | |||
| 1813 | Ga0495679_024738 | |||
| 1814 | Ga0495679_029831 | |||
| 1815 | Ga0495679_037239 | |||
| 1816 | Ga0495679_069304 | |||
| 1817 | Ga0495679_101527 | |||
| 1818 | Ga0495685_085515 | |||
| 1819 | Ga0495673_0005218 | |||
| 1820 | Ga0495673_0006168 | |||
| 1821 | Ga0495673_0007676 | |||
| 1822 | Ga0495673_0009165 | |||
| 1823 | Ga0495673_0009710 | |||
| 1824 | Ga0495673_0015441 | |||
| 1825 | Ga0495673_0025778 | |||
| 1826 | Ga0495673_0029141 | |||
| 1827 | Ga0495673_0038061 | |||
| 1828 | Ga0495673_0073508 | |||
| 1829 | Ga0495673_0105918 | |||
| 1830 | Ga0495673_0135083 | |||
| 1831 | Ga0495673_0150889 | |||
| 1832 | Ga0495673_0156760 | |||
| 1833 | Ga0495681_0002383 | |||
| 1834 | Ga0495681_0004962 | |||
| 1835 | Ga0495681_0008341 | |||
| 1836 | Ga0495681_0009563 | |||
| 1837 | Ga0495681_0010666 | |||
| 1838 | Ga0495681_0016197 | |||
| 1839 | Ga0495681_0016536 | |||
| 1840 | Ga0495681_0020738 | |||
| 1841 | Ga0495681_0054819 | |||
| 1842 | Ga0495681_0060390 | |||
| 1843 | Ga0495681_0065421 | |||
| 1844 | Ga0495681_0071792 | |||
| 1845 | Ga0495681_0081306 | |||
| 1846 | Ga0495681_0129096 | |||
| 1847 | Ga0495681_0172902 | |||
| 1848 | Ga0495684_0510901 | |||
| 1849 | Ga0495686_0029158 | |||
| 1850 | Ga0495686_0038370 | |||
| 1851 | Ga0495686_0046754 | |||
| 1852 | Ga0495686_0064955 | |||
| 1853 | Ga0495686_0183861 | |||
| 1854 | Ga0495686_0238883 | |||
| 1855 | Ga0495593_0017925 | |||
| 1856 | Ga0495593_0082252 | |||
| 1857 | Ga0495593_0085393 | |||
| 1858 | Ga0495593_0355268 | |||
| 1859 | Ga0495602_0170217 | |||
| 1860 | Ga0495614_0177743 | |||
| 1861 | Ga0495626_0000039 | |||
| 1862 | Ga0495626_0000242 | |||
| 1863 | Ga0495626_0001832 | |||
| 1864 | Ga0495626_0003058 | |||
| 1865 | Ga0495626_0007505 | |||
| 1866 | Ga0495626_0024057 | |||
| 1867 | Ga0495626_0052218 | |||
| 1868 | Ga0495626_0063285 | |||
| 1869 | Ga0495626_0207197 | |||
| 1870 | Ga0495626_0240986 | |||
| 1871 | Ga0496102_0002921 | |||
| 1872 | Ga0496102_0412767 | |||
| 1873 | Ga0496102_0879801 | |||
| 1874 | Ga0496103_0199568 | |||
| 1875 | Ga0496105_0199517 | |||
| 1876 | Ga0496106_0383505 | |||
| 1877 | Ga0496110_0069439 | |||
| 1878 | Ga0496110_0384741 | |||
| 1879 | Ga0496110_0387135 | |||
| 1880 | Ga0496110_0661238 | |||
| 1881 | Ga0496110_0796049 | |||
| 1882 | Ga0496111_0429774 | |||
| 1883 | Ga0496112_0595844 | |||
| 1884 | Ga0496114_0318725 | |||
| 1885 | Ga0496115_0338557 | |||
| 1886 | Ga0496116_0000881 | |||
| 1887 | Ga0496116_0004892 | |||
| 1888 | Ga0496116_0005284 | |||
| 1889 | Ga0496116_0053916 | |||
| 1890 | Ga0496116_0095145 | |||
| 1891 | Ga0496116_0102424 | |||
| 1892 | Ga0496117_0000385 | |||
| 1893 | Ga0496117_0002861 | |||
| 1894 | Ga0496117_0008441 | |||
| 1895 | Ga0496117_0015017 | |||
| 1896 | Ga0496117_0021194 | |||
| 1897 | Ga0496117_0049035 | |||
| 1898 | Ga0496117_0065064 | |||
| 1899 | Ga0496117_0140100 | |||
| 1900 | Ga0496117_0173425 | |||
| 1901 | Ga0496117_0221332 | |||
| 1902 | Ga0496118_0009635 | |||
| 1903 | Ga0496118_0053236 | |||
| 1904 | Ga0496118_0089322 | |||
| 1905 | Ga0496118_0104397 | |||
| 1906 | Ga0496118_0133121 | |||
| 1907 | Ga0496118_0160884 | |||
| 1908 | Ga0496118_0203565 | |||
| 1909 | Ga0496118_0206512 | |||
| 1910 | Ga0496118_0388422 | |||
| 1911 | Ga0496119_0116846 | |||
| 1912 | Ga0496119_0156893 | |||
| 1913 | Ga0496121_0001650 | |||
| 1914 | Ga0496121_0002827 | |||
| 1915 | Ga0496121_0045727 | |||
| 1916 | Ga0496121_0063687 | |||
| 1917 | Ga0496121_0080979 | |||
| 1918 | Ga0496121_0223445 | |||
| 1919 | Ga0496121_0672401 | |||
| 1920 | Ga0496122_0002897 | |||
| 1921 | Ga0496122_0096287 | |||
| 1922 | Ga0496122_0116835 | |||
| 1923 | Ga0496122_0132207 | |||
| 1924 | Ga0496122_0347889 | |||
| 1925 | Ga0496123_0000717 | |||
| 1926 | Ga0496123_0027453 | |||
| 1927 | Ga0496123_0081253 | |||
| 1928 | Ga0496123_0103535 | |||
| 1929 | Ga0496123_0174367 | |||
| 1930 | Ga0496124_0001280 | |||
| 1931 | Ga0496124_0015978 | |||
| 1932 | Ga0496124_0019027 | |||
| 1933 | Ga0496124_0024994 | |||
| 1934 | Ga0496124_0025744 | |||
| 1935 | Ga0496124_0041266 | |||
| 1936 | Ga0496124_0273670 | |||
| 1937 | Ga0496124_0279264 | |||
| 1938 | Ga0496124_0306361 | |||
| 1939 | Ga0496124_0484925 | |||
| 1940 | Ga0496124_0484971 | |||
| 1941 | Ga0496124_0501643 | |||
| 1942 | Ga0496124_0520607 | |||
| 1943 | Ga0496125_0013483 | |||
| 1944 | Ga0496125_0022065 | |||
| 1945 | Ga0496125_0156909 | |||
| 1946 | Ga0496125_0180253 | |||
| 1947 | Ga0496125_0603207 | |||
| 1948 | Ga0496126_0326389 | |||
| 1949 | Ga0495678_001946 | |||
| 1950 | Ga0495678_019529 | |||
| 1951 | Ga0495678_032957 | |||
| 1952 | Ga0495678_039954 | |||
| 1953 | Ga0495678_042971 | |||
| 1954 | Ga0495678_045109 | |||
| 1955 | Ga0495678_057195 | |||
| 1956 | Ga0495678_057220 | |||
| 1957 | Ga0495678_175058 | |||
| 1958 | Ga0495682_0035529 | |||
| 1959 | Ga0495682_0036598 | |||
| 1960 | Ga0495682_0045704 | |||
| 1961 | Ga0495682_0076491 | |||
| 1962 | Ga0495682_0077877 | |||
| 1963 | Ga0495682_0089738 | |||
| 1964 | Ga0495682_0185216 | |||
| 1965 | Ga0501032_0007380 | |||
| 1966 | Ga0501034_0001845 | |||
| 1967 | Ga0501034_0683379 | |||
| 1968 | Ga0501241_011913 | |||
| 1969 | Ga0501269_014228 | |||
| 1970 | nmdc:mga03683_305342_c1 | |||
| 1971 | nmdc:mga00v17_222156_c1 | |||
| 1972 | nmdc:mga00v17_450395_c1 | |||
| 1973 | Ga0500659_0008421 | |||
| 1974 | Ga0500573_0064542 | |||
| 1975 | 2511258454 | |||
| 1976 | 2511265613 | |||
| 1977 | 2511269652 | |||
| 1978 | 2511280592 | |||
| 1979 | 2511288864 | |||
| 1980 | 2511293895 | |||
| 1981 | 2511302327 | |||
| 1982 | 2511315176 | |||
| 1983 | 2511322577 | |||
| 1984 | 2511323634 | |||
| 1985 | 2511332717 | |||
| 1986 | 2511337886 | |||
| 1987 | 2511345095 | |||
| 1988 | 2511349026 | |||
| 1989 | 2511355915 | |||
| 1990 | 2511361407 | |||
| 1991 | 2511368550 | |||
| 1992 | 2511411236 | |||
| 1993 | 2511822355 | |||
| 1994 | 2512325875 | |||
| 1995 | 2554818157 | |||
| 1996 | 2555247803 | |||
| 1997 | 2555667340 | |||
| 1998 | 2583789884 | |||
| 1999 | 2597855582 | |||
| 2000 | 2599356563 | |||
| 2001 | 2599363407 | |||
| 2002 | 2599369641 | |||
| 2003 | 2599376516 | |||
| 2004 | 2599381668 | |||
| 2005 | 2599388188 | |||
| 2006 | 2599395288 | |||
| 2007 | 2599407053 | |||
| 2008 | 2599463396 | |||
| 2009 | 2599469254 | |||
| 2010 | 2599485484 | |||
| 2011 | 2599492413 | |||
| 2012 | 2599502565 | |||
| 2013 | 2599613044 | |||
| 2014 | 2599769311 | |||
| 2015 | 2599806613 | |||
| 2016 | 2599888554 | |||
| 2017 | 2599900197 | |||
| 2018 | 2599934157 | |||
| 2019 | 2599943676 | |||
| 2020 | 2599955986 | |||
| 2021 | 2599961788 | |||
| 2022 | 2599966913 | |||
| 2023 | 2599974400 | |||
| 2024 | 2599978276 | |||
| 2025 | 2599984680 | |||
| 2026 | 2599991167 | |||
| 2027 | 2599994949 | |||
| 2028 | 2600002302 | |||
| 2029 | 2600004764 | |||
| 2030 | 2600012504 | |||
| 2031 | 2600018740 | |||
| 2032 | 2600026734 | |||
| 2033 | 2600029877 | |||
| 2034 | 2600034777 | |||
| 2035 | 2600043902 | |||
| 2036 | 2600047978 | |||
| 2037 | 2600055618 | |||
| 2038 | 2600060298 | |||
| 2039 | 2600067558 | |||
| 2040 | 2600071419 | |||
| 2041 | 2600080409 | |||
| 2042 | 2600216025 | |||
| 2043 | 2600359186 | |||
| 2044 | 2600364959 | |||
| 2045 | 2600443948 | |||
| 2046 | 2601776192 | |||
| 2047 | 2601797752 | |||
| 2048 | 2602008568 | |||
| 2049 | 2606076765 | |||
| 2050 | 2606128821 | |||
| 2051 | 2608380544 | |||
| 2052 | 2624478139 | |||
| 2053 | 2624489684 | |||
| 2054 | 2643840904 | |||
| 2055 | 2643954992 | |||
| 2056 | 2644024629 | |||
| 2057 | 2644186042 | |||
| 2058 | 2644282655 | |||
| 2059 | 2652546623 | |||
| 2060 | 2671092681 | |||
| 2061 | 2671100047 | |||
| 2062 | 2671127243 | |||
| 2063 | 2671772264 | |||
| 2064 | 2678260891 | |||
| 2065 | 2715749128 | |||
| 2066 | 2715754398 | |||
| 2067 | 2718632085 | |||
| 2068 | 2739197947 | |||
| 2069 | 2739260392 | |||
| 2070 | 2739311203 | |||
| 2071 | 2743735000 | |||
| 2072 | 2745006204 | |||
| 2073 | 2774119639 | |||
| 2074 | 2774134661 | |||
| 2075 | 2784261129 | |||
| 2076 | 2784316286 | |||
| 2077 | 2794598747 | |||
| 2078 | 2808856555 | |||
| 2079 | 2808922838 | |||
| 2080 | 2808932102 | |||
| 2081 | 2808936542 | |||
| 2082 | 2808939762 | |||
| 2083 | 2808944525 | |||
| 2084 | 2808954297 | |||
| 2085 | 2808955779 | |||
| 2086 | 2808964942 | |||
| 2087 | 2808999834 | |||
| 2088 | 2809217900 | |||
| 2089 | 2819657148 | |||
| 2090 | 2819705137 | |||
| 2091 | 2823425573 | |||
| 2092 | 2825654351 | |||
| 2093 | 2826582511 | |||
| 2094 | 2842817643 | |||
| 2095 | 2842834087 | |||
| 2096 | 2842846441 | |||
| 2097 | 2842851601 | |||
| 2098 | 2842859474 | |||
| 2099 | 2844667818 | |||
| 2100 | 2852660531 | |||
| 2101 | 2860343718 | |||
| 2102 | 2878030084 | |||
| 2103 | 2880231035 | |||
| 2104 | 2904519494 | |||
| 2105 | 2904552328 | |||
| 2106 | 2913037186 | |||
| 2107 | 2917071091 | |||
| 2108 | 2919066234 | |||
| 2109 | 2919389850 | |||
| 2110 | 2919459905 | |||
| 2111 | 2919486485 | |||
| 2112 | 2919488785 | |||
| 2113 | 2919502309 | |||
| 2114 | 2919699037 | |||
| 2115 | 2923153995 | |||
| 2116 | 2923589684 | |||
| 2117 | 2926063982 | |||
| 2118 | 2929144723 | |||
| 2119 | 2931371944 | |||
| 2120 | 2931398758 | |||
| 2121 | 2935358919 | |||
| 2122 | 2939641021 | |||
| 2123 | 2969304880 | |||
| 2124 | 2974293426 | |||
| 2125 | 2984292066 | |||
| 2126 | 2988732117 | |||
| 2127 | 2998140381 | |||
| 2128 | 3007398008 | |||
| 2129 | 3007419937 | |||
| 2130 | 3007517816 | |||
| 2131 | 3007619178 | |||
| 2132 | 3007625373 | |||
| 2133 | 3007724022 | |||
| 2134 | 3007805674 | |||
| 2135 | 3007857171 | |||
| 2136 | 3007864413 | |||
| 2137 | 3007871980 | |||
| 2138 | 3007875581 | |||
| 2139 | 637317737 | |||
| 2140 | 8015688244 | |||
| 2141 | 8019777258 | |||
| 2142 | 8030000351 | |||
| 2143 | 8034963520 | |||
| 2144 | 8052494992 | |||
| 2145 | 8055771340 | |||
| 2146 | 8055880032 | |||
| 2147 | 8056126388 | |||
| 2148 | 8056143649 | |||
| 2149 | 8056158437 | |||
| 2150 | 8056170665 | |||
| 2151 | 8056176781 | |||
| 2152 | 8056179714 | |||
| 2153 | 8056572243 | |||
| 2154 | 8057802633 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i6h-assembly1.cif.gz_B | structure of protein of unknown function atu0120 from agrobacterium tumefaciens | 0.8736 | 19 | 192 |
| 2i6h-assembly1.cif.gz_B | structure of protein of unknown function atu0120 from agrobacterium tumefaciens | 0.8304 | 19 | 192 |
| 2n8w-assembly1.cif.gz_A | solution nmr structure of designed protein da05r1, northeast structural genomics consortium (nesg) target or690 | 0.6406 | 93 | 169 |
| 3jaj-assembly1.cif.gz_6 | structure of the engaged state of the mammalian srp-ribosome complex | 0.5396 | 16 | 169 |
| 4epz-assembly1.cif.gz_A | crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution | 0.5369 | 16 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2i6hB02 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9272 | 91 | 192 | 1.25.40.10 |
| 2i6hB02 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8727 | 91 | 192 | 1.25.40.10 |
| af_P82872_1_141_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.6215 | 44 | 181 | 1.25.40.10 |
| af_P82805_1_146_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.6123 | 35 | 186 | 1.25.40.10 |
| af_P82805_1_146_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.596 | 35 | 186 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0KBE4-F1-model_v4 | deleted | 0.9975 | 1 | 125 |
|
| AF-A0A365VNW2-F1-model_v4 | deleted | 0.9954 | 87 | 199 |
|
| AF-A0A068Z0E8-F1-model_v4 | Putative transmembrane protein | 0.9913 | 124 | 195 |
|
| AF-A0A1E4PPH0-F1-model_v4 | deleted | 0.9886 | 5 | 199 |
|
| AF-A0A2V4L6P2-F1-model_v4 | DUF924 domain-containing protein | 0.9885 | 1 | 199 |
|