F489604

General Info

Members Datasets Scaffolds Average Seq Length
1077 454 2154 77

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0153792|Ga0436363_0153792_577_834
Length 85
Sequence MPMAASEIEAAIVAALPGAVVTITDLAGDGDHYRAHVVAAGFAGLSRVKQHQLVYNALSGRMGGVLHALQLTTAVPGTAPEGVSA

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
209 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
238 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
239 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
240 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
241 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
242 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
243 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
244 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
247 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
248 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
249 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
250 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
251 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
252 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
255 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
256 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
257 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
258 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
259 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
260 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
261 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
262 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
263 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
273 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
291 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
296 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
329 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
330 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
331 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
332 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
333 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
334 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
335 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
336 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
358 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
359 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
360 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
361 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
362 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
363 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
364 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
365 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
366 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
367 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
368 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
369 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
370 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
374 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
375 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
376 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
377 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
378 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
379 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
383 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
392 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
393 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
394 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
395 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
396 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
397 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
398 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
399 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
400 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
401 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
402 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
403 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
404 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
405 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
406 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
407 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
408 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
409 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
410 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
411 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
412 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
413 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
414 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
415 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
416 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
417 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
418 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
419 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
420 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
421 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
422 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
423 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
424 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
431 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
432 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
433 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
434 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
435 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
436 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
437 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
438 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
439 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
440 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
441 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
442 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
443 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
444 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
445 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
446 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
447 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
448 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
449 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
450 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
451 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
452 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
453 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
454 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 1.3
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 11.88
Nodule 0
Rhizoplane 4.92
Rhizosphere 71.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0153792 3300039450 Bacteria 1691
2 SwRhRL2b_contig_14491 2162886007 Bacteria 5668
3 ARcpr5yngRDRAFT_c004470 3300000043 Bacteria 1323
4 ARCol0yngRDRAFT_1009092 3300000652 Bacteria 718
5 JGI24736J21556_1000613 3300001904 Bacteria 6542
6 JGI24741J21665_1000366 3300001915 Bacteria 13487
7 JGI24752J21851_1006793 3300001976 Bacteria 1495
8 JGI24740J21852_10005104 3300001979 Bacteria 5575
9 JGI24740J21852_10044246 3300001979 Bacteria 1322
10 JGI24739J22299_10005319 3300001989 Bacteria 4903
11 JGI24739J22299_10006470 3300001989 Bacteria 4419
12 JGI24739J22299_10110044 3300001989 Bacteria 827
13 JGI24739J22299_10112626 3300001989 Bacteria 816
14 JGI24739J22299_10159140 3300001989 Bacteria 667
15 JGI24737J22298_10015406 3300001990 Bacteria 2474
16 JGI24737J22298_10020406 3300001990 Bacteria 2115
17 JGI24737J22298_10048588 3300001990 Bacteria 1291
18 JGI24737J22298_10132662 3300001990 Bacteria 736
19 JGI24737J22298_10186610 3300001990 Bacteria 612
20 JGI24743J22301_10030394 3300001991 Bacteria 1062
21 JGI24743J22301_10113531 3300001991 Bacteria 590
22 JGI24735J21928_10000590 3300002067 Bacteria 12771
23 JGI24735J21928_10004614 3300002067 Bacteria 4616
24 JGI24735J21928_10004932 3300002067 Bacteria 4449
25 JGI24735J21928_10015755 3300002067 Bacteria 2353
26 JGI24735J21928_10018807 3300002067 Bacteria 2128
27 JGI24735J21928_10041906 3300002067 Bacteria 1334
28 JGI24735J21928_10058528 3300002067 Bacteria 1109
29 JGI24735J21928_10059101 3300002067 Bacteria 1102
30 JGI24735J21928_10135297 3300002067 Bacteria 711
31 JGI24735J21928_10202768 3300002067 Bacteria 575
32 JGI24748J21848_1005228 3300002074 Bacteria 1502
33 JGI24748J21848_1057374 3300002074 Bacteria 516
34 JGI24738J21930_10000184 3300002075 Bacteria 16152
35 JGI24738J21930_10000231 3300002075 Bacteria 15154
36 JGI24738J21930_10001740 3300002075 Bacteria 5944
37 JGI24738J21930_10015275 3300002075 Bacteria 1636
38 JGI24749J21850_1000049 3300002076 Bacteria 22639
39 JGI24744J21845_10008674 3300002077 Bacteria 2089
40 JGI24035J26624_1026616 3300002126 Bacteria 622
41 JGI24034J26672_10003845 3300002239 Bacteria 2109
42 JGI24034J26672_10041405 3300002239 Bacteria 774
43 JGI24751J29686_10000216 3300002459 Bacteria 24503
44 JGI24751J29686_10018164 3300002459 Bacteria 1454
45 JGI25164J39214_1007846 3300002772 Bacteria 1076
46 JGI25150J39212_1002047 3300002774 Bacteria 5243
47 JGI25151J46595_10122326 3300003187 Bacteria 661
48 JGI25165J46597_1000043 3300003214 Bacteria 264515
49 JGI25153J46596_10000395 3300003215 Bacteria 29365
50 JGI25153J46596_10002504 3300003215 Bacteria 10546
51 rootH1_10113314 3300003316 Bacteria 1254
52 rootH1_10035136 3300003323 Bacteria 3354
53 Ga0055529_1042867 3300003763 Bacteria 546
54 Ga0055537_1001019 3300003773 Bacteria 12668
55 Ga0055524_1000056 3300003775 Bacteria 141764
56 Ga0055528_1020848 3300003790 Bacteria 2108
57 Ga0055530_10000931 3300003791 Bacteria 23980
58 Ga0055530_10007314 3300003791 Bacteria 4682
59 Ga0055540_1002064 3300003792 Bacteria 11085
60 Ga0055531_10012617 3300003794 Bacteria 3963
61 Ga0055531_10015017 3300003794 Bacteria 3443
62 Ga0065165_1005029 3300005262 Bacteria 7727
63 Ga0065165_1009273 3300005262 Bacteria 4438
64 Ga0065165_1017463 3300005262 Bacteria 2643
65 Ga0065165_1062777 3300005262 Bacteria 1012
66 Ga0065714_10116065 3300005288 Bacteria 1408
67 Ga0065704_10070504 3300005289 Bacteria 22276
68 Ga0065707_10000505 3300005295 Bacteria 50569
69 Ga0065707_10086198 3300005295 Bacteria 5602
70 Ga0065707_10135500 3300005295 Bacteria 1848
71 Ga0065707_10212812 3300005295 Bacteria 1258
72 Ga0065707_10371722 3300005295 Bacteria 889
73 Ga0065707_10414622 3300005295 Bacteria 837
74 Ga0065707_10938111 3300005295 Bacteria 556
75 Ga0070658_10006525 3300005327 Bacteria 9464
76 Ga0070658_10068992 3300005327 Bacteria 2891
77 Ga0070658_10097157 3300005327 Bacteria 2432
78 Ga0070658_10584581 3300005327 Bacteria 967
79 Ga0070658_10669238 3300005327 Bacteria 901
80 Ga0070658_11102012 3300005327 Bacteria 691
81 Ga0070676_10000230 3300005328 Bacteria 23872
82 Ga0070683_100195033 3300005329 Bacteria 1923
83 Ga0070670_100000003 3300005331 Bacteria 529510
84 Ga0070670_100002377 3300005331 Bacteria 15504
85 Ga0070670_100004170 3300005331 Bacteria 12090
86 Ga0070670_100126344 3300005331 Bacteria 2207
87 Ga0070670_100189232 3300005331 Bacteria 1787
88 Ga0070677_10801344 3300005333 Bacteria 538
89 Ga0068869_100000200 3300005334 Bacteria 31213
90 Ga0070666_10000184 3300005335 Bacteria 42807
91 Ga0070666_10033483 3300005335 Bacteria 3400
92 Ga0070666_10257671 3300005335 Bacteria 1236
93 Ga0070682_100302630 3300005337 Bacteria 1174
94 Ga0068868_100001398 3300005338 Bacteria 16647
95 Ga0070660_100004583 3300005339 Bacteria 9552
96 Ga0070660_100070534 3300005339 Bacteria 2727
97 Ga0070660_100209408 3300005339 Bacteria 1582
98 Ga0070660_100996905 3300005339 Bacteria 708
99 Ga0070661_100581848 3300005344 Bacteria 903
100 Ga0070661_101005335 3300005344 Bacteria 692
101 Ga0070668_100000026 3300005347 Bacteria 92584
102 Ga0070668_100000080 3300005347 Bacteria 60157
103 Ga0070668_100018364 3300005347 Bacteria 5250
104 Ga0070668_100027483 3300005347 Bacteria 4320
105 Ga0070668_100208292 3300005347 Bacteria 1607
106 Ga0070668_100408180 3300005347 Bacteria 1161
107 Ga0070668_100428915 3300005347 Bacteria 1133
108 Ga0070669_100000008 3300005353 Bacteria 226764
109 Ga0070669_100000020 3300005353 Bacteria 181297
110 Ga0070669_100000082 3300005353 Bacteria 91465
111 Ga0070669_100096603 3300005353 Bacteria 2223
112 Ga0070675_100006627 3300005354 Bacteria 8902
113 Ga0070671_100000015 3300005355 Bacteria 166132
114 Ga0070671_100000169 3300005355 Bacteria 43010
115 Ga0070671_100000470 3300005355 Bacteria 28105
116 Ga0070671_100013092 3300005355 Bacteria 6684
117 Ga0070671_100053502 3300005355 Bacteria 3356
118 Ga0070674_100051002 3300005356 Bacteria 2849
119 Ga0070673_100000006 3300005364 Bacteria 184299
120 Ga0070673_101154028 3300005364 Bacteria 725
121 Ga0070688_100464942 3300005365 Bacteria 948
122 Ga0070659_100052995 3300005366 Bacteria 3192
123 Ga0070659_100899434 3300005366 Bacteria 774
124 Ga0070659_101485301 3300005366 Bacteria 604
125 Ga0070659_101711550 3300005366 Bacteria 562
126 Ga0070667_100000019 3300005367 Bacteria 224710
127 Ga0070667_100006367 3300005367 Bacteria 9810
128 Ga0070667_100037194 3300005367 Bacteria 4081
129 Ga0070667_100038717 3300005367 Bacteria 3998
130 Ga0070667_100681738 3300005367 Bacteria 950
131 Ga0070705_100054779 3300005440 Bacteria 2341
132 Ga0070705_100448402 3300005440 Bacteria 967
133 Ga0070708_100198374 3300005445 Bacteria 1878
134 Ga0070708_101344162 3300005445 Bacteria 667
135 Ga0070663_100000574 3300005455 Bacteria 19656
136 Ga0070663_100002941 3300005455 Bacteria 9696
137 Ga0070663_101387399 3300005455 Bacteria 622
138 Ga0070678_100552397 3300005456 Bacteria 1022
139 Ga0070662_100007108 3300005457 Bacteria 7246
140 Ga0070662_100094062 3300005457 Bacteria 2256
141 Ga0070662_100561610 3300005457 Bacteria 957
142 Ga0070662_100819864 3300005457 Bacteria 791
143 Ga0070662_101003480 3300005457 Bacteria 715
144 Ga0068867_100000001 3300005459 Bacteria 427563
145 Ga0070685_10103920 3300005466 Bacteria 1739
146 Ga0070685_10368722 3300005466 Bacteria 986
147 Ga0070707_101322160 3300005468 Bacteria 687
148 Ga0070679_100158874 3300005530 Bacteria 2235
149 Ga0070679_100424436 3300005530 Bacteria 1275
150 Ga0070684_100251597 3300005535 Bacteria 1615
151 Ga0068853_100143479 3300005539 Bacteria 2145
152 Ga0068853_100881719 3300005539 Bacteria 859
153 Ga0068853_100884100 3300005539 Bacteria 858
154 Ga0068853_102321716 3300005539 Bacteria 520
155 Ga0070672_100004199 3300005543 Bacteria 9412
156 Ga0070686_100290882 3300005544 Bacteria 1208
157 Ga0070665_100002434 3300005548 Bacteria 20520
158 Ga0070665_100009702 3300005548 Bacteria 9728
159 Ga0070665_100095381 3300005548 Bacteria 2980
160 Ga0070665_100378831 3300005548 Bacteria 1422
161 Ga0070665_100420653 3300005548 Bacteria 1345
162 Ga0070665_100895973 3300005548 Bacteria 900
163 Ga0070665_101432299 3300005548 Bacteria 700
164 Ga0068855_100218364 3300005563 Bacteria 2139
165 Ga0068855_100577260 3300005563 Bacteria 1215
166 Ga0068855_101048138 3300005563 Bacteria 855
167 Ga0068855_101587902 3300005563 Bacteria 670
168 Ga0068855_102121698 3300005563 Bacteria 566
169 Ga0068857_100021366 3300005577 Bacteria 5697
170 Ga0068857_100637109 3300005577 Bacteria 1009
171 Ga0068857_100711507 3300005577 Bacteria 955
172 Ga0068854_100000483 3300005578 Bacteria 24310
173 Ga0068854_100301862 3300005578 Bacteria 1296
174 Ga0068854_100538554 3300005578 Bacteria 988
175 Ga0068854_101277453 3300005578 Bacteria 660
176 Ga0068856_100003591 3300005614 Bacteria 15606
177 Ga0068856_100020542 3300005614 Bacteria 6414
178 Ga0068856_100312622 3300005614 Bacteria 1589
179 Ga0068852_100028295 3300005616 Bacteria 4585
180 Ga0068852_100608851 3300005616 Bacteria 1097
181 Ga0068852_101516957 3300005616 Bacteria 692
182 Ga0068859_100003505 3300005617 Bacteria 15985
183 Ga0068859_100023533 3300005617 Bacteria 6181
184 Ga0068859_100034581 3300005617 Bacteria 5071
185 Ga0068859_100216629 3300005617 Bacteria 2002
186 Ga0068859_100679313 3300005617 Bacteria 1121
187 Ga0068859_100859376 3300005617 Bacteria 993
188 Ga0068864_100000005 3300005618 Bacteria 400840
189 Ga0068864_100030140 3300005618 Bacteria 4598
190 Ga0068864_100466728 3300005618 Bacteria 1210
191 Ga0068861_100004980 3300005719 Bacteria 8951
192 Ga0068861_100154977 3300005719 Bacteria 1883
193 Ga0068851_10074177 3300005834 Bacteria 1765
194 Ga0068863_100000001 3300005841 Bacteria 581116
195 Ga0068863_100000582 3300005841 Bacteria 37202
196 Ga0068863_100067996 3300005841 Bacteria 3370
197 Ga0068863_100084694 3300005841 Bacteria 3004
198 Ga0068863_100137511 3300005841 Bacteria 2334
199 Ga0068863_100313791 3300005841 Bacteria 1522
200 Ga0068858_100010355 3300005842 Bacteria 8831
201 Ga0068858_100034454 3300005842 Bacteria 4697
202 Ga0068858_100380650 3300005842 Bacteria 1354
203 Ga0068860_100000036 3300005843 Bacteria 234917
204 Ga0068860_100001081 3300005843 Bacteria 30047
205 Ga0068860_100004358 3300005843 Bacteria 14457
206 Ga0068860_100044110 3300005843 Bacteria 4251
207 Ga0068860_100115216 3300005843 Bacteria 2570
208 Ga0068860_100263556 3300005843 Bacteria 1680
209 Ga0068860_100310382 3300005843 Bacteria 1546
210 Ga0068860_102676641 3300005843 Bacteria 517
211 Ga0068862_100000001 3300005844 Bacteria 523031
212 Ga0068862_100000169 3300005844 Bacteria 72633
213 Ga0068862_100001451 3300005844 Bacteria 21840
214 Ga0068862_100006085 3300005844 Bacteria 10046
215 Ga0068862_100021177 3300005844 Bacteria 5435
216 Ga0068862_100049285 3300005844 Bacteria 3597
217 Ga0068862_100087044 3300005844 Bacteria 2717
218 Ga0068862_101234307 3300005844 Bacteria 747
219 Ga0081455_10000255 3300005937 Bacteria 69927
220 Ga0081455_10023602 3300005937 Bacteria 5720
221 Ga0081538_10004148 3300005981 Bacteria 13446
222 Ga0081538_10036760 3300005981 Bacteria 3188
223 Ga0075364_10197055 3300006051 Bacteria 1365
224 Ga0075364_10888517 3300006051 Bacteria 607
225 Ga0075366_10043167 3300006195 Bacteria 2671
226 Ga0075366_10245806 3300006195 Bacteria 1091
227 Ga0075366_10576769 3300006195 Bacteria 697
228 Ga0075366_10726065 3300006195 Bacteria 617
229 Ga0075366_10801680 3300006195 Bacteria 586
230 Ga0097621_100001076 3300006237 Bacteria 19102
231 Ga0075370_10043587 3300006353 Bacteria 2536
232 Ga0075370_10637142 3300006353 Bacteria 647
233 Ga0068871_100067527 3300006358 Bacteria 2934
234 Ga0068871_101210368 3300006358 Bacteria 709
235 Ga0068865_100000003 3300006881 Bacteria 231761
236 Ga0097620_100003505 3300006931 Bacteria 15985
237 Ga0097620_100023532 3300006931 Bacteria 6181
238 Ga0097620_100034580 3300006931 Bacteria 5071
239 Ga0097620_100216626 3300006931 Bacteria 2002
240 Ga0097620_100679134 3300006931 Bacteria 1121
241 Ga0097620_100859461 3300006931 Bacteria 993
242 Ga0105251_10012362 3300009011 Bacteria 4831
243 Ga0105251_10638162 3300009011 Bacteria 508
244 Ga0105244_10606409 3300009036 Bacteria 501
245 Ga0105250_10006517 3300009092 Bacteria 5096
246 Ga0105240_10015679 3300009093 Bacteria 10290
247 Ga0105240_10025126 3300009093 Bacteria 7835
248 Ga0105240_10091793 3300009093 Bacteria 3709
249 Ga0105240_10318721 3300009093 Bacteria 1773
250 Ga0105240_10744819 3300009093 Bacteria 1066
251 Ga0105240_12089073 3300009093 Bacteria 588
252 Ga0105245_10000113 3300009098 Bacteria 78545
253 Ga0105245_10032215 3300009098 Bacteria 4641
254 Ga0105247_10001891 3300009101 Bacteria 14614
255 Ga0105247_10369422 3300009101 Bacteria 1014
256 Ga0105243_10000373 3300009148 Bacteria 48115
257 Ga0105243_10328860 3300009148 Bacteria 1395
258 Ga0105243_10942050 3300009148 Bacteria 862
259 Ga0105241_10038453 3300009174 Bacteria 3607
260 Ga0105241_10707420 3300009174 Bacteria 920
261 Ga0105242_10000165 3300009176 Bacteria 49974
262 Ga0105248_10001558 3300009177 Bacteria 25511
263 Ga0105248_10024425 3300009177 Bacteria 6720
264 Ga0105248_10043233 3300009177 Bacteria 5052
265 Ga0105248_10088281 3300009177 Bacteria 3490
266 Ga0105248_13138180 3300009177 Bacteria 526
267 Ga0105237_10044206 3300009545 Bacteria 4485
268 Ga0105237_11408470 3300009545 Bacteria 703
269 Ga0105237_11679876 3300009545 Bacteria 642
270 Ga0105237_12603792 3300009545 Bacteria 516
271 Ga0105238_10635331 3300009551 Bacteria 1077
272 Ga0105238_11154457 3300009551 Bacteria 798
273 Ga0105238_11442421 3300009551 Bacteria 716
274 Ga0105249_10000045 3300009553 Bacteria 182927
275 Ga0105249_10019753 3300009553 Bacteria 6016
276 Ga0105249_10037409 3300009553 Bacteria 4404
277 Ga0105249_10084345 3300009553 Bacteria 2959
278 Ga0105249_10265973 3300009553 Bacteria 1706
279 Ga0105249_10758182 3300009553 Bacteria 1033
280 Ga0105239_10000367 3300010375 Bacteria 66191
281 Ga0105239_10012172 3300010375 Bacteria 9592
282 Ga0105239_10326543 3300010375 Bacteria 1730
283 Ga0105239_10846266 3300010375 Bacteria 1049
284 Ga0105239_10931845 3300010375 Bacteria 997
285 Ga0105246_10001620 3300011119 Bacteria 13399
286 Ga0157326_1000423 3300012513 Bacteria 5017
287 Ga0157373_10081550 3300013100 Bacteria 2280
288 Ga0157373_10136804 3300013100 Bacteria 1723
289 Ga0157373_10232191 3300013100 Bacteria 1303
290 Ga0157371_10160163 3300013102 Bacteria 1607
291 Ga0157371_10492244 3300013102 Bacteria 905
292 Ga0157371_11482642 3300013102 Bacteria 529
293 Ga0157371_11598663 3300013102 Bacteria 510
294 Ga0157371_11604795 3300013102 Bacteria 509
295 Ga0157370_10000069 3300013104 Bacteria 112889
296 Ga0157370_10057965 3300013104 Bacteria 3681
297 Ga0157370_10174746 3300013104 Bacteria 1996
298 Ga0157370_10214812 3300013104 Bacteria 1782
299 Ga0157370_10647775 3300013104 Bacteria 966
300 Ga0157370_10971235 3300013104 Bacteria 770
301 Ga0157370_11695857 3300013104 Bacteria 567
302 Ga0157369_10012597 3300013105 Bacteria 9595
303 Ga0157369_10109686 3300013105 Bacteria 2934
304 Ga0157369_10173906 3300013105 Bacteria 2268
305 Ga0157369_10174888 3300013105 Bacteria 2260
306 Ga0157369_12006581 3300013105 Bacteria 587
307 Ga0157369_12357748 3300013105 Bacteria 539
308 Ga0157374_10100942 3300013296 Bacteria 2766
309 Ga0157374_10393274 3300013296 Bacteria 1382
310 Ga0157374_10432242 3300013296 Bacteria 1316
311 Ga0157378_10002300 3300013297 Bacteria 16976
312 Ga0163162_10016081 3300013306 Bacteria 7314
313 Ga0163162_10019579 3300013306 Bacteria 6643
314 Ga0163162_10301457 3300013306 Bacteria 1734
315 Ga0163162_12257592 3300013306 Bacteria 625
316 Ga0163162_13217757 3300013306 Bacteria 524
317 Ga0157372_10113522 3300013307 Bacteria 3105
318 Ga0157372_10118609 3300013307 Bacteria 3036
319 Ga0157372_10209575 3300013307 Bacteria 2258
320 Ga0157372_10258817 3300013307 Bacteria 2021
321 Ga0157372_10288298 3300013307 Bacteria 1909
322 Ga0157372_10337590 3300013307 Bacteria 1755
323 Ga0157372_10567943 3300013307 Bacteria 1322
324 Ga0157372_10932088 3300013307 Bacteria 1007
325 Ga0157372_12775511 3300013307 Bacteria 562
326 Ga0157375_10041491 3300013308 Bacteria 4443
327 Ga0157375_10798349 3300013308 Bacteria 1093
328 Ga0163163_10030114 3300014325 Bacteria 5225
329 Ga0157380_10000029 3300014326 Bacteria 98248
330 Ga0157380_10001161 3300014326 Bacteria 17056
331 Ga0157380_10230670 3300014326 Bacteria 1663
332 Ga0157380_12204024 3300014326 Bacteria 615
333 Ga0182008_10307738 3300014497 Bacteria 831
334 Ga0157377_10067056 3300014745 Bacteria 2065
335 Ga0157379_10128162 3300014968 Bacteria 2283
336 Ga0157379_10770590 3300014968 Bacteria 906
337 Ga0157376_10000089 3300014969 Bacteria 69351
338 Ga0163161_10000101 3300017792 Bacteria 81604
339 Ga0163161_10019426 3300017792 Bacteria 4767
340 Ga0163161_10030597 3300017792 Bacteria 3833
341 Ga0163161_10148380 3300017792 Bacteria 1781
342 Ga0163161_11831506 3300017792 Bacteria 540
343 Ga0206356_11727543 3300020070 Bacteria 986
344 Ga0206352_10131959 3300020078 Bacteria 789
345 Ga0213876_10024618 3300021384 Bacteria 3178
346 Ga0213876_10601056 3300021384 Bacteria 585
347 Ga0213875_10009905 3300021388 Bacteria 4804
348 Ga0213875_10524352 3300021388 Bacteria 570
349 Ga0209147_103605 3300025229 Bacteria 2915
350 Ga0207427_101450 3300025231 Bacteria 8548
351 Ga0207425_1000041 3300025245 Bacteria 210441
352 Ga0207425_1015629 3300025245 Bacteria 1699
353 Ga0209026_1004345 3300025250 Bacteria 4244
354 Ga0209148_1000238 3300025254 Bacteria 87836
355 Ga0209148_1001034 3300025254 Bacteria 17391
356 Ga0209129_1002094 3300025258 Bacteria 10228
357 Ga0209233_1000079 3300025261 Bacteria 346944
358 Ga0209233_1073702 3300025261 Bacteria 625
359 Ga0209565_1000008 3300025263 Bacteria 774179
360 Ga0209565_1000134 3300025263 Bacteria 104013
361 Ga0209455_1000952 3300025272 Bacteria 14767
362 Ga0209455_1056735 3300025272 Bacteria 526
363 Ga0209673_1002352 3300025273 Bacteria 13340
364 Ga0209673_1029162 3300025273 Bacteria 1761
365 Ga0209675_1009250 3300025291 Bacteria 3499
366 Ga0209676_1026408 3300025292 Bacteria 1844
367 Ga0209025_1000068 3300025294 Bacteria 294129
368 Ga0209564_1080218 3300025295 Bacteria 640
369 Ga0209758_1000004 3300025297 Bacteria 1375322
370 Ga0209758_1012697 3300025297 Bacteria 4679
371 Ga0209050_1000001 3300025298 Bacteria 3563507
372 Ga0209050_1000581 3300025298 Bacteria 59224
373 Ga0209050_1000687 3300025298 Bacteria 50814
374 Ga0209050_1007158 3300025298 Bacteria 6354
375 Ga0209256_1000009 3300025299 Bacteria 922071
376 Ga0209256_1000010 3300025299 Bacteria 912110
377 Ga0207426_1037675 3300025302 Bacteria 1528
378 Ga0209051_1000191 3300025303 Bacteria 108763
379 Ga0209257_1000876 3300025304 Bacteria 42634
380 Ga0209257_1002353 3300025304 Bacteria 19010
381 Ga0209257_1002898 3300025304 Bacteria 15899
382 Ga0209257_1003401 3300025304 Bacteria 13704
383 Ga0209257_1037487 3300025304 Bacteria 1478
384 Ga0209257_1100855 3300025304 Bacteria 704
385 Ga0207697_10006525 3300025315 Bacteria 5267
386 Ga0207697_10530809 3300025315 Bacteria 518
387 Ga0207656_10012218 3300025321 Bacteria 3260
388 Ga0207656_10159701 3300025321 Bacteria 1072
389 Ga0207696_1007265 3300025711 Bacteria 4353
390 Ga0207713_1010142 3300025735 Bacteria 5236
391 Ga0207713_1036906 3300025735 Bacteria 2090
392 Ga0207710_10007240 3300025900 Bacteria 4701
393 Ga0207710_10012300 3300025900 Bacteria 3601
394 Ga0207710_10207976 3300025900 Bacteria 968
395 Ga0207710_10331102 3300025900 Bacteria 773
396 Ga0207688_10409565 3300025901 Bacteria 842
397 Ga0207688_10846280 3300025901 Bacteria 579
398 Ga0207688_11043763 3300025901 Bacteria 516
399 Ga0207680_10000010 3300025903 Bacteria 414170
400 Ga0207680_10000186 3300025903 Bacteria 30147
401 Ga0207680_10093912 3300025903 Bacteria 1914
402 Ga0207647_10000038 3300025904 Bacteria 94897
403 Ga0207647_10002647 3300025904 Bacteria 13526
404 Ga0207647_10032481 3300025904 Bacteria 3352
405 Ga0207647_10041942 3300025904 Bacteria 2874
406 Ga0207647_10065904 3300025904 Bacteria 2197
407 Ga0207647_10095073 3300025904 Bacteria 1774
408 Ga0207647_10207898 3300025904 Bacteria 1131
409 Ga0207647_10212165 3300025904 Bacteria 1118
410 Ga0207647_10283643 3300025904 Bacteria 945
411 Ga0207647_10393125 3300025904 Bacteria 782
412 Ga0207645_10003616 3300025907 Bacteria 11690
413 Ga0207705_10000121 3300025909 Bacteria 86649
414 Ga0207705_10000365 3300025909 Bacteria 41098
415 Ga0207705_10014470 3300025909 Bacteria 5679
416 Ga0207705_10135124 3300025909 Bacteria 1838
417 Ga0207705_10159690 3300025909 Bacteria 1693
418 Ga0207654_10000375 3300025911 Bacteria 25999
419 Ga0207654_10080510 3300025911 Bacteria 1959
420 Ga0207654_10098883 3300025911 Bacteria 1793
421 Ga0207695_10001183 3300025913 Bacteria 45024
422 Ga0207695_10016421 3300025913 Bacteria 8662
423 Ga0207695_10021724 3300025913 Bacteria 7315
424 Ga0207695_10031555 3300025913 Bacteria 5808
425 Ga0207695_10077775 3300025913 Bacteria 3368
426 Ga0207695_10223979 3300025913 Bacteria 1787
427 Ga0207695_10873246 3300025913 Bacteria 779
428 Ga0207671_10001192 3300025914 Bacteria 30866
429 Ga0207671_10027639 3300025914 Bacteria 4241
430 Ga0207671_11237598 3300025914 Bacteria 583
431 Ga0207671_11279455 3300025914 Bacteria 572
432 Ga0207662_11126671 3300025918 Bacteria 558
433 Ga0207657_10015487 3300025919 Bacteria 7387
434 Ga0207657_10026870 3300025919 Bacteria 5279
435 Ga0207657_10048996 3300025919 Bacteria 3685
436 Ga0207657_10387615 3300025919 Bacteria 1100
437 Ga0207657_11006315 3300025919 Bacteria 639
438 Ga0207649_10150506 3300025920 Bacteria 1602
439 Ga0207649_10167287 3300025920 Bacteria 1528
440 Ga0207649_10831047 3300025920 Bacteria 722
441 Ga0207649_11059835 3300025920 Bacteria 639
442 Ga0207652_10134787 3300025921 Bacteria 2205
443 Ga0207652_10286625 3300025921 Bacteria 1486
444 Ga0207681_10000002 3300025923 Bacteria 985597
445 Ga0207681_10000005 3300025923 Bacteria 555724
446 Ga0207681_10000109 3300025923 Bacteria 71373
447 Ga0207681_10000183 3300025923 Bacteria 51105
448 Ga0207681_10033288 3300025923 Bacteria 3378
449 Ga0207681_10094028 3300025923 Bacteria 2147
450 Ga0207681_10122960 3300025923 Bacteria 1906
451 Ga0207681_10716631 3300025923 Bacteria 832
452 Ga0207694_10002087 3300025924 Bacteria 16502
453 Ga0207694_10091001 3300025924 Bacteria 2408
454 Ga0207694_10345340 3300025924 Bacteria 1231
455 Ga0207694_10637068 3300025924 Bacteria 898
456 Ga0207694_10801093 3300025924 Bacteria 796
457 Ga0207650_10000004 3300025925 Bacteria 743372
458 Ga0207650_10002904 3300025925 Bacteria 11832
459 Ga0207650_10006404 3300025925 Bacteria 8018
460 Ga0207650_10049447 3300025925 Bacteria 3105
461 Ga0207650_10174974 3300025925 Bacteria 1708
462 Ga0207659_10136023 3300025926 Bacteria 1902
463 Ga0207687_10000225 3300025927 Bacteria 38523
464 Ga0207687_10010076 3300025927 Bacteria 6180
465 Ga0207644_10000002 3300025931 Bacteria 942221
466 Ga0207644_10000012 3300025931 Bacteria 186652
467 Ga0207644_10000067 3300025931 Bacteria 76116
468 Ga0207644_10001857 3300025931 Bacteria 13746
469 Ga0207644_10022749 3300025931 Bacteria 4285
470 Ga0207644_10700505 3300025931 Bacteria 844
471 Ga0207690_10157914 3300025932 Bacteria 1688
472 Ga0207690_10186911 3300025932 Bacteria 1564
473 Ga0207690_10337182 3300025932 Bacteria 1189
474 Ga0207690_10342161 3300025932 Bacteria 1181
475 Ga0207690_10356195 3300025932 Bacteria 1158
476 Ga0207690_10878067 3300025932 Bacteria 743
477 Ga0207706_10008805 3300025933 Bacteria 9291
478 Ga0207706_10033279 3300025933 Bacteria 4590
479 Ga0207706_10083285 3300025933 Bacteria 2812
480 Ga0207706_10138164 3300025933 Bacteria 2144
481 Ga0207706_10198802 3300025933 Bacteria 1758
482 Ga0207706_11217586 3300025933 Bacteria 625
483 Ga0207686_10001878 3300025934 Bacteria 11648
484 Ga0207709_10000173 3300025935 Bacteria 86350
485 Ga0207709_10088718 3300025935 Bacteria 2014
486 Ga0207709_11210901 3300025935 Bacteria 622
487 Ga0207669_10046739 3300025937 Bacteria 2560
488 Ga0207669_11000337 3300025937 Bacteria 703
489 Ga0207704_10000001 3300025938 Bacteria 716296
490 Ga0207691_10009162 3300025940 Bacteria 9499
491 Ga0207711_10000075 3300025941 Bacteria 106870
492 Ga0207711_10024088 3300025941 Bacteria 5096
493 Ga0207711_10114106 3300025941 Bacteria 2406
494 Ga0207711_10236570 3300025941 Bacteria 1674
495 Ga0207711_11362142 3300025941 Bacteria 652
496 Ga0207689_10000744 3300025942 Bacteria 31242
497 Ga0207689_11445008 3300025942 Bacteria 575
498 Ga0207661_10482382 3300025944 Bacteria 1132
499 Ga0207661_11506624 3300025944 Bacteria 616
500 Ga0207679_10123611 3300025945 Bacteria 2064
501 Ga0207679_10140360 3300025945 Bacteria 1952
502 Ga0207667_10000016 3300025949 Bacteria 391466
503 Ga0207667_10011748 3300025949 Bacteria 10154
504 Ga0207667_10112317 3300025949 Bacteria 2810
505 Ga0207667_10498960 3300025949 Bacteria 1235
506 Ga0207667_10638165 3300025949 Bacteria 1071
507 Ga0207651_10000002 3300025960 Bacteria 427663
508 Ga0207651_11013347 3300025960 Bacteria 742
509 Ga0207712_10000014 3300025961 Bacteria 375393
510 Ga0207712_10000174 3300025961 Bacteria 66500
511 Ga0207712_10018137 3300025961 Bacteria 4580
512 Ga0207712_10057696 3300025961 Bacteria 2740
513 Ga0207712_10092123 3300025961 Bacteria 2234
514 Ga0207712_10657395 3300025961 Bacteria 911
515 Ga0207712_11277392 3300025961 Bacteria 656
516 Ga0207712_11688390 3300025961 Bacteria 568
517 Ga0207668_10000081 3300025972 Bacteria 72145
518 Ga0207668_10000304 3300025972 Bacteria 32235
519 Ga0207668_10005340 3300025972 Bacteria 7558
520 Ga0207668_10083673 3300025972 Bacteria 2322
521 Ga0207668_10085277 3300025972 Bacteria 2304
522 Ga0207668_10328540 3300025972 Bacteria 1271
523 Ga0207668_10484314 3300025972 Bacteria 1061
524 Ga0207640_10000063 3300025981 Bacteria 87065
525 Ga0207640_10031448 3300025981 Bacteria 3280
526 Ga0207640_10062003 3300025981 Bacteria 2479
527 Ga0207640_10100271 3300025981 Bacteria 2029
528 Ga0207640_10157229 3300025981 Bacteria 1677
529 Ga0207640_11027507 3300025981 Bacteria 726
530 Ga0207640_11246724 3300025981 Bacteria 662
531 Ga0207640_11397633 3300025981 Bacteria 627
532 Ga0207658_10000002 3300025986 Bacteria 1364188
533 Ga0207658_10001566 3300025986 Bacteria 17731
534 Ga0207658_10004095 3300025986 Bacteria 10169
535 Ga0207658_10008782 3300025986 Bacteria 6860
536 Ga0207658_10018656 3300025986 Bacteria 4795
537 Ga0207658_10819713 3300025986 Bacteria 845
538 Ga0207677_10000030 3300026023 Bacteria 120692
539 Ga0207703_10005351 3300026035 Bacteria 10337
540 Ga0207703_10008030 3300026035 Bacteria 8339
541 Ga0207703_10009134 3300026035 Bacteria 7806
542 Ga0207703_10124179 3300026035 Bacteria 2220
543 Ga0207639_10000213 3300026041 Bacteria 43227
544 Ga0207639_10012302 3300026041 Bacteria 5959
545 Ga0207639_10036850 3300026041 Bacteria 3628
546 Ga0207639_10122498 3300026041 Bacteria 2139
547 Ga0207639_10602963 3300026041 Bacteria 1013
548 Ga0207639_10828173 3300026041 Bacteria 863
549 Ga0207678_10000857 3300026067 Bacteria 27922
550 Ga0207678_10001793 3300026067 Bacteria 19669
551 Ga0207678_10088208 3300026067 Bacteria 2651
552 Ga0207702_10000887 3300026078 Bacteria 31141
553 Ga0207702_10002945 3300026078 Bacteria 15895
554 Ga0207702_10019109 3300026078 Bacteria 5670
555 Ga0207641_10000001 3300026088 Bacteria 1180841
556 Ga0207641_10000099 3300026088 Bacteria 122892
557 Ga0207641_10002512 3300026088 Bacteria 16895
558 Ga0207641_10004505 3300026088 Bacteria 12048
559 Ga0207641_10013693 3300026088 Bacteria 6656
560 Ga0207641_10014410 3300026088 Bacteria 6478
561 Ga0207641_11282650 3300026088 Bacteria 733
562 Ga0207648_10000001 3300026089 Bacteria 427499
563 Ga0207676_10000006 3300026095 Bacteria 681936
564 Ga0207676_10000770 3300026095 Bacteria 25065
565 Ga0207676_10022559 3300026095 Bacteria 4630
566 Ga0207674_10131652 3300026116 Bacteria 2464
567 Ga0207674_10300559 3300026116 Bacteria 1554
568 Ga0207674_10337148 3300026116 Bacteria 1458
569 Ga0207674_11129632 3300026116 Bacteria 753
570 Ga0207674_11201849 3300026116 Bacteria 728
571 Ga0207675_100000358 3300026118 Bacteria 43765
572 Ga0207675_100001138 3300026118 Bacteria 26336
573 Ga0207675_100230090 3300026118 Bacteria 1788
574 Ga0207683_10182888 3300026121 Bacteria 1901
575 Ga0207698_10034383 3300026142 Bacteria 3694
576 Ga0207698_10130218 3300026142 Bacteria 2148
577 Ga0207698_10201601 3300026142 Bacteria 1782
578 Ga0207698_10955811 3300026142 Bacteria 866
579 Ga0207698_12752071 3300026142 Bacteria 500
580 Ga0209371_1085272 3300027312 Bacteria 539
581 Ga0209813_10000051 3300027866 Bacteria 47545
582 Ga0268266_10000009 3300028379 Bacteria 1097737
583 Ga0268266_10002003 3300028379 Bacteria 22767
584 Ga0268266_10006189 3300028379 Bacteria 10993
585 Ga0268266_10158947 3300028379 Bacteria 2043
586 Ga0268266_10211526 3300028379 Bacteria 1779
587 Ga0268266_10315170 3300028379 Bacteria 1462
588 Ga0268266_10422983 3300028379 Bacteria 1263
589 Ga0268266_11019591 3300028379 Bacteria 801
590 Ga0268266_11411114 3300028379 Bacteria 672
591 Ga0268265_10000001 3300028380 Bacteria 1230727
592 Ga0268265_10000045 3300028380 Bacteria 180378
593 Ga0268265_10000047 3300028380 Bacteria 179354
594 Ga0268265_10000285 3300028380 Bacteria 57084
595 Ga0268265_10004726 3300028380 Bacteria 9397
596 Ga0268265_10017233 3300028380 Bacteria 4981
597 Ga0268265_10146980 3300028380 Bacteria 1982
598 Ga0268265_10315643 3300028380 Bacteria 1413
599 Ga0268265_10387566 3300028380 Bacteria 1287
600 Ga0268265_11127984 3300028380 Bacteria 779
601 Ga0268264_10000001 3300028381 Bacteria 1221000
602 Ga0268264_10000010 3300028381 Bacteria 596543
603 Ga0268264_10000023 3300028381 Bacteria 471408
604 Ga0268264_10004259 3300028381 Bacteria 12215
605 Ga0268264_10012572 3300028381 Bacteria 6971
606 Ga0268264_10105564 3300028381 Bacteria 2457
607 Ga0268264_10209613 3300028381 Bacteria 1788
608 Ga0268264_10405038 3300028381 Bacteria 1312
609 Ga0307517_10633740 3300028786 Bacteria 522
610 Ga0268256_1046229 3300030500 Bacteria 944
611 Ga0314311_1203820 3300030733 Bacteria 1025
612 Ga0265320_10000034 3300031240 Bacteria 141117
613 Ga0265325_10023456 3300031241 Bacteria 3367
614 Ga0265325_10037185 3300031241 Bacteria 2574
615 Ga0307513_10209984 3300031456 Bacteria 1779
616 Ga0307408_100051500 3300031548 Bacteria 2965
617 Ga0307408_101128429 3300031548 Bacteria 728
618 Ga0307408_101389987 3300031548 Bacteria 661
619 Ga0265313_10000665 3300031595 Bacteria 35397
620 Ga0265314_10019631 3300031711 Bacteria 5232
621 Ga0265314_10042189 3300031711 Bacteria 3258
622 Ga0265314_10118950 3300031711 Bacteria 1666
623 Ga0307405_10055116 3300031731 Bacteria 2486
624 Ga0307405_10530365 3300031731 Bacteria 949
625 Ga0307405_10949213 3300031731 Bacteria 730
626 Ga0307405_11486235 3300031731 Bacteria 595
627 Ga0307413_10332327 3300031824 Bacteria 1165
628 Ga0307413_11513892 3300031824 Bacteria 593
629 Ga0307410_10027090 3300031852 Bacteria 3618
630 Ga0307410_11135650 3300031852 Bacteria 679
631 Ga0307406_10589289 3300031901 Bacteria 915
632 Ga0307406_10614399 3300031901 Bacteria 898
633 Ga0307406_10706803 3300031901 Bacteria 842
634 Ga0307406_11005598 3300031901 Bacteria 715
635 Ga0307406_11917748 3300031901 Bacteria 528
636 Ga0307407_10257420 3300031903 Bacteria 1199
637 Ga0307412_10015626 3300031911 Bacteria 4506
638 Ga0307412_10514991 3300031911 Bacteria 998
639 Ga0307412_10947513 3300031911 Bacteria 757
640 Ga0307412_11429176 3300031911 Bacteria 627
641 Ga0307409_101359966 3300031995 Bacteria 736
642 Ga0307409_102980818 3300031995 Bacteria 500
643 Ga0307416_100014919 3300032002 Bacteria 5345
644 Ga0307414_11712720 3300032004 Bacteria 586
645 Ga0307414_11795155 3300032004 Bacteria 572
646 Ga0307411_10271081 3300032005 Bacteria 1346
647 Ga0307411_10440296 3300032005 Bacteria 1087
648 Ga0307411_12160541 3300032005 Bacteria 521
649 Ga0307510_10148726 3300033180 Bacteria 1967
650 Ga0373923_0143888 3300035111 Bacteria 1079
651 Ga0373946_0647350 3300035171 Bacteria 550
652 Ga0395899_0001521 3300037312 Bacteria 19608
653 Ga0395900_0009291 3300037418 Bacteria 10081
654 Ga0395900_1114422 3300037418 Bacteria 706
655 Ga0395898_1303005 3300037466 Bacteria 656
656 Ga0395905_0026896 3300037471 Bacteria 5426
657 Ga0395905_0516629 3300037471 Bacteria 1095
658 Ga0436364_0741438 3300037853 Bacteria 779
659 Ga0436364_0878110 3300037853 Bacteria 2836
660 Ga0395901_0073008 3300038443 Bacteria 3578
661 Ga0395901_2127733 3300038443 Bacteria 506
662 Ga0436365_0212007 3300039437 Bacteria 1166
663 Ga0436365_0922307 3300039437 Bacteria 725
664 Ga0436365_1667312 3300039437 Bacteria 780
665 Ga0436365_1773361 3300039437 Bacteria 6729
666 Ga0436361_1051839 3300039447 Bacteria 1442
667 Ga0439436_0009694 3300041404 Bacteria 2950
668 Ga0439439_0001779 3300041406 Bacteria 4402
669 Ga0439447_148918 3300041407 Bacteria 538
670 Ga0439461_0000498 3300041410 Bacteria 5666
671 Ga0439461_0003679 3300041410 Bacteria 2530
672 Ga0439461_0080904 3300041410 Bacteria 766
673 Ga0439465_0004274 3300041413 Bacteria 4644
674 Ga0439465_0004757 3300041413 Bacteria 4375
675 Ga0451793_0810995 3300041452 Bacteria 595
676 Ga0451793_1584048 3300041452 Bacteria 641
677 Ga0451802_1834731 3300041460 Bacteria 516
678 Ga0451806_522421 3300041462 Bacteria 552
679 Ga0451807_0720757 3300041486 Bacteria 754
680 Ga0451833_1022453 3300041491 Bacteria 551
681 Ga0451837_1536393 3300041494 Bacteria 581
682 Ga0451841_0590837 3300041498 Bacteria 1107
683 Ga0451853_3774724 3300041512 Bacteria 620
684 Ga0439431_0038651 3300041997 Bacteria 1208
685 Ga0439442_150916 3300042002 Bacteria 517
686 Ga0439445_0033115 3300042004 Bacteria 1349
687 Ga0439448_0002459 3300042005 Bacteria 5047
688 Ga0439432_000640 3300042006 Bacteria 13098
689 Ga0439432_022961 3300042006 Bacteria 2058
690 Ga0439452_018803 3300042010 Bacteria 1835
691 Ga0439457_024428 3300042014 Bacteria 1337
692 Ga0439462_0002776 3300042015 Bacteria 4116
693 Ga0450922_019334 3300042124 Bacteria 696
694 Ga0439446_0034458 3300042156 Bacteria 1473
695 Ga0439458_0000137 3300042157 Bacteria 15585
696 Ga0450909_012035 3300042185 Bacteria 1268
697 Ga0439434_0020110 3300042435 Bacteria 2004
698 Ga0439460_0201787 3300042461 Bacteria 678
699 Ga0466972_0086674 3300044658 Bacteria 1488
700 Ga0466965_0529846 3300044683 Bacteria 663
701 Ga0466963_0311463 3300044694 Bacteria 1108
702 Ga0466970_0256774 3300044765 Bacteria 980
703 Ga0466957_0347333 3300044842 Bacteria 1006
704 Ga0451576_0436970 3300045051 Bacteria 1373
705 Ga0466958_0391983 3300045836 Bacteria 896
706 Ga0466967_0379221 3300045976 Bacteria 1373
707 Ga0466967_0633257 3300045976 Bacteria 1057
708 Ga0466967_2162402 3300045976 Bacteria 552
709 Ga0495617_011498 3300046452 Bacteria 3019
710 Ga0495627_000156 3300046453 Bacteria 78784
711 Ga0495627_000578 3300046453 Bacteria 29484
712 Ga0495627_034662 3300046453 Bacteria 1576
713 Ga0495638_0000758 3300046460 Bacteria 34400
714 Ga0495638_0188677 3300046460 Bacteria 1171
715 Ga0495651_0721380 3300046462 Bacteria 620
716 Ga0495650_0001027 3300046471 Bacteria 31380
717 Ga0495650_0227391 3300046471 Bacteria 641
718 Ga0495584_0078046 3300046491 Bacteria 1666
719 Ga0495585_0127704 3300046492 Bacteria 1340
720 Ga0495585_0567920 3300046492 Bacteria 535
721 Ga0495607_0093490 3300046501 Bacteria 1624
722 Ga0495583_0220617 3300046506 Bacteria 766
723 Ga0495606_0072058 3300046507 Bacteria 2173
724 Ga0495610_0000291 3300046512 Bacteria 52599
725 Ga0495610_0144969 3300046512 Bacteria 1018
726 Ga0495616_0001456 3300046513 Bacteria 16481
727 Ga0495632_0000006 3300046519 Bacteria 345883
728 Ga0495637_0000784 3300046520 Bacteria 21358
729 Ga0495637_0010852 3300046520 Bacteria 4391
730 Ga0495637_0065588 3300046520 Bacteria 1478
731 Ga0495643_0000021 3300046522 Bacteria 293465
732 Ga0495643_0523213 3300046522 Bacteria 508
733 Ga0495648_0010683 3300046524 Bacteria 6974
734 Ga0495648_0045945 3300046524 Bacteria 2712
735 Ga0495663_0000008 3300046525 Bacteria 260614
736 Ga0495663_0018920 3300046525 Bacteria 1965
737 Ga0495663_0053401 3300046525 Bacteria 1256
738 Ga0495663_0242178 3300046525 Bacteria 638
739 Ga0495654_0116202 3300046530 Bacteria 1215
740 Ga0495597_0031259 3300046542 Bacteria 2424
741 Ga0495633_0000190 3300046558 Bacteria 79967
742 Ga0495633_0002635 3300046558 Bacteria 12531
743 Ga0495633_0013695 3300046558 Bacteria 4264
744 Ga0495633_0072188 3300046558 Bacteria 1610
745 Ga0495633_0146062 3300046558 Bacteria 1093
746 Ga0495668_0002221 3300046616 Bacteria 16492
747 Ga0495668_0105921 3300046616 Bacteria 1538
748 Ga0495668_0574724 3300046616 Bacteria 622
749 Ga0495625_0000629 3300046660 Bacteria 51047
750 Ga0495625_0215510 3300046660 Bacteria 1260
751 Ga0495625_0393492 3300046660 Bacteria 867
752 Ga0495661_0125781 3300046665 Bacteria 1411
753 Ga0495670_0000002 3300046691 Bacteria 601814
754 Ga0495670_0427746 3300046691 Bacteria 716
755 Ga0495671_0000017 3300046692 Bacteria 293465
756 Ga0495649_0327109 3300046694 Bacteria 777
757 Ga0495636_0180483 3300047318 Bacteria 958
758 Ga0495672_0174663 3300047320 Bacteria 1092
759 Ga0495672_0212818 3300047320 Bacteria 959
760 Ga0495673_0028297 3300047469 Bacteria 2656
761 Ga0495681_0000098 3300047470 Bacteria 75809
762 Ga0495681_0008268 3300047470 Bacteria 6539
763 Ga0495681_0009646 3300047470 Bacteria 5927
764 Ga0495681_0326806 3300047470 Bacteria 588
765 Ga0495686_0005063 3300047472 Bacteria 10564
766 Ga0495686_0008463 3300047472 Bacteria 7546
767 Ga0495686_0029938 3300047472 Bacteria 3538
768 Ga0495686_0042056 3300047472 Bacteria 2907
769 Ga0495686_0248449 3300047472 Bacteria 1000
770 Ga0495686_0254178 3300047472 Bacteria 986
771 Ga0495686_0377163 3300047472 Bacteria 766
772 Ga0495686_0686152 3300047472 Bacteria 523
773 Ga0496100_0082969 3300048903 Bacteria 2168
774 Ga0496100_0182282 3300048903 Bacteria 1519
775 Ga0496100_1223371 3300048903 Bacteria 592
776 Ga0496101_0111668 3300048904 Bacteria 2058
777 Ga0496101_0138327 3300048904 Bacteria 1854
778 Ga0496101_0333953 3300048904 Bacteria 1190
779 Ga0496101_0346342 3300048904 Bacteria 1167
780 Ga0496102_0000069 3300048905 Bacteria 156067
781 Ga0496102_0000615 3300048905 Bacteria 36925
782 Ga0496102_0172254 3300048905 Bacteria 2037
783 Ga0496102_0298555 3300048905 Bacteria 1518
784 Ga0496102_0681373 3300048905 Bacteria 951
785 Ga0496103_0000173 3300048906 Bacteria 67412
786 Ga0496103_0009010 3300048906 Bacteria 5911
787 Ga0496103_0033025 3300048906 Bacteria 3160
788 Ga0496103_0132529 3300048906 Bacteria 1592
789 Ga0496103_0224202 3300048906 Bacteria 1209
790 Ga0496103_0651014 3300048906 Bacteria 669
791 Ga0496104_0000081 3300048907 Bacteria 94514
792 Ga0496104_0059792 3300048907 Bacteria 3608
793 Ga0496105_0000034 3300048908 Bacteria 127505
794 Ga0496105_0090922 3300048908 Bacteria 2521
795 Ga0496105_0363545 3300048908 Bacteria 1154
796 Ga0496105_0615800 3300048908 Bacteria 841
797 Ga0496106_0076352 3300048909 Bacteria 2568
798 Ga0496106_0168900 3300048909 Bacteria 1733
799 Ga0496106_0222120 3300048909 Bacteria 1507
800 Ga0496107_0173558 3300048910 Bacteria 1600
801 Ga0496107_0252341 3300048910 Bacteria 1312
802 Ga0496109_0067327 3300048912 Bacteria 3280
803 Ga0496109_0116418 3300048912 Bacteria 2488
804 Ga0496109_0353061 3300048912 Bacteria 1389
805 Ga0496109_0539887 3300048912 Bacteria 1100
806 Ga0496110_0093856 3300048913 Bacteria 2686
807 Ga0496110_0124785 3300048913 Bacteria 2322
808 Ga0496110_0325345 3300048913 Bacteria 1400
809 Ga0496110_1131155 3300048913 Bacteria 691
810 Ga0496111_0328540 3300048914 Bacteria 1132
811 Ga0496111_0458563 3300048914 Bacteria 940
812 Ga0496112_0116278 3300048915 Bacteria 2645
813 Ga0496112_0663427 3300048915 Bacteria 972
814 Ga0496113_0000101 3300048916 Bacteria 36217
815 Ga0496113_0366514 3300048916 Bacteria 1156
816 Ga0496113_1445932 3300048916 Bacteria 532
817 Ga0496115_0001129 3300048918 Bacteria 19266
818 Ga0496115_0108956 3300048918 Bacteria 2274
819 Ga0496115_1026514 3300048918 Bacteria 629
820 Ga0496116_0000062 3300048919 Bacteria 271104
821 Ga0496116_0000566 3300048919 Bacteria 49509
822 Ga0496116_0032138 3300048919 Bacteria 3745
823 Ga0496116_0050745 3300048919 Bacteria 2762
824 Ga0496116_0101176 3300048919 Bacteria 1721
825 Ga0496116_0361464 3300048919 Bacteria 660
826 Ga0496117_0000146 3300048920 Bacteria 152244
827 Ga0496117_0000485 3300048920 Bacteria 65840
828 Ga0496117_0033071 3300048920 Bacteria 3916
829 Ga0496117_0046000 3300048920 Bacteria 3144
830 Ga0496117_0055578 3300048920 Bacteria 2765
831 Ga0496117_0089533 3300048920 Bacteria 1987
832 Ga0496117_0251385 3300048920 Bacteria 964
833 Ga0496117_0312713 3300048920 Bacteria 826
834 Ga0496117_0318261 3300048920 Bacteria 816
835 Ga0496117_0330651 3300048920 Bacteria 794
836 Ga0496118_0000190 3300048921 Bacteria 108017
837 Ga0496118_0003742 3300048921 Bacteria 18808
838 Ga0496118_0015425 3300048921 Bacteria 7071
839 Ga0496118_0015970 3300048921 Bacteria 6916
840 Ga0496118_0057773 3300048921 Bacteria 2905
841 Ga0496118_0076829 3300048921 Bacteria 2372
842 Ga0496118_0079363 3300048921 Bacteria 2316
843 Ga0496118_0104776 3300048921 Bacteria 1897
844 Ga0496118_0127031 3300048921 Bacteria 1647
845 Ga0496118_0139050 3300048921 Bacteria 1544
846 Ga0496118_0370348 3300048921 Bacteria 756
847 Ga0496119_0000057 3300048922 Bacteria 173746
848 Ga0496119_0072971 3300048922 Bacteria 2003
849 Ga0496119_0180016 3300048922 Bacteria 1109
850 Ga0496119_0186126 3300048922 Bacteria 1085
851 Ga0496119_0313654 3300048922 Bacteria 769
852 Ga0496120_0005360 3300048923 Bacteria 10261
853 Ga0496120_0110614 3300048923 Bacteria 1436
854 Ga0496120_0178484 3300048923 Bacteria 1045
855 Ga0496120_0185785 3300048923 Bacteria 1017
856 Ga0496120_0487953 3300048923 Bacteria 531
857 Ga0496121_0005623 3300048924 Bacteria 15968
858 Ga0496121_0010499 3300048924 Bacteria 10435
859 Ga0496121_0015601 3300048924 Bacteria 7936
860 Ga0496121_0016723 3300048924 Bacteria 7548
861 Ga0496121_0017016 3300048924 Bacteria 7461
862 Ga0496121_0058069 3300048924 Bacteria 3202
863 Ga0496121_0115314 3300048924 Bacteria 2040
864 Ga0496121_0180678 3300048924 Bacteria 1523
865 Ga0496121_0205134 3300048924 Bacteria 1401
866 Ga0496121_0568689 3300048924 Bacteria 706
867 Ga0496121_0907952 3300048924 Bacteria 506
868 Ga0496122_0000723 3300048925 Bacteria 64694
869 Ga0496122_0003556 3300048925 Bacteria 20365
870 Ga0496122_0006671 3300048925 Bacteria 13150
871 Ga0496122_0026134 3300048925 Bacteria 5047
872 Ga0496122_0366886 3300048925 Bacteria 745
873 Ga0496122_0420631 3300048925 Bacteria 672
874 Ga0496123_0000545 3300048926 Bacteria 64687
875 Ga0496123_0002968 3300048926 Bacteria 19751
876 Ga0496123_0016815 3300048926 Bacteria 5914
877 Ga0496123_0062259 3300048926 Bacteria 2392
878 Ga0496123_0235440 3300048926 Bacteria 913
879 Ga0496124_0000546 3300048927 Bacteria 63624
880 Ga0496124_0000874 3300048927 Bacteria 49185
881 Ga0496124_0002439 3300048927 Bacteria 24366
882 Ga0496124_0006061 3300048927 Bacteria 13305
883 Ga0496124_0023588 3300048927 Bacteria 5614
884 Ga0496124_0023873 3300048927 Bacteria 5571
885 Ga0496124_0081473 3300048927 Bacteria 2660
886 Ga0496124_0299780 3300048927 Bacteria 1162
887 Ga0496124_0474242 3300048927 Bacteria 847
888 Ga0496124_0507938 3300048927 Bacteria 806
889 Ga0496124_0805486 3300048927 Bacteria 581
890 Ga0496125_0002465 3300048928 Bacteria 24034
891 Ga0496125_0006988 3300048928 Bacteria 12081
892 Ga0496125_0033431 3300048928 Bacteria 4551
893 Ga0496125_0034343 3300048928 Bacteria 4472
894 Ga0496125_0071024 3300048928 Bacteria 2722
895 Ga0496125_0355978 3300048928 Bacteria 872
896 Ga0496125_0415581 3300048928 Bacteria 781
897 Ga0496125_0439744 3300048928 Bacteria 750
898 Ga0496126_0000028 3300048929 Bacteria 394082
899 Ga0496126_0006838 3300048929 Bacteria 12646
900 Ga0496126_0016996 3300048929 Bacteria 7259
901 Ga0496126_0034229 3300048929 Bacteria 4773
902 Ga0496126_0054886 3300048929 Bacteria 3607
903 Ga0496126_0121519 3300048929 Bacteria 2264
904 Ga0496126_0150910 3300048929 Bacteria 1992
905 Ga0496126_0372477 3300048929 Bacteria 1164
906 Ga0496126_0632782 3300048929 Bacteria 839
907 Ga0496126_1231595 3300048929 Bacteria 549
908 Ga0495678_014836 3300049459 Bacteria 3610
909 Ga0495682_0279655 3300049460 Bacteria 589
910 Ga0501290_000237 3300049513 Bacteria 9135
911 Ga0501292_000042 3300049515 Bacteria 29474
912 Ga0501294_000032 3300049517 Bacteria 13769
913 Ga0501297_009582 3300049520 Bacteria 1085
914 Ga0501300_000392 3300049523 Bacteria 6689
915 Ga0501302_002270 3300049525 Bacteria 1084
916 Ga0501315_000962 3300049531 Bacteria 2273
917 Ga0501317_002915 3300049533 Bacteria 1662
918 Ga0501318_049501 3300049534 Bacteria 621
919 Ga0501321_023679 3300049537 Bacteria 780
920 Ga0501335_000615 3300049551 Bacteria 2383
921 Ga0501337_013057 3300049553 Bacteria 625
922 Ga0501033_0085723 3300049570 Bacteria 2307
923 Ga0501034_0099962 3300049571 Bacteria 2895
924 Ga0501034_0285394 3300049571 Bacteria 1590
925 Ga0501038_0164937 3300049574 Bacteria 1798
926 Ga0501038_0323317 3300049574 Bacteria 1206
927 Ga0501038_0770013 3300049574 Bacteria 717
928 Ga0501041_0866607 3300049577 Bacteria 580
929 Ga0501042_0040621 3300049578 Bacteria 3307
930 Ga0501042_0260954 3300049578 Bacteria 1251
931 Ga0501043_0113159 3300049579 Bacteria 2131
932 Ga0501046_0030454 3300049580 Bacteria 4380
933 Ga0501047_0000731 3300049581 Bacteria 34159
934 Ga0501047_0450251 3300049581 Bacteria 1117
935 Ga0501047_0935022 3300049581 Bacteria 680
936 Ga0501070_0968333 3300049586 Bacteria 661
937 Ga0501071_0191090 3300049587 Bacteria 1536
938 Ga0501071_1187966 3300049587 Bacteria 589
939 Ga0501073_0139551 3300049589 Bacteria 1679
940 Ga0501074_0761420 3300049590 Bacteria 683
941 Ga0501075_0834129 3300049591 Bacteria 701
942 Ga0501076_0426670 3300049592 Bacteria 1091
943 Ga0501076_1405930 3300049592 Bacteria 573
944 Ga0501077_0216387 3300049593 Bacteria 1218
945 Ga0501206_003378 3300049653 Bacteria 2028
946 Ga0501211_000103 3300049658 Bacteria 6327
947 Ga0501222_001746 3300049662 Bacteria 3014
948 Ga0501223_004016 3300049663 Bacteria 3169
949 Ga0501223_036809 3300049663 Bacteria 951
950 Ga0501224_000754 3300049664 Bacteria 4084
951 Ga0501227_028030 3300049665 Bacteria 1336
952 Ga0501233_012436 3300049668 Bacteria 1708
953 Ga0501235_001097 3300049669 Bacteria 5663
954 Ga0501236_053975 3300049670 Bacteria 697
955 Ga0501259_001391 3300049688 Bacteria 4043
956 Ga0501261_000021 3300049690 Bacteria 37511
957 Ga0501221_003846 3300049704 Bacteria 2478
958 Ga0501225_0006973 3300049705 Bacteria 3291
959 Ga0501225_0043405 3300049705 Bacteria 1242
960 Ga0501079_0374717 3300049741 Bacteria 1116
961 Ga0501080_0702389 3300049742 Bacteria 892
962 Ga0501083_0271764 3300049744 Bacteria 1103
963 Ga0501083_0292932 3300049744 Bacteria 1059
964 Ga0501264_008163 3300049761 Bacteria 985
965 Ga0501276_013553 3300049773 Bacteria 716
966 Ga0501279_000010 3300049775 Bacteria 103375
967 Ga0501280_000064 3300049776 Bacteria 31054
968 Ga0501280_001057 3300049776 Bacteria 5596
969 Ga0501281_00086 3300049777 Bacteria 10989
970 Ga0501282_000404 3300049778 Bacteria 5157
971 Ga0501283_001453 3300049779 Bacteria 3071
972 Ga0501035_0179700 3300049822 Bacteria 1823
973 Ga0501035_0244287 3300049822 Bacteria 1526
974 Ga0501035_1048316 3300049822 Bacteria 639
975 Ga0501044_0134255 3300049823 Bacteria 2467
976 Ga0501044_0204047 3300049823 Bacteria 1934
977 Ga0501044_0896240 3300049823 Bacteria 762
978 Ga0501226_021697 3300049853 Bacteria 712
979 Ga0501284_02268 3300050005 Bacteria 1056
980 nmdc:mga03n38_266481_c1 3300050490 Bacteria 910
981 nmdc:mga00v17_75476_c1 3300050491 Bacteria 1412
982 nmdc:mga00v17_911672_c1 3300050491 Bacteria 556
983 nmdc:mga0k408_344198_c1 3300050493 Bacteria 889
984 nmdc:mga0k408_529690_c1 3300050493 Bacteria 697
985 nmdc:mga0k408_583414_c1 3300050493 Bacteria 660
986 nmdc:mga0k408_832522_c1 3300050493 Bacteria 537
987 nmdc:mga06z11_17_c1 3300050494 Bacteria 79602
988 nmdc:mga04h51_146_c1 3300050495 Bacteria 20585
989 nmdc:mga04h51_411911_c1 3300050495 Bacteria 567
990 nmdc:mga07m45_111328_c1 3300050496 Bacteria 1577
991 nmdc:mga07m45_567769_c1 3300050496 Bacteria 656
992 nmdc:mga07m45_60295_c1 3300050496 Bacteria 2147
993 nmdc:mga05p37_171786_c1 3300050507 Bacteria 2643
994 nmdc:mga05p37_2021674_c1 3300050507 Bacteria 544
995 Ga0500643_010906 3300053087 Bacteria 3352
996 Ga0500647_0376821 3300053091 Bacteria 582
997 Ga0500651_0086862 3300053093 Bacteria 1931
998 Ga0500566_0004538 3300053094 Bacteria 8291
999 Ga0500641_0004173 3300053096 Bacteria 5101
1000 Ga0500641_0136367 3300053096 Bacteria 1059
1001 Ga0500556_0189304 3300053104 Bacteria 813
1002 Ga0500562_070755 3300053108 Bacteria 941
1003 Ga0500592_000031 3300053116 Bacteria 47686
1004 Ga0500592_001156 3300053116 Bacteria 4293
1005 Ga0500594_0054708 3300053118 Bacteria 1134
1006 Ga0500595_000572 3300053119 Bacteria 21961
1007 Ga0500595_052569 3300053119 Bacteria 1257
1008 Ga0500595_055810 3300053119 Bacteria 1209
1009 Ga0500608_066104 3300053122 Bacteria 1724
1010 Ga0500618_014810 3300053125 Bacteria 1983
1011 Ga0500626_092170 3300053128 Bacteria 1329
1012 Ga0500642_0014296 3300053130 Bacteria 2948
1013 Ga0500652_278543 3300053131 Bacteria 654
1014 Ga0500655_000251 3300053133 Bacteria 12576
1015 Ga0500658_0010885 3300053134 Bacteria 3356
1016 Ga0500658_0014446 3300053134 Bacteria 2923
1017 Ga0500658_0267841 3300053134 Bacteria 785
1018 Ga0500658_0476850 3300053134 Bacteria 566
1019 Ga0500559_0159324 3300053136 Bacteria 1060
1020 Ga0500559_0232776 3300053136 Bacteria 868
1021 Ga0500564_386623 3300053138 Bacteria 510
1022 Ga0500568_0018906 3300053139 Bacteria 3006
1023 Ga0500568_0092427 3300053139 Bacteria 1140
1024 Ga0500568_0195118 3300053139 Bacteria 742
1025 Ga0500588_0071841 3300053146 Bacteria 1137
1026 Ga0500590_000131 3300053148 Bacteria 20923
1027 Ga0500604_0036484 3300053151 Bacteria 1466
1028 Ga0500604_0071415 3300053151 Bacteria 1107
1029 Ga0500616_0008241 3300053153 Bacteria 6496
1030 Ga0500616_0222499 3300053153 Bacteria 822
1031 Ga0500616_0284202 3300053153 Bacteria 693
1032 Ga0500616_0291538 3300053153 Bacteria 681
1033 Ga0500622_0025695 3300053156 Bacteria 3111
1034 Ga0500622_0077848 3300053156 Bacteria 1665
1035 Ga0500622_0091256 3300053156 Bacteria 1511
1036 Ga0500624_000063 3300053157 Bacteria 65333
1037 Ga0500627_0001223 3300053158 Bacteria 7068
1038 Ga0500627_0027041 3300053158 Bacteria 2372
1039 Ga0500627_0378067 3300053158 Bacteria 607
1040 Ga0500639_139272 3300053163 Bacteria 1137
1041 Ga0500636_0058873 3300053177 Bacteria 2245
1042 Ga0500570_004079 3300053724 Bacteria 7637
1043 Ga0500645_180888 3300053730 Bacteria 573
1044 Ga0500645_223100 3300053730 Bacteria 504
1045 Ga0500601_034828 3300053737 Bacteria 604
1046 Ga0501084_0791318 3300054114 Bacteria 799
1047 Ga0587066_169647 3300059490 Bacteria 554
1048 Ga0587077_168426 3300059493 Bacteria 585
1049 Ga0587088_134191 3300059508 Bacteria 585
1050 Ga0587094_030537 3300059513 Bacteria 833
1051 Ga0587067_076756 3300059640 Bacteria 732
1052 Ga0587069_140777 3300059642 Bacteria 528
1053 Ga0501082_0979656 3300060353 Bacteria 739
1054 2511130325 2510917021 Bacteria 5705459
1055 2523469825 2523231067 Bacteria 5230452
1056 2585262260 2582581305 Bacteria 4895574
1057 2600225503 2599185359 Bacteria 4772316
1058 2643731598 2643221541 Bacteria 5498788
1059 2644036775 2643221605 Bacteria 4772303
1060 2644042074 2643221606 Bacteria 5588032
1061 2644126038 2643221622 Bacteria 4212502
1062 2644394283 2643221671 Bacteria 5496681
1063 2738709615 2738541275 Bacteria 4830863
1064 2738848040 2738541301 Bacteria 4834102
1065 2738863769 2738541304 Bacteria 4833665
1066 2739296287 2738543022 Bacteria 4835059
1067 2739348858 2738543031 Bacteria 5769731
1068 2739357965 2738543033 Bacteria 4833336
1069 2819713935 2818991466 Bacteria 4748179
1070 2879165166 2879163058 Bacteria 4223965
1071 2917557483 2917554339 Bacteria 4987857
1072 2928528495 2928526807 Bacteria 4760224
1073 2928960419 2928959182 Bacteria 4725774
1074 2928970040 2928968154 Bacteria 4633371
1075 2990266882 2990265787 Bacteria 3943888
1076 2993693827 2993693658 Bacteria 4040749
1077 8054303052 8054302542 Bacteria 5698134
1078 Ga0436363_0153792
1079 SwRhRL2b_contig_14491
1080 ARcpr5yngRDRAFT_c004470
1081 ARCol0yngRDRAFT_1009092
1082 JGI24736J21556_1000613
1083 JGI24741J21665_1000366
1084 JGI24752J21851_1006793
1085 JGI24740J21852_10005104
1086 JGI24740J21852_10044246
1087 JGI24739J22299_10005319
1088 JGI24739J22299_10006470
1089 JGI24739J22299_10110044
1090 JGI24739J22299_10112626
1091 JGI24739J22299_10159140
1092 JGI24737J22298_10015406
1093 JGI24737J22298_10020406
1094 JGI24737J22298_10048588
1095 JGI24737J22298_10132662
1096 JGI24737J22298_10186610
1097 JGI24743J22301_10030394
1098 JGI24743J22301_10113531
1099 JGI24735J21928_10000590
1100 JGI24735J21928_10004614
1101 JGI24735J21928_10004932
1102 JGI24735J21928_10015755
1103 JGI24735J21928_10018807
1104 JGI24735J21928_10041906
1105 JGI24735J21928_10058528
1106 JGI24735J21928_10059101
1107 JGI24735J21928_10135297
1108 JGI24735J21928_10202768
1109 JGI24748J21848_1005228
1110 JGI24748J21848_1057374
1111 JGI24738J21930_10000184
1112 JGI24738J21930_10000231
1113 JGI24738J21930_10001740
1114 JGI24738J21930_10015275
1115 JGI24749J21850_1000049
1116 JGI24744J21845_10008674
1117 JGI24035J26624_1026616
1118 JGI24034J26672_10003845
1119 JGI24034J26672_10041405
1120 JGI24751J29686_10000216
1121 JGI24751J29686_10018164
1122 JGI25164J39214_1007846
1123 JGI25150J39212_1002047
1124 JGI25151J46595_10122326
1125 JGI25165J46597_1000043
1126 JGI25153J46596_10000395
1127 JGI25153J46596_10002504
1128 rootH1_10113314
1129 rootH1_10035136
1130 Ga0055529_1042867
1131 Ga0055537_1001019
1132 Ga0055524_1000056
1133 Ga0055528_1020848
1134 Ga0055530_10000931
1135 Ga0055530_10007314
1136 Ga0055540_1002064
1137 Ga0055531_10012617
1138 Ga0055531_10015017
1139 Ga0065165_1005029
1140 Ga0065165_1009273
1141 Ga0065165_1017463
1142 Ga0065165_1062777
1143 Ga0065714_10116065
1144 Ga0065704_10070504
1145 Ga0065707_10000505
1146 Ga0065707_10086198
1147 Ga0065707_10135500
1148 Ga0065707_10212812
1149 Ga0065707_10371722
1150 Ga0065707_10414622
1151 Ga0065707_10938111
1152 Ga0070658_10006525
1153 Ga0070658_10068992
1154 Ga0070658_10097157
1155 Ga0070658_10584581
1156 Ga0070658_10669238
1157 Ga0070658_11102012
1158 Ga0070676_10000230
1159 Ga0070683_100195033
1160 Ga0070670_100000003
1161 Ga0070670_100002377
1162 Ga0070670_100004170
1163 Ga0070670_100126344
1164 Ga0070670_100189232
1165 Ga0070677_10801344
1166 Ga0068869_100000200
1167 Ga0070666_10000184
1168 Ga0070666_10033483
1169 Ga0070666_10257671
1170 Ga0070682_100302630
1171 Ga0068868_100001398
1172 Ga0070660_100004583
1173 Ga0070660_100070534
1174 Ga0070660_100209408
1175 Ga0070660_100996905
1176 Ga0070661_100581848
1177 Ga0070661_101005335
1178 Ga0070668_100000026
1179 Ga0070668_100000080
1180 Ga0070668_100018364
1181 Ga0070668_100027483
1182 Ga0070668_100208292
1183 Ga0070668_100408180
1184 Ga0070668_100428915
1185 Ga0070669_100000008
1186 Ga0070669_100000020
1187 Ga0070669_100000082
1188 Ga0070669_100096603
1189 Ga0070675_100006627
1190 Ga0070671_100000015
1191 Ga0070671_100000169
1192 Ga0070671_100000470
1193 Ga0070671_100013092
1194 Ga0070671_100053502
1195 Ga0070674_100051002
1196 Ga0070673_100000006
1197 Ga0070673_101154028
1198 Ga0070688_100464942
1199 Ga0070659_100052995
1200 Ga0070659_100899434
1201 Ga0070659_101485301
1202 Ga0070659_101711550
1203 Ga0070667_100000019
1204 Ga0070667_100006367
1205 Ga0070667_100037194
1206 Ga0070667_100038717
1207 Ga0070667_100681738
1208 Ga0070705_100054779
1209 Ga0070705_100448402
1210 Ga0070708_100198374
1211 Ga0070708_101344162
1212 Ga0070663_100000574
1213 Ga0070663_100002941
1214 Ga0070663_101387399
1215 Ga0070678_100552397
1216 Ga0070662_100007108
1217 Ga0070662_100094062
1218 Ga0070662_100561610
1219 Ga0070662_100819864
1220 Ga0070662_101003480
1221 Ga0068867_100000001
1222 Ga0070685_10103920
1223 Ga0070685_10368722
1224 Ga0070707_101322160
1225 Ga0070679_100158874
1226 Ga0070679_100424436
1227 Ga0070684_100251597
1228 Ga0068853_100143479
1229 Ga0068853_100881719
1230 Ga0068853_100884100
1231 Ga0068853_102321716
1232 Ga0070672_100004199
1233 Ga0070686_100290882
1234 Ga0070665_100002434
1235 Ga0070665_100009702
1236 Ga0070665_100095381
1237 Ga0070665_100378831
1238 Ga0070665_100420653
1239 Ga0070665_100895973
1240 Ga0070665_101432299
1241 Ga0068855_100218364
1242 Ga0068855_100577260
1243 Ga0068855_101048138
1244 Ga0068855_101587902
1245 Ga0068855_102121698
1246 Ga0068857_100021366
1247 Ga0068857_100637109
1248 Ga0068857_100711507
1249 Ga0068854_100000483
1250 Ga0068854_100301862
1251 Ga0068854_100538554
1252 Ga0068854_101277453
1253 Ga0068856_100003591
1254 Ga0068856_100020542
1255 Ga0068856_100312622
1256 Ga0068852_100028295
1257 Ga0068852_100608851
1258 Ga0068852_101516957
1259 Ga0068859_100003505
1260 Ga0068859_100023533
1261 Ga0068859_100034581
1262 Ga0068859_100216629
1263 Ga0068859_100679313
1264 Ga0068859_100859376
1265 Ga0068864_100000005
1266 Ga0068864_100030140
1267 Ga0068864_100466728
1268 Ga0068861_100004980
1269 Ga0068861_100154977
1270 Ga0068851_10074177
1271 Ga0068863_100000001
1272 Ga0068863_100000582
1273 Ga0068863_100067996
1274 Ga0068863_100084694
1275 Ga0068863_100137511
1276 Ga0068863_100313791
1277 Ga0068858_100010355
1278 Ga0068858_100034454
1279 Ga0068858_100380650
1280 Ga0068860_100000036
1281 Ga0068860_100001081
1282 Ga0068860_100004358
1283 Ga0068860_100044110
1284 Ga0068860_100115216
1285 Ga0068860_100263556
1286 Ga0068860_100310382
1287 Ga0068860_102676641
1288 Ga0068862_100000001
1289 Ga0068862_100000169
1290 Ga0068862_100001451
1291 Ga0068862_100006085
1292 Ga0068862_100021177
1293 Ga0068862_100049285
1294 Ga0068862_100087044
1295 Ga0068862_101234307
1296 Ga0081455_10000255
1297 Ga0081455_10023602
1298 Ga0081538_10004148
1299 Ga0081538_10036760
1300 Ga0075364_10197055
1301 Ga0075364_10888517
1302 Ga0075366_10043167
1303 Ga0075366_10245806
1304 Ga0075366_10576769
1305 Ga0075366_10726065
1306 Ga0075366_10801680
1307 Ga0097621_100001076
1308 Ga0075370_10043587
1309 Ga0075370_10637142
1310 Ga0068871_100067527
1311 Ga0068871_101210368
1312 Ga0068865_100000003
1313 Ga0097620_100003505
1314 Ga0097620_100023532
1315 Ga0097620_100034580
1316 Ga0097620_100216626
1317 Ga0097620_100679134
1318 Ga0097620_100859461
1319 Ga0105251_10012362
1320 Ga0105251_10638162
1321 Ga0105244_10606409
1322 Ga0105250_10006517
1323 Ga0105240_10015679
1324 Ga0105240_10025126
1325 Ga0105240_10091793
1326 Ga0105240_10318721
1327 Ga0105240_10744819
1328 Ga0105240_12089073
1329 Ga0105245_10000113
1330 Ga0105245_10032215
1331 Ga0105247_10001891
1332 Ga0105247_10369422
1333 Ga0105243_10000373
1334 Ga0105243_10328860
1335 Ga0105243_10942050
1336 Ga0105241_10038453
1337 Ga0105241_10707420
1338 Ga0105242_10000165
1339 Ga0105248_10001558
1340 Ga0105248_10024425
1341 Ga0105248_10043233
1342 Ga0105248_10088281
1343 Ga0105248_13138180
1344 Ga0105237_10044206
1345 Ga0105237_11408470
1346 Ga0105237_11679876
1347 Ga0105237_12603792
1348 Ga0105238_10635331
1349 Ga0105238_11154457
1350 Ga0105238_11442421
1351 Ga0105249_10000045
1352 Ga0105249_10019753
1353 Ga0105249_10037409
1354 Ga0105249_10084345
1355 Ga0105249_10265973
1356 Ga0105249_10758182
1357 Ga0105239_10000367
1358 Ga0105239_10012172
1359 Ga0105239_10326543
1360 Ga0105239_10846266
1361 Ga0105239_10931845
1362 Ga0105246_10001620
1363 Ga0157326_1000423
1364 Ga0157373_10081550
1365 Ga0157373_10136804
1366 Ga0157373_10232191
1367 Ga0157371_10160163
1368 Ga0157371_10492244
1369 Ga0157371_11482642
1370 Ga0157371_11598663
1371 Ga0157371_11604795
1372 Ga0157370_10000069
1373 Ga0157370_10057965
1374 Ga0157370_10174746
1375 Ga0157370_10214812
1376 Ga0157370_10647775
1377 Ga0157370_10971235
1378 Ga0157370_11695857
1379 Ga0157369_10012597
1380 Ga0157369_10109686
1381 Ga0157369_10173906
1382 Ga0157369_10174888
1383 Ga0157369_12006581
1384 Ga0157369_12357748
1385 Ga0157374_10100942
1386 Ga0157374_10393274
1387 Ga0157374_10432242
1388 Ga0157378_10002300
1389 Ga0163162_10016081
1390 Ga0163162_10019579
1391 Ga0163162_10301457
1392 Ga0163162_12257592
1393 Ga0163162_13217757
1394 Ga0157372_10113522
1395 Ga0157372_10118609
1396 Ga0157372_10209575
1397 Ga0157372_10258817
1398 Ga0157372_10288298
1399 Ga0157372_10337590
1400 Ga0157372_10567943
1401 Ga0157372_10932088
1402 Ga0157372_12775511
1403 Ga0157375_10041491
1404 Ga0157375_10798349
1405 Ga0163163_10030114
1406 Ga0157380_10000029
1407 Ga0157380_10001161
1408 Ga0157380_10230670
1409 Ga0157380_12204024
1410 Ga0182008_10307738
1411 Ga0157377_10067056
1412 Ga0157379_10128162
1413 Ga0157379_10770590
1414 Ga0157376_10000089
1415 Ga0163161_10000101
1416 Ga0163161_10019426
1417 Ga0163161_10030597
1418 Ga0163161_10148380
1419 Ga0163161_11831506
1420 Ga0206356_11727543
1421 Ga0206352_10131959
1422 Ga0213876_10024618
1423 Ga0213876_10601056
1424 Ga0213875_10009905
1425 Ga0213875_10524352
1426 Ga0209147_103605
1427 Ga0207427_101450
1428 Ga0207425_1000041
1429 Ga0207425_1015629
1430 Ga0209026_1004345
1431 Ga0209148_1000238
1432 Ga0209148_1001034
1433 Ga0209129_1002094
1434 Ga0209233_1000079
1435 Ga0209233_1073702
1436 Ga0209565_1000008
1437 Ga0209565_1000134
1438 Ga0209455_1000952
1439 Ga0209455_1056735
1440 Ga0209673_1002352
1441 Ga0209673_1029162
1442 Ga0209675_1009250
1443 Ga0209676_1026408
1444 Ga0209025_1000068
1445 Ga0209564_1080218
1446 Ga0209758_1000004
1447 Ga0209758_1012697
1448 Ga0209050_1000001
1449 Ga0209050_1000581
1450 Ga0209050_1000687
1451 Ga0209050_1007158
1452 Ga0209256_1000009
1453 Ga0209256_1000010
1454 Ga0207426_1037675
1455 Ga0209051_1000191
1456 Ga0209257_1000876
1457 Ga0209257_1002353
1458 Ga0209257_1002898
1459 Ga0209257_1003401
1460 Ga0209257_1037487
1461 Ga0209257_1100855
1462 Ga0207697_10006525
1463 Ga0207697_10530809
1464 Ga0207656_10012218
1465 Ga0207656_10159701
1466 Ga0207696_1007265
1467 Ga0207713_1010142
1468 Ga0207713_1036906
1469 Ga0207710_10007240
1470 Ga0207710_10012300
1471 Ga0207710_10207976
1472 Ga0207710_10331102
1473 Ga0207688_10409565
1474 Ga0207688_10846280
1475 Ga0207688_11043763
1476 Ga0207680_10000010
1477 Ga0207680_10000186
1478 Ga0207680_10093912
1479 Ga0207647_10000038
1480 Ga0207647_10002647
1481 Ga0207647_10032481
1482 Ga0207647_10041942
1483 Ga0207647_10065904
1484 Ga0207647_10095073
1485 Ga0207647_10207898
1486 Ga0207647_10212165
1487 Ga0207647_10283643
1488 Ga0207647_10393125
1489 Ga0207645_10003616
1490 Ga0207705_10000121
1491 Ga0207705_10000365
1492 Ga0207705_10014470
1493 Ga0207705_10135124
1494 Ga0207705_10159690
1495 Ga0207654_10000375
1496 Ga0207654_10080510
1497 Ga0207654_10098883
1498 Ga0207695_10001183
1499 Ga0207695_10016421
1500 Ga0207695_10021724
1501 Ga0207695_10031555
1502 Ga0207695_10077775
1503 Ga0207695_10223979
1504 Ga0207695_10873246
1505 Ga0207671_10001192
1506 Ga0207671_10027639
1507 Ga0207671_11237598
1508 Ga0207671_11279455
1509 Ga0207662_11126671
1510 Ga0207657_10015487
1511 Ga0207657_10026870
1512 Ga0207657_10048996
1513 Ga0207657_10387615
1514 Ga0207657_11006315
1515 Ga0207649_10150506
1516 Ga0207649_10167287
1517 Ga0207649_10831047
1518 Ga0207649_11059835
1519 Ga0207652_10134787
1520 Ga0207652_10286625
1521 Ga0207681_10000002
1522 Ga0207681_10000005
1523 Ga0207681_10000109
1524 Ga0207681_10000183
1525 Ga0207681_10033288
1526 Ga0207681_10094028
1527 Ga0207681_10122960
1528 Ga0207681_10716631
1529 Ga0207694_10002087
1530 Ga0207694_10091001
1531 Ga0207694_10345340
1532 Ga0207694_10637068
1533 Ga0207694_10801093
1534 Ga0207650_10000004
1535 Ga0207650_10002904
1536 Ga0207650_10006404
1537 Ga0207650_10049447
1538 Ga0207650_10174974
1539 Ga0207659_10136023
1540 Ga0207687_10000225
1541 Ga0207687_10010076
1542 Ga0207644_10000002
1543 Ga0207644_10000012
1544 Ga0207644_10000067
1545 Ga0207644_10001857
1546 Ga0207644_10022749
1547 Ga0207644_10700505
1548 Ga0207690_10157914
1549 Ga0207690_10186911
1550 Ga0207690_10337182
1551 Ga0207690_10342161
1552 Ga0207690_10356195
1553 Ga0207690_10878067
1554 Ga0207706_10008805
1555 Ga0207706_10033279
1556 Ga0207706_10083285
1557 Ga0207706_10138164
1558 Ga0207706_10198802
1559 Ga0207706_11217586
1560 Ga0207686_10001878
1561 Ga0207709_10000173
1562 Ga0207709_10088718
1563 Ga0207709_11210901
1564 Ga0207669_10046739
1565 Ga0207669_11000337
1566 Ga0207704_10000001
1567 Ga0207691_10009162
1568 Ga0207711_10000075
1569 Ga0207711_10024088
1570 Ga0207711_10114106
1571 Ga0207711_10236570
1572 Ga0207711_11362142
1573 Ga0207689_10000744
1574 Ga0207689_11445008
1575 Ga0207661_10482382
1576 Ga0207661_11506624
1577 Ga0207679_10123611
1578 Ga0207679_10140360
1579 Ga0207667_10000016
1580 Ga0207667_10011748
1581 Ga0207667_10112317
1582 Ga0207667_10498960
1583 Ga0207667_10638165
1584 Ga0207651_10000002
1585 Ga0207651_11013347
1586 Ga0207712_10000014
1587 Ga0207712_10000174
1588 Ga0207712_10018137
1589 Ga0207712_10057696
1590 Ga0207712_10092123
1591 Ga0207712_10657395
1592 Ga0207712_11277392
1593 Ga0207712_11688390
1594 Ga0207668_10000081
1595 Ga0207668_10000304
1596 Ga0207668_10005340
1597 Ga0207668_10083673
1598 Ga0207668_10085277
1599 Ga0207668_10328540
1600 Ga0207668_10484314
1601 Ga0207640_10000063
1602 Ga0207640_10031448
1603 Ga0207640_10062003
1604 Ga0207640_10100271
1605 Ga0207640_10157229
1606 Ga0207640_11027507
1607 Ga0207640_11246724
1608 Ga0207640_11397633
1609 Ga0207658_10000002
1610 Ga0207658_10001566
1611 Ga0207658_10004095
1612 Ga0207658_10008782
1613 Ga0207658_10018656
1614 Ga0207658_10819713
1615 Ga0207677_10000030
1616 Ga0207703_10005351
1617 Ga0207703_10008030
1618 Ga0207703_10009134
1619 Ga0207703_10124179
1620 Ga0207639_10000213
1621 Ga0207639_10012302
1622 Ga0207639_10036850
1623 Ga0207639_10122498
1624 Ga0207639_10602963
1625 Ga0207639_10828173
1626 Ga0207678_10000857
1627 Ga0207678_10001793
1628 Ga0207678_10088208
1629 Ga0207702_10000887
1630 Ga0207702_10002945
1631 Ga0207702_10019109
1632 Ga0207641_10000001
1633 Ga0207641_10000099
1634 Ga0207641_10002512
1635 Ga0207641_10004505
1636 Ga0207641_10013693
1637 Ga0207641_10014410
1638 Ga0207641_11282650
1639 Ga0207648_10000001
1640 Ga0207676_10000006
1641 Ga0207676_10000770
1642 Ga0207676_10022559
1643 Ga0207674_10131652
1644 Ga0207674_10300559
1645 Ga0207674_10337148
1646 Ga0207674_11129632
1647 Ga0207674_11201849
1648 Ga0207675_100000358
1649 Ga0207675_100001138
1650 Ga0207675_100230090
1651 Ga0207683_10182888
1652 Ga0207698_10034383
1653 Ga0207698_10130218
1654 Ga0207698_10201601
1655 Ga0207698_10955811
1656 Ga0207698_12752071
1657 Ga0209371_1085272
1658 Ga0209813_10000051
1659 Ga0268266_10000009
1660 Ga0268266_10002003
1661 Ga0268266_10006189
1662 Ga0268266_10158947
1663 Ga0268266_10211526
1664 Ga0268266_10315170
1665 Ga0268266_10422983
1666 Ga0268266_11019591
1667 Ga0268266_11411114
1668 Ga0268265_10000001
1669 Ga0268265_10000045
1670 Ga0268265_10000047
1671 Ga0268265_10000285
1672 Ga0268265_10004726
1673 Ga0268265_10017233
1674 Ga0268265_10146980
1675 Ga0268265_10315643
1676 Ga0268265_10387566
1677 Ga0268265_11127984
1678 Ga0268264_10000001
1679 Ga0268264_10000010
1680 Ga0268264_10000023
1681 Ga0268264_10004259
1682 Ga0268264_10012572
1683 Ga0268264_10105564
1684 Ga0268264_10209613
1685 Ga0268264_10405038
1686 Ga0307517_10633740
1687 Ga0268256_1046229
1688 Ga0314311_1203820
1689 Ga0265320_10000034
1690 Ga0265325_10023456
1691 Ga0265325_10037185
1692 Ga0307513_10209984
1693 Ga0307408_100051500
1694 Ga0307408_101128429
1695 Ga0307408_101389987
1696 Ga0265313_10000665
1697 Ga0265314_10019631
1698 Ga0265314_10042189
1699 Ga0265314_10118950
1700 Ga0307405_10055116
1701 Ga0307405_10530365
1702 Ga0307405_10949213
1703 Ga0307405_11486235
1704 Ga0307413_10332327
1705 Ga0307413_11513892
1706 Ga0307410_10027090
1707 Ga0307410_11135650
1708 Ga0307406_10589289
1709 Ga0307406_10614399
1710 Ga0307406_10706803
1711 Ga0307406_11005598
1712 Ga0307406_11917748
1713 Ga0307407_10257420
1714 Ga0307412_10015626
1715 Ga0307412_10514991
1716 Ga0307412_10947513
1717 Ga0307412_11429176
1718 Ga0307409_101359966
1719 Ga0307409_102980818
1720 Ga0307416_100014919
1721 Ga0307414_11712720
1722 Ga0307414_11795155
1723 Ga0307411_10271081
1724 Ga0307411_10440296
1725 Ga0307411_12160541
1726 Ga0307510_10148726
1727 Ga0373923_0143888
1728 Ga0373946_0647350
1729 Ga0395899_0001521
1730 Ga0395900_0009291
1731 Ga0395900_1114422
1732 Ga0395898_1303005
1733 Ga0395905_0026896
1734 Ga0395905_0516629
1735 Ga0436364_0741438
1736 Ga0436364_0878110
1737 Ga0395901_0073008
1738 Ga0395901_2127733
1739 Ga0436365_0212007
1740 Ga0436365_0922307
1741 Ga0436365_1667312
1742 Ga0436365_1773361
1743 Ga0436361_1051839
1744 Ga0439436_0009694
1745 Ga0439439_0001779
1746 Ga0439447_148918
1747 Ga0439461_0000498
1748 Ga0439461_0003679
1749 Ga0439461_0080904
1750 Ga0439465_0004274
1751 Ga0439465_0004757
1752 Ga0451793_0810995
1753 Ga0451793_1584048
1754 Ga0451802_1834731
1755 Ga0451806_522421
1756 Ga0451807_0720757
1757 Ga0451833_1022453
1758 Ga0451837_1536393
1759 Ga0451841_0590837
1760 Ga0451853_3774724
1761 Ga0439431_0038651
1762 Ga0439442_150916
1763 Ga0439445_0033115
1764 Ga0439448_0002459
1765 Ga0439432_000640
1766 Ga0439432_022961
1767 Ga0439452_018803
1768 Ga0439457_024428
1769 Ga0439462_0002776
1770 Ga0450922_019334
1771 Ga0439446_0034458
1772 Ga0439458_0000137
1773 Ga0450909_012035
1774 Ga0439434_0020110
1775 Ga0439460_0201787
1776 Ga0466972_0086674
1777 Ga0466965_0529846
1778 Ga0466963_0311463
1779 Ga0466970_0256774
1780 Ga0466957_0347333
1781 Ga0451576_0436970
1782 Ga0466958_0391983
1783 Ga0466967_0379221
1784 Ga0466967_0633257
1785 Ga0466967_2162402
1786 Ga0495617_011498
1787 Ga0495627_000156
1788 Ga0495627_000578
1789 Ga0495627_034662
1790 Ga0495638_0000758
1791 Ga0495638_0188677
1792 Ga0495651_0721380
1793 Ga0495650_0001027
1794 Ga0495650_0227391
1795 Ga0495584_0078046
1796 Ga0495585_0127704
1797 Ga0495585_0567920
1798 Ga0495607_0093490
1799 Ga0495583_0220617
1800 Ga0495606_0072058
1801 Ga0495610_0000291
1802 Ga0495610_0144969
1803 Ga0495616_0001456
1804 Ga0495632_0000006
1805 Ga0495637_0000784
1806 Ga0495637_0010852
1807 Ga0495637_0065588
1808 Ga0495643_0000021
1809 Ga0495643_0523213
1810 Ga0495648_0010683
1811 Ga0495648_0045945
1812 Ga0495663_0000008
1813 Ga0495663_0018920
1814 Ga0495663_0053401
1815 Ga0495663_0242178
1816 Ga0495654_0116202
1817 Ga0495597_0031259
1818 Ga0495633_0000190
1819 Ga0495633_0002635
1820 Ga0495633_0013695
1821 Ga0495633_0072188
1822 Ga0495633_0146062
1823 Ga0495668_0002221
1824 Ga0495668_0105921
1825 Ga0495668_0574724
1826 Ga0495625_0000629
1827 Ga0495625_0215510
1828 Ga0495625_0393492
1829 Ga0495661_0125781
1830 Ga0495670_0000002
1831 Ga0495670_0427746
1832 Ga0495671_0000017
1833 Ga0495649_0327109
1834 Ga0495636_0180483
1835 Ga0495672_0174663
1836 Ga0495672_0212818
1837 Ga0495673_0028297
1838 Ga0495681_0000098
1839 Ga0495681_0008268
1840 Ga0495681_0009646
1841 Ga0495681_0326806
1842 Ga0495686_0005063
1843 Ga0495686_0008463
1844 Ga0495686_0029938
1845 Ga0495686_0042056
1846 Ga0495686_0248449
1847 Ga0495686_0254178
1848 Ga0495686_0377163
1849 Ga0495686_0686152
1850 Ga0496100_0082969
1851 Ga0496100_0182282
1852 Ga0496100_1223371
1853 Ga0496101_0111668
1854 Ga0496101_0138327
1855 Ga0496101_0333953
1856 Ga0496101_0346342
1857 Ga0496102_0000069
1858 Ga0496102_0000615
1859 Ga0496102_0172254
1860 Ga0496102_0298555
1861 Ga0496102_0681373
1862 Ga0496103_0000173
1863 Ga0496103_0009010
1864 Ga0496103_0033025
1865 Ga0496103_0132529
1866 Ga0496103_0224202
1867 Ga0496103_0651014
1868 Ga0496104_0000081
1869 Ga0496104_0059792
1870 Ga0496105_0000034
1871 Ga0496105_0090922
1872 Ga0496105_0363545
1873 Ga0496105_0615800
1874 Ga0496106_0076352
1875 Ga0496106_0168900
1876 Ga0496106_0222120
1877 Ga0496107_0173558
1878 Ga0496107_0252341
1879 Ga0496109_0067327
1880 Ga0496109_0116418
1881 Ga0496109_0353061
1882 Ga0496109_0539887
1883 Ga0496110_0093856
1884 Ga0496110_0124785
1885 Ga0496110_0325345
1886 Ga0496110_1131155
1887 Ga0496111_0328540
1888 Ga0496111_0458563
1889 Ga0496112_0116278
1890 Ga0496112_0663427
1891 Ga0496113_0000101
1892 Ga0496113_0366514
1893 Ga0496113_1445932
1894 Ga0496115_0001129
1895 Ga0496115_0108956
1896 Ga0496115_1026514
1897 Ga0496116_0000062
1898 Ga0496116_0000566
1899 Ga0496116_0032138
1900 Ga0496116_0050745
1901 Ga0496116_0101176
1902 Ga0496116_0361464
1903 Ga0496117_0000146
1904 Ga0496117_0000485
1905 Ga0496117_0033071
1906 Ga0496117_0046000
1907 Ga0496117_0055578
1908 Ga0496117_0089533
1909 Ga0496117_0251385
1910 Ga0496117_0312713
1911 Ga0496117_0318261
1912 Ga0496117_0330651
1913 Ga0496118_0000190
1914 Ga0496118_0003742
1915 Ga0496118_0015425
1916 Ga0496118_0015970
1917 Ga0496118_0057773
1918 Ga0496118_0076829
1919 Ga0496118_0079363
1920 Ga0496118_0104776
1921 Ga0496118_0127031
1922 Ga0496118_0139050
1923 Ga0496118_0370348
1924 Ga0496119_0000057
1925 Ga0496119_0072971
1926 Ga0496119_0180016
1927 Ga0496119_0186126
1928 Ga0496119_0313654
1929 Ga0496120_0005360
1930 Ga0496120_0110614
1931 Ga0496120_0178484
1932 Ga0496120_0185785
1933 Ga0496120_0487953
1934 Ga0496121_0005623
1935 Ga0496121_0010499
1936 Ga0496121_0015601
1937 Ga0496121_0016723
1938 Ga0496121_0017016
1939 Ga0496121_0058069
1940 Ga0496121_0115314
1941 Ga0496121_0180678
1942 Ga0496121_0205134
1943 Ga0496121_0568689
1944 Ga0496121_0907952
1945 Ga0496122_0000723
1946 Ga0496122_0003556
1947 Ga0496122_0006671
1948 Ga0496122_0026134
1949 Ga0496122_0366886
1950 Ga0496122_0420631
1951 Ga0496123_0000545
1952 Ga0496123_0002968
1953 Ga0496123_0016815
1954 Ga0496123_0062259
1955 Ga0496123_0235440
1956 Ga0496124_0000546
1957 Ga0496124_0000874
1958 Ga0496124_0002439
1959 Ga0496124_0006061
1960 Ga0496124_0023588
1961 Ga0496124_0023873
1962 Ga0496124_0081473
1963 Ga0496124_0299780
1964 Ga0496124_0474242
1965 Ga0496124_0507938
1966 Ga0496124_0805486
1967 Ga0496125_0002465
1968 Ga0496125_0006988
1969 Ga0496125_0033431
1970 Ga0496125_0034343
1971 Ga0496125_0071024
1972 Ga0496125_0355978
1973 Ga0496125_0415581
1974 Ga0496125_0439744
1975 Ga0496126_0000028
1976 Ga0496126_0006838
1977 Ga0496126_0016996
1978 Ga0496126_0034229
1979 Ga0496126_0054886
1980 Ga0496126_0121519
1981 Ga0496126_0150910
1982 Ga0496126_0372477
1983 Ga0496126_0632782
1984 Ga0496126_1231595
1985 Ga0495678_014836
1986 Ga0495682_0279655
1987 Ga0501290_000237
1988 Ga0501292_000042
1989 Ga0501294_000032
1990 Ga0501297_009582
1991 Ga0501300_000392
1992 Ga0501302_002270
1993 Ga0501315_000962
1994 Ga0501317_002915
1995 Ga0501318_049501
1996 Ga0501321_023679
1997 Ga0501335_000615
1998 Ga0501337_013057
1999 Ga0501033_0085723
2000 Ga0501034_0099962
2001 Ga0501034_0285394
2002 Ga0501038_0164937
2003 Ga0501038_0323317
2004 Ga0501038_0770013
2005 Ga0501041_0866607
2006 Ga0501042_0040621
2007 Ga0501042_0260954
2008 Ga0501043_0113159
2009 Ga0501046_0030454
2010 Ga0501047_0000731
2011 Ga0501047_0450251
2012 Ga0501047_0935022
2013 Ga0501070_0968333
2014 Ga0501071_0191090
2015 Ga0501071_1187966
2016 Ga0501073_0139551
2017 Ga0501074_0761420
2018 Ga0501075_0834129
2019 Ga0501076_0426670
2020 Ga0501076_1405930
2021 Ga0501077_0216387
2022 Ga0501206_003378
2023 Ga0501211_000103
2024 Ga0501222_001746
2025 Ga0501223_004016
2026 Ga0501223_036809
2027 Ga0501224_000754
2028 Ga0501227_028030
2029 Ga0501233_012436
2030 Ga0501235_001097
2031 Ga0501236_053975
2032 Ga0501259_001391
2033 Ga0501261_000021
2034 Ga0501221_003846
2035 Ga0501225_0006973
2036 Ga0501225_0043405
2037 Ga0501079_0374717
2038 Ga0501080_0702389
2039 Ga0501083_0271764
2040 Ga0501083_0292932
2041 Ga0501264_008163
2042 Ga0501276_013553
2043 Ga0501279_000010
2044 Ga0501280_000064
2045 Ga0501280_001057
2046 Ga0501281_00086
2047 Ga0501282_000404
2048 Ga0501283_001453
2049 Ga0501035_0179700
2050 Ga0501035_0244287
2051 Ga0501035_1048316
2052 Ga0501044_0134255
2053 Ga0501044_0204047
2054 Ga0501044_0896240
2055 Ga0501226_021697
2056 Ga0501284_02268
2057 nmdc:mga03n38_266481_c1
2058 nmdc:mga00v17_75476_c1
2059 nmdc:mga00v17_911672_c1
2060 nmdc:mga0k408_344198_c1
2061 nmdc:mga0k408_529690_c1
2062 nmdc:mga0k408_583414_c1
2063 nmdc:mga0k408_832522_c1
2064 nmdc:mga06z11_17_c1
2065 nmdc:mga04h51_146_c1
2066 nmdc:mga04h51_411911_c1
2067 nmdc:mga07m45_111328_c1
2068 nmdc:mga07m45_567769_c1
2069 nmdc:mga07m45_60295_c1
2070 nmdc:mga05p37_171786_c1
2071 nmdc:mga05p37_2021674_c1
2072 Ga0500643_010906
2073 Ga0500647_0376821
2074 Ga0500651_0086862
2075 Ga0500566_0004538
2076 Ga0500641_0004173
2077 Ga0500641_0136367
2078 Ga0500556_0189304
2079 Ga0500562_070755
2080 Ga0500592_000031
2081 Ga0500592_001156
2082 Ga0500594_0054708
2083 Ga0500595_000572
2084 Ga0500595_052569
2085 Ga0500595_055810
2086 Ga0500608_066104
2087 Ga0500618_014810
2088 Ga0500626_092170
2089 Ga0500642_0014296
2090 Ga0500652_278543
2091 Ga0500655_000251
2092 Ga0500658_0010885
2093 Ga0500658_0014446
2094 Ga0500658_0267841
2095 Ga0500658_0476850
2096 Ga0500559_0159324
2097 Ga0500559_0232776
2098 Ga0500564_386623
2099 Ga0500568_0018906
2100 Ga0500568_0092427
2101 Ga0500568_0195118
2102 Ga0500588_0071841
2103 Ga0500590_000131
2104 Ga0500604_0036484
2105 Ga0500604_0071415
2106 Ga0500616_0008241
2107 Ga0500616_0222499
2108 Ga0500616_0284202
2109 Ga0500616_0291538
2110 Ga0500622_0025695
2111 Ga0500622_0077848
2112 Ga0500622_0091256
2113 Ga0500624_000063
2114 Ga0500627_0001223
2115 Ga0500627_0027041
2116 Ga0500627_0378067
2117 Ga0500639_139272
2118 Ga0500636_0058873
2119 Ga0500570_004079
2120 Ga0500645_180888
2121 Ga0500645_223100
2122 Ga0500601_034828
2123 Ga0501084_0791318
2124 Ga0587066_169647
2125 Ga0587077_168426
2126 Ga0587088_134191
2127 Ga0587094_030537
2128 Ga0587067_076756
2129 Ga0587069_140777
2130 Ga0501082_0979656
2131 2511130325
2132 2523469825
2133 2585262260
2134 2600225503
2135 2643731598
2136 2644036775
2137 2644042074
2138 2644126038
2139 2644394283
2140 2738709615
2141 2738848040
2142 2738863769
2143 2739296287
2144 2739348858
2145 2739357965
2146 2819713935
2147 2879165166
2148 2917557483
2149 2928528495
2150 2928960419
2151 2928970040
2152 2990266882
2153 2993693827
2154 8054303052

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

17

78

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8816 4 77
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8709 4 77
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.831 3 76
1v60-assembly1.cif.gz_A solution structure of bola1 protein from mus musculus 0.8119 6 76
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8104 3 76
ID Description Score Start End Superfamily
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8816 4 77 3.30.300.90
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8709 4 77 3.30.300.90
af_Q53S33_27_107_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8547 8 77 3.30.300.90
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8508 1 75 3.10.20.90
af_Q54GP0_1_85_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8479 3 75 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A258E1I0-F1-model_v4 BolA family transcriptional regulator 0.9824 1 77
AF-A0A357LA00-F1-model_v4 BolA family transcriptional regulator 0.976 1 77
AF-A0A5C8PQA4-F1-model_v4 BolA family transcriptional regulator 0.9741 1 77
AF-A0A1G3ISV3-F1-model_v4 ATP-binding protein 0.9714 1 57 GO:0005524
AF-A0A0S6X249-F1-model_v4 BolA-like protein 0.9686 1 76

Map