F489604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1077 | 454 | 2154 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_0153792|Ga0436363_0153792_577_834 |
| Length | 85 |
| Sequence | MPMAASEIEAAIVAALPGAVVTITDLAGDGDHYRAHVVAAGFAGLSRVKQHQLVYNALSGRMGGVLHALQLTTAVPGTAPEGVSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 7 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 8 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 26 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 208 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 210 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 238 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 239 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 240 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 241 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 242 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 247 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 248 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 249 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 250 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 251 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 252 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 255 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 256 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 257 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 258 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 259 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 260 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 261 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 321 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 322 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 323 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 326 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 327 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 328 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 331 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 332 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 333 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 334 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 335 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 336 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 358 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 359 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 360 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 361 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 367 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 368 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 369 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 374 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 375 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 376 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 377 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 378 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 379 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 383 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 392 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 393 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 394 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 396 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 398 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 399 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 400 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 401 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 402 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 406 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 407 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 409 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 411 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 412 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 413 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 415 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 416 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 417 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 418 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 419 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 421 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 423 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 432 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 433 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 434 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 435 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 436 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 437 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 438 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 439 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 440 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 441 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 442 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 443 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 444 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 445 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 446 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 447 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 448 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 449 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 450 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 451 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 452 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 453 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 454 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.47 |
| Metatranscriptomes | 1.3 |
| Isolates | 2.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 11.88 |
| Nodule | 0 |
| Rhizoplane | 4.92 |
| Rhizosphere | 71.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436363_0153792 | 3300039450 | Bacteria | 1691 |
| 2 | SwRhRL2b_contig_14491 | 2162886007 | Bacteria | 5668 |
| 3 | ARcpr5yngRDRAFT_c004470 | 3300000043 | Bacteria | 1323 |
| 4 | ARCol0yngRDRAFT_1009092 | 3300000652 | Bacteria | 718 |
| 5 | JGI24736J21556_1000613 | 3300001904 | Bacteria | 6542 |
| 6 | JGI24741J21665_1000366 | 3300001915 | Bacteria | 13487 |
| 7 | JGI24752J21851_1006793 | 3300001976 | Bacteria | 1495 |
| 8 | JGI24740J21852_10005104 | 3300001979 | Bacteria | 5575 |
| 9 | JGI24740J21852_10044246 | 3300001979 | Bacteria | 1322 |
| 10 | JGI24739J22299_10005319 | 3300001989 | Bacteria | 4903 |
| 11 | JGI24739J22299_10006470 | 3300001989 | Bacteria | 4419 |
| 12 | JGI24739J22299_10110044 | 3300001989 | Bacteria | 827 |
| 13 | JGI24739J22299_10112626 | 3300001989 | Bacteria | 816 |
| 14 | JGI24739J22299_10159140 | 3300001989 | Bacteria | 667 |
| 15 | JGI24737J22298_10015406 | 3300001990 | Bacteria | 2474 |
| 16 | JGI24737J22298_10020406 | 3300001990 | Bacteria | 2115 |
| 17 | JGI24737J22298_10048588 | 3300001990 | Bacteria | 1291 |
| 18 | JGI24737J22298_10132662 | 3300001990 | Bacteria | 736 |
| 19 | JGI24737J22298_10186610 | 3300001990 | Bacteria | 612 |
| 20 | JGI24743J22301_10030394 | 3300001991 | Bacteria | 1062 |
| 21 | JGI24743J22301_10113531 | 3300001991 | Bacteria | 590 |
| 22 | JGI24735J21928_10000590 | 3300002067 | Bacteria | 12771 |
| 23 | JGI24735J21928_10004614 | 3300002067 | Bacteria | 4616 |
| 24 | JGI24735J21928_10004932 | 3300002067 | Bacteria | 4449 |
| 25 | JGI24735J21928_10015755 | 3300002067 | Bacteria | 2353 |
| 26 | JGI24735J21928_10018807 | 3300002067 | Bacteria | 2128 |
| 27 | JGI24735J21928_10041906 | 3300002067 | Bacteria | 1334 |
| 28 | JGI24735J21928_10058528 | 3300002067 | Bacteria | 1109 |
| 29 | JGI24735J21928_10059101 | 3300002067 | Bacteria | 1102 |
| 30 | JGI24735J21928_10135297 | 3300002067 | Bacteria | 711 |
| 31 | JGI24735J21928_10202768 | 3300002067 | Bacteria | 575 |
| 32 | JGI24748J21848_1005228 | 3300002074 | Bacteria | 1502 |
| 33 | JGI24748J21848_1057374 | 3300002074 | Bacteria | 516 |
| 34 | JGI24738J21930_10000184 | 3300002075 | Bacteria | 16152 |
| 35 | JGI24738J21930_10000231 | 3300002075 | Bacteria | 15154 |
| 36 | JGI24738J21930_10001740 | 3300002075 | Bacteria | 5944 |
| 37 | JGI24738J21930_10015275 | 3300002075 | Bacteria | 1636 |
| 38 | JGI24749J21850_1000049 | 3300002076 | Bacteria | 22639 |
| 39 | JGI24744J21845_10008674 | 3300002077 | Bacteria | 2089 |
| 40 | JGI24035J26624_1026616 | 3300002126 | Bacteria | 622 |
| 41 | JGI24034J26672_10003845 | 3300002239 | Bacteria | 2109 |
| 42 | JGI24034J26672_10041405 | 3300002239 | Bacteria | 774 |
| 43 | JGI24751J29686_10000216 | 3300002459 | Bacteria | 24503 |
| 44 | JGI24751J29686_10018164 | 3300002459 | Bacteria | 1454 |
| 45 | JGI25164J39214_1007846 | 3300002772 | Bacteria | 1076 |
| 46 | JGI25150J39212_1002047 | 3300002774 | Bacteria | 5243 |
| 47 | JGI25151J46595_10122326 | 3300003187 | Bacteria | 661 |
| 48 | JGI25165J46597_1000043 | 3300003214 | Bacteria | 264515 |
| 49 | JGI25153J46596_10000395 | 3300003215 | Bacteria | 29365 |
| 50 | JGI25153J46596_10002504 | 3300003215 | Bacteria | 10546 |
| 51 | rootH1_10113314 | 3300003316 | Bacteria | 1254 |
| 52 | rootH1_10035136 | 3300003323 | Bacteria | 3354 |
| 53 | Ga0055529_1042867 | 3300003763 | Bacteria | 546 |
| 54 | Ga0055537_1001019 | 3300003773 | Bacteria | 12668 |
| 55 | Ga0055524_1000056 | 3300003775 | Bacteria | 141764 |
| 56 | Ga0055528_1020848 | 3300003790 | Bacteria | 2108 |
| 57 | Ga0055530_10000931 | 3300003791 | Bacteria | 23980 |
| 58 | Ga0055530_10007314 | 3300003791 | Bacteria | 4682 |
| 59 | Ga0055540_1002064 | 3300003792 | Bacteria | 11085 |
| 60 | Ga0055531_10012617 | 3300003794 | Bacteria | 3963 |
| 61 | Ga0055531_10015017 | 3300003794 | Bacteria | 3443 |
| 62 | Ga0065165_1005029 | 3300005262 | Bacteria | 7727 |
| 63 | Ga0065165_1009273 | 3300005262 | Bacteria | 4438 |
| 64 | Ga0065165_1017463 | 3300005262 | Bacteria | 2643 |
| 65 | Ga0065165_1062777 | 3300005262 | Bacteria | 1012 |
| 66 | Ga0065714_10116065 | 3300005288 | Bacteria | 1408 |
| 67 | Ga0065704_10070504 | 3300005289 | Bacteria | 22276 |
| 68 | Ga0065707_10000505 | 3300005295 | Bacteria | 50569 |
| 69 | Ga0065707_10086198 | 3300005295 | Bacteria | 5602 |
| 70 | Ga0065707_10135500 | 3300005295 | Bacteria | 1848 |
| 71 | Ga0065707_10212812 | 3300005295 | Bacteria | 1258 |
| 72 | Ga0065707_10371722 | 3300005295 | Bacteria | 889 |
| 73 | Ga0065707_10414622 | 3300005295 | Bacteria | 837 |
| 74 | Ga0065707_10938111 | 3300005295 | Bacteria | 556 |
| 75 | Ga0070658_10006525 | 3300005327 | Bacteria | 9464 |
| 76 | Ga0070658_10068992 | 3300005327 | Bacteria | 2891 |
| 77 | Ga0070658_10097157 | 3300005327 | Bacteria | 2432 |
| 78 | Ga0070658_10584581 | 3300005327 | Bacteria | 967 |
| 79 | Ga0070658_10669238 | 3300005327 | Bacteria | 901 |
| 80 | Ga0070658_11102012 | 3300005327 | Bacteria | 691 |
| 81 | Ga0070676_10000230 | 3300005328 | Bacteria | 23872 |
| 82 | Ga0070683_100195033 | 3300005329 | Bacteria | 1923 |
| 83 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 84 | Ga0070670_100002377 | 3300005331 | Bacteria | 15504 |
| 85 | Ga0070670_100004170 | 3300005331 | Bacteria | 12090 |
| 86 | Ga0070670_100126344 | 3300005331 | Bacteria | 2207 |
| 87 | Ga0070670_100189232 | 3300005331 | Bacteria | 1787 |
| 88 | Ga0070677_10801344 | 3300005333 | Bacteria | 538 |
| 89 | Ga0068869_100000200 | 3300005334 | Bacteria | 31213 |
| 90 | Ga0070666_10000184 | 3300005335 | Bacteria | 42807 |
| 91 | Ga0070666_10033483 | 3300005335 | Bacteria | 3400 |
| 92 | Ga0070666_10257671 | 3300005335 | Bacteria | 1236 |
| 93 | Ga0070682_100302630 | 3300005337 | Bacteria | 1174 |
| 94 | Ga0068868_100001398 | 3300005338 | Bacteria | 16647 |
| 95 | Ga0070660_100004583 | 3300005339 | Bacteria | 9552 |
| 96 | Ga0070660_100070534 | 3300005339 | Bacteria | 2727 |
| 97 | Ga0070660_100209408 | 3300005339 | Bacteria | 1582 |
| 98 | Ga0070660_100996905 | 3300005339 | Bacteria | 708 |
| 99 | Ga0070661_100581848 | 3300005344 | Bacteria | 903 |
| 100 | Ga0070661_101005335 | 3300005344 | Bacteria | 692 |
| 101 | Ga0070668_100000026 | 3300005347 | Bacteria | 92584 |
| 102 | Ga0070668_100000080 | 3300005347 | Bacteria | 60157 |
| 103 | Ga0070668_100018364 | 3300005347 | Bacteria | 5250 |
| 104 | Ga0070668_100027483 | 3300005347 | Bacteria | 4320 |
| 105 | Ga0070668_100208292 | 3300005347 | Bacteria | 1607 |
| 106 | Ga0070668_100408180 | 3300005347 | Bacteria | 1161 |
| 107 | Ga0070668_100428915 | 3300005347 | Bacteria | 1133 |
| 108 | Ga0070669_100000008 | 3300005353 | Bacteria | 226764 |
| 109 | Ga0070669_100000020 | 3300005353 | Bacteria | 181297 |
| 110 | Ga0070669_100000082 | 3300005353 | Bacteria | 91465 |
| 111 | Ga0070669_100096603 | 3300005353 | Bacteria | 2223 |
| 112 | Ga0070675_100006627 | 3300005354 | Bacteria | 8902 |
| 113 | Ga0070671_100000015 | 3300005355 | Bacteria | 166132 |
| 114 | Ga0070671_100000169 | 3300005355 | Bacteria | 43010 |
| 115 | Ga0070671_100000470 | 3300005355 | Bacteria | 28105 |
| 116 | Ga0070671_100013092 | 3300005355 | Bacteria | 6684 |
| 117 | Ga0070671_100053502 | 3300005355 | Bacteria | 3356 |
| 118 | Ga0070674_100051002 | 3300005356 | Bacteria | 2849 |
| 119 | Ga0070673_100000006 | 3300005364 | Bacteria | 184299 |
| 120 | Ga0070673_101154028 | 3300005364 | Bacteria | 725 |
| 121 | Ga0070688_100464942 | 3300005365 | Bacteria | 948 |
| 122 | Ga0070659_100052995 | 3300005366 | Bacteria | 3192 |
| 123 | Ga0070659_100899434 | 3300005366 | Bacteria | 774 |
| 124 | Ga0070659_101485301 | 3300005366 | Bacteria | 604 |
| 125 | Ga0070659_101711550 | 3300005366 | Bacteria | 562 |
| 126 | Ga0070667_100000019 | 3300005367 | Bacteria | 224710 |
| 127 | Ga0070667_100006367 | 3300005367 | Bacteria | 9810 |
| 128 | Ga0070667_100037194 | 3300005367 | Bacteria | 4081 |
| 129 | Ga0070667_100038717 | 3300005367 | Bacteria | 3998 |
| 130 | Ga0070667_100681738 | 3300005367 | Bacteria | 950 |
| 131 | Ga0070705_100054779 | 3300005440 | Bacteria | 2341 |
| 132 | Ga0070705_100448402 | 3300005440 | Bacteria | 967 |
| 133 | Ga0070708_100198374 | 3300005445 | Bacteria | 1878 |
| 134 | Ga0070708_101344162 | 3300005445 | Bacteria | 667 |
| 135 | Ga0070663_100000574 | 3300005455 | Bacteria | 19656 |
| 136 | Ga0070663_100002941 | 3300005455 | Bacteria | 9696 |
| 137 | Ga0070663_101387399 | 3300005455 | Bacteria | 622 |
| 138 | Ga0070678_100552397 | 3300005456 | Bacteria | 1022 |
| 139 | Ga0070662_100007108 | 3300005457 | Bacteria | 7246 |
| 140 | Ga0070662_100094062 | 3300005457 | Bacteria | 2256 |
| 141 | Ga0070662_100561610 | 3300005457 | Bacteria | 957 |
| 142 | Ga0070662_100819864 | 3300005457 | Bacteria | 791 |
| 143 | Ga0070662_101003480 | 3300005457 | Bacteria | 715 |
| 144 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 145 | Ga0070685_10103920 | 3300005466 | Bacteria | 1739 |
| 146 | Ga0070685_10368722 | 3300005466 | Bacteria | 986 |
| 147 | Ga0070707_101322160 | 3300005468 | Bacteria | 687 |
| 148 | Ga0070679_100158874 | 3300005530 | Bacteria | 2235 |
| 149 | Ga0070679_100424436 | 3300005530 | Bacteria | 1275 |
| 150 | Ga0070684_100251597 | 3300005535 | Bacteria | 1615 |
| 151 | Ga0068853_100143479 | 3300005539 | Bacteria | 2145 |
| 152 | Ga0068853_100881719 | 3300005539 | Bacteria | 859 |
| 153 | Ga0068853_100884100 | 3300005539 | Bacteria | 858 |
| 154 | Ga0068853_102321716 | 3300005539 | Bacteria | 520 |
| 155 | Ga0070672_100004199 | 3300005543 | Bacteria | 9412 |
| 156 | Ga0070686_100290882 | 3300005544 | Bacteria | 1208 |
| 157 | Ga0070665_100002434 | 3300005548 | Bacteria | 20520 |
| 158 | Ga0070665_100009702 | 3300005548 | Bacteria | 9728 |
| 159 | Ga0070665_100095381 | 3300005548 | Bacteria | 2980 |
| 160 | Ga0070665_100378831 | 3300005548 | Bacteria | 1422 |
| 161 | Ga0070665_100420653 | 3300005548 | Bacteria | 1345 |
| 162 | Ga0070665_100895973 | 3300005548 | Bacteria | 900 |
| 163 | Ga0070665_101432299 | 3300005548 | Bacteria | 700 |
| 164 | Ga0068855_100218364 | 3300005563 | Bacteria | 2139 |
| 165 | Ga0068855_100577260 | 3300005563 | Bacteria | 1215 |
| 166 | Ga0068855_101048138 | 3300005563 | Bacteria | 855 |
| 167 | Ga0068855_101587902 | 3300005563 | Bacteria | 670 |
| 168 | Ga0068855_102121698 | 3300005563 | Bacteria | 566 |
| 169 | Ga0068857_100021366 | 3300005577 | Bacteria | 5697 |
| 170 | Ga0068857_100637109 | 3300005577 | Bacteria | 1009 |
| 171 | Ga0068857_100711507 | 3300005577 | Bacteria | 955 |
| 172 | Ga0068854_100000483 | 3300005578 | Bacteria | 24310 |
| 173 | Ga0068854_100301862 | 3300005578 | Bacteria | 1296 |
| 174 | Ga0068854_100538554 | 3300005578 | Bacteria | 988 |
| 175 | Ga0068854_101277453 | 3300005578 | Bacteria | 660 |
| 176 | Ga0068856_100003591 | 3300005614 | Bacteria | 15606 |
| 177 | Ga0068856_100020542 | 3300005614 | Bacteria | 6414 |
| 178 | Ga0068856_100312622 | 3300005614 | Bacteria | 1589 |
| 179 | Ga0068852_100028295 | 3300005616 | Bacteria | 4585 |
| 180 | Ga0068852_100608851 | 3300005616 | Bacteria | 1097 |
| 181 | Ga0068852_101516957 | 3300005616 | Bacteria | 692 |
| 182 | Ga0068859_100003505 | 3300005617 | Bacteria | 15985 |
| 183 | Ga0068859_100023533 | 3300005617 | Bacteria | 6181 |
| 184 | Ga0068859_100034581 | 3300005617 | Bacteria | 5071 |
| 185 | Ga0068859_100216629 | 3300005617 | Bacteria | 2002 |
| 186 | Ga0068859_100679313 | 3300005617 | Bacteria | 1121 |
| 187 | Ga0068859_100859376 | 3300005617 | Bacteria | 993 |
| 188 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 189 | Ga0068864_100030140 | 3300005618 | Bacteria | 4598 |
| 190 | Ga0068864_100466728 | 3300005618 | Bacteria | 1210 |
| 191 | Ga0068861_100004980 | 3300005719 | Bacteria | 8951 |
| 192 | Ga0068861_100154977 | 3300005719 | Bacteria | 1883 |
| 193 | Ga0068851_10074177 | 3300005834 | Bacteria | 1765 |
| 194 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 195 | Ga0068863_100000582 | 3300005841 | Bacteria | 37202 |
| 196 | Ga0068863_100067996 | 3300005841 | Bacteria | 3370 |
| 197 | Ga0068863_100084694 | 3300005841 | Bacteria | 3004 |
| 198 | Ga0068863_100137511 | 3300005841 | Bacteria | 2334 |
| 199 | Ga0068863_100313791 | 3300005841 | Bacteria | 1522 |
| 200 | Ga0068858_100010355 | 3300005842 | Bacteria | 8831 |
| 201 | Ga0068858_100034454 | 3300005842 | Bacteria | 4697 |
| 202 | Ga0068858_100380650 | 3300005842 | Bacteria | 1354 |
| 203 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 204 | Ga0068860_100001081 | 3300005843 | Bacteria | 30047 |
| 205 | Ga0068860_100004358 | 3300005843 | Bacteria | 14457 |
| 206 | Ga0068860_100044110 | 3300005843 | Bacteria | 4251 |
| 207 | Ga0068860_100115216 | 3300005843 | Bacteria | 2570 |
| 208 | Ga0068860_100263556 | 3300005843 | Bacteria | 1680 |
| 209 | Ga0068860_100310382 | 3300005843 | Bacteria | 1546 |
| 210 | Ga0068860_102676641 | 3300005843 | Bacteria | 517 |
| 211 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 212 | Ga0068862_100000169 | 3300005844 | Bacteria | 72633 |
| 213 | Ga0068862_100001451 | 3300005844 | Bacteria | 21840 |
| 214 | Ga0068862_100006085 | 3300005844 | Bacteria | 10046 |
| 215 | Ga0068862_100021177 | 3300005844 | Bacteria | 5435 |
| 216 | Ga0068862_100049285 | 3300005844 | Bacteria | 3597 |
| 217 | Ga0068862_100087044 | 3300005844 | Bacteria | 2717 |
| 218 | Ga0068862_101234307 | 3300005844 | Bacteria | 747 |
| 219 | Ga0081455_10000255 | 3300005937 | Bacteria | 69927 |
| 220 | Ga0081455_10023602 | 3300005937 | Bacteria | 5720 |
| 221 | Ga0081538_10004148 | 3300005981 | Bacteria | 13446 |
| 222 | Ga0081538_10036760 | 3300005981 | Bacteria | 3188 |
| 223 | Ga0075364_10197055 | 3300006051 | Bacteria | 1365 |
| 224 | Ga0075364_10888517 | 3300006051 | Bacteria | 607 |
| 225 | Ga0075366_10043167 | 3300006195 | Bacteria | 2671 |
| 226 | Ga0075366_10245806 | 3300006195 | Bacteria | 1091 |
| 227 | Ga0075366_10576769 | 3300006195 | Bacteria | 697 |
| 228 | Ga0075366_10726065 | 3300006195 | Bacteria | 617 |
| 229 | Ga0075366_10801680 | 3300006195 | Bacteria | 586 |
| 230 | Ga0097621_100001076 | 3300006237 | Bacteria | 19102 |
| 231 | Ga0075370_10043587 | 3300006353 | Bacteria | 2536 |
| 232 | Ga0075370_10637142 | 3300006353 | Bacteria | 647 |
| 233 | Ga0068871_100067527 | 3300006358 | Bacteria | 2934 |
| 234 | Ga0068871_101210368 | 3300006358 | Bacteria | 709 |
| 235 | Ga0068865_100000003 | 3300006881 | Bacteria | 231761 |
| 236 | Ga0097620_100003505 | 3300006931 | Bacteria | 15985 |
| 237 | Ga0097620_100023532 | 3300006931 | Bacteria | 6181 |
| 238 | Ga0097620_100034580 | 3300006931 | Bacteria | 5071 |
| 239 | Ga0097620_100216626 | 3300006931 | Bacteria | 2002 |
| 240 | Ga0097620_100679134 | 3300006931 | Bacteria | 1121 |
| 241 | Ga0097620_100859461 | 3300006931 | Bacteria | 993 |
| 242 | Ga0105251_10012362 | 3300009011 | Bacteria | 4831 |
| 243 | Ga0105251_10638162 | 3300009011 | Bacteria | 508 |
| 244 | Ga0105244_10606409 | 3300009036 | Bacteria | 501 |
| 245 | Ga0105250_10006517 | 3300009092 | Bacteria | 5096 |
| 246 | Ga0105240_10015679 | 3300009093 | Bacteria | 10290 |
| 247 | Ga0105240_10025126 | 3300009093 | Bacteria | 7835 |
| 248 | Ga0105240_10091793 | 3300009093 | Bacteria | 3709 |
| 249 | Ga0105240_10318721 | 3300009093 | Bacteria | 1773 |
| 250 | Ga0105240_10744819 | 3300009093 | Bacteria | 1066 |
| 251 | Ga0105240_12089073 | 3300009093 | Bacteria | 588 |
| 252 | Ga0105245_10000113 | 3300009098 | Bacteria | 78545 |
| 253 | Ga0105245_10032215 | 3300009098 | Bacteria | 4641 |
| 254 | Ga0105247_10001891 | 3300009101 | Bacteria | 14614 |
| 255 | Ga0105247_10369422 | 3300009101 | Bacteria | 1014 |
| 256 | Ga0105243_10000373 | 3300009148 | Bacteria | 48115 |
| 257 | Ga0105243_10328860 | 3300009148 | Bacteria | 1395 |
| 258 | Ga0105243_10942050 | 3300009148 | Bacteria | 862 |
| 259 | Ga0105241_10038453 | 3300009174 | Bacteria | 3607 |
| 260 | Ga0105241_10707420 | 3300009174 | Bacteria | 920 |
| 261 | Ga0105242_10000165 | 3300009176 | Bacteria | 49974 |
| 262 | Ga0105248_10001558 | 3300009177 | Bacteria | 25511 |
| 263 | Ga0105248_10024425 | 3300009177 | Bacteria | 6720 |
| 264 | Ga0105248_10043233 | 3300009177 | Bacteria | 5052 |
| 265 | Ga0105248_10088281 | 3300009177 | Bacteria | 3490 |
| 266 | Ga0105248_13138180 | 3300009177 | Bacteria | 526 |
| 267 | Ga0105237_10044206 | 3300009545 | Bacteria | 4485 |
| 268 | Ga0105237_11408470 | 3300009545 | Bacteria | 703 |
| 269 | Ga0105237_11679876 | 3300009545 | Bacteria | 642 |
| 270 | Ga0105237_12603792 | 3300009545 | Bacteria | 516 |
| 271 | Ga0105238_10635331 | 3300009551 | Bacteria | 1077 |
| 272 | Ga0105238_11154457 | 3300009551 | Bacteria | 798 |
| 273 | Ga0105238_11442421 | 3300009551 | Bacteria | 716 |
| 274 | Ga0105249_10000045 | 3300009553 | Bacteria | 182927 |
| 275 | Ga0105249_10019753 | 3300009553 | Bacteria | 6016 |
| 276 | Ga0105249_10037409 | 3300009553 | Bacteria | 4404 |
| 277 | Ga0105249_10084345 | 3300009553 | Bacteria | 2959 |
| 278 | Ga0105249_10265973 | 3300009553 | Bacteria | 1706 |
| 279 | Ga0105249_10758182 | 3300009553 | Bacteria | 1033 |
| 280 | Ga0105239_10000367 | 3300010375 | Bacteria | 66191 |
| 281 | Ga0105239_10012172 | 3300010375 | Bacteria | 9592 |
| 282 | Ga0105239_10326543 | 3300010375 | Bacteria | 1730 |
| 283 | Ga0105239_10846266 | 3300010375 | Bacteria | 1049 |
| 284 | Ga0105239_10931845 | 3300010375 | Bacteria | 997 |
| 285 | Ga0105246_10001620 | 3300011119 | Bacteria | 13399 |
| 286 | Ga0157326_1000423 | 3300012513 | Bacteria | 5017 |
| 287 | Ga0157373_10081550 | 3300013100 | Bacteria | 2280 |
| 288 | Ga0157373_10136804 | 3300013100 | Bacteria | 1723 |
| 289 | Ga0157373_10232191 | 3300013100 | Bacteria | 1303 |
| 290 | Ga0157371_10160163 | 3300013102 | Bacteria | 1607 |
| 291 | Ga0157371_10492244 | 3300013102 | Bacteria | 905 |
| 292 | Ga0157371_11482642 | 3300013102 | Bacteria | 529 |
| 293 | Ga0157371_11598663 | 3300013102 | Bacteria | 510 |
| 294 | Ga0157371_11604795 | 3300013102 | Bacteria | 509 |
| 295 | Ga0157370_10000069 | 3300013104 | Bacteria | 112889 |
| 296 | Ga0157370_10057965 | 3300013104 | Bacteria | 3681 |
| 297 | Ga0157370_10174746 | 3300013104 | Bacteria | 1996 |
| 298 | Ga0157370_10214812 | 3300013104 | Bacteria | 1782 |
| 299 | Ga0157370_10647775 | 3300013104 | Bacteria | 966 |
| 300 | Ga0157370_10971235 | 3300013104 | Bacteria | 770 |
| 301 | Ga0157370_11695857 | 3300013104 | Bacteria | 567 |
| 302 | Ga0157369_10012597 | 3300013105 | Bacteria | 9595 |
| 303 | Ga0157369_10109686 | 3300013105 | Bacteria | 2934 |
| 304 | Ga0157369_10173906 | 3300013105 | Bacteria | 2268 |
| 305 | Ga0157369_10174888 | 3300013105 | Bacteria | 2260 |
| 306 | Ga0157369_12006581 | 3300013105 | Bacteria | 587 |
| 307 | Ga0157369_12357748 | 3300013105 | Bacteria | 539 |
| 308 | Ga0157374_10100942 | 3300013296 | Bacteria | 2766 |
| 309 | Ga0157374_10393274 | 3300013296 | Bacteria | 1382 |
| 310 | Ga0157374_10432242 | 3300013296 | Bacteria | 1316 |
| 311 | Ga0157378_10002300 | 3300013297 | Bacteria | 16976 |
| 312 | Ga0163162_10016081 | 3300013306 | Bacteria | 7314 |
| 313 | Ga0163162_10019579 | 3300013306 | Bacteria | 6643 |
| 314 | Ga0163162_10301457 | 3300013306 | Bacteria | 1734 |
| 315 | Ga0163162_12257592 | 3300013306 | Bacteria | 625 |
| 316 | Ga0163162_13217757 | 3300013306 | Bacteria | 524 |
| 317 | Ga0157372_10113522 | 3300013307 | Bacteria | 3105 |
| 318 | Ga0157372_10118609 | 3300013307 | Bacteria | 3036 |
| 319 | Ga0157372_10209575 | 3300013307 | Bacteria | 2258 |
| 320 | Ga0157372_10258817 | 3300013307 | Bacteria | 2021 |
| 321 | Ga0157372_10288298 | 3300013307 | Bacteria | 1909 |
| 322 | Ga0157372_10337590 | 3300013307 | Bacteria | 1755 |
| 323 | Ga0157372_10567943 | 3300013307 | Bacteria | 1322 |
| 324 | Ga0157372_10932088 | 3300013307 | Bacteria | 1007 |
| 325 | Ga0157372_12775511 | 3300013307 | Bacteria | 562 |
| 326 | Ga0157375_10041491 | 3300013308 | Bacteria | 4443 |
| 327 | Ga0157375_10798349 | 3300013308 | Bacteria | 1093 |
| 328 | Ga0163163_10030114 | 3300014325 | Bacteria | 5225 |
| 329 | Ga0157380_10000029 | 3300014326 | Bacteria | 98248 |
| 330 | Ga0157380_10001161 | 3300014326 | Bacteria | 17056 |
| 331 | Ga0157380_10230670 | 3300014326 | Bacteria | 1663 |
| 332 | Ga0157380_12204024 | 3300014326 | Bacteria | 615 |
| 333 | Ga0182008_10307738 | 3300014497 | Bacteria | 831 |
| 334 | Ga0157377_10067056 | 3300014745 | Bacteria | 2065 |
| 335 | Ga0157379_10128162 | 3300014968 | Bacteria | 2283 |
| 336 | Ga0157379_10770590 | 3300014968 | Bacteria | 906 |
| 337 | Ga0157376_10000089 | 3300014969 | Bacteria | 69351 |
| 338 | Ga0163161_10000101 | 3300017792 | Bacteria | 81604 |
| 339 | Ga0163161_10019426 | 3300017792 | Bacteria | 4767 |
| 340 | Ga0163161_10030597 | 3300017792 | Bacteria | 3833 |
| 341 | Ga0163161_10148380 | 3300017792 | Bacteria | 1781 |
| 342 | Ga0163161_11831506 | 3300017792 | Bacteria | 540 |
| 343 | Ga0206356_11727543 | 3300020070 | Bacteria | 986 |
| 344 | Ga0206352_10131959 | 3300020078 | Bacteria | 789 |
| 345 | Ga0213876_10024618 | 3300021384 | Bacteria | 3178 |
| 346 | Ga0213876_10601056 | 3300021384 | Bacteria | 585 |
| 347 | Ga0213875_10009905 | 3300021388 | Bacteria | 4804 |
| 348 | Ga0213875_10524352 | 3300021388 | Bacteria | 570 |
| 349 | Ga0209147_103605 | 3300025229 | Bacteria | 2915 |
| 350 | Ga0207427_101450 | 3300025231 | Bacteria | 8548 |
| 351 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 352 | Ga0207425_1015629 | 3300025245 | Bacteria | 1699 |
| 353 | Ga0209026_1004345 | 3300025250 | Bacteria | 4244 |
| 354 | Ga0209148_1000238 | 3300025254 | Bacteria | 87836 |
| 355 | Ga0209148_1001034 | 3300025254 | Bacteria | 17391 |
| 356 | Ga0209129_1002094 | 3300025258 | Bacteria | 10228 |
| 357 | Ga0209233_1000079 | 3300025261 | Bacteria | 346944 |
| 358 | Ga0209233_1073702 | 3300025261 | Bacteria | 625 |
| 359 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 360 | Ga0209565_1000134 | 3300025263 | Bacteria | 104013 |
| 361 | Ga0209455_1000952 | 3300025272 | Bacteria | 14767 |
| 362 | Ga0209455_1056735 | 3300025272 | Bacteria | 526 |
| 363 | Ga0209673_1002352 | 3300025273 | Bacteria | 13340 |
| 364 | Ga0209673_1029162 | 3300025273 | Bacteria | 1761 |
| 365 | Ga0209675_1009250 | 3300025291 | Bacteria | 3499 |
| 366 | Ga0209676_1026408 | 3300025292 | Bacteria | 1844 |
| 367 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 368 | Ga0209564_1080218 | 3300025295 | Bacteria | 640 |
| 369 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 370 | Ga0209758_1012697 | 3300025297 | Bacteria | 4679 |
| 371 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 372 | Ga0209050_1000581 | 3300025298 | Bacteria | 59224 |
| 373 | Ga0209050_1000687 | 3300025298 | Bacteria | 50814 |
| 374 | Ga0209050_1007158 | 3300025298 | Bacteria | 6354 |
| 375 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 376 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 377 | Ga0207426_1037675 | 3300025302 | Bacteria | 1528 |
| 378 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 379 | Ga0209257_1000876 | 3300025304 | Bacteria | 42634 |
| 380 | Ga0209257_1002353 | 3300025304 | Bacteria | 19010 |
| 381 | Ga0209257_1002898 | 3300025304 | Bacteria | 15899 |
| 382 | Ga0209257_1003401 | 3300025304 | Bacteria | 13704 |
| 383 | Ga0209257_1037487 | 3300025304 | Bacteria | 1478 |
| 384 | Ga0209257_1100855 | 3300025304 | Bacteria | 704 |
| 385 | Ga0207697_10006525 | 3300025315 | Bacteria | 5267 |
| 386 | Ga0207697_10530809 | 3300025315 | Bacteria | 518 |
| 387 | Ga0207656_10012218 | 3300025321 | Bacteria | 3260 |
| 388 | Ga0207656_10159701 | 3300025321 | Bacteria | 1072 |
| 389 | Ga0207696_1007265 | 3300025711 | Bacteria | 4353 |
| 390 | Ga0207713_1010142 | 3300025735 | Bacteria | 5236 |
| 391 | Ga0207713_1036906 | 3300025735 | Bacteria | 2090 |
| 392 | Ga0207710_10007240 | 3300025900 | Bacteria | 4701 |
| 393 | Ga0207710_10012300 | 3300025900 | Bacteria | 3601 |
| 394 | Ga0207710_10207976 | 3300025900 | Bacteria | 968 |
| 395 | Ga0207710_10331102 | 3300025900 | Bacteria | 773 |
| 396 | Ga0207688_10409565 | 3300025901 | Bacteria | 842 |
| 397 | Ga0207688_10846280 | 3300025901 | Bacteria | 579 |
| 398 | Ga0207688_11043763 | 3300025901 | Bacteria | 516 |
| 399 | Ga0207680_10000010 | 3300025903 | Bacteria | 414170 |
| 400 | Ga0207680_10000186 | 3300025903 | Bacteria | 30147 |
| 401 | Ga0207680_10093912 | 3300025903 | Bacteria | 1914 |
| 402 | Ga0207647_10000038 | 3300025904 | Bacteria | 94897 |
| 403 | Ga0207647_10002647 | 3300025904 | Bacteria | 13526 |
| 404 | Ga0207647_10032481 | 3300025904 | Bacteria | 3352 |
| 405 | Ga0207647_10041942 | 3300025904 | Bacteria | 2874 |
| 406 | Ga0207647_10065904 | 3300025904 | Bacteria | 2197 |
| 407 | Ga0207647_10095073 | 3300025904 | Bacteria | 1774 |
| 408 | Ga0207647_10207898 | 3300025904 | Bacteria | 1131 |
| 409 | Ga0207647_10212165 | 3300025904 | Bacteria | 1118 |
| 410 | Ga0207647_10283643 | 3300025904 | Bacteria | 945 |
| 411 | Ga0207647_10393125 | 3300025904 | Bacteria | 782 |
| 412 | Ga0207645_10003616 | 3300025907 | Bacteria | 11690 |
| 413 | Ga0207705_10000121 | 3300025909 | Bacteria | 86649 |
| 414 | Ga0207705_10000365 | 3300025909 | Bacteria | 41098 |
| 415 | Ga0207705_10014470 | 3300025909 | Bacteria | 5679 |
| 416 | Ga0207705_10135124 | 3300025909 | Bacteria | 1838 |
| 417 | Ga0207705_10159690 | 3300025909 | Bacteria | 1693 |
| 418 | Ga0207654_10000375 | 3300025911 | Bacteria | 25999 |
| 419 | Ga0207654_10080510 | 3300025911 | Bacteria | 1959 |
| 420 | Ga0207654_10098883 | 3300025911 | Bacteria | 1793 |
| 421 | Ga0207695_10001183 | 3300025913 | Bacteria | 45024 |
| 422 | Ga0207695_10016421 | 3300025913 | Bacteria | 8662 |
| 423 | Ga0207695_10021724 | 3300025913 | Bacteria | 7315 |
| 424 | Ga0207695_10031555 | 3300025913 | Bacteria | 5808 |
| 425 | Ga0207695_10077775 | 3300025913 | Bacteria | 3368 |
| 426 | Ga0207695_10223979 | 3300025913 | Bacteria | 1787 |
| 427 | Ga0207695_10873246 | 3300025913 | Bacteria | 779 |
| 428 | Ga0207671_10001192 | 3300025914 | Bacteria | 30866 |
| 429 | Ga0207671_10027639 | 3300025914 | Bacteria | 4241 |
| 430 | Ga0207671_11237598 | 3300025914 | Bacteria | 583 |
| 431 | Ga0207671_11279455 | 3300025914 | Bacteria | 572 |
| 432 | Ga0207662_11126671 | 3300025918 | Bacteria | 558 |
| 433 | Ga0207657_10015487 | 3300025919 | Bacteria | 7387 |
| 434 | Ga0207657_10026870 | 3300025919 | Bacteria | 5279 |
| 435 | Ga0207657_10048996 | 3300025919 | Bacteria | 3685 |
| 436 | Ga0207657_10387615 | 3300025919 | Bacteria | 1100 |
| 437 | Ga0207657_11006315 | 3300025919 | Bacteria | 639 |
| 438 | Ga0207649_10150506 | 3300025920 | Bacteria | 1602 |
| 439 | Ga0207649_10167287 | 3300025920 | Bacteria | 1528 |
| 440 | Ga0207649_10831047 | 3300025920 | Bacteria | 722 |
| 441 | Ga0207649_11059835 | 3300025920 | Bacteria | 639 |
| 442 | Ga0207652_10134787 | 3300025921 | Bacteria | 2205 |
| 443 | Ga0207652_10286625 | 3300025921 | Bacteria | 1486 |
| 444 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 445 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 446 | Ga0207681_10000109 | 3300025923 | Bacteria | 71373 |
| 447 | Ga0207681_10000183 | 3300025923 | Bacteria | 51105 |
| 448 | Ga0207681_10033288 | 3300025923 | Bacteria | 3378 |
| 449 | Ga0207681_10094028 | 3300025923 | Bacteria | 2147 |
| 450 | Ga0207681_10122960 | 3300025923 | Bacteria | 1906 |
| 451 | Ga0207681_10716631 | 3300025923 | Bacteria | 832 |
| 452 | Ga0207694_10002087 | 3300025924 | Bacteria | 16502 |
| 453 | Ga0207694_10091001 | 3300025924 | Bacteria | 2408 |
| 454 | Ga0207694_10345340 | 3300025924 | Bacteria | 1231 |
| 455 | Ga0207694_10637068 | 3300025924 | Bacteria | 898 |
| 456 | Ga0207694_10801093 | 3300025924 | Bacteria | 796 |
| 457 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 458 | Ga0207650_10002904 | 3300025925 | Bacteria | 11832 |
| 459 | Ga0207650_10006404 | 3300025925 | Bacteria | 8018 |
| 460 | Ga0207650_10049447 | 3300025925 | Bacteria | 3105 |
| 461 | Ga0207650_10174974 | 3300025925 | Bacteria | 1708 |
| 462 | Ga0207659_10136023 | 3300025926 | Bacteria | 1902 |
| 463 | Ga0207687_10000225 | 3300025927 | Bacteria | 38523 |
| 464 | Ga0207687_10010076 | 3300025927 | Bacteria | 6180 |
| 465 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 466 | Ga0207644_10000012 | 3300025931 | Bacteria | 186652 |
| 467 | Ga0207644_10000067 | 3300025931 | Bacteria | 76116 |
| 468 | Ga0207644_10001857 | 3300025931 | Bacteria | 13746 |
| 469 | Ga0207644_10022749 | 3300025931 | Bacteria | 4285 |
| 470 | Ga0207644_10700505 | 3300025931 | Bacteria | 844 |
| 471 | Ga0207690_10157914 | 3300025932 | Bacteria | 1688 |
| 472 | Ga0207690_10186911 | 3300025932 | Bacteria | 1564 |
| 473 | Ga0207690_10337182 | 3300025932 | Bacteria | 1189 |
| 474 | Ga0207690_10342161 | 3300025932 | Bacteria | 1181 |
| 475 | Ga0207690_10356195 | 3300025932 | Bacteria | 1158 |
| 476 | Ga0207690_10878067 | 3300025932 | Bacteria | 743 |
| 477 | Ga0207706_10008805 | 3300025933 | Bacteria | 9291 |
| 478 | Ga0207706_10033279 | 3300025933 | Bacteria | 4590 |
| 479 | Ga0207706_10083285 | 3300025933 | Bacteria | 2812 |
| 480 | Ga0207706_10138164 | 3300025933 | Bacteria | 2144 |
| 481 | Ga0207706_10198802 | 3300025933 | Bacteria | 1758 |
| 482 | Ga0207706_11217586 | 3300025933 | Bacteria | 625 |
| 483 | Ga0207686_10001878 | 3300025934 | Bacteria | 11648 |
| 484 | Ga0207709_10000173 | 3300025935 | Bacteria | 86350 |
| 485 | Ga0207709_10088718 | 3300025935 | Bacteria | 2014 |
| 486 | Ga0207709_11210901 | 3300025935 | Bacteria | 622 |
| 487 | Ga0207669_10046739 | 3300025937 | Bacteria | 2560 |
| 488 | Ga0207669_11000337 | 3300025937 | Bacteria | 703 |
| 489 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 490 | Ga0207691_10009162 | 3300025940 | Bacteria | 9499 |
| 491 | Ga0207711_10000075 | 3300025941 | Bacteria | 106870 |
| 492 | Ga0207711_10024088 | 3300025941 | Bacteria | 5096 |
| 493 | Ga0207711_10114106 | 3300025941 | Bacteria | 2406 |
| 494 | Ga0207711_10236570 | 3300025941 | Bacteria | 1674 |
| 495 | Ga0207711_11362142 | 3300025941 | Bacteria | 652 |
| 496 | Ga0207689_10000744 | 3300025942 | Bacteria | 31242 |
| 497 | Ga0207689_11445008 | 3300025942 | Bacteria | 575 |
| 498 | Ga0207661_10482382 | 3300025944 | Bacteria | 1132 |
| 499 | Ga0207661_11506624 | 3300025944 | Bacteria | 616 |
| 500 | Ga0207679_10123611 | 3300025945 | Bacteria | 2064 |
| 501 | Ga0207679_10140360 | 3300025945 | Bacteria | 1952 |
| 502 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 503 | Ga0207667_10011748 | 3300025949 | Bacteria | 10154 |
| 504 | Ga0207667_10112317 | 3300025949 | Bacteria | 2810 |
| 505 | Ga0207667_10498960 | 3300025949 | Bacteria | 1235 |
| 506 | Ga0207667_10638165 | 3300025949 | Bacteria | 1071 |
| 507 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 508 | Ga0207651_11013347 | 3300025960 | Bacteria | 742 |
| 509 | Ga0207712_10000014 | 3300025961 | Bacteria | 375393 |
| 510 | Ga0207712_10000174 | 3300025961 | Bacteria | 66500 |
| 511 | Ga0207712_10018137 | 3300025961 | Bacteria | 4580 |
| 512 | Ga0207712_10057696 | 3300025961 | Bacteria | 2740 |
| 513 | Ga0207712_10092123 | 3300025961 | Bacteria | 2234 |
| 514 | Ga0207712_10657395 | 3300025961 | Bacteria | 911 |
| 515 | Ga0207712_11277392 | 3300025961 | Bacteria | 656 |
| 516 | Ga0207712_11688390 | 3300025961 | Bacteria | 568 |
| 517 | Ga0207668_10000081 | 3300025972 | Bacteria | 72145 |
| 518 | Ga0207668_10000304 | 3300025972 | Bacteria | 32235 |
| 519 | Ga0207668_10005340 | 3300025972 | Bacteria | 7558 |
| 520 | Ga0207668_10083673 | 3300025972 | Bacteria | 2322 |
| 521 | Ga0207668_10085277 | 3300025972 | Bacteria | 2304 |
| 522 | Ga0207668_10328540 | 3300025972 | Bacteria | 1271 |
| 523 | Ga0207668_10484314 | 3300025972 | Bacteria | 1061 |
| 524 | Ga0207640_10000063 | 3300025981 | Bacteria | 87065 |
| 525 | Ga0207640_10031448 | 3300025981 | Bacteria | 3280 |
| 526 | Ga0207640_10062003 | 3300025981 | Bacteria | 2479 |
| 527 | Ga0207640_10100271 | 3300025981 | Bacteria | 2029 |
| 528 | Ga0207640_10157229 | 3300025981 | Bacteria | 1677 |
| 529 | Ga0207640_11027507 | 3300025981 | Bacteria | 726 |
| 530 | Ga0207640_11246724 | 3300025981 | Bacteria | 662 |
| 531 | Ga0207640_11397633 | 3300025981 | Bacteria | 627 |
| 532 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 533 | Ga0207658_10001566 | 3300025986 | Bacteria | 17731 |
| 534 | Ga0207658_10004095 | 3300025986 | Bacteria | 10169 |
| 535 | Ga0207658_10008782 | 3300025986 | Bacteria | 6860 |
| 536 | Ga0207658_10018656 | 3300025986 | Bacteria | 4795 |
| 537 | Ga0207658_10819713 | 3300025986 | Bacteria | 845 |
| 538 | Ga0207677_10000030 | 3300026023 | Bacteria | 120692 |
| 539 | Ga0207703_10005351 | 3300026035 | Bacteria | 10337 |
| 540 | Ga0207703_10008030 | 3300026035 | Bacteria | 8339 |
| 541 | Ga0207703_10009134 | 3300026035 | Bacteria | 7806 |
| 542 | Ga0207703_10124179 | 3300026035 | Bacteria | 2220 |
| 543 | Ga0207639_10000213 | 3300026041 | Bacteria | 43227 |
| 544 | Ga0207639_10012302 | 3300026041 | Bacteria | 5959 |
| 545 | Ga0207639_10036850 | 3300026041 | Bacteria | 3628 |
| 546 | Ga0207639_10122498 | 3300026041 | Bacteria | 2139 |
| 547 | Ga0207639_10602963 | 3300026041 | Bacteria | 1013 |
| 548 | Ga0207639_10828173 | 3300026041 | Bacteria | 863 |
| 549 | Ga0207678_10000857 | 3300026067 | Bacteria | 27922 |
| 550 | Ga0207678_10001793 | 3300026067 | Bacteria | 19669 |
| 551 | Ga0207678_10088208 | 3300026067 | Bacteria | 2651 |
| 552 | Ga0207702_10000887 | 3300026078 | Bacteria | 31141 |
| 553 | Ga0207702_10002945 | 3300026078 | Bacteria | 15895 |
| 554 | Ga0207702_10019109 | 3300026078 | Bacteria | 5670 |
| 555 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 556 | Ga0207641_10000099 | 3300026088 | Bacteria | 122892 |
| 557 | Ga0207641_10002512 | 3300026088 | Bacteria | 16895 |
| 558 | Ga0207641_10004505 | 3300026088 | Bacteria | 12048 |
| 559 | Ga0207641_10013693 | 3300026088 | Bacteria | 6656 |
| 560 | Ga0207641_10014410 | 3300026088 | Bacteria | 6478 |
| 561 | Ga0207641_11282650 | 3300026088 | Bacteria | 733 |
| 562 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 563 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 564 | Ga0207676_10000770 | 3300026095 | Bacteria | 25065 |
| 565 | Ga0207676_10022559 | 3300026095 | Bacteria | 4630 |
| 566 | Ga0207674_10131652 | 3300026116 | Bacteria | 2464 |
| 567 | Ga0207674_10300559 | 3300026116 | Bacteria | 1554 |
| 568 | Ga0207674_10337148 | 3300026116 | Bacteria | 1458 |
| 569 | Ga0207674_11129632 | 3300026116 | Bacteria | 753 |
| 570 | Ga0207674_11201849 | 3300026116 | Bacteria | 728 |
| 571 | Ga0207675_100000358 | 3300026118 | Bacteria | 43765 |
| 572 | Ga0207675_100001138 | 3300026118 | Bacteria | 26336 |
| 573 | Ga0207675_100230090 | 3300026118 | Bacteria | 1788 |
| 574 | Ga0207683_10182888 | 3300026121 | Bacteria | 1901 |
| 575 | Ga0207698_10034383 | 3300026142 | Bacteria | 3694 |
| 576 | Ga0207698_10130218 | 3300026142 | Bacteria | 2148 |
| 577 | Ga0207698_10201601 | 3300026142 | Bacteria | 1782 |
| 578 | Ga0207698_10955811 | 3300026142 | Bacteria | 866 |
| 579 | Ga0207698_12752071 | 3300026142 | Bacteria | 500 |
| 580 | Ga0209371_1085272 | 3300027312 | Bacteria | 539 |
| 581 | Ga0209813_10000051 | 3300027866 | Bacteria | 47545 |
| 582 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 583 | Ga0268266_10002003 | 3300028379 | Bacteria | 22767 |
| 584 | Ga0268266_10006189 | 3300028379 | Bacteria | 10993 |
| 585 | Ga0268266_10158947 | 3300028379 | Bacteria | 2043 |
| 586 | Ga0268266_10211526 | 3300028379 | Bacteria | 1779 |
| 587 | Ga0268266_10315170 | 3300028379 | Bacteria | 1462 |
| 588 | Ga0268266_10422983 | 3300028379 | Bacteria | 1263 |
| 589 | Ga0268266_11019591 | 3300028379 | Bacteria | 801 |
| 590 | Ga0268266_11411114 | 3300028379 | Bacteria | 672 |
| 591 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 592 | Ga0268265_10000045 | 3300028380 | Bacteria | 180378 |
| 593 | Ga0268265_10000047 | 3300028380 | Bacteria | 179354 |
| 594 | Ga0268265_10000285 | 3300028380 | Bacteria | 57084 |
| 595 | Ga0268265_10004726 | 3300028380 | Bacteria | 9397 |
| 596 | Ga0268265_10017233 | 3300028380 | Bacteria | 4981 |
| 597 | Ga0268265_10146980 | 3300028380 | Bacteria | 1982 |
| 598 | Ga0268265_10315643 | 3300028380 | Bacteria | 1413 |
| 599 | Ga0268265_10387566 | 3300028380 | Bacteria | 1287 |
| 600 | Ga0268265_11127984 | 3300028380 | Bacteria | 779 |
| 601 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 602 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 603 | Ga0268264_10000023 | 3300028381 | Bacteria | 471408 |
| 604 | Ga0268264_10004259 | 3300028381 | Bacteria | 12215 |
| 605 | Ga0268264_10012572 | 3300028381 | Bacteria | 6971 |
| 606 | Ga0268264_10105564 | 3300028381 | Bacteria | 2457 |
| 607 | Ga0268264_10209613 | 3300028381 | Bacteria | 1788 |
| 608 | Ga0268264_10405038 | 3300028381 | Bacteria | 1312 |
| 609 | Ga0307517_10633740 | 3300028786 | Bacteria | 522 |
| 610 | Ga0268256_1046229 | 3300030500 | Bacteria | 944 |
| 611 | Ga0314311_1203820 | 3300030733 | Bacteria | 1025 |
| 612 | Ga0265320_10000034 | 3300031240 | Bacteria | 141117 |
| 613 | Ga0265325_10023456 | 3300031241 | Bacteria | 3367 |
| 614 | Ga0265325_10037185 | 3300031241 | Bacteria | 2574 |
| 615 | Ga0307513_10209984 | 3300031456 | Bacteria | 1779 |
| 616 | Ga0307408_100051500 | 3300031548 | Bacteria | 2965 |
| 617 | Ga0307408_101128429 | 3300031548 | Bacteria | 728 |
| 618 | Ga0307408_101389987 | 3300031548 | Bacteria | 661 |
| 619 | Ga0265313_10000665 | 3300031595 | Bacteria | 35397 |
| 620 | Ga0265314_10019631 | 3300031711 | Bacteria | 5232 |
| 621 | Ga0265314_10042189 | 3300031711 | Bacteria | 3258 |
| 622 | Ga0265314_10118950 | 3300031711 | Bacteria | 1666 |
| 623 | Ga0307405_10055116 | 3300031731 | Bacteria | 2486 |
| 624 | Ga0307405_10530365 | 3300031731 | Bacteria | 949 |
| 625 | Ga0307405_10949213 | 3300031731 | Bacteria | 730 |
| 626 | Ga0307405_11486235 | 3300031731 | Bacteria | 595 |
| 627 | Ga0307413_10332327 | 3300031824 | Bacteria | 1165 |
| 628 | Ga0307413_11513892 | 3300031824 | Bacteria | 593 |
| 629 | Ga0307410_10027090 | 3300031852 | Bacteria | 3618 |
| 630 | Ga0307410_11135650 | 3300031852 | Bacteria | 679 |
| 631 | Ga0307406_10589289 | 3300031901 | Bacteria | 915 |
| 632 | Ga0307406_10614399 | 3300031901 | Bacteria | 898 |
| 633 | Ga0307406_10706803 | 3300031901 | Bacteria | 842 |
| 634 | Ga0307406_11005598 | 3300031901 | Bacteria | 715 |
| 635 | Ga0307406_11917748 | 3300031901 | Bacteria | 528 |
| 636 | Ga0307407_10257420 | 3300031903 | Bacteria | 1199 |
| 637 | Ga0307412_10015626 | 3300031911 | Bacteria | 4506 |
| 638 | Ga0307412_10514991 | 3300031911 | Bacteria | 998 |
| 639 | Ga0307412_10947513 | 3300031911 | Bacteria | 757 |
| 640 | Ga0307412_11429176 | 3300031911 | Bacteria | 627 |
| 641 | Ga0307409_101359966 | 3300031995 | Bacteria | 736 |
| 642 | Ga0307409_102980818 | 3300031995 | Bacteria | 500 |
| 643 | Ga0307416_100014919 | 3300032002 | Bacteria | 5345 |
| 644 | Ga0307414_11712720 | 3300032004 | Bacteria | 586 |
| 645 | Ga0307414_11795155 | 3300032004 | Bacteria | 572 |
| 646 | Ga0307411_10271081 | 3300032005 | Bacteria | 1346 |
| 647 | Ga0307411_10440296 | 3300032005 | Bacteria | 1087 |
| 648 | Ga0307411_12160541 | 3300032005 | Bacteria | 521 |
| 649 | Ga0307510_10148726 | 3300033180 | Bacteria | 1967 |
| 650 | Ga0373923_0143888 | 3300035111 | Bacteria | 1079 |
| 651 | Ga0373946_0647350 | 3300035171 | Bacteria | 550 |
| 652 | Ga0395899_0001521 | 3300037312 | Bacteria | 19608 |
| 653 | Ga0395900_0009291 | 3300037418 | Bacteria | 10081 |
| 654 | Ga0395900_1114422 | 3300037418 | Bacteria | 706 |
| 655 | Ga0395898_1303005 | 3300037466 | Bacteria | 656 |
| 656 | Ga0395905_0026896 | 3300037471 | Bacteria | 5426 |
| 657 | Ga0395905_0516629 | 3300037471 | Bacteria | 1095 |
| 658 | Ga0436364_0741438 | 3300037853 | Bacteria | 779 |
| 659 | Ga0436364_0878110 | 3300037853 | Bacteria | 2836 |
| 660 | Ga0395901_0073008 | 3300038443 | Bacteria | 3578 |
| 661 | Ga0395901_2127733 | 3300038443 | Bacteria | 506 |
| 662 | Ga0436365_0212007 | 3300039437 | Bacteria | 1166 |
| 663 | Ga0436365_0922307 | 3300039437 | Bacteria | 725 |
| 664 | Ga0436365_1667312 | 3300039437 | Bacteria | 780 |
| 665 | Ga0436365_1773361 | 3300039437 | Bacteria | 6729 |
| 666 | Ga0436361_1051839 | 3300039447 | Bacteria | 1442 |
| 667 | Ga0439436_0009694 | 3300041404 | Bacteria | 2950 |
| 668 | Ga0439439_0001779 | 3300041406 | Bacteria | 4402 |
| 669 | Ga0439447_148918 | 3300041407 | Bacteria | 538 |
| 670 | Ga0439461_0000498 | 3300041410 | Bacteria | 5666 |
| 671 | Ga0439461_0003679 | 3300041410 | Bacteria | 2530 |
| 672 | Ga0439461_0080904 | 3300041410 | Bacteria | 766 |
| 673 | Ga0439465_0004274 | 3300041413 | Bacteria | 4644 |
| 674 | Ga0439465_0004757 | 3300041413 | Bacteria | 4375 |
| 675 | Ga0451793_0810995 | 3300041452 | Bacteria | 595 |
| 676 | Ga0451793_1584048 | 3300041452 | Bacteria | 641 |
| 677 | Ga0451802_1834731 | 3300041460 | Bacteria | 516 |
| 678 | Ga0451806_522421 | 3300041462 | Bacteria | 552 |
| 679 | Ga0451807_0720757 | 3300041486 | Bacteria | 754 |
| 680 | Ga0451833_1022453 | 3300041491 | Bacteria | 551 |
| 681 | Ga0451837_1536393 | 3300041494 | Bacteria | 581 |
| 682 | Ga0451841_0590837 | 3300041498 | Bacteria | 1107 |
| 683 | Ga0451853_3774724 | 3300041512 | Bacteria | 620 |
| 684 | Ga0439431_0038651 | 3300041997 | Bacteria | 1208 |
| 685 | Ga0439442_150916 | 3300042002 | Bacteria | 517 |
| 686 | Ga0439445_0033115 | 3300042004 | Bacteria | 1349 |
| 687 | Ga0439448_0002459 | 3300042005 | Bacteria | 5047 |
| 688 | Ga0439432_000640 | 3300042006 | Bacteria | 13098 |
| 689 | Ga0439432_022961 | 3300042006 | Bacteria | 2058 |
| 690 | Ga0439452_018803 | 3300042010 | Bacteria | 1835 |
| 691 | Ga0439457_024428 | 3300042014 | Bacteria | 1337 |
| 692 | Ga0439462_0002776 | 3300042015 | Bacteria | 4116 |
| 693 | Ga0450922_019334 | 3300042124 | Bacteria | 696 |
| 694 | Ga0439446_0034458 | 3300042156 | Bacteria | 1473 |
| 695 | Ga0439458_0000137 | 3300042157 | Bacteria | 15585 |
| 696 | Ga0450909_012035 | 3300042185 | Bacteria | 1268 |
| 697 | Ga0439434_0020110 | 3300042435 | Bacteria | 2004 |
| 698 | Ga0439460_0201787 | 3300042461 | Bacteria | 678 |
| 699 | Ga0466972_0086674 | 3300044658 | Bacteria | 1488 |
| 700 | Ga0466965_0529846 | 3300044683 | Bacteria | 663 |
| 701 | Ga0466963_0311463 | 3300044694 | Bacteria | 1108 |
| 702 | Ga0466970_0256774 | 3300044765 | Bacteria | 980 |
| 703 | Ga0466957_0347333 | 3300044842 | Bacteria | 1006 |
| 704 | Ga0451576_0436970 | 3300045051 | Bacteria | 1373 |
| 705 | Ga0466958_0391983 | 3300045836 | Bacteria | 896 |
| 706 | Ga0466967_0379221 | 3300045976 | Bacteria | 1373 |
| 707 | Ga0466967_0633257 | 3300045976 | Bacteria | 1057 |
| 708 | Ga0466967_2162402 | 3300045976 | Bacteria | 552 |
| 709 | Ga0495617_011498 | 3300046452 | Bacteria | 3019 |
| 710 | Ga0495627_000156 | 3300046453 | Bacteria | 78784 |
| 711 | Ga0495627_000578 | 3300046453 | Bacteria | 29484 |
| 712 | Ga0495627_034662 | 3300046453 | Bacteria | 1576 |
| 713 | Ga0495638_0000758 | 3300046460 | Bacteria | 34400 |
| 714 | Ga0495638_0188677 | 3300046460 | Bacteria | 1171 |
| 715 | Ga0495651_0721380 | 3300046462 | Bacteria | 620 |
| 716 | Ga0495650_0001027 | 3300046471 | Bacteria | 31380 |
| 717 | Ga0495650_0227391 | 3300046471 | Bacteria | 641 |
| 718 | Ga0495584_0078046 | 3300046491 | Bacteria | 1666 |
| 719 | Ga0495585_0127704 | 3300046492 | Bacteria | 1340 |
| 720 | Ga0495585_0567920 | 3300046492 | Bacteria | 535 |
| 721 | Ga0495607_0093490 | 3300046501 | Bacteria | 1624 |
| 722 | Ga0495583_0220617 | 3300046506 | Bacteria | 766 |
| 723 | Ga0495606_0072058 | 3300046507 | Bacteria | 2173 |
| 724 | Ga0495610_0000291 | 3300046512 | Bacteria | 52599 |
| 725 | Ga0495610_0144969 | 3300046512 | Bacteria | 1018 |
| 726 | Ga0495616_0001456 | 3300046513 | Bacteria | 16481 |
| 727 | Ga0495632_0000006 | 3300046519 | Bacteria | 345883 |
| 728 | Ga0495637_0000784 | 3300046520 | Bacteria | 21358 |
| 729 | Ga0495637_0010852 | 3300046520 | Bacteria | 4391 |
| 730 | Ga0495637_0065588 | 3300046520 | Bacteria | 1478 |
| 731 | Ga0495643_0000021 | 3300046522 | Bacteria | 293465 |
| 732 | Ga0495643_0523213 | 3300046522 | Bacteria | 508 |
| 733 | Ga0495648_0010683 | 3300046524 | Bacteria | 6974 |
| 734 | Ga0495648_0045945 | 3300046524 | Bacteria | 2712 |
| 735 | Ga0495663_0000008 | 3300046525 | Bacteria | 260614 |
| 736 | Ga0495663_0018920 | 3300046525 | Bacteria | 1965 |
| 737 | Ga0495663_0053401 | 3300046525 | Bacteria | 1256 |
| 738 | Ga0495663_0242178 | 3300046525 | Bacteria | 638 |
| 739 | Ga0495654_0116202 | 3300046530 | Bacteria | 1215 |
| 740 | Ga0495597_0031259 | 3300046542 | Bacteria | 2424 |
| 741 | Ga0495633_0000190 | 3300046558 | Bacteria | 79967 |
| 742 | Ga0495633_0002635 | 3300046558 | Bacteria | 12531 |
| 743 | Ga0495633_0013695 | 3300046558 | Bacteria | 4264 |
| 744 | Ga0495633_0072188 | 3300046558 | Bacteria | 1610 |
| 745 | Ga0495633_0146062 | 3300046558 | Bacteria | 1093 |
| 746 | Ga0495668_0002221 | 3300046616 | Bacteria | 16492 |
| 747 | Ga0495668_0105921 | 3300046616 | Bacteria | 1538 |
| 748 | Ga0495668_0574724 | 3300046616 | Bacteria | 622 |
| 749 | Ga0495625_0000629 | 3300046660 | Bacteria | 51047 |
| 750 | Ga0495625_0215510 | 3300046660 | Bacteria | 1260 |
| 751 | Ga0495625_0393492 | 3300046660 | Bacteria | 867 |
| 752 | Ga0495661_0125781 | 3300046665 | Bacteria | 1411 |
| 753 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 754 | Ga0495670_0427746 | 3300046691 | Bacteria | 716 |
| 755 | Ga0495671_0000017 | 3300046692 | Bacteria | 293465 |
| 756 | Ga0495649_0327109 | 3300046694 | Bacteria | 777 |
| 757 | Ga0495636_0180483 | 3300047318 | Bacteria | 958 |
| 758 | Ga0495672_0174663 | 3300047320 | Bacteria | 1092 |
| 759 | Ga0495672_0212818 | 3300047320 | Bacteria | 959 |
| 760 | Ga0495673_0028297 | 3300047469 | Bacteria | 2656 |
| 761 | Ga0495681_0000098 | 3300047470 | Bacteria | 75809 |
| 762 | Ga0495681_0008268 | 3300047470 | Bacteria | 6539 |
| 763 | Ga0495681_0009646 | 3300047470 | Bacteria | 5927 |
| 764 | Ga0495681_0326806 | 3300047470 | Bacteria | 588 |
| 765 | Ga0495686_0005063 | 3300047472 | Bacteria | 10564 |
| 766 | Ga0495686_0008463 | 3300047472 | Bacteria | 7546 |
| 767 | Ga0495686_0029938 | 3300047472 | Bacteria | 3538 |
| 768 | Ga0495686_0042056 | 3300047472 | Bacteria | 2907 |
| 769 | Ga0495686_0248449 | 3300047472 | Bacteria | 1000 |
| 770 | Ga0495686_0254178 | 3300047472 | Bacteria | 986 |
| 771 | Ga0495686_0377163 | 3300047472 | Bacteria | 766 |
| 772 | Ga0495686_0686152 | 3300047472 | Bacteria | 523 |
| 773 | Ga0496100_0082969 | 3300048903 | Bacteria | 2168 |
| 774 | Ga0496100_0182282 | 3300048903 | Bacteria | 1519 |
| 775 | Ga0496100_1223371 | 3300048903 | Bacteria | 592 |
| 776 | Ga0496101_0111668 | 3300048904 | Bacteria | 2058 |
| 777 | Ga0496101_0138327 | 3300048904 | Bacteria | 1854 |
| 778 | Ga0496101_0333953 | 3300048904 | Bacteria | 1190 |
| 779 | Ga0496101_0346342 | 3300048904 | Bacteria | 1167 |
| 780 | Ga0496102_0000069 | 3300048905 | Bacteria | 156067 |
| 781 | Ga0496102_0000615 | 3300048905 | Bacteria | 36925 |
| 782 | Ga0496102_0172254 | 3300048905 | Bacteria | 2037 |
| 783 | Ga0496102_0298555 | 3300048905 | Bacteria | 1518 |
| 784 | Ga0496102_0681373 | 3300048905 | Bacteria | 951 |
| 785 | Ga0496103_0000173 | 3300048906 | Bacteria | 67412 |
| 786 | Ga0496103_0009010 | 3300048906 | Bacteria | 5911 |
| 787 | Ga0496103_0033025 | 3300048906 | Bacteria | 3160 |
| 788 | Ga0496103_0132529 | 3300048906 | Bacteria | 1592 |
| 789 | Ga0496103_0224202 | 3300048906 | Bacteria | 1209 |
| 790 | Ga0496103_0651014 | 3300048906 | Bacteria | 669 |
| 791 | Ga0496104_0000081 | 3300048907 | Bacteria | 94514 |
| 792 | Ga0496104_0059792 | 3300048907 | Bacteria | 3608 |
| 793 | Ga0496105_0000034 | 3300048908 | Bacteria | 127505 |
| 794 | Ga0496105_0090922 | 3300048908 | Bacteria | 2521 |
| 795 | Ga0496105_0363545 | 3300048908 | Bacteria | 1154 |
| 796 | Ga0496105_0615800 | 3300048908 | Bacteria | 841 |
| 797 | Ga0496106_0076352 | 3300048909 | Bacteria | 2568 |
| 798 | Ga0496106_0168900 | 3300048909 | Bacteria | 1733 |
| 799 | Ga0496106_0222120 | 3300048909 | Bacteria | 1507 |
| 800 | Ga0496107_0173558 | 3300048910 | Bacteria | 1600 |
| 801 | Ga0496107_0252341 | 3300048910 | Bacteria | 1312 |
| 802 | Ga0496109_0067327 | 3300048912 | Bacteria | 3280 |
| 803 | Ga0496109_0116418 | 3300048912 | Bacteria | 2488 |
| 804 | Ga0496109_0353061 | 3300048912 | Bacteria | 1389 |
| 805 | Ga0496109_0539887 | 3300048912 | Bacteria | 1100 |
| 806 | Ga0496110_0093856 | 3300048913 | Bacteria | 2686 |
| 807 | Ga0496110_0124785 | 3300048913 | Bacteria | 2322 |
| 808 | Ga0496110_0325345 | 3300048913 | Bacteria | 1400 |
| 809 | Ga0496110_1131155 | 3300048913 | Bacteria | 691 |
| 810 | Ga0496111_0328540 | 3300048914 | Bacteria | 1132 |
| 811 | Ga0496111_0458563 | 3300048914 | Bacteria | 940 |
| 812 | Ga0496112_0116278 | 3300048915 | Bacteria | 2645 |
| 813 | Ga0496112_0663427 | 3300048915 | Bacteria | 972 |
| 814 | Ga0496113_0000101 | 3300048916 | Bacteria | 36217 |
| 815 | Ga0496113_0366514 | 3300048916 | Bacteria | 1156 |
| 816 | Ga0496113_1445932 | 3300048916 | Bacteria | 532 |
| 817 | Ga0496115_0001129 | 3300048918 | Bacteria | 19266 |
| 818 | Ga0496115_0108956 | 3300048918 | Bacteria | 2274 |
| 819 | Ga0496115_1026514 | 3300048918 | Bacteria | 629 |
| 820 | Ga0496116_0000062 | 3300048919 | Bacteria | 271104 |
| 821 | Ga0496116_0000566 | 3300048919 | Bacteria | 49509 |
| 822 | Ga0496116_0032138 | 3300048919 | Bacteria | 3745 |
| 823 | Ga0496116_0050745 | 3300048919 | Bacteria | 2762 |
| 824 | Ga0496116_0101176 | 3300048919 | Bacteria | 1721 |
| 825 | Ga0496116_0361464 | 3300048919 | Bacteria | 660 |
| 826 | Ga0496117_0000146 | 3300048920 | Bacteria | 152244 |
| 827 | Ga0496117_0000485 | 3300048920 | Bacteria | 65840 |
| 828 | Ga0496117_0033071 | 3300048920 | Bacteria | 3916 |
| 829 | Ga0496117_0046000 | 3300048920 | Bacteria | 3144 |
| 830 | Ga0496117_0055578 | 3300048920 | Bacteria | 2765 |
| 831 | Ga0496117_0089533 | 3300048920 | Bacteria | 1987 |
| 832 | Ga0496117_0251385 | 3300048920 | Bacteria | 964 |
| 833 | Ga0496117_0312713 | 3300048920 | Bacteria | 826 |
| 834 | Ga0496117_0318261 | 3300048920 | Bacteria | 816 |
| 835 | Ga0496117_0330651 | 3300048920 | Bacteria | 794 |
| 836 | Ga0496118_0000190 | 3300048921 | Bacteria | 108017 |
| 837 | Ga0496118_0003742 | 3300048921 | Bacteria | 18808 |
| 838 | Ga0496118_0015425 | 3300048921 | Bacteria | 7071 |
| 839 | Ga0496118_0015970 | 3300048921 | Bacteria | 6916 |
| 840 | Ga0496118_0057773 | 3300048921 | Bacteria | 2905 |
| 841 | Ga0496118_0076829 | 3300048921 | Bacteria | 2372 |
| 842 | Ga0496118_0079363 | 3300048921 | Bacteria | 2316 |
| 843 | Ga0496118_0104776 | 3300048921 | Bacteria | 1897 |
| 844 | Ga0496118_0127031 | 3300048921 | Bacteria | 1647 |
| 845 | Ga0496118_0139050 | 3300048921 | Bacteria | 1544 |
| 846 | Ga0496118_0370348 | 3300048921 | Bacteria | 756 |
| 847 | Ga0496119_0000057 | 3300048922 | Bacteria | 173746 |
| 848 | Ga0496119_0072971 | 3300048922 | Bacteria | 2003 |
| 849 | Ga0496119_0180016 | 3300048922 | Bacteria | 1109 |
| 850 | Ga0496119_0186126 | 3300048922 | Bacteria | 1085 |
| 851 | Ga0496119_0313654 | 3300048922 | Bacteria | 769 |
| 852 | Ga0496120_0005360 | 3300048923 | Bacteria | 10261 |
| 853 | Ga0496120_0110614 | 3300048923 | Bacteria | 1436 |
| 854 | Ga0496120_0178484 | 3300048923 | Bacteria | 1045 |
| 855 | Ga0496120_0185785 | 3300048923 | Bacteria | 1017 |
| 856 | Ga0496120_0487953 | 3300048923 | Bacteria | 531 |
| 857 | Ga0496121_0005623 | 3300048924 | Bacteria | 15968 |
| 858 | Ga0496121_0010499 | 3300048924 | Bacteria | 10435 |
| 859 | Ga0496121_0015601 | 3300048924 | Bacteria | 7936 |
| 860 | Ga0496121_0016723 | 3300048924 | Bacteria | 7548 |
| 861 | Ga0496121_0017016 | 3300048924 | Bacteria | 7461 |
| 862 | Ga0496121_0058069 | 3300048924 | Bacteria | 3202 |
| 863 | Ga0496121_0115314 | 3300048924 | Bacteria | 2040 |
| 864 | Ga0496121_0180678 | 3300048924 | Bacteria | 1523 |
| 865 | Ga0496121_0205134 | 3300048924 | Bacteria | 1401 |
| 866 | Ga0496121_0568689 | 3300048924 | Bacteria | 706 |
| 867 | Ga0496121_0907952 | 3300048924 | Bacteria | 506 |
| 868 | Ga0496122_0000723 | 3300048925 | Bacteria | 64694 |
| 869 | Ga0496122_0003556 | 3300048925 | Bacteria | 20365 |
| 870 | Ga0496122_0006671 | 3300048925 | Bacteria | 13150 |
| 871 | Ga0496122_0026134 | 3300048925 | Bacteria | 5047 |
| 872 | Ga0496122_0366886 | 3300048925 | Bacteria | 745 |
| 873 | Ga0496122_0420631 | 3300048925 | Bacteria | 672 |
| 874 | Ga0496123_0000545 | 3300048926 | Bacteria | 64687 |
| 875 | Ga0496123_0002968 | 3300048926 | Bacteria | 19751 |
| 876 | Ga0496123_0016815 | 3300048926 | Bacteria | 5914 |
| 877 | Ga0496123_0062259 | 3300048926 | Bacteria | 2392 |
| 878 | Ga0496123_0235440 | 3300048926 | Bacteria | 913 |
| 879 | Ga0496124_0000546 | 3300048927 | Bacteria | 63624 |
| 880 | Ga0496124_0000874 | 3300048927 | Bacteria | 49185 |
| 881 | Ga0496124_0002439 | 3300048927 | Bacteria | 24366 |
| 882 | Ga0496124_0006061 | 3300048927 | Bacteria | 13305 |
| 883 | Ga0496124_0023588 | 3300048927 | Bacteria | 5614 |
| 884 | Ga0496124_0023873 | 3300048927 | Bacteria | 5571 |
| 885 | Ga0496124_0081473 | 3300048927 | Bacteria | 2660 |
| 886 | Ga0496124_0299780 | 3300048927 | Bacteria | 1162 |
| 887 | Ga0496124_0474242 | 3300048927 | Bacteria | 847 |
| 888 | Ga0496124_0507938 | 3300048927 | Bacteria | 806 |
| 889 | Ga0496124_0805486 | 3300048927 | Bacteria | 581 |
| 890 | Ga0496125_0002465 | 3300048928 | Bacteria | 24034 |
| 891 | Ga0496125_0006988 | 3300048928 | Bacteria | 12081 |
| 892 | Ga0496125_0033431 | 3300048928 | Bacteria | 4551 |
| 893 | Ga0496125_0034343 | 3300048928 | Bacteria | 4472 |
| 894 | Ga0496125_0071024 | 3300048928 | Bacteria | 2722 |
| 895 | Ga0496125_0355978 | 3300048928 | Bacteria | 872 |
| 896 | Ga0496125_0415581 | 3300048928 | Bacteria | 781 |
| 897 | Ga0496125_0439744 | 3300048928 | Bacteria | 750 |
| 898 | Ga0496126_0000028 | 3300048929 | Bacteria | 394082 |
| 899 | Ga0496126_0006838 | 3300048929 | Bacteria | 12646 |
| 900 | Ga0496126_0016996 | 3300048929 | Bacteria | 7259 |
| 901 | Ga0496126_0034229 | 3300048929 | Bacteria | 4773 |
| 902 | Ga0496126_0054886 | 3300048929 | Bacteria | 3607 |
| 903 | Ga0496126_0121519 | 3300048929 | Bacteria | 2264 |
| 904 | Ga0496126_0150910 | 3300048929 | Bacteria | 1992 |
| 905 | Ga0496126_0372477 | 3300048929 | Bacteria | 1164 |
| 906 | Ga0496126_0632782 | 3300048929 | Bacteria | 839 |
| 907 | Ga0496126_1231595 | 3300048929 | Bacteria | 549 |
| 908 | Ga0495678_014836 | 3300049459 | Bacteria | 3610 |
| 909 | Ga0495682_0279655 | 3300049460 | Bacteria | 589 |
| 910 | Ga0501290_000237 | 3300049513 | Bacteria | 9135 |
| 911 | Ga0501292_000042 | 3300049515 | Bacteria | 29474 |
| 912 | Ga0501294_000032 | 3300049517 | Bacteria | 13769 |
| 913 | Ga0501297_009582 | 3300049520 | Bacteria | 1085 |
| 914 | Ga0501300_000392 | 3300049523 | Bacteria | 6689 |
| 915 | Ga0501302_002270 | 3300049525 | Bacteria | 1084 |
| 916 | Ga0501315_000962 | 3300049531 | Bacteria | 2273 |
| 917 | Ga0501317_002915 | 3300049533 | Bacteria | 1662 |
| 918 | Ga0501318_049501 | 3300049534 | Bacteria | 621 |
| 919 | Ga0501321_023679 | 3300049537 | Bacteria | 780 |
| 920 | Ga0501335_000615 | 3300049551 | Bacteria | 2383 |
| 921 | Ga0501337_013057 | 3300049553 | Bacteria | 625 |
| 922 | Ga0501033_0085723 | 3300049570 | Bacteria | 2307 |
| 923 | Ga0501034_0099962 | 3300049571 | Bacteria | 2895 |
| 924 | Ga0501034_0285394 | 3300049571 | Bacteria | 1590 |
| 925 | Ga0501038_0164937 | 3300049574 | Bacteria | 1798 |
| 926 | Ga0501038_0323317 | 3300049574 | Bacteria | 1206 |
| 927 | Ga0501038_0770013 | 3300049574 | Bacteria | 717 |
| 928 | Ga0501041_0866607 | 3300049577 | Bacteria | 580 |
| 929 | Ga0501042_0040621 | 3300049578 | Bacteria | 3307 |
| 930 | Ga0501042_0260954 | 3300049578 | Bacteria | 1251 |
| 931 | Ga0501043_0113159 | 3300049579 | Bacteria | 2131 |
| 932 | Ga0501046_0030454 | 3300049580 | Bacteria | 4380 |
| 933 | Ga0501047_0000731 | 3300049581 | Bacteria | 34159 |
| 934 | Ga0501047_0450251 | 3300049581 | Bacteria | 1117 |
| 935 | Ga0501047_0935022 | 3300049581 | Bacteria | 680 |
| 936 | Ga0501070_0968333 | 3300049586 | Bacteria | 661 |
| 937 | Ga0501071_0191090 | 3300049587 | Bacteria | 1536 |
| 938 | Ga0501071_1187966 | 3300049587 | Bacteria | 589 |
| 939 | Ga0501073_0139551 | 3300049589 | Bacteria | 1679 |
| 940 | Ga0501074_0761420 | 3300049590 | Bacteria | 683 |
| 941 | Ga0501075_0834129 | 3300049591 | Bacteria | 701 |
| 942 | Ga0501076_0426670 | 3300049592 | Bacteria | 1091 |
| 943 | Ga0501076_1405930 | 3300049592 | Bacteria | 573 |
| 944 | Ga0501077_0216387 | 3300049593 | Bacteria | 1218 |
| 945 | Ga0501206_003378 | 3300049653 | Bacteria | 2028 |
| 946 | Ga0501211_000103 | 3300049658 | Bacteria | 6327 |
| 947 | Ga0501222_001746 | 3300049662 | Bacteria | 3014 |
| 948 | Ga0501223_004016 | 3300049663 | Bacteria | 3169 |
| 949 | Ga0501223_036809 | 3300049663 | Bacteria | 951 |
| 950 | Ga0501224_000754 | 3300049664 | Bacteria | 4084 |
| 951 | Ga0501227_028030 | 3300049665 | Bacteria | 1336 |
| 952 | Ga0501233_012436 | 3300049668 | Bacteria | 1708 |
| 953 | Ga0501235_001097 | 3300049669 | Bacteria | 5663 |
| 954 | Ga0501236_053975 | 3300049670 | Bacteria | 697 |
| 955 | Ga0501259_001391 | 3300049688 | Bacteria | 4043 |
| 956 | Ga0501261_000021 | 3300049690 | Bacteria | 37511 |
| 957 | Ga0501221_003846 | 3300049704 | Bacteria | 2478 |
| 958 | Ga0501225_0006973 | 3300049705 | Bacteria | 3291 |
| 959 | Ga0501225_0043405 | 3300049705 | Bacteria | 1242 |
| 960 | Ga0501079_0374717 | 3300049741 | Bacteria | 1116 |
| 961 | Ga0501080_0702389 | 3300049742 | Bacteria | 892 |
| 962 | Ga0501083_0271764 | 3300049744 | Bacteria | 1103 |
| 963 | Ga0501083_0292932 | 3300049744 | Bacteria | 1059 |
| 964 | Ga0501264_008163 | 3300049761 | Bacteria | 985 |
| 965 | Ga0501276_013553 | 3300049773 | Bacteria | 716 |
| 966 | Ga0501279_000010 | 3300049775 | Bacteria | 103375 |
| 967 | Ga0501280_000064 | 3300049776 | Bacteria | 31054 |
| 968 | Ga0501280_001057 | 3300049776 | Bacteria | 5596 |
| 969 | Ga0501281_00086 | 3300049777 | Bacteria | 10989 |
| 970 | Ga0501282_000404 | 3300049778 | Bacteria | 5157 |
| 971 | Ga0501283_001453 | 3300049779 | Bacteria | 3071 |
| 972 | Ga0501035_0179700 | 3300049822 | Bacteria | 1823 |
| 973 | Ga0501035_0244287 | 3300049822 | Bacteria | 1526 |
| 974 | Ga0501035_1048316 | 3300049822 | Bacteria | 639 |
| 975 | Ga0501044_0134255 | 3300049823 | Bacteria | 2467 |
| 976 | Ga0501044_0204047 | 3300049823 | Bacteria | 1934 |
| 977 | Ga0501044_0896240 | 3300049823 | Bacteria | 762 |
| 978 | Ga0501226_021697 | 3300049853 | Bacteria | 712 |
| 979 | Ga0501284_02268 | 3300050005 | Bacteria | 1056 |
| 980 | nmdc:mga03n38_266481_c1 | 3300050490 | Bacteria | 910 |
| 981 | nmdc:mga00v17_75476_c1 | 3300050491 | Bacteria | 1412 |
| 982 | nmdc:mga00v17_911672_c1 | 3300050491 | Bacteria | 556 |
| 983 | nmdc:mga0k408_344198_c1 | 3300050493 | Bacteria | 889 |
| 984 | nmdc:mga0k408_529690_c1 | 3300050493 | Bacteria | 697 |
| 985 | nmdc:mga0k408_583414_c1 | 3300050493 | Bacteria | 660 |
| 986 | nmdc:mga0k408_832522_c1 | 3300050493 | Bacteria | 537 |
| 987 | nmdc:mga06z11_17_c1 | 3300050494 | Bacteria | 79602 |
| 988 | nmdc:mga04h51_146_c1 | 3300050495 | Bacteria | 20585 |
| 989 | nmdc:mga04h51_411911_c1 | 3300050495 | Bacteria | 567 |
| 990 | nmdc:mga07m45_111328_c1 | 3300050496 | Bacteria | 1577 |
| 991 | nmdc:mga07m45_567769_c1 | 3300050496 | Bacteria | 656 |
| 992 | nmdc:mga07m45_60295_c1 | 3300050496 | Bacteria | 2147 |
| 993 | nmdc:mga05p37_171786_c1 | 3300050507 | Bacteria | 2643 |
| 994 | nmdc:mga05p37_2021674_c1 | 3300050507 | Bacteria | 544 |
| 995 | Ga0500643_010906 | 3300053087 | Bacteria | 3352 |
| 996 | Ga0500647_0376821 | 3300053091 | Bacteria | 582 |
| 997 | Ga0500651_0086862 | 3300053093 | Bacteria | 1931 |
| 998 | Ga0500566_0004538 | 3300053094 | Bacteria | 8291 |
| 999 | Ga0500641_0004173 | 3300053096 | Bacteria | 5101 |
| 1000 | Ga0500641_0136367 | 3300053096 | Bacteria | 1059 |
| 1001 | Ga0500556_0189304 | 3300053104 | Bacteria | 813 |
| 1002 | Ga0500562_070755 | 3300053108 | Bacteria | 941 |
| 1003 | Ga0500592_000031 | 3300053116 | Bacteria | 47686 |
| 1004 | Ga0500592_001156 | 3300053116 | Bacteria | 4293 |
| 1005 | Ga0500594_0054708 | 3300053118 | Bacteria | 1134 |
| 1006 | Ga0500595_000572 | 3300053119 | Bacteria | 21961 |
| 1007 | Ga0500595_052569 | 3300053119 | Bacteria | 1257 |
| 1008 | Ga0500595_055810 | 3300053119 | Bacteria | 1209 |
| 1009 | Ga0500608_066104 | 3300053122 | Bacteria | 1724 |
| 1010 | Ga0500618_014810 | 3300053125 | Bacteria | 1983 |
| 1011 | Ga0500626_092170 | 3300053128 | Bacteria | 1329 |
| 1012 | Ga0500642_0014296 | 3300053130 | Bacteria | 2948 |
| 1013 | Ga0500652_278543 | 3300053131 | Bacteria | 654 |
| 1014 | Ga0500655_000251 | 3300053133 | Bacteria | 12576 |
| 1015 | Ga0500658_0010885 | 3300053134 | Bacteria | 3356 |
| 1016 | Ga0500658_0014446 | 3300053134 | Bacteria | 2923 |
| 1017 | Ga0500658_0267841 | 3300053134 | Bacteria | 785 |
| 1018 | Ga0500658_0476850 | 3300053134 | Bacteria | 566 |
| 1019 | Ga0500559_0159324 | 3300053136 | Bacteria | 1060 |
| 1020 | Ga0500559_0232776 | 3300053136 | Bacteria | 868 |
| 1021 | Ga0500564_386623 | 3300053138 | Bacteria | 510 |
| 1022 | Ga0500568_0018906 | 3300053139 | Bacteria | 3006 |
| 1023 | Ga0500568_0092427 | 3300053139 | Bacteria | 1140 |
| 1024 | Ga0500568_0195118 | 3300053139 | Bacteria | 742 |
| 1025 | Ga0500588_0071841 | 3300053146 | Bacteria | 1137 |
| 1026 | Ga0500590_000131 | 3300053148 | Bacteria | 20923 |
| 1027 | Ga0500604_0036484 | 3300053151 | Bacteria | 1466 |
| 1028 | Ga0500604_0071415 | 3300053151 | Bacteria | 1107 |
| 1029 | Ga0500616_0008241 | 3300053153 | Bacteria | 6496 |
| 1030 | Ga0500616_0222499 | 3300053153 | Bacteria | 822 |
| 1031 | Ga0500616_0284202 | 3300053153 | Bacteria | 693 |
| 1032 | Ga0500616_0291538 | 3300053153 | Bacteria | 681 |
| 1033 | Ga0500622_0025695 | 3300053156 | Bacteria | 3111 |
| 1034 | Ga0500622_0077848 | 3300053156 | Bacteria | 1665 |
| 1035 | Ga0500622_0091256 | 3300053156 | Bacteria | 1511 |
| 1036 | Ga0500624_000063 | 3300053157 | Bacteria | 65333 |
| 1037 | Ga0500627_0001223 | 3300053158 | Bacteria | 7068 |
| 1038 | Ga0500627_0027041 | 3300053158 | Bacteria | 2372 |
| 1039 | Ga0500627_0378067 | 3300053158 | Bacteria | 607 |
| 1040 | Ga0500639_139272 | 3300053163 | Bacteria | 1137 |
| 1041 | Ga0500636_0058873 | 3300053177 | Bacteria | 2245 |
| 1042 | Ga0500570_004079 | 3300053724 | Bacteria | 7637 |
| 1043 | Ga0500645_180888 | 3300053730 | Bacteria | 573 |
| 1044 | Ga0500645_223100 | 3300053730 | Bacteria | 504 |
| 1045 | Ga0500601_034828 | 3300053737 | Bacteria | 604 |
| 1046 | Ga0501084_0791318 | 3300054114 | Bacteria | 799 |
| 1047 | Ga0587066_169647 | 3300059490 | Bacteria | 554 |
| 1048 | Ga0587077_168426 | 3300059493 | Bacteria | 585 |
| 1049 | Ga0587088_134191 | 3300059508 | Bacteria | 585 |
| 1050 | Ga0587094_030537 | 3300059513 | Bacteria | 833 |
| 1051 | Ga0587067_076756 | 3300059640 | Bacteria | 732 |
| 1052 | Ga0587069_140777 | 3300059642 | Bacteria | 528 |
| 1053 | Ga0501082_0979656 | 3300060353 | Bacteria | 739 |
| 1054 | 2511130325 | 2510917021 | Bacteria | 5705459 |
| 1055 | 2523469825 | 2523231067 | Bacteria | 5230452 |
| 1056 | 2585262260 | 2582581305 | Bacteria | 4895574 |
| 1057 | 2600225503 | 2599185359 | Bacteria | 4772316 |
| 1058 | 2643731598 | 2643221541 | Bacteria | 5498788 |
| 1059 | 2644036775 | 2643221605 | Bacteria | 4772303 |
| 1060 | 2644042074 | 2643221606 | Bacteria | 5588032 |
| 1061 | 2644126038 | 2643221622 | Bacteria | 4212502 |
| 1062 | 2644394283 | 2643221671 | Bacteria | 5496681 |
| 1063 | 2738709615 | 2738541275 | Bacteria | 4830863 |
| 1064 | 2738848040 | 2738541301 | Bacteria | 4834102 |
| 1065 | 2738863769 | 2738541304 | Bacteria | 4833665 |
| 1066 | 2739296287 | 2738543022 | Bacteria | 4835059 |
| 1067 | 2739348858 | 2738543031 | Bacteria | 5769731 |
| 1068 | 2739357965 | 2738543033 | Bacteria | 4833336 |
| 1069 | 2819713935 | 2818991466 | Bacteria | 4748179 |
| 1070 | 2879165166 | 2879163058 | Bacteria | 4223965 |
| 1071 | 2917557483 | 2917554339 | Bacteria | 4987857 |
| 1072 | 2928528495 | 2928526807 | Bacteria | 4760224 |
| 1073 | 2928960419 | 2928959182 | Bacteria | 4725774 |
| 1074 | 2928970040 | 2928968154 | Bacteria | 4633371 |
| 1075 | 2990266882 | 2990265787 | Bacteria | 3943888 |
| 1076 | 2993693827 | 2993693658 | Bacteria | 4040749 |
| 1077 | 8054303052 | 8054302542 | Bacteria | 5698134 |
| 1078 | Ga0436363_0153792 | |||
| 1079 | SwRhRL2b_contig_14491 | |||
| 1080 | ARcpr5yngRDRAFT_c004470 | |||
| 1081 | ARCol0yngRDRAFT_1009092 | |||
| 1082 | JGI24736J21556_1000613 | |||
| 1083 | JGI24741J21665_1000366 | |||
| 1084 | JGI24752J21851_1006793 | |||
| 1085 | JGI24740J21852_10005104 | |||
| 1086 | JGI24740J21852_10044246 | |||
| 1087 | JGI24739J22299_10005319 | |||
| 1088 | JGI24739J22299_10006470 | |||
| 1089 | JGI24739J22299_10110044 | |||
| 1090 | JGI24739J22299_10112626 | |||
| 1091 | JGI24739J22299_10159140 | |||
| 1092 | JGI24737J22298_10015406 | |||
| 1093 | JGI24737J22298_10020406 | |||
| 1094 | JGI24737J22298_10048588 | |||
| 1095 | JGI24737J22298_10132662 | |||
| 1096 | JGI24737J22298_10186610 | |||
| 1097 | JGI24743J22301_10030394 | |||
| 1098 | JGI24743J22301_10113531 | |||
| 1099 | JGI24735J21928_10000590 | |||
| 1100 | JGI24735J21928_10004614 | |||
| 1101 | JGI24735J21928_10004932 | |||
| 1102 | JGI24735J21928_10015755 | |||
| 1103 | JGI24735J21928_10018807 | |||
| 1104 | JGI24735J21928_10041906 | |||
| 1105 | JGI24735J21928_10058528 | |||
| 1106 | JGI24735J21928_10059101 | |||
| 1107 | JGI24735J21928_10135297 | |||
| 1108 | JGI24735J21928_10202768 | |||
| 1109 | JGI24748J21848_1005228 | |||
| 1110 | JGI24748J21848_1057374 | |||
| 1111 | JGI24738J21930_10000184 | |||
| 1112 | JGI24738J21930_10000231 | |||
| 1113 | JGI24738J21930_10001740 | |||
| 1114 | JGI24738J21930_10015275 | |||
| 1115 | JGI24749J21850_1000049 | |||
| 1116 | JGI24744J21845_10008674 | |||
| 1117 | JGI24035J26624_1026616 | |||
| 1118 | JGI24034J26672_10003845 | |||
| 1119 | JGI24034J26672_10041405 | |||
| 1120 | JGI24751J29686_10000216 | |||
| 1121 | JGI24751J29686_10018164 | |||
| 1122 | JGI25164J39214_1007846 | |||
| 1123 | JGI25150J39212_1002047 | |||
| 1124 | JGI25151J46595_10122326 | |||
| 1125 | JGI25165J46597_1000043 | |||
| 1126 | JGI25153J46596_10000395 | |||
| 1127 | JGI25153J46596_10002504 | |||
| 1128 | rootH1_10113314 | |||
| 1129 | rootH1_10035136 | |||
| 1130 | Ga0055529_1042867 | |||
| 1131 | Ga0055537_1001019 | |||
| 1132 | Ga0055524_1000056 | |||
| 1133 | Ga0055528_1020848 | |||
| 1134 | Ga0055530_10000931 | |||
| 1135 | Ga0055530_10007314 | |||
| 1136 | Ga0055540_1002064 | |||
| 1137 | Ga0055531_10012617 | |||
| 1138 | Ga0055531_10015017 | |||
| 1139 | Ga0065165_1005029 | |||
| 1140 | Ga0065165_1009273 | |||
| 1141 | Ga0065165_1017463 | |||
| 1142 | Ga0065165_1062777 | |||
| 1143 | Ga0065714_10116065 | |||
| 1144 | Ga0065704_10070504 | |||
| 1145 | Ga0065707_10000505 | |||
| 1146 | Ga0065707_10086198 | |||
| 1147 | Ga0065707_10135500 | |||
| 1148 | Ga0065707_10212812 | |||
| 1149 | Ga0065707_10371722 | |||
| 1150 | Ga0065707_10414622 | |||
| 1151 | Ga0065707_10938111 | |||
| 1152 | Ga0070658_10006525 | |||
| 1153 | Ga0070658_10068992 | |||
| 1154 | Ga0070658_10097157 | |||
| 1155 | Ga0070658_10584581 | |||
| 1156 | Ga0070658_10669238 | |||
| 1157 | Ga0070658_11102012 | |||
| 1158 | Ga0070676_10000230 | |||
| 1159 | Ga0070683_100195033 | |||
| 1160 | Ga0070670_100000003 | |||
| 1161 | Ga0070670_100002377 | |||
| 1162 | Ga0070670_100004170 | |||
| 1163 | Ga0070670_100126344 | |||
| 1164 | Ga0070670_100189232 | |||
| 1165 | Ga0070677_10801344 | |||
| 1166 | Ga0068869_100000200 | |||
| 1167 | Ga0070666_10000184 | |||
| 1168 | Ga0070666_10033483 | |||
| 1169 | Ga0070666_10257671 | |||
| 1170 | Ga0070682_100302630 | |||
| 1171 | Ga0068868_100001398 | |||
| 1172 | Ga0070660_100004583 | |||
| 1173 | Ga0070660_100070534 | |||
| 1174 | Ga0070660_100209408 | |||
| 1175 | Ga0070660_100996905 | |||
| 1176 | Ga0070661_100581848 | |||
| 1177 | Ga0070661_101005335 | |||
| 1178 | Ga0070668_100000026 | |||
| 1179 | Ga0070668_100000080 | |||
| 1180 | Ga0070668_100018364 | |||
| 1181 | Ga0070668_100027483 | |||
| 1182 | Ga0070668_100208292 | |||
| 1183 | Ga0070668_100408180 | |||
| 1184 | Ga0070668_100428915 | |||
| 1185 | Ga0070669_100000008 | |||
| 1186 | Ga0070669_100000020 | |||
| 1187 | Ga0070669_100000082 | |||
| 1188 | Ga0070669_100096603 | |||
| 1189 | Ga0070675_100006627 | |||
| 1190 | Ga0070671_100000015 | |||
| 1191 | Ga0070671_100000169 | |||
| 1192 | Ga0070671_100000470 | |||
| 1193 | Ga0070671_100013092 | |||
| 1194 | Ga0070671_100053502 | |||
| 1195 | Ga0070674_100051002 | |||
| 1196 | Ga0070673_100000006 | |||
| 1197 | Ga0070673_101154028 | |||
| 1198 | Ga0070688_100464942 | |||
| 1199 | Ga0070659_100052995 | |||
| 1200 | Ga0070659_100899434 | |||
| 1201 | Ga0070659_101485301 | |||
| 1202 | Ga0070659_101711550 | |||
| 1203 | Ga0070667_100000019 | |||
| 1204 | Ga0070667_100006367 | |||
| 1205 | Ga0070667_100037194 | |||
| 1206 | Ga0070667_100038717 | |||
| 1207 | Ga0070667_100681738 | |||
| 1208 | Ga0070705_100054779 | |||
| 1209 | Ga0070705_100448402 | |||
| 1210 | Ga0070708_100198374 | |||
| 1211 | Ga0070708_101344162 | |||
| 1212 | Ga0070663_100000574 | |||
| 1213 | Ga0070663_100002941 | |||
| 1214 | Ga0070663_101387399 | |||
| 1215 | Ga0070678_100552397 | |||
| 1216 | Ga0070662_100007108 | |||
| 1217 | Ga0070662_100094062 | |||
| 1218 | Ga0070662_100561610 | |||
| 1219 | Ga0070662_100819864 | |||
| 1220 | Ga0070662_101003480 | |||
| 1221 | Ga0068867_100000001 | |||
| 1222 | Ga0070685_10103920 | |||
| 1223 | Ga0070685_10368722 | |||
| 1224 | Ga0070707_101322160 | |||
| 1225 | Ga0070679_100158874 | |||
| 1226 | Ga0070679_100424436 | |||
| 1227 | Ga0070684_100251597 | |||
| 1228 | Ga0068853_100143479 | |||
| 1229 | Ga0068853_100881719 | |||
| 1230 | Ga0068853_100884100 | |||
| 1231 | Ga0068853_102321716 | |||
| 1232 | Ga0070672_100004199 | |||
| 1233 | Ga0070686_100290882 | |||
| 1234 | Ga0070665_100002434 | |||
| 1235 | Ga0070665_100009702 | |||
| 1236 | Ga0070665_100095381 | |||
| 1237 | Ga0070665_100378831 | |||
| 1238 | Ga0070665_100420653 | |||
| 1239 | Ga0070665_100895973 | |||
| 1240 | Ga0070665_101432299 | |||
| 1241 | Ga0068855_100218364 | |||
| 1242 | Ga0068855_100577260 | |||
| 1243 | Ga0068855_101048138 | |||
| 1244 | Ga0068855_101587902 | |||
| 1245 | Ga0068855_102121698 | |||
| 1246 | Ga0068857_100021366 | |||
| 1247 | Ga0068857_100637109 | |||
| 1248 | Ga0068857_100711507 | |||
| 1249 | Ga0068854_100000483 | |||
| 1250 | Ga0068854_100301862 | |||
| 1251 | Ga0068854_100538554 | |||
| 1252 | Ga0068854_101277453 | |||
| 1253 | Ga0068856_100003591 | |||
| 1254 | Ga0068856_100020542 | |||
| 1255 | Ga0068856_100312622 | |||
| 1256 | Ga0068852_100028295 | |||
| 1257 | Ga0068852_100608851 | |||
| 1258 | Ga0068852_101516957 | |||
| 1259 | Ga0068859_100003505 | |||
| 1260 | Ga0068859_100023533 | |||
| 1261 | Ga0068859_100034581 | |||
| 1262 | Ga0068859_100216629 | |||
| 1263 | Ga0068859_100679313 | |||
| 1264 | Ga0068859_100859376 | |||
| 1265 | Ga0068864_100000005 | |||
| 1266 | Ga0068864_100030140 | |||
| 1267 | Ga0068864_100466728 | |||
| 1268 | Ga0068861_100004980 | |||
| 1269 | Ga0068861_100154977 | |||
| 1270 | Ga0068851_10074177 | |||
| 1271 | Ga0068863_100000001 | |||
| 1272 | Ga0068863_100000582 | |||
| 1273 | Ga0068863_100067996 | |||
| 1274 | Ga0068863_100084694 | |||
| 1275 | Ga0068863_100137511 | |||
| 1276 | Ga0068863_100313791 | |||
| 1277 | Ga0068858_100010355 | |||
| 1278 | Ga0068858_100034454 | |||
| 1279 | Ga0068858_100380650 | |||
| 1280 | Ga0068860_100000036 | |||
| 1281 | Ga0068860_100001081 | |||
| 1282 | Ga0068860_100004358 | |||
| 1283 | Ga0068860_100044110 | |||
| 1284 | Ga0068860_100115216 | |||
| 1285 | Ga0068860_100263556 | |||
| 1286 | Ga0068860_100310382 | |||
| 1287 | Ga0068860_102676641 | |||
| 1288 | Ga0068862_100000001 | |||
| 1289 | Ga0068862_100000169 | |||
| 1290 | Ga0068862_100001451 | |||
| 1291 | Ga0068862_100006085 | |||
| 1292 | Ga0068862_100021177 | |||
| 1293 | Ga0068862_100049285 | |||
| 1294 | Ga0068862_100087044 | |||
| 1295 | Ga0068862_101234307 | |||
| 1296 | Ga0081455_10000255 | |||
| 1297 | Ga0081455_10023602 | |||
| 1298 | Ga0081538_10004148 | |||
| 1299 | Ga0081538_10036760 | |||
| 1300 | Ga0075364_10197055 | |||
| 1301 | Ga0075364_10888517 | |||
| 1302 | Ga0075366_10043167 | |||
| 1303 | Ga0075366_10245806 | |||
| 1304 | Ga0075366_10576769 | |||
| 1305 | Ga0075366_10726065 | |||
| 1306 | Ga0075366_10801680 | |||
| 1307 | Ga0097621_100001076 | |||
| 1308 | Ga0075370_10043587 | |||
| 1309 | Ga0075370_10637142 | |||
| 1310 | Ga0068871_100067527 | |||
| 1311 | Ga0068871_101210368 | |||
| 1312 | Ga0068865_100000003 | |||
| 1313 | Ga0097620_100003505 | |||
| 1314 | Ga0097620_100023532 | |||
| 1315 | Ga0097620_100034580 | |||
| 1316 | Ga0097620_100216626 | |||
| 1317 | Ga0097620_100679134 | |||
| 1318 | Ga0097620_100859461 | |||
| 1319 | Ga0105251_10012362 | |||
| 1320 | Ga0105251_10638162 | |||
| 1321 | Ga0105244_10606409 | |||
| 1322 | Ga0105250_10006517 | |||
| 1323 | Ga0105240_10015679 | |||
| 1324 | Ga0105240_10025126 | |||
| 1325 | Ga0105240_10091793 | |||
| 1326 | Ga0105240_10318721 | |||
| 1327 | Ga0105240_10744819 | |||
| 1328 | Ga0105240_12089073 | |||
| 1329 | Ga0105245_10000113 | |||
| 1330 | Ga0105245_10032215 | |||
| 1331 | Ga0105247_10001891 | |||
| 1332 | Ga0105247_10369422 | |||
| 1333 | Ga0105243_10000373 | |||
| 1334 | Ga0105243_10328860 | |||
| 1335 | Ga0105243_10942050 | |||
| 1336 | Ga0105241_10038453 | |||
| 1337 | Ga0105241_10707420 | |||
| 1338 | Ga0105242_10000165 | |||
| 1339 | Ga0105248_10001558 | |||
| 1340 | Ga0105248_10024425 | |||
| 1341 | Ga0105248_10043233 | |||
| 1342 | Ga0105248_10088281 | |||
| 1343 | Ga0105248_13138180 | |||
| 1344 | Ga0105237_10044206 | |||
| 1345 | Ga0105237_11408470 | |||
| 1346 | Ga0105237_11679876 | |||
| 1347 | Ga0105237_12603792 | |||
| 1348 | Ga0105238_10635331 | |||
| 1349 | Ga0105238_11154457 | |||
| 1350 | Ga0105238_11442421 | |||
| 1351 | Ga0105249_10000045 | |||
| 1352 | Ga0105249_10019753 | |||
| 1353 | Ga0105249_10037409 | |||
| 1354 | Ga0105249_10084345 | |||
| 1355 | Ga0105249_10265973 | |||
| 1356 | Ga0105249_10758182 | |||
| 1357 | Ga0105239_10000367 | |||
| 1358 | Ga0105239_10012172 | |||
| 1359 | Ga0105239_10326543 | |||
| 1360 | Ga0105239_10846266 | |||
| 1361 | Ga0105239_10931845 | |||
| 1362 | Ga0105246_10001620 | |||
| 1363 | Ga0157326_1000423 | |||
| 1364 | Ga0157373_10081550 | |||
| 1365 | Ga0157373_10136804 | |||
| 1366 | Ga0157373_10232191 | |||
| 1367 | Ga0157371_10160163 | |||
| 1368 | Ga0157371_10492244 | |||
| 1369 | Ga0157371_11482642 | |||
| 1370 | Ga0157371_11598663 | |||
| 1371 | Ga0157371_11604795 | |||
| 1372 | Ga0157370_10000069 | |||
| 1373 | Ga0157370_10057965 | |||
| 1374 | Ga0157370_10174746 | |||
| 1375 | Ga0157370_10214812 | |||
| 1376 | Ga0157370_10647775 | |||
| 1377 | Ga0157370_10971235 | |||
| 1378 | Ga0157370_11695857 | |||
| 1379 | Ga0157369_10012597 | |||
| 1380 | Ga0157369_10109686 | |||
| 1381 | Ga0157369_10173906 | |||
| 1382 | Ga0157369_10174888 | |||
| 1383 | Ga0157369_12006581 | |||
| 1384 | Ga0157369_12357748 | |||
| 1385 | Ga0157374_10100942 | |||
| 1386 | Ga0157374_10393274 | |||
| 1387 | Ga0157374_10432242 | |||
| 1388 | Ga0157378_10002300 | |||
| 1389 | Ga0163162_10016081 | |||
| 1390 | Ga0163162_10019579 | |||
| 1391 | Ga0163162_10301457 | |||
| 1392 | Ga0163162_12257592 | |||
| 1393 | Ga0163162_13217757 | |||
| 1394 | Ga0157372_10113522 | |||
| 1395 | Ga0157372_10118609 | |||
| 1396 | Ga0157372_10209575 | |||
| 1397 | Ga0157372_10258817 | |||
| 1398 | Ga0157372_10288298 | |||
| 1399 | Ga0157372_10337590 | |||
| 1400 | Ga0157372_10567943 | |||
| 1401 | Ga0157372_10932088 | |||
| 1402 | Ga0157372_12775511 | |||
| 1403 | Ga0157375_10041491 | |||
| 1404 | Ga0157375_10798349 | |||
| 1405 | Ga0163163_10030114 | |||
| 1406 | Ga0157380_10000029 | |||
| 1407 | Ga0157380_10001161 | |||
| 1408 | Ga0157380_10230670 | |||
| 1409 | Ga0157380_12204024 | |||
| 1410 | Ga0182008_10307738 | |||
| 1411 | Ga0157377_10067056 | |||
| 1412 | Ga0157379_10128162 | |||
| 1413 | Ga0157379_10770590 | |||
| 1414 | Ga0157376_10000089 | |||
| 1415 | Ga0163161_10000101 | |||
| 1416 | Ga0163161_10019426 | |||
| 1417 | Ga0163161_10030597 | |||
| 1418 | Ga0163161_10148380 | |||
| 1419 | Ga0163161_11831506 | |||
| 1420 | Ga0206356_11727543 | |||
| 1421 | Ga0206352_10131959 | |||
| 1422 | Ga0213876_10024618 | |||
| 1423 | Ga0213876_10601056 | |||
| 1424 | Ga0213875_10009905 | |||
| 1425 | Ga0213875_10524352 | |||
| 1426 | Ga0209147_103605 | |||
| 1427 | Ga0207427_101450 | |||
| 1428 | Ga0207425_1000041 | |||
| 1429 | Ga0207425_1015629 | |||
| 1430 | Ga0209026_1004345 | |||
| 1431 | Ga0209148_1000238 | |||
| 1432 | Ga0209148_1001034 | |||
| 1433 | Ga0209129_1002094 | |||
| 1434 | Ga0209233_1000079 | |||
| 1435 | Ga0209233_1073702 | |||
| 1436 | Ga0209565_1000008 | |||
| 1437 | Ga0209565_1000134 | |||
| 1438 | Ga0209455_1000952 | |||
| 1439 | Ga0209455_1056735 | |||
| 1440 | Ga0209673_1002352 | |||
| 1441 | Ga0209673_1029162 | |||
| 1442 | Ga0209675_1009250 | |||
| 1443 | Ga0209676_1026408 | |||
| 1444 | Ga0209025_1000068 | |||
| 1445 | Ga0209564_1080218 | |||
| 1446 | Ga0209758_1000004 | |||
| 1447 | Ga0209758_1012697 | |||
| 1448 | Ga0209050_1000001 | |||
| 1449 | Ga0209050_1000581 | |||
| 1450 | Ga0209050_1000687 | |||
| 1451 | Ga0209050_1007158 | |||
| 1452 | Ga0209256_1000009 | |||
| 1453 | Ga0209256_1000010 | |||
| 1454 | Ga0207426_1037675 | |||
| 1455 | Ga0209051_1000191 | |||
| 1456 | Ga0209257_1000876 | |||
| 1457 | Ga0209257_1002353 | |||
| 1458 | Ga0209257_1002898 | |||
| 1459 | Ga0209257_1003401 | |||
| 1460 | Ga0209257_1037487 | |||
| 1461 | Ga0209257_1100855 | |||
| 1462 | Ga0207697_10006525 | |||
| 1463 | Ga0207697_10530809 | |||
| 1464 | Ga0207656_10012218 | |||
| 1465 | Ga0207656_10159701 | |||
| 1466 | Ga0207696_1007265 | |||
| 1467 | Ga0207713_1010142 | |||
| 1468 | Ga0207713_1036906 | |||
| 1469 | Ga0207710_10007240 | |||
| 1470 | Ga0207710_10012300 | |||
| 1471 | Ga0207710_10207976 | |||
| 1472 | Ga0207710_10331102 | |||
| 1473 | Ga0207688_10409565 | |||
| 1474 | Ga0207688_10846280 | |||
| 1475 | Ga0207688_11043763 | |||
| 1476 | Ga0207680_10000010 | |||
| 1477 | Ga0207680_10000186 | |||
| 1478 | Ga0207680_10093912 | |||
| 1479 | Ga0207647_10000038 | |||
| 1480 | Ga0207647_10002647 | |||
| 1481 | Ga0207647_10032481 | |||
| 1482 | Ga0207647_10041942 | |||
| 1483 | Ga0207647_10065904 | |||
| 1484 | Ga0207647_10095073 | |||
| 1485 | Ga0207647_10207898 | |||
| 1486 | Ga0207647_10212165 | |||
| 1487 | Ga0207647_10283643 | |||
| 1488 | Ga0207647_10393125 | |||
| 1489 | Ga0207645_10003616 | |||
| 1490 | Ga0207705_10000121 | |||
| 1491 | Ga0207705_10000365 | |||
| 1492 | Ga0207705_10014470 | |||
| 1493 | Ga0207705_10135124 | |||
| 1494 | Ga0207705_10159690 | |||
| 1495 | Ga0207654_10000375 | |||
| 1496 | Ga0207654_10080510 | |||
| 1497 | Ga0207654_10098883 | |||
| 1498 | Ga0207695_10001183 | |||
| 1499 | Ga0207695_10016421 | |||
| 1500 | Ga0207695_10021724 | |||
| 1501 | Ga0207695_10031555 | |||
| 1502 | Ga0207695_10077775 | |||
| 1503 | Ga0207695_10223979 | |||
| 1504 | Ga0207695_10873246 | |||
| 1505 | Ga0207671_10001192 | |||
| 1506 | Ga0207671_10027639 | |||
| 1507 | Ga0207671_11237598 | |||
| 1508 | Ga0207671_11279455 | |||
| 1509 | Ga0207662_11126671 | |||
| 1510 | Ga0207657_10015487 | |||
| 1511 | Ga0207657_10026870 | |||
| 1512 | Ga0207657_10048996 | |||
| 1513 | Ga0207657_10387615 | |||
| 1514 | Ga0207657_11006315 | |||
| 1515 | Ga0207649_10150506 | |||
| 1516 | Ga0207649_10167287 | |||
| 1517 | Ga0207649_10831047 | |||
| 1518 | Ga0207649_11059835 | |||
| 1519 | Ga0207652_10134787 | |||
| 1520 | Ga0207652_10286625 | |||
| 1521 | Ga0207681_10000002 | |||
| 1522 | Ga0207681_10000005 | |||
| 1523 | Ga0207681_10000109 | |||
| 1524 | Ga0207681_10000183 | |||
| 1525 | Ga0207681_10033288 | |||
| 1526 | Ga0207681_10094028 | |||
| 1527 | Ga0207681_10122960 | |||
| 1528 | Ga0207681_10716631 | |||
| 1529 | Ga0207694_10002087 | |||
| 1530 | Ga0207694_10091001 | |||
| 1531 | Ga0207694_10345340 | |||
| 1532 | Ga0207694_10637068 | |||
| 1533 | Ga0207694_10801093 | |||
| 1534 | Ga0207650_10000004 | |||
| 1535 | Ga0207650_10002904 | |||
| 1536 | Ga0207650_10006404 | |||
| 1537 | Ga0207650_10049447 | |||
| 1538 | Ga0207650_10174974 | |||
| 1539 | Ga0207659_10136023 | |||
| 1540 | Ga0207687_10000225 | |||
| 1541 | Ga0207687_10010076 | |||
| 1542 | Ga0207644_10000002 | |||
| 1543 | Ga0207644_10000012 | |||
| 1544 | Ga0207644_10000067 | |||
| 1545 | Ga0207644_10001857 | |||
| 1546 | Ga0207644_10022749 | |||
| 1547 | Ga0207644_10700505 | |||
| 1548 | Ga0207690_10157914 | |||
| 1549 | Ga0207690_10186911 | |||
| 1550 | Ga0207690_10337182 | |||
| 1551 | Ga0207690_10342161 | |||
| 1552 | Ga0207690_10356195 | |||
| 1553 | Ga0207690_10878067 | |||
| 1554 | Ga0207706_10008805 | |||
| 1555 | Ga0207706_10033279 | |||
| 1556 | Ga0207706_10083285 | |||
| 1557 | Ga0207706_10138164 | |||
| 1558 | Ga0207706_10198802 | |||
| 1559 | Ga0207706_11217586 | |||
| 1560 | Ga0207686_10001878 | |||
| 1561 | Ga0207709_10000173 | |||
| 1562 | Ga0207709_10088718 | |||
| 1563 | Ga0207709_11210901 | |||
| 1564 | Ga0207669_10046739 | |||
| 1565 | Ga0207669_11000337 | |||
| 1566 | Ga0207704_10000001 | |||
| 1567 | Ga0207691_10009162 | |||
| 1568 | Ga0207711_10000075 | |||
| 1569 | Ga0207711_10024088 | |||
| 1570 | Ga0207711_10114106 | |||
| 1571 | Ga0207711_10236570 | |||
| 1572 | Ga0207711_11362142 | |||
| 1573 | Ga0207689_10000744 | |||
| 1574 | Ga0207689_11445008 | |||
| 1575 | Ga0207661_10482382 | |||
| 1576 | Ga0207661_11506624 | |||
| 1577 | Ga0207679_10123611 | |||
| 1578 | Ga0207679_10140360 | |||
| 1579 | Ga0207667_10000016 | |||
| 1580 | Ga0207667_10011748 | |||
| 1581 | Ga0207667_10112317 | |||
| 1582 | Ga0207667_10498960 | |||
| 1583 | Ga0207667_10638165 | |||
| 1584 | Ga0207651_10000002 | |||
| 1585 | Ga0207651_11013347 | |||
| 1586 | Ga0207712_10000014 | |||
| 1587 | Ga0207712_10000174 | |||
| 1588 | Ga0207712_10018137 | |||
| 1589 | Ga0207712_10057696 | |||
| 1590 | Ga0207712_10092123 | |||
| 1591 | Ga0207712_10657395 | |||
| 1592 | Ga0207712_11277392 | |||
| 1593 | Ga0207712_11688390 | |||
| 1594 | Ga0207668_10000081 | |||
| 1595 | Ga0207668_10000304 | |||
| 1596 | Ga0207668_10005340 | |||
| 1597 | Ga0207668_10083673 | |||
| 1598 | Ga0207668_10085277 | |||
| 1599 | Ga0207668_10328540 | |||
| 1600 | Ga0207668_10484314 | |||
| 1601 | Ga0207640_10000063 | |||
| 1602 | Ga0207640_10031448 | |||
| 1603 | Ga0207640_10062003 | |||
| 1604 | Ga0207640_10100271 | |||
| 1605 | Ga0207640_10157229 | |||
| 1606 | Ga0207640_11027507 | |||
| 1607 | Ga0207640_11246724 | |||
| 1608 | Ga0207640_11397633 | |||
| 1609 | Ga0207658_10000002 | |||
| 1610 | Ga0207658_10001566 | |||
| 1611 | Ga0207658_10004095 | |||
| 1612 | Ga0207658_10008782 | |||
| 1613 | Ga0207658_10018656 | |||
| 1614 | Ga0207658_10819713 | |||
| 1615 | Ga0207677_10000030 | |||
| 1616 | Ga0207703_10005351 | |||
| 1617 | Ga0207703_10008030 | |||
| 1618 | Ga0207703_10009134 | |||
| 1619 | Ga0207703_10124179 | |||
| 1620 | Ga0207639_10000213 | |||
| 1621 | Ga0207639_10012302 | |||
| 1622 | Ga0207639_10036850 | |||
| 1623 | Ga0207639_10122498 | |||
| 1624 | Ga0207639_10602963 | |||
| 1625 | Ga0207639_10828173 | |||
| 1626 | Ga0207678_10000857 | |||
| 1627 | Ga0207678_10001793 | |||
| 1628 | Ga0207678_10088208 | |||
| 1629 | Ga0207702_10000887 | |||
| 1630 | Ga0207702_10002945 | |||
| 1631 | Ga0207702_10019109 | |||
| 1632 | Ga0207641_10000001 | |||
| 1633 | Ga0207641_10000099 | |||
| 1634 | Ga0207641_10002512 | |||
| 1635 | Ga0207641_10004505 | |||
| 1636 | Ga0207641_10013693 | |||
| 1637 | Ga0207641_10014410 | |||
| 1638 | Ga0207641_11282650 | |||
| 1639 | Ga0207648_10000001 | |||
| 1640 | Ga0207676_10000006 | |||
| 1641 | Ga0207676_10000770 | |||
| 1642 | Ga0207676_10022559 | |||
| 1643 | Ga0207674_10131652 | |||
| 1644 | Ga0207674_10300559 | |||
| 1645 | Ga0207674_10337148 | |||
| 1646 | Ga0207674_11129632 | |||
| 1647 | Ga0207674_11201849 | |||
| 1648 | Ga0207675_100000358 | |||
| 1649 | Ga0207675_100001138 | |||
| 1650 | Ga0207675_100230090 | |||
| 1651 | Ga0207683_10182888 | |||
| 1652 | Ga0207698_10034383 | |||
| 1653 | Ga0207698_10130218 | |||
| 1654 | Ga0207698_10201601 | |||
| 1655 | Ga0207698_10955811 | |||
| 1656 | Ga0207698_12752071 | |||
| 1657 | Ga0209371_1085272 | |||
| 1658 | Ga0209813_10000051 | |||
| 1659 | Ga0268266_10000009 | |||
| 1660 | Ga0268266_10002003 | |||
| 1661 | Ga0268266_10006189 | |||
| 1662 | Ga0268266_10158947 | |||
| 1663 | Ga0268266_10211526 | |||
| 1664 | Ga0268266_10315170 | |||
| 1665 | Ga0268266_10422983 | |||
| 1666 | Ga0268266_11019591 | |||
| 1667 | Ga0268266_11411114 | |||
| 1668 | Ga0268265_10000001 | |||
| 1669 | Ga0268265_10000045 | |||
| 1670 | Ga0268265_10000047 | |||
| 1671 | Ga0268265_10000285 | |||
| 1672 | Ga0268265_10004726 | |||
| 1673 | Ga0268265_10017233 | |||
| 1674 | Ga0268265_10146980 | |||
| 1675 | Ga0268265_10315643 | |||
| 1676 | Ga0268265_10387566 | |||
| 1677 | Ga0268265_11127984 | |||
| 1678 | Ga0268264_10000001 | |||
| 1679 | Ga0268264_10000010 | |||
| 1680 | Ga0268264_10000023 | |||
| 1681 | Ga0268264_10004259 | |||
| 1682 | Ga0268264_10012572 | |||
| 1683 | Ga0268264_10105564 | |||
| 1684 | Ga0268264_10209613 | |||
| 1685 | Ga0268264_10405038 | |||
| 1686 | Ga0307517_10633740 | |||
| 1687 | Ga0268256_1046229 | |||
| 1688 | Ga0314311_1203820 | |||
| 1689 | Ga0265320_10000034 | |||
| 1690 | Ga0265325_10023456 | |||
| 1691 | Ga0265325_10037185 | |||
| 1692 | Ga0307513_10209984 | |||
| 1693 | Ga0307408_100051500 | |||
| 1694 | Ga0307408_101128429 | |||
| 1695 | Ga0307408_101389987 | |||
| 1696 | Ga0265313_10000665 | |||
| 1697 | Ga0265314_10019631 | |||
| 1698 | Ga0265314_10042189 | |||
| 1699 | Ga0265314_10118950 | |||
| 1700 | Ga0307405_10055116 | |||
| 1701 | Ga0307405_10530365 | |||
| 1702 | Ga0307405_10949213 | |||
| 1703 | Ga0307405_11486235 | |||
| 1704 | Ga0307413_10332327 | |||
| 1705 | Ga0307413_11513892 | |||
| 1706 | Ga0307410_10027090 | |||
| 1707 | Ga0307410_11135650 | |||
| 1708 | Ga0307406_10589289 | |||
| 1709 | Ga0307406_10614399 | |||
| 1710 | Ga0307406_10706803 | |||
| 1711 | Ga0307406_11005598 | |||
| 1712 | Ga0307406_11917748 | |||
| 1713 | Ga0307407_10257420 | |||
| 1714 | Ga0307412_10015626 | |||
| 1715 | Ga0307412_10514991 | |||
| 1716 | Ga0307412_10947513 | |||
| 1717 | Ga0307412_11429176 | |||
| 1718 | Ga0307409_101359966 | |||
| 1719 | Ga0307409_102980818 | |||
| 1720 | Ga0307416_100014919 | |||
| 1721 | Ga0307414_11712720 | |||
| 1722 | Ga0307414_11795155 | |||
| 1723 | Ga0307411_10271081 | |||
| 1724 | Ga0307411_10440296 | |||
| 1725 | Ga0307411_12160541 | |||
| 1726 | Ga0307510_10148726 | |||
| 1727 | Ga0373923_0143888 | |||
| 1728 | Ga0373946_0647350 | |||
| 1729 | Ga0395899_0001521 | |||
| 1730 | Ga0395900_0009291 | |||
| 1731 | Ga0395900_1114422 | |||
| 1732 | Ga0395898_1303005 | |||
| 1733 | Ga0395905_0026896 | |||
| 1734 | Ga0395905_0516629 | |||
| 1735 | Ga0436364_0741438 | |||
| 1736 | Ga0436364_0878110 | |||
| 1737 | Ga0395901_0073008 | |||
| 1738 | Ga0395901_2127733 | |||
| 1739 | Ga0436365_0212007 | |||
| 1740 | Ga0436365_0922307 | |||
| 1741 | Ga0436365_1667312 | |||
| 1742 | Ga0436365_1773361 | |||
| 1743 | Ga0436361_1051839 | |||
| 1744 | Ga0439436_0009694 | |||
| 1745 | Ga0439439_0001779 | |||
| 1746 | Ga0439447_148918 | |||
| 1747 | Ga0439461_0000498 | |||
| 1748 | Ga0439461_0003679 | |||
| 1749 | Ga0439461_0080904 | |||
| 1750 | Ga0439465_0004274 | |||
| 1751 | Ga0439465_0004757 | |||
| 1752 | Ga0451793_0810995 | |||
| 1753 | Ga0451793_1584048 | |||
| 1754 | Ga0451802_1834731 | |||
| 1755 | Ga0451806_522421 | |||
| 1756 | Ga0451807_0720757 | |||
| 1757 | Ga0451833_1022453 | |||
| 1758 | Ga0451837_1536393 | |||
| 1759 | Ga0451841_0590837 | |||
| 1760 | Ga0451853_3774724 | |||
| 1761 | Ga0439431_0038651 | |||
| 1762 | Ga0439442_150916 | |||
| 1763 | Ga0439445_0033115 | |||
| 1764 | Ga0439448_0002459 | |||
| 1765 | Ga0439432_000640 | |||
| 1766 | Ga0439432_022961 | |||
| 1767 | Ga0439452_018803 | |||
| 1768 | Ga0439457_024428 | |||
| 1769 | Ga0439462_0002776 | |||
| 1770 | Ga0450922_019334 | |||
| 1771 | Ga0439446_0034458 | |||
| 1772 | Ga0439458_0000137 | |||
| 1773 | Ga0450909_012035 | |||
| 1774 | Ga0439434_0020110 | |||
| 1775 | Ga0439460_0201787 | |||
| 1776 | Ga0466972_0086674 | |||
| 1777 | Ga0466965_0529846 | |||
| 1778 | Ga0466963_0311463 | |||
| 1779 | Ga0466970_0256774 | |||
| 1780 | Ga0466957_0347333 | |||
| 1781 | Ga0451576_0436970 | |||
| 1782 | Ga0466958_0391983 | |||
| 1783 | Ga0466967_0379221 | |||
| 1784 | Ga0466967_0633257 | |||
| 1785 | Ga0466967_2162402 | |||
| 1786 | Ga0495617_011498 | |||
| 1787 | Ga0495627_000156 | |||
| 1788 | Ga0495627_000578 | |||
| 1789 | Ga0495627_034662 | |||
| 1790 | Ga0495638_0000758 | |||
| 1791 | Ga0495638_0188677 | |||
| 1792 | Ga0495651_0721380 | |||
| 1793 | Ga0495650_0001027 | |||
| 1794 | Ga0495650_0227391 | |||
| 1795 | Ga0495584_0078046 | |||
| 1796 | Ga0495585_0127704 | |||
| 1797 | Ga0495585_0567920 | |||
| 1798 | Ga0495607_0093490 | |||
| 1799 | Ga0495583_0220617 | |||
| 1800 | Ga0495606_0072058 | |||
| 1801 | Ga0495610_0000291 | |||
| 1802 | Ga0495610_0144969 | |||
| 1803 | Ga0495616_0001456 | |||
| 1804 | Ga0495632_0000006 | |||
| 1805 | Ga0495637_0000784 | |||
| 1806 | Ga0495637_0010852 | |||
| 1807 | Ga0495637_0065588 | |||
| 1808 | Ga0495643_0000021 | |||
| 1809 | Ga0495643_0523213 | |||
| 1810 | Ga0495648_0010683 | |||
| 1811 | Ga0495648_0045945 | |||
| 1812 | Ga0495663_0000008 | |||
| 1813 | Ga0495663_0018920 | |||
| 1814 | Ga0495663_0053401 | |||
| 1815 | Ga0495663_0242178 | |||
| 1816 | Ga0495654_0116202 | |||
| 1817 | Ga0495597_0031259 | |||
| 1818 | Ga0495633_0000190 | |||
| 1819 | Ga0495633_0002635 | |||
| 1820 | Ga0495633_0013695 | |||
| 1821 | Ga0495633_0072188 | |||
| 1822 | Ga0495633_0146062 | |||
| 1823 | Ga0495668_0002221 | |||
| 1824 | Ga0495668_0105921 | |||
| 1825 | Ga0495668_0574724 | |||
| 1826 | Ga0495625_0000629 | |||
| 1827 | Ga0495625_0215510 | |||
| 1828 | Ga0495625_0393492 | |||
| 1829 | Ga0495661_0125781 | |||
| 1830 | Ga0495670_0000002 | |||
| 1831 | Ga0495670_0427746 | |||
| 1832 | Ga0495671_0000017 | |||
| 1833 | Ga0495649_0327109 | |||
| 1834 | Ga0495636_0180483 | |||
| 1835 | Ga0495672_0174663 | |||
| 1836 | Ga0495672_0212818 | |||
| 1837 | Ga0495673_0028297 | |||
| 1838 | Ga0495681_0000098 | |||
| 1839 | Ga0495681_0008268 | |||
| 1840 | Ga0495681_0009646 | |||
| 1841 | Ga0495681_0326806 | |||
| 1842 | Ga0495686_0005063 | |||
| 1843 | Ga0495686_0008463 | |||
| 1844 | Ga0495686_0029938 | |||
| 1845 | Ga0495686_0042056 | |||
| 1846 | Ga0495686_0248449 | |||
| 1847 | Ga0495686_0254178 | |||
| 1848 | Ga0495686_0377163 | |||
| 1849 | Ga0495686_0686152 | |||
| 1850 | Ga0496100_0082969 | |||
| 1851 | Ga0496100_0182282 | |||
| 1852 | Ga0496100_1223371 | |||
| 1853 | Ga0496101_0111668 | |||
| 1854 | Ga0496101_0138327 | |||
| 1855 | Ga0496101_0333953 | |||
| 1856 | Ga0496101_0346342 | |||
| 1857 | Ga0496102_0000069 | |||
| 1858 | Ga0496102_0000615 | |||
| 1859 | Ga0496102_0172254 | |||
| 1860 | Ga0496102_0298555 | |||
| 1861 | Ga0496102_0681373 | |||
| 1862 | Ga0496103_0000173 | |||
| 1863 | Ga0496103_0009010 | |||
| 1864 | Ga0496103_0033025 | |||
| 1865 | Ga0496103_0132529 | |||
| 1866 | Ga0496103_0224202 | |||
| 1867 | Ga0496103_0651014 | |||
| 1868 | Ga0496104_0000081 | |||
| 1869 | Ga0496104_0059792 | |||
| 1870 | Ga0496105_0000034 | |||
| 1871 | Ga0496105_0090922 | |||
| 1872 | Ga0496105_0363545 | |||
| 1873 | Ga0496105_0615800 | |||
| 1874 | Ga0496106_0076352 | |||
| 1875 | Ga0496106_0168900 | |||
| 1876 | Ga0496106_0222120 | |||
| 1877 | Ga0496107_0173558 | |||
| 1878 | Ga0496107_0252341 | |||
| 1879 | Ga0496109_0067327 | |||
| 1880 | Ga0496109_0116418 | |||
| 1881 | Ga0496109_0353061 | |||
| 1882 | Ga0496109_0539887 | |||
| 1883 | Ga0496110_0093856 | |||
| 1884 | Ga0496110_0124785 | |||
| 1885 | Ga0496110_0325345 | |||
| 1886 | Ga0496110_1131155 | |||
| 1887 | Ga0496111_0328540 | |||
| 1888 | Ga0496111_0458563 | |||
| 1889 | Ga0496112_0116278 | |||
| 1890 | Ga0496112_0663427 | |||
| 1891 | Ga0496113_0000101 | |||
| 1892 | Ga0496113_0366514 | |||
| 1893 | Ga0496113_1445932 | |||
| 1894 | Ga0496115_0001129 | |||
| 1895 | Ga0496115_0108956 | |||
| 1896 | Ga0496115_1026514 | |||
| 1897 | Ga0496116_0000062 | |||
| 1898 | Ga0496116_0000566 | |||
| 1899 | Ga0496116_0032138 | |||
| 1900 | Ga0496116_0050745 | |||
| 1901 | Ga0496116_0101176 | |||
| 1902 | Ga0496116_0361464 | |||
| 1903 | Ga0496117_0000146 | |||
| 1904 | Ga0496117_0000485 | |||
| 1905 | Ga0496117_0033071 | |||
| 1906 | Ga0496117_0046000 | |||
| 1907 | Ga0496117_0055578 | |||
| 1908 | Ga0496117_0089533 | |||
| 1909 | Ga0496117_0251385 | |||
| 1910 | Ga0496117_0312713 | |||
| 1911 | Ga0496117_0318261 | |||
| 1912 | Ga0496117_0330651 | |||
| 1913 | Ga0496118_0000190 | |||
| 1914 | Ga0496118_0003742 | |||
| 1915 | Ga0496118_0015425 | |||
| 1916 | Ga0496118_0015970 | |||
| 1917 | Ga0496118_0057773 | |||
| 1918 | Ga0496118_0076829 | |||
| 1919 | Ga0496118_0079363 | |||
| 1920 | Ga0496118_0104776 | |||
| 1921 | Ga0496118_0127031 | |||
| 1922 | Ga0496118_0139050 | |||
| 1923 | Ga0496118_0370348 | |||
| 1924 | Ga0496119_0000057 | |||
| 1925 | Ga0496119_0072971 | |||
| 1926 | Ga0496119_0180016 | |||
| 1927 | Ga0496119_0186126 | |||
| 1928 | Ga0496119_0313654 | |||
| 1929 | Ga0496120_0005360 | |||
| 1930 | Ga0496120_0110614 | |||
| 1931 | Ga0496120_0178484 | |||
| 1932 | Ga0496120_0185785 | |||
| 1933 | Ga0496120_0487953 | |||
| 1934 | Ga0496121_0005623 | |||
| 1935 | Ga0496121_0010499 | |||
| 1936 | Ga0496121_0015601 | |||
| 1937 | Ga0496121_0016723 | |||
| 1938 | Ga0496121_0017016 | |||
| 1939 | Ga0496121_0058069 | |||
| 1940 | Ga0496121_0115314 | |||
| 1941 | Ga0496121_0180678 | |||
| 1942 | Ga0496121_0205134 | |||
| 1943 | Ga0496121_0568689 | |||
| 1944 | Ga0496121_0907952 | |||
| 1945 | Ga0496122_0000723 | |||
| 1946 | Ga0496122_0003556 | |||
| 1947 | Ga0496122_0006671 | |||
| 1948 | Ga0496122_0026134 | |||
| 1949 | Ga0496122_0366886 | |||
| 1950 | Ga0496122_0420631 | |||
| 1951 | Ga0496123_0000545 | |||
| 1952 | Ga0496123_0002968 | |||
| 1953 | Ga0496123_0016815 | |||
| 1954 | Ga0496123_0062259 | |||
| 1955 | Ga0496123_0235440 | |||
| 1956 | Ga0496124_0000546 | |||
| 1957 | Ga0496124_0000874 | |||
| 1958 | Ga0496124_0002439 | |||
| 1959 | Ga0496124_0006061 | |||
| 1960 | Ga0496124_0023588 | |||
| 1961 | Ga0496124_0023873 | |||
| 1962 | Ga0496124_0081473 | |||
| 1963 | Ga0496124_0299780 | |||
| 1964 | Ga0496124_0474242 | |||
| 1965 | Ga0496124_0507938 | |||
| 1966 | Ga0496124_0805486 | |||
| 1967 | Ga0496125_0002465 | |||
| 1968 | Ga0496125_0006988 | |||
| 1969 | Ga0496125_0033431 | |||
| 1970 | Ga0496125_0034343 | |||
| 1971 | Ga0496125_0071024 | |||
| 1972 | Ga0496125_0355978 | |||
| 1973 | Ga0496125_0415581 | |||
| 1974 | Ga0496125_0439744 | |||
| 1975 | Ga0496126_0000028 | |||
| 1976 | Ga0496126_0006838 | |||
| 1977 | Ga0496126_0016996 | |||
| 1978 | Ga0496126_0034229 | |||
| 1979 | Ga0496126_0054886 | |||
| 1980 | Ga0496126_0121519 | |||
| 1981 | Ga0496126_0150910 | |||
| 1982 | Ga0496126_0372477 | |||
| 1983 | Ga0496126_0632782 | |||
| 1984 | Ga0496126_1231595 | |||
| 1985 | Ga0495678_014836 | |||
| 1986 | Ga0495682_0279655 | |||
| 1987 | Ga0501290_000237 | |||
| 1988 | Ga0501292_000042 | |||
| 1989 | Ga0501294_000032 | |||
| 1990 | Ga0501297_009582 | |||
| 1991 | Ga0501300_000392 | |||
| 1992 | Ga0501302_002270 | |||
| 1993 | Ga0501315_000962 | |||
| 1994 | Ga0501317_002915 | |||
| 1995 | Ga0501318_049501 | |||
| 1996 | Ga0501321_023679 | |||
| 1997 | Ga0501335_000615 | |||
| 1998 | Ga0501337_013057 | |||
| 1999 | Ga0501033_0085723 | |||
| 2000 | Ga0501034_0099962 | |||
| 2001 | Ga0501034_0285394 | |||
| 2002 | Ga0501038_0164937 | |||
| 2003 | Ga0501038_0323317 | |||
| 2004 | Ga0501038_0770013 | |||
| 2005 | Ga0501041_0866607 | |||
| 2006 | Ga0501042_0040621 | |||
| 2007 | Ga0501042_0260954 | |||
| 2008 | Ga0501043_0113159 | |||
| 2009 | Ga0501046_0030454 | |||
| 2010 | Ga0501047_0000731 | |||
| 2011 | Ga0501047_0450251 | |||
| 2012 | Ga0501047_0935022 | |||
| 2013 | Ga0501070_0968333 | |||
| 2014 | Ga0501071_0191090 | |||
| 2015 | Ga0501071_1187966 | |||
| 2016 | Ga0501073_0139551 | |||
| 2017 | Ga0501074_0761420 | |||
| 2018 | Ga0501075_0834129 | |||
| 2019 | Ga0501076_0426670 | |||
| 2020 | Ga0501076_1405930 | |||
| 2021 | Ga0501077_0216387 | |||
| 2022 | Ga0501206_003378 | |||
| 2023 | Ga0501211_000103 | |||
| 2024 | Ga0501222_001746 | |||
| 2025 | Ga0501223_004016 | |||
| 2026 | Ga0501223_036809 | |||
| 2027 | Ga0501224_000754 | |||
| 2028 | Ga0501227_028030 | |||
| 2029 | Ga0501233_012436 | |||
| 2030 | Ga0501235_001097 | |||
| 2031 | Ga0501236_053975 | |||
| 2032 | Ga0501259_001391 | |||
| 2033 | Ga0501261_000021 | |||
| 2034 | Ga0501221_003846 | |||
| 2035 | Ga0501225_0006973 | |||
| 2036 | Ga0501225_0043405 | |||
| 2037 | Ga0501079_0374717 | |||
| 2038 | Ga0501080_0702389 | |||
| 2039 | Ga0501083_0271764 | |||
| 2040 | Ga0501083_0292932 | |||
| 2041 | Ga0501264_008163 | |||
| 2042 | Ga0501276_013553 | |||
| 2043 | Ga0501279_000010 | |||
| 2044 | Ga0501280_000064 | |||
| 2045 | Ga0501280_001057 | |||
| 2046 | Ga0501281_00086 | |||
| 2047 | Ga0501282_000404 | |||
| 2048 | Ga0501283_001453 | |||
| 2049 | Ga0501035_0179700 | |||
| 2050 | Ga0501035_0244287 | |||
| 2051 | Ga0501035_1048316 | |||
| 2052 | Ga0501044_0134255 | |||
| 2053 | Ga0501044_0204047 | |||
| 2054 | Ga0501044_0896240 | |||
| 2055 | Ga0501226_021697 | |||
| 2056 | Ga0501284_02268 | |||
| 2057 | nmdc:mga03n38_266481_c1 | |||
| 2058 | nmdc:mga00v17_75476_c1 | |||
| 2059 | nmdc:mga00v17_911672_c1 | |||
| 2060 | nmdc:mga0k408_344198_c1 | |||
| 2061 | nmdc:mga0k408_529690_c1 | |||
| 2062 | nmdc:mga0k408_583414_c1 | |||
| 2063 | nmdc:mga0k408_832522_c1 | |||
| 2064 | nmdc:mga06z11_17_c1 | |||
| 2065 | nmdc:mga04h51_146_c1 | |||
| 2066 | nmdc:mga04h51_411911_c1 | |||
| 2067 | nmdc:mga07m45_111328_c1 | |||
| 2068 | nmdc:mga07m45_567769_c1 | |||
| 2069 | nmdc:mga07m45_60295_c1 | |||
| 2070 | nmdc:mga05p37_171786_c1 | |||
| 2071 | nmdc:mga05p37_2021674_c1 | |||
| 2072 | Ga0500643_010906 | |||
| 2073 | Ga0500647_0376821 | |||
| 2074 | Ga0500651_0086862 | |||
| 2075 | Ga0500566_0004538 | |||
| 2076 | Ga0500641_0004173 | |||
| 2077 | Ga0500641_0136367 | |||
| 2078 | Ga0500556_0189304 | |||
| 2079 | Ga0500562_070755 | |||
| 2080 | Ga0500592_000031 | |||
| 2081 | Ga0500592_001156 | |||
| 2082 | Ga0500594_0054708 | |||
| 2083 | Ga0500595_000572 | |||
| 2084 | Ga0500595_052569 | |||
| 2085 | Ga0500595_055810 | |||
| 2086 | Ga0500608_066104 | |||
| 2087 | Ga0500618_014810 | |||
| 2088 | Ga0500626_092170 | |||
| 2089 | Ga0500642_0014296 | |||
| 2090 | Ga0500652_278543 | |||
| 2091 | Ga0500655_000251 | |||
| 2092 | Ga0500658_0010885 | |||
| 2093 | Ga0500658_0014446 | |||
| 2094 | Ga0500658_0267841 | |||
| 2095 | Ga0500658_0476850 | |||
| 2096 | Ga0500559_0159324 | |||
| 2097 | Ga0500559_0232776 | |||
| 2098 | Ga0500564_386623 | |||
| 2099 | Ga0500568_0018906 | |||
| 2100 | Ga0500568_0092427 | |||
| 2101 | Ga0500568_0195118 | |||
| 2102 | Ga0500588_0071841 | |||
| 2103 | Ga0500590_000131 | |||
| 2104 | Ga0500604_0036484 | |||
| 2105 | Ga0500604_0071415 | |||
| 2106 | Ga0500616_0008241 | |||
| 2107 | Ga0500616_0222499 | |||
| 2108 | Ga0500616_0284202 | |||
| 2109 | Ga0500616_0291538 | |||
| 2110 | Ga0500622_0025695 | |||
| 2111 | Ga0500622_0077848 | |||
| 2112 | Ga0500622_0091256 | |||
| 2113 | Ga0500624_000063 | |||
| 2114 | Ga0500627_0001223 | |||
| 2115 | Ga0500627_0027041 | |||
| 2116 | Ga0500627_0378067 | |||
| 2117 | Ga0500639_139272 | |||
| 2118 | Ga0500636_0058873 | |||
| 2119 | Ga0500570_004079 | |||
| 2120 | Ga0500645_180888 | |||
| 2121 | Ga0500645_223100 | |||
| 2122 | Ga0500601_034828 | |||
| 2123 | Ga0501084_0791318 | |||
| 2124 | Ga0587066_169647 | |||
| 2125 | Ga0587077_168426 | |||
| 2126 | Ga0587088_134191 | |||
| 2127 | Ga0587094_030537 | |||
| 2128 | Ga0587067_076756 | |||
| 2129 | Ga0587069_140777 | |||
| 2130 | Ga0501082_0979656 | |||
| 2131 | 2511130325 | |||
| 2132 | 2523469825 | |||
| 2133 | 2585262260 | |||
| 2134 | 2600225503 | |||
| 2135 | 2643731598 | |||
| 2136 | 2644036775 | |||
| 2137 | 2644042074 | |||
| 2138 | 2644126038 | |||
| 2139 | 2644394283 | |||
| 2140 | 2738709615 | |||
| 2141 | 2738848040 | |||
| 2142 | 2738863769 | |||
| 2143 | 2739296287 | |||
| 2144 | 2739348858 | |||
| 2145 | 2739357965 | |||
| 2146 | 2819713935 | |||
| 2147 | 2879165166 | |||
| 2148 | 2917557483 | |||
| 2149 | 2928528495 | |||
| 2150 | 2928960419 | |||
| 2151 | 2928970040 | |||
| 2152 | 2990266882 | |||
| 2153 | 2993693827 | |||
| 2154 | 8054303052 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nfl-assembly1.cif.gz_A | crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. | 0.8816 | 4 | 77 |
| 5nfl-assembly1.cif.gz_A | crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. | 0.8709 | 4 | 77 |
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.831 | 3 | 76 |
| 1v60-assembly1.cif.gz_A | solution structure of bola1 protein from mus musculus | 0.8119 | 6 | 76 |
| 3o2e-assembly1.cif.gz_A | crystal structure of a bol-like protein from babesia bovis | 0.8104 | 3 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5nflA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8816 | 4 | 77 | 3.30.300.90 |
| 5nflA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8709 | 4 | 77 | 3.30.300.90 |
| af_Q53S33_27_107_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8547 | 8 | 77 | 3.30.300.90 |
| af_P53082_9_118_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.8508 | 1 | 75 | 3.10.20.90 |
| af_Q54GP0_1_85_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8479 | 3 | 75 | 3.30.300.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258E1I0-F1-model_v4 | BolA family transcriptional regulator | 0.9824 | 1 | 77 |
|
| AF-A0A357LA00-F1-model_v4 | BolA family transcriptional regulator | 0.976 | 1 | 77 |
|
| AF-A0A5C8PQA4-F1-model_v4 | BolA family transcriptional regulator | 0.9741 | 1 | 77 |
|
| AF-A0A1G3ISV3-F1-model_v4 | ATP-binding protein | 0.9714 | 1 | 57 |
GO:0005524
|
| AF-A0A0S6X249-F1-model_v4 | BolA-like protein | 0.9686 | 1 | 76 |
|