F489635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1079 | 377 | 1079 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100306354|Ga0070671_1003063541 |
| Length | 377 |
| Sequence | MPPEAGQAGRRSGALGVEQPPTRRGTPERRPRVPPRDRRARFVGLVRIFSGIQPTGRKHLGNYIGAIRQYVEGQDRGDPAIYCIVDLHAITVAYEPSELRERLYDTTAILIAAGLDPERCILFRQSDVREHTELCWLLSSVTAIGELNRMHQFRDKSLAQRELVSSGLLFYPVLQAADVLAYRAHEVPVGEDQREHLELMRDVARRFNARYGEDILVVPEHRIPEVGARIMDLQEPTRKMSTTGGTEEGTVLVLDDPKTIEKKIKRAVTDSGTEILRAPDKPGVSNLIDVLAVARGVSPAAVEEDMRSARGYGDLKGAVAEAVVGMLAPVRERYAEIRPDEDRLEAILAQGADKARTLASATLADVRDAMGVGAPPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 194 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 224 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 227 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 236 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 310 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 311 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 312 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 313 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 368 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 369 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 370 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 373 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 374 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.41 |
| Nodule | 0 |
| Rhizoplane | 12.42 |
| Rhizosphere | 82.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000008 | 3300001977 | Bacteria | 19234 |
| 2 | JGI24740J21852_10008667 | 3300001979 | Bacteria | 4037 |
| 3 | JGI24748J21848_1001192 | 3300002074 | Bacteria | 2834 |
| 4 | JGI24034J26672_10002685 | 3300002239 | Bacteria | 2450 |
| 5 | JGI24742J22300_10005449 | 3300002244 | Bacteria | 2093 |
| 6 | JGI25406J46586_10003262 | 3300003203 | Bacteria | 7639 |
| 7 | JGI25406J46586_10035344 | 3300003203 | Bacteria | 1825 |
| 8 | JGI25404J52841_10002501 | 3300003659 | Bacteria | 3486 |
| 9 | Ga0070658_10073527 | 3300005327 | Bacteria | 2803 |
| 10 | Ga0070676_10115690 | 3300005328 | Bacteria | 1676 |
| 11 | Ga0070683_100025124 | 3300005329 | Bacteria | 5346 |
| 12 | Ga0070683_100042159 | 3300005329 | Bacteria | 4202 |
| 13 | Ga0070683_100062589 | 3300005329 | Bacteria | 3460 |
| 14 | Ga0070683_100073405 | 3300005329 | Bacteria | 3195 |
| 15 | Ga0070683_100075467 | 3300005329 | Bacteria | 3150 |
| 16 | Ga0070683_100376039 | 3300005329 | Bacteria | 1354 |
| 17 | Ga0070690_100062046 | 3300005330 | Bacteria | 2410 |
| 18 | Ga0070677_10000190 | 3300005333 | Bacteria | 21167 |
| 19 | Ga0068869_100104385 | 3300005334 | Bacteria | 2148 |
| 20 | Ga0068869_100139148 | 3300005334 | Bacteria | 1873 |
| 21 | Ga0070666_10012316 | 3300005335 | Bacteria | 5392 |
| 22 | Ga0070680_100166436 | 3300005336 | Bacteria | 1854 |
| 23 | Ga0070682_100000017 | 3300005337 | Bacteria | 235228 |
| 24 | Ga0070682_100000049 | 3300005337 | Bacteria | 127229 |
| 25 | Ga0070682_100006477 | 3300005337 | Bacteria | 6583 |
| 26 | Ga0068868_100000026 | 3300005338 | Bacteria | 81980 |
| 27 | Ga0068868_100006160 | 3300005338 | Bacteria | 8479 |
| 28 | Ga0068868_100056518 | 3300005338 | Bacteria | 3099 |
| 29 | Ga0068868_100116141 | 3300005338 | Bacteria | 2179 |
| 30 | Ga0070660_100013156 | 3300005339 | Bacteria | 5930 |
| 31 | Ga0070660_100024817 | 3300005339 | Bacteria | 4452 |
| 32 | Ga0070689_100062567 | 3300005340 | Bacteria | 2896 |
| 33 | Ga0070689_100137471 | 3300005340 | Bacteria | 1963 |
| 34 | Ga0070691_10000001 | 3300005341 | Bacteria | 94744 |
| 35 | Ga0070691_10011263 | 3300005341 | Bacteria | 4081 |
| 36 | Ga0070691_10032476 | 3300005341 | Bacteria | 2453 |
| 37 | Ga0070661_100000492 | 3300005344 | Bacteria | 30277 |
| 38 | Ga0070661_100087761 | 3300005344 | Bacteria | 2301 |
| 39 | Ga0070661_100173092 | 3300005344 | Bacteria | 1640 |
| 40 | Ga0070692_10012752 | 3300005345 | Bacteria | 3902 |
| 41 | Ga0070692_10029433 | 3300005345 | Bacteria | 2737 |
| 42 | Ga0070668_100003085 | 3300005347 | Bacteria | 12311 |
| 43 | Ga0070668_100037834 | 3300005347 | Bacteria | 3686 |
| 44 | Ga0070669_100369034 | 3300005353 | Bacteria | 1169 |
| 45 | Ga0070675_100000025 | 3300005354 | Bacteria | 115134 |
| 46 | Ga0070675_100108017 | 3300005354 | Bacteria | 2350 |
| 47 | Ga0070671_100306354 | 3300005355 | Bacteria | 1352 |
| 48 | Ga0070674_100000005 | 3300005356 | Bacteria | 168443 |
| 49 | Ga0070674_100000009 | 3300005356 | Bacteria | 143336 |
| 50 | Ga0070674_100117209 | 3300005356 | Bacteria | 1966 |
| 51 | Ga0070674_100135857 | 3300005356 | Bacteria | 1839 |
| 52 | Ga0070673_100022147 | 3300005364 | Bacteria | 4621 |
| 53 | Ga0070673_100047121 | 3300005364 | Bacteria | 3352 |
| 54 | Ga0070688_100000069 | 3300005365 | Bacteria | 50704 |
| 55 | Ga0070688_100000099 | 3300005365 | Bacteria | 44288 |
| 56 | Ga0070659_100010269 | 3300005366 | Bacteria | 6888 |
| 57 | Ga0070659_100011575 | 3300005366 | Bacteria | 6529 |
| 58 | Ga0070659_100068926 | 3300005366 | Bacteria | 2807 |
| 59 | Ga0070659_100346998 | 3300005366 | Bacteria | 1245 |
| 60 | Ga0070667_100000625 | 3300005367 | Bacteria | 34457 |
| 61 | Ga0070667_100004009 | 3300005367 | Bacteria | 12469 |
| 62 | Ga0070714_100000137 | 3300005435 | Bacteria | 58260 |
| 63 | Ga0070714_100030023 | 3300005435 | Bacteria | 4523 |
| 64 | Ga0070714_100068311 | 3300005435 | Bacteria | 3066 |
| 65 | Ga0070714_100075381 | 3300005435 | Bacteria | 2927 |
| 66 | Ga0070714_100164642 | 3300005435 | Bacteria | 2009 |
| 67 | Ga0070713_100000079 | 3300005436 | Bacteria | 60238 |
| 68 | Ga0070713_100330713 | 3300005436 | Bacteria | 1409 |
| 69 | Ga0070701_10030805 | 3300005438 | Bacteria | 2657 |
| 70 | Ga0070711_100001716 | 3300005439 | Bacteria | 12150 |
| 71 | Ga0070711_100006351 | 3300005439 | Bacteria | 7120 |
| 72 | Ga0070711_100097109 | 3300005439 | Bacteria | 2136 |
| 73 | Ga0070711_100146244 | 3300005439 | Bacteria | 1778 |
| 74 | Ga0070711_100244943 | 3300005439 | Bacteria | 1403 |
| 75 | Ga0070705_100306933 | 3300005440 | Bacteria | 1140 |
| 76 | Ga0070700_100006904 | 3300005441 | Bacteria | 6096 |
| 77 | Ga0070700_100021303 | 3300005441 | Bacteria | 3767 |
| 78 | Ga0070700_100161929 | 3300005441 | Bacteria | 1541 |
| 79 | Ga0070708_100340298 | 3300005445 | Bacteria | 1414 |
| 80 | Ga0070663_100078773 | 3300005455 | Bacteria | 2416 |
| 81 | Ga0070663_100152699 | 3300005455 | Bacteria | 1772 |
| 82 | Ga0070678_100006059 | 3300005456 | Bacteria | 7055 |
| 83 | Ga0070678_100015270 | 3300005456 | Bacteria | 4876 |
| 84 | Ga0070678_100288326 | 3300005456 | Bacteria | 1391 |
| 85 | Ga0070662_100000009 | 3300005457 | Bacteria | 142979 |
| 86 | Ga0070662_100146963 | 3300005457 | Bacteria | 1832 |
| 87 | Ga0070681_10056027 | 3300005458 | Bacteria | 3924 |
| 88 | Ga0068867_100002520 | 3300005459 | Bacteria | 12885 |
| 89 | Ga0068867_100045794 | 3300005459 | Bacteria | 3210 |
| 90 | Ga0070685_10000024 | 3300005466 | Bacteria | 101602 |
| 91 | Ga0070685_10000025 | 3300005466 | Bacteria | 100621 |
| 92 | Ga0070685_10042553 | 3300005466 | Bacteria | 2592 |
| 93 | Ga0070685_10045276 | 3300005466 | Bacteria | 2522 |
| 94 | Ga0070706_100010715 | 3300005467 | Bacteria | 8509 |
| 95 | Ga0070707_100217407 | 3300005468 | Bacteria | 1862 |
| 96 | Ga0070699_100079328 | 3300005518 | Bacteria | 2860 |
| 97 | Ga0070679_100000245 | 3300005530 | Bacteria | 45408 |
| 98 | Ga0070679_100030794 | 3300005530 | Bacteria | 5300 |
| 99 | Ga0070679_100083807 | 3300005530 | Bacteria | 3176 |
| 100 | Ga0070679_100219759 | 3300005530 | Bacteria | 1861 |
| 101 | Ga0070684_100057855 | 3300005535 | Bacteria | 3386 |
| 102 | Ga0070684_100323033 | 3300005535 | Bacteria | 1418 |
| 103 | Ga0068853_100159773 | 3300005539 | Bacteria | 2033 |
| 104 | Ga0068853_100240043 | 3300005539 | Bacteria | 1661 |
| 105 | Ga0070672_100000283 | 3300005543 | Bacteria | 28861 |
| 106 | Ga0070686_100107402 | 3300005544 | Bacteria | 1895 |
| 107 | Ga0070695_100042564 | 3300005545 | Bacteria | 2884 |
| 108 | Ga0070693_100022499 | 3300005547 | Bacteria | 3353 |
| 109 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 110 | Ga0070665_100004387 | 3300005548 | Bacteria | 14836 |
| 111 | Ga0070665_100009749 | 3300005548 | Bacteria | 9712 |
| 112 | Ga0070704_100028722 | 3300005549 | Bacteria | 3704 |
| 113 | Ga0070704_100106342 | 3300005549 | Bacteria | 2126 |
| 114 | Ga0070704_100252601 | 3300005549 | Bacteria | 1449 |
| 115 | Ga0068855_100112334 | 3300005563 | Bacteria | 3127 |
| 116 | Ga0068855_100590323 | 3300005563 | Bacteria | 1199 |
| 117 | Ga0070664_100007855 | 3300005564 | Bacteria | 8617 |
| 118 | Ga0070664_100154111 | 3300005564 | Bacteria | 2029 |
| 119 | Ga0068857_100226217 | 3300005577 | Bacteria | 1710 |
| 120 | Ga0068854_100000065 | 3300005578 | Bacteria | 76046 |
| 121 | Ga0068854_100098115 | 3300005578 | Bacteria | 2192 |
| 122 | Ga0068854_100165665 | 3300005578 | Bacteria | 1716 |
| 123 | Ga0068854_100207256 | 3300005578 | Bacteria | 1544 |
| 124 | Ga0068856_100000635 | 3300005614 | Bacteria | 38196 |
| 125 | Ga0068856_100003952 | 3300005614 | Bacteria | 14848 |
| 126 | Ga0068856_100024767 | 3300005614 | Bacteria | 5845 |
| 127 | Ga0068856_100025704 | 3300005614 | Bacteria | 5741 |
| 128 | Ga0068856_100056321 | 3300005614 | Bacteria | 3879 |
| 129 | Ga0068856_100219927 | 3300005614 | Bacteria | 1915 |
| 130 | Ga0068856_100273226 | 3300005614 | Bacteria | 1706 |
| 131 | Ga0070702_100071332 | 3300005615 | Bacteria | 2053 |
| 132 | Ga0070702_100159897 | 3300005615 | Bacteria | 1455 |
| 133 | Ga0068852_100000094 | 3300005616 | Bacteria | 59653 |
| 134 | Ga0068852_100046949 | 3300005616 | Bacteria | 3682 |
| 135 | Ga0068852_100383203 | 3300005616 | Bacteria | 1380 |
| 136 | Ga0068852_100569808 | 3300005616 | Bacteria | 1134 |
| 137 | Ga0068859_100205860 | 3300005617 | Bacteria | 2053 |
| 138 | Ga0068859_100563043 | 3300005617 | Bacteria | 1234 |
| 139 | Ga0068864_100000031 | 3300005618 | Bacteria | 215331 |
| 140 | Ga0068864_100311207 | 3300005618 | Bacteria | 1476 |
| 141 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 142 | Ga0068866_10000389 | 3300005718 | Bacteria | 20645 |
| 143 | Ga0068866_10094595 | 3300005718 | Bacteria | 1635 |
| 144 | Ga0068861_100002823 | 3300005719 | Bacteria | 11419 |
| 145 | Ga0068861_100089830 | 3300005719 | Bacteria | 2422 |
| 146 | Ga0068851_10000339 | 3300005834 | Bacteria | 21112 |
| 147 | Ga0068851_10010203 | 3300005834 | Bacteria | 4379 |
| 148 | Ga0068863_100000170 | 3300005841 | Bacteria | 70180 |
| 149 | Ga0068863_100007521 | 3300005841 | Bacteria | 10655 |
| 150 | Ga0068863_100075609 | 3300005841 | Bacteria | 3187 |
| 151 | Ga0068858_100000069 | 3300005842 | Bacteria | 105617 |
| 152 | Ga0068858_100001457 | 3300005842 | Bacteria | 24338 |
| 153 | Ga0068858_100108226 | 3300005842 | Bacteria | 2595 |
| 154 | Ga0068860_100174128 | 3300005843 | Bacteria | 2079 |
| 155 | Ga0068862_100001642 | 3300005844 | Bacteria | 20337 |
| 156 | Ga0081455_10007837 | 3300005937 | Bacteria | 11182 |
| 157 | Ga0081455_10012576 | 3300005937 | Bacteria | 8440 |
| 158 | Ga0081455_10025676 | 3300005937 | Bacteria | 5433 |
| 159 | Ga0081455_10034998 | 3300005937 | Bacteria | 4494 |
| 160 | Ga0081455_10085414 | 3300005937 | Bacteria | 2573 |
| 161 | Ga0081455_10089357 | 3300005937 | Bacteria | 2500 |
| 162 | Ga0081455_10114109 | 3300005937 | Bacteria | 2141 |
| 163 | Ga0081538_10000035 | 3300005981 | Bacteria | 120009 |
| 164 | Ga0081538_10000103 | 3300005981 | Bacteria | 83685 |
| 165 | Ga0081538_10000386 | 3300005981 | Bacteria | 50093 |
| 166 | Ga0081538_10000909 | 3300005981 | Bacteria | 31949 |
| 167 | Ga0081538_10001446 | 3300005981 | Bacteria | 24414 |
| 168 | Ga0081538_10002436 | 3300005981 | Bacteria | 18209 |
| 169 | Ga0081538_10005326 | 3300005981 | Bacteria | 11582 |
| 170 | Ga0081538_10008613 | 3300005981 | Bacteria | 8630 |
| 171 | Ga0081538_10012736 | 3300005981 | Bacteria | 6718 |
| 172 | Ga0081538_10042930 | 3300005981 | Bacteria | 2846 |
| 173 | Ga0081538_10050023 | 3300005981 | Bacteria | 2529 |
| 174 | Ga0081538_10081679 | 3300005981 | Bacteria | 1718 |
| 175 | Ga0081540_1000265 | 3300005983 | Bacteria | 55107 |
| 176 | Ga0081540_1000554 | 3300005983 | Bacteria | 36225 |
| 177 | Ga0081540_1000650 | 3300005983 | Bacteria | 32779 |
| 178 | Ga0081540_1073886 | 3300005983 | Bacteria | 1565 |
| 179 | Ga0081539_10003820 | 3300005985 | Bacteria | 17708 |
| 180 | Ga0081539_10010669 | 3300005985 | Bacteria | 7412 |
| 181 | Ga0081539_10016831 | 3300005985 | Bacteria | 5186 |
| 182 | Ga0081539_10035589 | 3300005985 | Bacteria | 2989 |
| 183 | Ga0081539_10057279 | 3300005985 | Bacteria | 2158 |
| 184 | Ga0081539_10116686 | 3300005985 | Bacteria | 1333 |
| 185 | Ga0070717_10002035 | 3300006028 | Bacteria | 14160 |
| 186 | Ga0070717_10067208 | 3300006028 | Bacteria | 2982 |
| 187 | Ga0070717_10153196 | 3300006028 | Bacteria | 1996 |
| 188 | Ga0075365_10017279 | 3300006038 | Bacteria | 4410 |
| 189 | Ga0075365_10018927 | 3300006038 | Bacteria | 4241 |
| 190 | Ga0075365_10042336 | 3300006038 | Bacteria | 2977 |
| 191 | Ga0075365_10058623 | 3300006038 | Bacteria | 2564 |
| 192 | Ga0075365_10157485 | 3300006038 | Bacteria | 1581 |
| 193 | Ga0075365_10273791 | 3300006038 | Bacteria | 1187 |
| 194 | Ga0075363_100066793 | 3300006048 | Bacteria | 1947 |
| 195 | Ga0075363_100081554 | 3300006048 | Bacteria | 1770 |
| 196 | Ga0075363_100084439 | 3300006048 | Bacteria | 1741 |
| 197 | Ga0075364_10035244 | 3300006051 | Bacteria | 3233 |
| 198 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 199 | Ga0070716_100039133 | 3300006173 | Bacteria | 2630 |
| 200 | Ga0070716_100084330 | 3300006173 | Bacteria | 1905 |
| 201 | Ga0070712_100000002 | 3300006175 | Bacteria | 288475 |
| 202 | Ga0070712_100002700 | 3300006175 | Bacteria | 10958 |
| 203 | Ga0070712_100005751 | 3300006175 | Bacteria | 7665 |
| 204 | Ga0070712_100012205 | 3300006175 | Bacteria | 5461 |
| 205 | Ga0097621_100045919 | 3300006237 | Bacteria | 3531 |
| 206 | Ga0075428_100008397 | 3300006844 | Bacteria | 11449 |
| 207 | Ga0075428_100015609 | 3300006844 | Bacteria | 8419 |
| 208 | Ga0075428_100053326 | 3300006844 | Bacteria | 4430 |
| 209 | Ga0075428_100093527 | 3300006844 | Bacteria | 3278 |
| 210 | Ga0075428_100156573 | 3300006844 | Bacteria | 2475 |
| 211 | Ga0075430_100002217 | 3300006846 | Bacteria | 16112 |
| 212 | Ga0075430_100004849 | 3300006846 | Bacteria | 11317 |
| 213 | Ga0075430_100103456 | 3300006846 | Bacteria | 2377 |
| 214 | Ga0075431_100031776 | 3300006847 | Bacteria | 5438 |
| 215 | Ga0075431_100037352 | 3300006847 | Bacteria | 5004 |
| 216 | Ga0075431_100076092 | 3300006847 | Bacteria | 3464 |
| 217 | Ga0075431_100233256 | 3300006847 | Bacteria | 1874 |
| 218 | Ga0075433_10000556 | 3300006852 | Bacteria | 24597 |
| 219 | Ga0075433_10031897 | 3300006852 | Bacteria | 4508 |
| 220 | Ga0075433_10107486 | 3300006852 | Bacteria | 2474 |
| 221 | Ga0075434_100008022 | 3300006871 | Bacteria | 9785 |
| 222 | Ga0075434_100020344 | 3300006871 | Bacteria | 6436 |
| 223 | Ga0075434_100092872 | 3300006871 | Bacteria | 3020 |
| 224 | Ga0075434_100245894 | 3300006871 | Bacteria | 1808 |
| 225 | Ga0075434_100446095 | 3300006871 | Bacteria | 1315 |
| 226 | Ga0075429_100023593 | 3300006880 | Bacteria | 5339 |
| 227 | Ga0075429_100227752 | 3300006880 | Bacteria | 1633 |
| 228 | Ga0068865_100000034 | 3300006881 | Bacteria | 84043 |
| 229 | Ga0068865_100047443 | 3300006881 | Bacteria | 2951 |
| 230 | Ga0068865_100120979 | 3300006881 | Bacteria | 1946 |
| 231 | Ga0075436_100057057 | 3300006914 | Bacteria | 2697 |
| 232 | Ga0075436_100097051 | 3300006914 | Bacteria | 2050 |
| 233 | Ga0075436_100140264 | 3300006914 | Bacteria | 1698 |
| 234 | Ga0097620_100205850 | 3300006931 | Bacteria | 2053 |
| 235 | Ga0097620_100563100 | 3300006931 | Bacteria | 1234 |
| 236 | Ga0075435_100029836 | 3300007076 | Bacteria | 4283 |
| 237 | Ga0075435_100037672 | 3300007076 | Bacteria | 3851 |
| 238 | Ga0105240_10003665 | 3300009093 | Bacteria | 23758 |
| 239 | Ga0105240_10036442 | 3300009093 | Bacteria | 6327 |
| 240 | Ga0111539_10050403 | 3300009094 | Bacteria | 4959 |
| 241 | Ga0111539_10052407 | 3300009094 | Bacteria | 4857 |
| 242 | Ga0111539_10479514 | 3300009094 | Bacteria | 1449 |
| 243 | Ga0105245_10000135 | 3300009098 | Bacteria | 70480 |
| 244 | Ga0105245_10002293 | 3300009098 | Bacteria | 17319 |
| 245 | Ga0105245_10011852 | 3300009098 | Bacteria | 7585 |
| 246 | Ga0105245_10015606 | 3300009098 | Bacteria | 6625 |
| 247 | Ga0105245_10024710 | 3300009098 | Bacteria | 5278 |
| 248 | Ga0105245_10065785 | 3300009098 | Bacteria | 3279 |
| 249 | Ga0105245_10320307 | 3300009098 | Bacteria | 1527 |
| 250 | Ga0105247_10000892 | 3300009101 | Bacteria | 22478 |
| 251 | Ga0114129_10000229 | 3300009147 | Bacteria | 62652 |
| 252 | Ga0114129_10023002 | 3300009147 | Bacteria | 8842 |
| 253 | Ga0114129_10036577 | 3300009147 | Bacteria | 6932 |
| 254 | Ga0114129_10488803 | 3300009147 | Bacteria | 1609 |
| 255 | Ga0114129_10769486 | 3300009147 | Bacteria | 1231 |
| 256 | Ga0105243_10040129 | 3300009148 | Bacteria | 3654 |
| 257 | Ga0105243_10312181 | 3300009148 | Bacteria | 1429 |
| 258 | Ga0105243_10440617 | 3300009148 | Bacteria | 1220 |
| 259 | Ga0105242_10000473 | 3300009176 | Bacteria | 31915 |
| 260 | Ga0105242_10005668 | 3300009176 | Bacteria | 9637 |
| 261 | Ga0105242_10059700 | 3300009176 | Bacteria | 3130 |
| 262 | Ga0105242_10137492 | 3300009176 | Bacteria | 2116 |
| 263 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 264 | Ga0105248_10073668 | 3300009177 | Bacteria | 3838 |
| 265 | Ga0105248_10128056 | 3300009177 | Bacteria | 2864 |
| 266 | Ga0105248_10372090 | 3300009177 | Bacteria | 1608 |
| 267 | Ga0105237_10001714 | 3300009545 | Bacteria | 28350 |
| 268 | Ga0105238_10000009 | 3300009551 | Bacteria | 288729 |
| 269 | Ga0105238_10231600 | 3300009551 | Bacteria | 1824 |
| 270 | Ga0105249_10000050 | 3300009553 | Bacteria | 169617 |
| 271 | Ga0105249_10004662 | 3300009553 | Bacteria | 11840 |
| 272 | Ga0105249_10052691 | 3300009553 | Bacteria | 3717 |
| 273 | Ga0105249_10089249 | 3300009553 | Bacteria | 2880 |
| 274 | Ga0105249_10315720 | 3300009553 | Bacteria | 1572 |
| 275 | Ga0105239_10004095 | 3300010375 | Bacteria | 17531 |
| 276 | Ga0105239_10072024 | 3300010375 | Bacteria | 3798 |
| 277 | Ga0105239_10172957 | 3300010375 | Bacteria | 2416 |
| 278 | Ga0105246_10148592 | 3300011119 | Bacteria | 1771 |
| 279 | Ga0105246_10179186 | 3300011119 | Bacteria | 1630 |
| 280 | Ga0157371_10002052 | 3300013102 | Bacteria | 19848 |
| 281 | Ga0157370_10008177 | 3300013104 | Bacteria | 11308 |
| 282 | Ga0157370_10036245 | 3300013104 | Bacteria | 4788 |
| 283 | Ga0157370_10077456 | 3300013104 | Bacteria | 3132 |
| 284 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 285 | Ga0157374_10010688 | 3300013296 | Bacteria | 7907 |
| 286 | Ga0157374_10015151 | 3300013296 | Bacteria | 6761 |
| 287 | Ga0163162_10072950 | 3300013306 | Bacteria | 3487 |
| 288 | Ga0163162_10334238 | 3300013306 | Bacteria | 1647 |
| 289 | Ga0163162_10459077 | 3300013306 | Bacteria | 1405 |
| 290 | Ga0157372_10000610 | 3300013307 | Bacteria | 39073 |
| 291 | Ga0157372_10186378 | 3300013307 | Bacteria | 2403 |
| 292 | Ga0157372_10235069 | 3300013307 | Bacteria | 2125 |
| 293 | Ga0157375_10000236 | 3300013308 | Bacteria | 51196 |
| 294 | Ga0157375_10002341 | 3300013308 | Bacteria | 16367 |
| 295 | Ga0157375_10157415 | 3300013308 | Bacteria | 2411 |
| 296 | Ga0157375_10520165 | 3300013308 | Bacteria | 1353 |
| 297 | Ga0163163_10066087 | 3300014325 | Bacteria | 3591 |
| 298 | Ga0163163_10096176 | 3300014325 | Bacteria | 2982 |
| 299 | Ga0163163_10168575 | 3300014325 | Bacteria | 2236 |
| 300 | Ga0157380_10000167 | 3300014326 | Bacteria | 37815 |
| 301 | Ga0157380_10000179 | 3300014326 | Bacteria | 36685 |
| 302 | Ga0157377_10001774 | 3300014745 | Bacteria | 9412 |
| 303 | Ga0157379_10015709 | 3300014968 | Bacteria | 6653 |
| 304 | Ga0157379_10225573 | 3300014968 | Bacteria | 1698 |
| 305 | Ga0157376_10041111 | 3300014969 | Bacteria | 3783 |
| 306 | Ga0157376_10054029 | 3300014969 | Bacteria | 3347 |
| 307 | Ga0163161_10000021 | 3300017792 | Bacteria | 208779 |
| 308 | Ga0163161_10336924 | 3300017792 | Bacteria | 1196 |
| 309 | Ga0206356_10475672 | 3300020070 | Bacteria | 1993 |
| 310 | Ga0213876_10016626 | 3300021384 | Bacteria | 3887 |
| 311 | Ga0213876_10039275 | 3300021384 | Bacteria | 2500 |
| 312 | Ga0213876_10049019 | 3300021384 | Bacteria | 2231 |
| 313 | Ga0213876_10099757 | 3300021384 | Bacteria | 1539 |
| 314 | Ga0207656_10000124 | 3300025321 | Bacteria | 29553 |
| 315 | Ga0207656_10039829 | 3300025321 | Bacteria | 1990 |
| 316 | Ga0207653_10074537 | 3300025885 | Bacteria | 1165 |
| 317 | Ga0207682_10000045 | 3300025893 | Bacteria | 51744 |
| 318 | Ga0207692_10048285 | 3300025898 | Bacteria | 2142 |
| 319 | Ga0207692_10115645 | 3300025898 | Bacteria | 1495 |
| 320 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 321 | Ga0207642_10000238 | 3300025899 | Bacteria | 16455 |
| 322 | Ga0207642_10101382 | 3300025899 | Bacteria | 1446 |
| 323 | Ga0207710_10000548 | 3300025900 | Bacteria | 22601 |
| 324 | Ga0207710_10048481 | 3300025900 | Bacteria | 1901 |
| 325 | Ga0207688_10003516 | 3300025901 | Bacteria | 8553 |
| 326 | Ga0207688_10012330 | 3300025901 | Bacteria | 4652 |
| 327 | Ga0207688_10131569 | 3300025901 | Bacteria | 1467 |
| 328 | Ga0207688_10137918 | 3300025901 | Bacteria | 1434 |
| 329 | Ga0207685_10000005 | 3300025905 | Bacteria | 289944 |
| 330 | Ga0207645_10163847 | 3300025907 | Bacteria | 1455 |
| 331 | Ga0207643_10077699 | 3300025908 | Bacteria | 1919 |
| 332 | Ga0207684_10001611 | 3300025910 | Bacteria | 23952 |
| 333 | Ga0207707_10041141 | 3300025912 | Bacteria | 4036 |
| 334 | Ga0207707_10229762 | 3300025912 | Bacteria | 1614 |
| 335 | Ga0207695_10005035 | 3300025913 | Bacteria | 17747 |
| 336 | Ga0207695_10006218 | 3300025913 | Bacteria | 15545 |
| 337 | Ga0207671_10001437 | 3300025914 | Bacteria | 27616 |
| 338 | Ga0207671_10123230 | 3300025914 | Bacteria | 1983 |
| 339 | Ga0207693_10000014 | 3300025915 | Bacteria | 148984 |
| 340 | Ga0207693_10008348 | 3300025915 | Bacteria | 8476 |
| 341 | Ga0207693_10014178 | 3300025915 | Bacteria | 6417 |
| 342 | Ga0207693_10016044 | 3300025915 | Bacteria | 5995 |
| 343 | Ga0207693_10142350 | 3300025915 | Bacteria | 1885 |
| 344 | Ga0207663_10004337 | 3300025916 | Bacteria | 7042 |
| 345 | Ga0207663_10012244 | 3300025916 | Bacteria | 4631 |
| 346 | Ga0207663_10028817 | 3300025916 | Bacteria | 3254 |
| 347 | Ga0207663_10084925 | 3300025916 | Bacteria | 2083 |
| 348 | Ga0207663_10115862 | 3300025916 | Bacteria | 1826 |
| 349 | Ga0207663_10243367 | 3300025916 | Bacteria | 1320 |
| 350 | Ga0207662_10072934 | 3300025918 | Bacteria | 2082 |
| 351 | Ga0207657_10124941 | 3300025919 | Bacteria | 2114 |
| 352 | Ga0207657_10254047 | 3300025919 | Bacteria | 1400 |
| 353 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 354 | Ga0207652_10001906 | 3300025921 | Bacteria | 18072 |
| 355 | Ga0207652_10023036 | 3300025921 | Bacteria | 5158 |
| 356 | Ga0207646_10057050 | 3300025922 | Bacteria | 3489 |
| 357 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 358 | Ga0207659_10000033 | 3300025926 | Bacteria | 113729 |
| 359 | Ga0207659_10151820 | 3300025926 | Bacteria | 1809 |
| 360 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 361 | Ga0207687_10000013 | 3300025927 | Bacteria | 299826 |
| 362 | Ga0207687_10015729 | 3300025927 | Bacteria | 4965 |
| 363 | Ga0207687_10022929 | 3300025927 | Bacteria | 4157 |
| 364 | Ga0207687_10116589 | 3300025927 | Bacteria | 1991 |
| 365 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 366 | Ga0207700_10038669 | 3300025928 | Bacteria | 3465 |
| 367 | Ga0207700_10234380 | 3300025928 | Bacteria | 1562 |
| 368 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 369 | Ga0207664_10012727 | 3300025929 | Bacteria | 6021 |
| 370 | Ga0207664_10030907 | 3300025929 | Bacteria | 4093 |
| 371 | Ga0207664_10071622 | 3300025929 | Bacteria | 2793 |
| 372 | Ga0207664_10090856 | 3300025929 | Bacteria | 2503 |
| 373 | Ga0207664_10359207 | 3300025929 | Bacteria | 1290 |
| 374 | Ga0207690_10012005 | 3300025932 | Bacteria | 5180 |
| 375 | Ga0207690_10053536 | 3300025932 | Bacteria | 2708 |
| 376 | Ga0207690_10072124 | 3300025932 | Bacteria | 2384 |
| 377 | Ga0207690_10092269 | 3300025932 | Bacteria | 2142 |
| 378 | Ga0207690_10104340 | 3300025932 | Bacteria | 2031 |
| 379 | Ga0207690_10112246 | 3300025932 | Bacteria | 1965 |
| 380 | Ga0207690_10226983 | 3300025932 | Bacteria | 1432 |
| 381 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 382 | Ga0207706_10001715 | 3300025933 | Bacteria | 21601 |
| 383 | Ga0207706_10165567 | 3300025933 | Bacteria | 1943 |
| 384 | Ga0207686_10000300 | 3300025934 | Bacteria | 36083 |
| 385 | Ga0207686_10000644 | 3300025934 | Bacteria | 21471 |
| 386 | Ga0207670_10021953 | 3300025936 | Bacteria | 3946 |
| 387 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 388 | Ga0207669_10000006 | 3300025937 | Bacteria | 176348 |
| 389 | Ga0207669_10059794 | 3300025937 | Bacteria | 2333 |
| 390 | Ga0207669_10158095 | 3300025937 | Bacteria | 1597 |
| 391 | Ga0207669_10163373 | 3300025937 | Bacteria | 1576 |
| 392 | Ga0207704_10000059 | 3300025938 | Bacteria | 76643 |
| 393 | Ga0207704_10031608 | 3300025938 | Bacteria | 2985 |
| 394 | Ga0207704_10032887 | 3300025938 | Bacteria | 2942 |
| 395 | Ga0207665_10056858 | 3300025939 | Bacteria | 2642 |
| 396 | Ga0207691_10000934 | 3300025940 | Bacteria | 28991 |
| 397 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 398 | Ga0207711_10057858 | 3300025941 | Bacteria | 3333 |
| 399 | Ga0207689_10113518 | 3300025942 | Bacteria | 2227 |
| 400 | Ga0207689_10208465 | 3300025942 | Bacteria | 1614 |
| 401 | Ga0207661_10000707 | 3300025944 | Bacteria | 21658 |
| 402 | Ga0207661_10012761 | 3300025944 | Bacteria | 6121 |
| 403 | Ga0207661_10109553 | 3300025944 | Bacteria | 2333 |
| 404 | Ga0207661_10254744 | 3300025944 | Bacteria | 1561 |
| 405 | Ga0207661_10255974 | 3300025944 | Bacteria | 1558 |
| 406 | Ga0207661_10391491 | 3300025944 | Bacteria | 1259 |
| 407 | Ga0207679_10007996 | 3300025945 | Bacteria | 6725 |
| 408 | Ga0207679_10009512 | 3300025945 | Bacteria | 6231 |
| 409 | Ga0207679_10061831 | 3300025945 | Bacteria | 2789 |
| 410 | Ga0207667_10043085 | 3300025949 | Bacteria | 4791 |
| 411 | Ga0207667_10452247 | 3300025949 | Bacteria | 1305 |
| 412 | Ga0207651_10014173 | 3300025960 | Bacteria | 4594 |
| 413 | Ga0207712_10000019 | 3300025961 | Bacteria | 317060 |
| 414 | Ga0207712_10061889 | 3300025961 | Bacteria | 2658 |
| 415 | Ga0207712_10063009 | 3300025961 | Bacteria | 2638 |
| 416 | Ga0207712_10366304 | 3300025961 | Bacteria | 1202 |
| 417 | Ga0207668_10002210 | 3300025972 | Bacteria | 11349 |
| 418 | Ga0207668_10011009 | 3300025972 | Bacteria | 5485 |
| 419 | Ga0207668_10188129 | 3300025972 | Bacteria | 1634 |
| 420 | Ga0207640_10000151 | 3300025981 | Bacteria | 50644 |
| 421 | Ga0207640_10005821 | 3300025981 | Bacteria | 6722 |
| 422 | Ga0207640_10043408 | 3300025981 | Bacteria | 2873 |
| 423 | Ga0207658_10000506 | 3300025986 | Bacteria | 35648 |
| 424 | Ga0207658_10139099 | 3300025986 | Bacteria | 1962 |
| 425 | Ga0207677_10000106 | 3300026023 | Bacteria | 68108 |
| 426 | Ga0207677_10001102 | 3300026023 | Bacteria | 14732 |
| 427 | Ga0207677_10024474 | 3300026023 | Bacteria | 3752 |
| 428 | Ga0207677_10028342 | 3300026023 | Bacteria | 3539 |
| 429 | Ga0207677_10317993 | 3300026023 | Bacteria | 1292 |
| 430 | Ga0207703_10000078 | 3300026035 | Bacteria | 115634 |
| 431 | Ga0207703_10000257 | 3300026035 | Bacteria | 59688 |
| 432 | Ga0207639_10000747 | 3300026041 | Bacteria | 22193 |
| 433 | Ga0207639_10197162 | 3300026041 | Bacteria | 1724 |
| 434 | Ga0207639_10302852 | 3300026041 | Bacteria | 1413 |
| 435 | Ga0207678_10024623 | 3300026067 | Bacteria | 5257 |
| 436 | Ga0207678_10196534 | 3300026067 | Bacteria | 1724 |
| 437 | Ga0207678_10239182 | 3300026067 | Bacteria | 1555 |
| 438 | Ga0207708_10001166 | 3300026075 | Bacteria | 19795 |
| 439 | Ga0207708_10001883 | 3300026075 | Bacteria | 15485 |
| 440 | Ga0207708_10019391 | 3300026075 | Bacteria | 5126 |
| 441 | Ga0207708_10099467 | 3300026075 | Bacteria | 2250 |
| 442 | Ga0207702_10000360 | 3300026078 | Bacteria | 52006 |
| 443 | Ga0207702_10003603 | 3300026078 | Bacteria | 14075 |
| 444 | Ga0207702_10019703 | 3300026078 | Bacteria | 5585 |
| 445 | Ga0207702_10140831 | 3300026078 | Bacteria | 2182 |
| 446 | Ga0207641_10000301 | 3300026088 | Bacteria | 61780 |
| 447 | Ga0207641_10010509 | 3300026088 | Bacteria | 7598 |
| 448 | Ga0207641_10035210 | 3300026088 | Bacteria | 4170 |
| 449 | Ga0207648_10017132 | 3300026089 | Bacteria | 6603 |
| 450 | Ga0207676_10000031 | 3300026095 | Bacteria | 215877 |
| 451 | Ga0207676_10217897 | 3300026095 | Bacteria | 1698 |
| 452 | Ga0207674_10021899 | 3300026116 | Bacteria | 6876 |
| 453 | Ga0207674_10051341 | 3300026116 | Bacteria | 4209 |
| 454 | Ga0207675_100000091 | 3300026118 | Bacteria | 70559 |
| 455 | Ga0207675_100038624 | 3300026118 | Bacteria | 4455 |
| 456 | Ga0207683_10027531 | 3300026121 | Bacteria | 4912 |
| 457 | Ga0207683_10039055 | 3300026121 | Bacteria | 4140 |
| 458 | Ga0207683_10093205 | 3300026121 | Bacteria | 2684 |
| 459 | Ga0207683_10369127 | 3300026121 | Bacteria | 1318 |
| 460 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 461 | Ga0207698_10052769 | 3300026142 | Bacteria | 3117 |
| 462 | Ga0207698_10589241 | 3300026142 | Bacteria | 1095 |
| 463 | Ga0207428_10020740 | 3300027907 | Bacteria | 5574 |
| 464 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 465 | Ga0268266_10001143 | 3300028379 | Bacteria | 32951 |
| 466 | Ga0268266_10120741 | 3300028379 | Bacteria | 2332 |
| 467 | Ga0268265_10005906 | 3300028380 | Bacteria | 8341 |
| 468 | Ga0268264_10255537 | 3300028381 | Bacteria | 1630 |
| 469 | Ga0268264_10376295 | 3300028381 | Bacteria | 1359 |
| 470 | Ga0265337_1000006 | 3300028556 | Bacteria | 99562 |
| 471 | Ga0265337_1003682 | 3300028556 | Bacteria | 6561 |
| 472 | Ga0265337_1020390 | 3300028556 | Bacteria | 2077 |
| 473 | Ga0265326_10000066 | 3300028558 | Bacteria | 59893 |
| 474 | Ga0265326_10004289 | 3300028558 | Bacteria | 4582 |
| 475 | Ga0265319_1000073 | 3300028563 | Bacteria | 81138 |
| 476 | Ga0265319_1000323 | 3300028563 | Bacteria | 35477 |
| 477 | Ga0265319_1001236 | 3300028563 | Bacteria | 15700 |
| 478 | Ga0265318_10000650 | 3300028577 | Bacteria | 23762 |
| 479 | Ga0265318_10015071 | 3300028577 | Bacteria | 3227 |
| 480 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 481 | Ga0265322_10004940 | 3300028654 | Bacteria | 3956 |
| 482 | Ga0265336_10000002 | 3300028666 | Bacteria | 830172 |
| 483 | Ga0265336_10002244 | 3300028666 | Bacteria | 8097 |
| 484 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 485 | Ga0265338_10002303 | 3300028800 | Bacteria | 29010 |
| 486 | Ga0265338_10005918 | 3300028800 | Bacteria | 15760 |
| 487 | Ga0265338_10012258 | 3300028800 | Bacteria | 9789 |
| 488 | Ga0265338_10086363 | 3300028800 | Bacteria | 2611 |
| 489 | Ga0265324_10000563 | 3300029957 | Bacteria | 25385 |
| 490 | Ga0265324_10001753 | 3300029957 | Bacteria | 11934 |
| 491 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 492 | Ga0265320_10018765 | 3300031240 | Bacteria | 3799 |
| 493 | Ga0265320_10103011 | 3300031240 | Bacteria | 1313 |
| 494 | Ga0265325_10006312 | 3300031241 | Bacteria | 7213 |
| 495 | Ga0265329_10003034 | 3300031242 | Bacteria | 7455 |
| 496 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 497 | Ga0265339_10011892 | 3300031249 | Bacteria | 5337 |
| 498 | Ga0265339_10019994 | 3300031249 | Bacteria | 3919 |
| 499 | Ga0265331_10003440 | 3300031250 | Bacteria | 10239 |
| 500 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 501 | Ga0265327_10001436 | 3300031251 | Bacteria | 30052 |
| 502 | Ga0265327_10002767 | 3300031251 | Bacteria | 17760 |
| 503 | Ga0265316_10008459 | 3300031344 | Bacteria | 9545 |
| 504 | Ga0265316_10014142 | 3300031344 | Bacteria | 7040 |
| 505 | Ga0265314_10000726 | 3300031711 | Bacteria | 39827 |
| 506 | Ga0307405_10035033 | 3300031731 | Bacteria | 2994 |
| 507 | Ga0307405_10150056 | 3300031731 | Bacteria | 1638 |
| 508 | Ga0307413_10036602 | 3300031824 | Bacteria | 2827 |
| 509 | Ga0307413_10102556 | 3300031824 | Bacteria | 1894 |
| 510 | Ga0307413_10229887 | 3300031824 | Bacteria | 1361 |
| 511 | Ga0307410_10015552 | 3300031852 | Bacteria | 4517 |
| 512 | Ga0307410_10153873 | 3300031852 | Bacteria | 1715 |
| 513 | Ga0307410_10218850 | 3300031852 | Bacteria | 1464 |
| 514 | Ga0307406_10009961 | 3300031901 | Bacteria | 5346 |
| 515 | Ga0307406_10024976 | 3300031901 | Bacteria | 3573 |
| 516 | Ga0307406_10029141 | 3300031901 | Bacteria | 3341 |
| 517 | Ga0307406_10136958 | 3300031901 | Bacteria | 1727 |
| 518 | Ga0307406_10230666 | 3300031901 | Bacteria | 1382 |
| 519 | Ga0307406_10301037 | 3300031901 | Bacteria | 1232 |
| 520 | Ga0307406_10337463 | 3300031901 | Bacteria | 1173 |
| 521 | Ga0307406_10346300 | 3300031901 | Bacteria | 1159 |
| 522 | Ga0307407_10014776 | 3300031903 | Bacteria | 3835 |
| 523 | Ga0307407_10030563 | 3300031903 | Bacteria | 2907 |
| 524 | Ga0307407_10070539 | 3300031903 | Bacteria | 2077 |
| 525 | Ga0307409_100045253 | 3300031995 | Bacteria | 3321 |
| 526 | Ga0307409_100047478 | 3300031995 | Bacteria | 3259 |
| 527 | Ga0307409_100089555 | 3300031995 | Bacteria | 2516 |
| 528 | Ga0307409_100099139 | 3300031995 | Bacteria | 2412 |
| 529 | Ga0307409_100147053 | 3300031995 | Bacteria | 2039 |
| 530 | Ga0307409_100181402 | 3300031995 | Bacteria | 1864 |
| 531 | Ga0307416_100052310 | 3300032002 | Bacteria | 3269 |
| 532 | Ga0307416_100056695 | 3300032002 | Bacteria | 3164 |
| 533 | Ga0307416_100089091 | 3300032002 | Bacteria | 2641 |
| 534 | Ga0307416_100092075 | 3300032002 | Bacteria | 2606 |
| 535 | Ga0307416_100402665 | 3300032002 | Bacteria | 1406 |
| 536 | Ga0307416_100423565 | 3300032002 | Bacteria | 1376 |
| 537 | Ga0307416_100451090 | 3300032002 | Bacteria | 1339 |
| 538 | Ga0307411_10019425 | 3300032005 | Bacteria | 3926 |
| 539 | Ga0307411_10143917 | 3300032005 | Bacteria | 1762 |
| 540 | Ga0307415_100027638 | 3300032126 | Bacteria | 3597 |
| 541 | Ga0307415_100029921 | 3300032126 | Bacteria | 3487 |
| 542 | Ga0307415_100038515 | 3300032126 | Bacteria | 3152 |
| 543 | Ga0307415_100199266 | 3300032126 | Bacteria | 1587 |
| 544 | Ga0307415_100219967 | 3300032126 | Bacteria | 1522 |
| 545 | Ga0307415_100242214 | 3300032126 | Bacteria | 1459 |
| 546 | Ga0307415_100383258 | 3300032126 | Bacteria | 1194 |
| 547 | Ga0373930_0023452 | 3300034816 | Bacteria | 1227 |
| 548 | Ga0373957_0070803 | 3300035120 | Bacteria | 1364 |
| 549 | Ga0373960_0002815 | 3300035121 | Bacteria | 3939 |
| 550 | Ga0373931_0028618 | 3300035691 | Bacteria | 2855 |
| 551 | Ga0373937_0039385 | 3300036401 | Bacteria | 4307 |
| 552 | Ga0395899_0020250 | 3300037312 | Bacteria | 5048 |
| 553 | Ga0395899_0020569 | 3300037312 | Bacteria | 5002 |
| 554 | Ga0395899_0026257 | 3300037312 | Bacteria | 4395 |
| 555 | Ga0395899_0058634 | 3300037312 | Bacteria | 2839 |
| 556 | Ga0395900_0019376 | 3300037418 | Bacteria | 6939 |
| 557 | Ga0395900_0046056 | 3300037418 | Bacteria | 4491 |
| 558 | Ga0395900_0077025 | 3300037418 | Bacteria | 3426 |
| 559 | Ga0395900_0166368 | 3300037418 | Bacteria | 2247 |
| 560 | Ga0395900_0205142 | 3300037418 | Bacteria | 1992 |
| 561 | Ga0395900_0382200 | 3300037418 | Bacteria | 1376 |
| 562 | Ga0395900_0435928 | 3300037418 | Bacteria | 1269 |
| 563 | Ga0395898_0002543 | 3300037466 | Bacteria | 21393 |
| 564 | Ga0395898_0003141 | 3300037466 | Bacteria | 18655 |
| 565 | Ga0395898_0006287 | 3300037466 | Bacteria | 12695 |
| 566 | Ga0395898_0063887 | 3300037466 | Bacteria | 3572 |
| 567 | Ga0395898_0067934 | 3300037466 | Bacteria | 3450 |
| 568 | Ga0395898_0122780 | 3300037466 | Bacteria | 2489 |
| 569 | Ga0395898_0201989 | 3300037466 | Bacteria | 1897 |
| 570 | Ga0395898_0288586 | 3300037466 | Bacteria | 1565 |
| 571 | Ga0395898_0293825 | 3300037466 | Bacteria | 1550 |
| 572 | Ga0395898_0402724 | 3300037466 | Bacteria | 1305 |
| 573 | Ga0395905_0006210 | 3300037471 | Bacteria | 12058 |
| 574 | Ga0395905_0019433 | 3300037471 | Bacteria | 6441 |
| 575 | Ga0395905_0021115 | 3300037471 | Bacteria | 6165 |
| 576 | Ga0395905_0170345 | 3300037471 | Bacteria | 2045 |
| 577 | Ga0436364_0240449 | 3300037853 | Bacteria | 25321 |
| 578 | Ga0436364_0815220 | 3300037853 | Bacteria | 1715 |
| 579 | Ga0436364_1477052 | 3300037853 | Bacteria | 18241 |
| 580 | Ga0395901_0005774 | 3300038443 | Bacteria | 12531 |
| 581 | Ga0395901_0023382 | 3300038443 | Bacteria | 6334 |
| 582 | Ga0395901_0023591 | 3300038443 | Bacteria | 6307 |
| 583 | Ga0395901_0064733 | 3300038443 | Bacteria | 3806 |
| 584 | Ga0395901_0100570 | 3300038443 | Bacteria | 3033 |
| 585 | Ga0395901_0278375 | 3300038443 | Bacteria | 1739 |
| 586 | Ga0395901_0369543 | 3300038443 | Bacteria | 1477 |
| 587 | Ga0436365_0000795 | 3300039437 | Bacteria | 3798 |
| 588 | Ga0436365_0378539 | 3300039437 | Bacteria | 21711 |
| 589 | Ga0436365_0807310 | 3300039437 | Bacteria | 5094 |
| 590 | Ga0436365_1395668 | 3300039437 | Bacteria | 2872 |
| 591 | Ga0436365_1487643 | 3300039437 | Bacteria | 7653 |
| 592 | Ga0436365_1549123 | 3300039437 | Bacteria | 9132 |
| 593 | Ga0436363_0805533 | 3300039450 | Bacteria | 51825 |
| 594 | Ga0436362_0170227 | 3300039453 | Bacteria | 1492 |
| 595 | Ga0436362_0570716 | 3300039453 | Bacteria | 2239 |
| 596 | Ga0436362_0857091 | 3300039453 | Bacteria | 3844 |
| 597 | Ga0436362_1078989 | 3300039453 | Bacteria | 2184 |
| 598 | Ga0436362_1091830 | 3300039453 | Bacteria | 1753 |
| 599 | Ga0436362_1156991 | 3300039453 | Bacteria | 1073 |
| 600 | Ga0451833_0087528 | 3300041491 | Bacteria | 1953 |
| 601 | Ga0451853_1497798 | 3300041512 | Bacteria | 2824 |
| 602 | Ga0439450_021683 | 3300042008 | Bacteria | 1381 |
| 603 | Ga0439440_0002839 | 3300042993 | Bacteria | 3293 |
| 604 | Ga0466966_0141494 | 3300044684 | Bacteria | 1470 |
| 605 | Ga0466961_0008158 | 3300044693 | Bacteria | 6671 |
| 606 | Ga0466961_0011845 | 3300044693 | Bacteria | 5574 |
| 607 | Ga0466961_0065974 | 3300044693 | Bacteria | 2300 |
| 608 | Ga0466961_0224164 | 3300044693 | Bacteria | 1158 |
| 609 | Ga0466963_0000075 | 3300044694 | Bacteria | 34739 |
| 610 | Ga0466963_0003594 | 3300044694 | Bacteria | 8913 |
| 611 | Ga0466963_0007404 | 3300044694 | Bacteria | 6541 |
| 612 | Ga0466963_0011029 | 3300044694 | Bacteria | 5494 |
| 613 | Ga0466963_0014580 | 3300044694 | Bacteria | 4850 |
| 614 | Ga0466963_0027393 | 3300044694 | Bacteria | 3649 |
| 615 | Ga0466963_0077408 | 3300044694 | Bacteria | 2247 |
| 616 | Ga0466971_0007205 | 3300044719 | Bacteria | 4843 |
| 617 | Ga0466971_0062070 | 3300044719 | Bacteria | 1691 |
| 618 | Ga0466968_0030758 | 3300044735 | Bacteria | 2225 |
| 619 | Ga0466968_0086922 | 3300044735 | Bacteria | 1380 |
| 620 | Ga0466970_0035935 | 3300044765 | Bacteria | 2624 |
| 621 | Ga0466970_0104245 | 3300044765 | Bacteria | 1546 |
| 622 | Ga0466957_0003008 | 3300044842 | Bacteria | 9152 |
| 623 | Ga0466957_0014919 | 3300044842 | Bacteria | 4532 |
| 624 | Ga0466957_0032032 | 3300044842 | Bacteria | 3146 |
| 625 | Ga0466957_0045274 | 3300044842 | Bacteria | 2669 |
| 626 | Ga0466957_0122175 | 3300044842 | Bacteria | 1661 |
| 627 | Ga0466960_0019437 | 3300044901 | Bacteria | 2994 |
| 628 | Ga0466960_0035547 | 3300044901 | Bacteria | 2329 |
| 629 | Ga0466960_0049897 | 3300044901 | Bacteria | 2016 |
| 630 | Ga0466959_0000352 | 3300045049 | Bacteria | 27249 |
| 631 | Ga0466959_0039628 | 3300045049 | Bacteria | 3482 |
| 632 | Ga0466959_0041894 | 3300045049 | Bacteria | 3379 |
| 633 | Ga0466959_0042350 | 3300045049 | Bacteria | 3359 |
| 634 | Ga0466959_0047397 | 3300045049 | Bacteria | 3161 |
| 635 | Ga0466959_0110195 | 3300045049 | Bacteria | 1965 |
| 636 | Ga0466959_0176315 | 3300045049 | Bacteria | 1497 |
| 637 | Ga0466958_0000550 | 3300045836 | Bacteria | 15964 |
| 638 | Ga0466958_0003128 | 3300045836 | Bacteria | 8514 |
| 639 | Ga0466958_0005509 | 3300045836 | Bacteria | 6828 |
| 640 | Ga0466958_0100493 | 3300045836 | Bacteria | 1798 |
| 641 | Ga0466967_0000019 | 3300045976 | Bacteria | 79629 |
| 642 | Ga0466967_0000217 | 3300045976 | Bacteria | 24528 |
| 643 | Ga0466967_0005609 | 3300045976 | Bacteria | 8726 |
| 644 | Ga0466967_0078341 | 3300045976 | Bacteria | 2977 |
| 645 | Ga0466967_0079502 | 3300045976 | Bacteria | 2956 |
| 646 | Ga0466967_0092564 | 3300045976 | Bacteria | 2749 |
| 647 | Ga0466967_0102252 | 3300045976 | Bacteria | 2621 |
| 648 | Ga0466967_0129745 | 3300045976 | Bacteria | 2339 |
| 649 | Ga0466967_0155266 | 3300045976 | Bacteria | 2143 |
| 650 | Ga0466967_0240892 | 3300045976 | Bacteria | 1725 |
| 651 | Ga0495592_0015168 | 3300046454 | Bacteria | 5852 |
| 652 | Ga0495603_0000828 | 3300046455 | Bacteria | 17765 |
| 653 | Ga0495603_0006166 | 3300046455 | Bacteria | 7168 |
| 654 | Ga0495629_0000145 | 3300046459 | Bacteria | 61915 |
| 655 | Ga0495629_0001110 | 3300046459 | Bacteria | 21316 |
| 656 | Ga0495629_0001588 | 3300046459 | Bacteria | 17867 |
| 657 | Ga0495629_0029468 | 3300046459 | Bacteria | 3892 |
| 658 | Ga0495641_0000050 | 3300046461 | Bacteria | 73259 |
| 659 | Ga0495641_0136187 | 3300046461 | Bacteria | 1096 |
| 660 | Ga0495651_0110277 | 3300046462 | Bacteria | 2036 |
| 661 | Ga0495651_0110944 | 3300046462 | Bacteria | 2028 |
| 662 | Ga0495653_0000982 | 3300046463 | Bacteria | 21923 |
| 663 | Ga0495653_0050898 | 3300046463 | Bacteria | 3184 |
| 664 | Ga0495653_0150783 | 3300046463 | Bacteria | 1625 |
| 665 | Ga0495653_0252695 | 3300046463 | Bacteria | 1169 |
| 666 | Ga0495582_0000004 | 3300046473 | Bacteria | 168322 |
| 667 | Ga0495582_0071872 | 3300046473 | Bacteria | 1914 |
| 668 | Ga0495605_0075081 | 3300046474 | Bacteria | 1590 |
| 669 | Ga0495639_0073494 | 3300046475 | Bacteria | 1583 |
| 670 | Ga0495662_0012304 | 3300046476 | Bacteria | 4176 |
| 671 | Ga0495662_0065988 | 3300046476 | Bacteria | 1750 |
| 672 | Ga0495664_0000032 | 3300046477 | Bacteria | 85909 |
| 673 | Ga0495584_0020785 | 3300046491 | Bacteria | 3334 |
| 674 | Ga0495594_0000010 | 3300046499 | Bacteria | 118481 |
| 675 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 676 | Ga0495608_0000023 | 3300046511 | Bacteria | 160090 |
| 677 | Ga0495608_0000891 | 3300046511 | Bacteria | 20918 |
| 678 | Ga0495608_0010082 | 3300046511 | Bacteria | 6592 |
| 679 | Ga0495608_0015492 | 3300046511 | Bacteria | 5287 |
| 680 | Ga0495610_0085075 | 3300046512 | Bacteria | 1444 |
| 681 | Ga0495618_0000008 | 3300046514 | Bacteria | 204578 |
| 682 | Ga0495618_0000113 | 3300046514 | Bacteria | 59243 |
| 683 | Ga0495620_0000247 | 3300046515 | Bacteria | 40394 |
| 684 | Ga0495628_0000165 | 3300046516 | Bacteria | 57669 |
| 685 | Ga0495628_0001530 | 3300046516 | Bacteria | 21206 |
| 686 | Ga0495628_0065563 | 3300046516 | Bacteria | 2840 |
| 687 | Ga0495628_0116689 | 3300046516 | Bacteria | 2050 |
| 688 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 689 | Ga0495630_0000145 | 3300046517 | Bacteria | 54974 |
| 690 | Ga0495630_0009696 | 3300046517 | Bacteria | 6925 |
| 691 | Ga0495630_0029400 | 3300046517 | Bacteria | 4086 |
| 692 | Ga0495630_0041247 | 3300046517 | Bacteria | 3446 |
| 693 | Ga0495630_0233502 | 3300046517 | Bacteria | 1405 |
| 694 | Ga0495644_0000902 | 3300046523 | Bacteria | 12289 |
| 695 | Ga0495644_0001127 | 3300046523 | Bacteria | 10971 |
| 696 | Ga0495652_0000346 | 3300046529 | Bacteria | 55138 |
| 697 | Ga0495652_0013007 | 3300046529 | Bacteria | 7501 |
| 698 | Ga0495652_0152823 | 3300046529 | Bacteria | 1801 |
| 699 | Ga0495665_0208760 | 3300046531 | Bacteria | 1011 |
| 700 | Ga0495586_0008489 | 3300046535 | Bacteria | 5466 |
| 701 | Ga0495587_0005182 | 3300046536 | Bacteria | 8519 |
| 702 | Ga0495645_0000021 | 3300046543 | Bacteria | 137604 |
| 703 | Ga0495645_0001238 | 3300046543 | Bacteria | 17431 |
| 704 | Ga0495645_0040166 | 3300046543 | Bacteria | 3413 |
| 705 | Ga0495622_0000104 | 3300046557 | Bacteria | 73828 |
| 706 | Ga0495633_0118090 | 3300046558 | Bacteria | 1229 |
| 707 | Ga0495667_0000047 | 3300046559 | Bacteria | 117718 |
| 708 | Ga0495667_0089911 | 3300046559 | Bacteria | 1990 |
| 709 | Ga0495667_0119247 | 3300046559 | Bacteria | 1704 |
| 710 | Ga0495667_0120399 | 3300046559 | Bacteria | 1695 |
| 711 | Ga0495656_0001137 | 3300046615 | Bacteria | 8646 |
| 712 | Ga0495656_0034837 | 3300046615 | Bacteria | 2064 |
| 713 | Ga0495634_0000034 | 3300046642 | Bacteria | 106338 |
| 714 | Ga0495634_0005892 | 3300046642 | Bacteria | 9363 |
| 715 | Ga0495634_0005924 | 3300046642 | Bacteria | 9338 |
| 716 | Ga0495634_0048539 | 3300046642 | Bacteria | 2858 |
| 717 | Ga0495625_0001243 | 3300046660 | Bacteria | 32172 |
| 718 | Ga0495635_0000034 | 3300046663 | Bacteria | 96408 |
| 719 | Ga0495635_0071907 | 3300046663 | Bacteria | 2371 |
| 720 | Ga0495635_0118943 | 3300046663 | Bacteria | 1803 |
| 721 | Ga0495588_0000422 | 3300046674 | Bacteria | 22711 |
| 722 | Ga0495657_0000013 | 3300046675 | Bacteria | 195590 |
| 723 | Ga0495657_0000020 | 3300046675 | Bacteria | 160089 |
| 724 | Ga0495657_0026853 | 3300046675 | Bacteria | 4072 |
| 725 | Ga0495657_0049342 | 3300046675 | Bacteria | 2836 |
| 726 | Ga0495599_0038243 | 3300046678 | Bacteria | 3015 |
| 727 | Ga0495599_0149180 | 3300046678 | Bacteria | 1449 |
| 728 | Ga0495646_0025126 | 3300046680 | Bacteria | 3748 |
| 729 | Ga0495647_0001315 | 3300046681 | Bacteria | 7645 |
| 730 | Ga0495647_0018848 | 3300046681 | Bacteria | 2463 |
| 731 | Ga0495658_0000004 | 3300046683 | Bacteria | 173598 |
| 732 | Ga0495658_0014050 | 3300046683 | Bacteria | 4082 |
| 733 | Ga0495658_0030299 | 3300046683 | Bacteria | 2937 |
| 734 | Ga0495658_0125692 | 3300046683 | Bacteria | 1556 |
| 735 | Ga0495669_0000030 | 3300046684 | Bacteria | 102988 |
| 736 | Ga0495613_0000251 | 3300046689 | Bacteria | 50730 |
| 737 | Ga0495613_0000850 | 3300046689 | Bacteria | 23420 |
| 738 | Ga0495624_0007692 | 3300046690 | Bacteria | 7559 |
| 739 | Ga0495624_0052824 | 3300046690 | Bacteria | 2567 |
| 740 | Ga0495624_0060732 | 3300046690 | Bacteria | 2369 |
| 741 | Ga0495600_0014884 | 3300046809 | Bacteria | 4909 |
| 742 | Ga0495600_0047292 | 3300046809 | Bacteria | 2806 |
| 743 | Ga0495604_0000071 | 3300047317 | Bacteria | 89185 |
| 744 | Ga0495604_0000106 | 3300047317 | Bacteria | 69765 |
| 745 | Ga0495604_0000158 | 3300047317 | Bacteria | 59386 |
| 746 | Ga0495604_0011719 | 3300047317 | Bacteria | 6972 |
| 747 | Ga0495604_0037209 | 3300047317 | Bacteria | 3834 |
| 748 | Ga0495674_0000019 | 3300047319 | Bacteria | 185107 |
| 749 | Ga0495672_0005626 | 3300047320 | Bacteria | 9889 |
| 750 | Ga0495672_0029855 | 3300047320 | Bacteria | 3427 |
| 751 | Ga0495676_0001265 | 3300047321 | Bacteria | 21690 |
| 752 | Ga0495676_0010845 | 3300047321 | Bacteria | 8242 |
| 753 | Ga0495676_0010945 | 3300047321 | Bacteria | 8200 |
| 754 | Ga0495676_0057767 | 3300047321 | Bacteria | 3057 |
| 755 | Ga0495680_0000569 | 3300047322 | Bacteria | 41472 |
| 756 | Ga0495680_0002644 | 3300047322 | Bacteria | 18142 |
| 757 | Ga0495680_0003506 | 3300047322 | Bacteria | 15387 |
| 758 | Ga0495675_0000561 | 3300047444 | Bacteria | 23982 |
| 759 | Ga0495685_015775 | 3300047447 | Bacteria | 2580 |
| 760 | Ga0495673_0007713 | 3300047469 | Bacteria | 6145 |
| 761 | Ga0495684_0006606 | 3300047471 | Bacteria | 8994 |
| 762 | Ga0495684_0119730 | 3300047471 | Bacteria | 1984 |
| 763 | Ga0495686_0002378 | 3300047472 | Bacteria | 17896 |
| 764 | Ga0495686_0047528 | 3300047472 | Bacteria | 2709 |
| 765 | Ga0495686_0198100 | 3300047472 | Bacteria | 1154 |
| 766 | Ga0495602_0000142 | 3300048088 | Bacteria | 66941 |
| 767 | Ga0495602_0013667 | 3300048088 | Bacteria | 8283 |
| 768 | Ga0495602_0102358 | 3300048088 | Bacteria | 2347 |
| 769 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 770 | Ga0496100_0000010 | 3300048903 | Bacteria | 205204 |
| 771 | Ga0496100_0000156 | 3300048903 | Bacteria | 38167 |
| 772 | Ga0496100_0013715 | 3300048903 | Bacteria | 4685 |
| 773 | Ga0496100_0036184 | 3300048903 | Bacteria | 3111 |
| 774 | Ga0496100_0119669 | 3300048903 | Bacteria | 1840 |
| 775 | Ga0496100_0343536 | 3300048903 | Bacteria | 1126 |
| 776 | Ga0496101_0000022 | 3300048904 | Bacteria | 216728 |
| 777 | Ga0496101_0000025 | 3300048904 | Bacteria | 205204 |
| 778 | Ga0496101_0016622 | 3300048904 | Bacteria | 4976 |
| 779 | Ga0496101_0047037 | 3300048904 | Bacteria | 3096 |
| 780 | Ga0496101_0117600 | 3300048904 | Bacteria | 2007 |
| 781 | Ga0496101_0224926 | 3300048904 | Bacteria | 1457 |
| 782 | Ga0496101_0257672 | 3300048904 | Bacteria | 1360 |
| 783 | Ga0496101_0268843 | 3300048904 | Bacteria | 1331 |
| 784 | Ga0496101_0301027 | 3300048904 | Bacteria | 1256 |
| 785 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 786 | Ga0496102_0000572 | 3300048905 | Bacteria | 39087 |
| 787 | Ga0496102_0010557 | 3300048905 | Bacteria | 7953 |
| 788 | Ga0496102_0014625 | 3300048905 | Bacteria | 6822 |
| 789 | Ga0496102_0029110 | 3300048905 | Bacteria | 4939 |
| 790 | Ga0496102_0033594 | 3300048905 | Bacteria | 4610 |
| 791 | Ga0496102_0163015 | 3300048905 | Bacteria | 2097 |
| 792 | Ga0496102_0202423 | 3300048905 | Bacteria | 1871 |
| 793 | Ga0496102_0324241 | 3300048905 | Bacteria | 1451 |
| 794 | Ga0496103_0000031 | 3300048906 | Bacteria | 204016 |
| 795 | Ga0496103_0000047 | 3300048906 | Bacteria | 161130 |
| 796 | Ga0496103_0001442 | 3300048906 | Bacteria | 15951 |
| 797 | Ga0496103_0085303 | 3300048906 | Bacteria | 1990 |
| 798 | Ga0496103_0144315 | 3300048906 | Bacteria | 1523 |
| 799 | Ga0496103_0199585 | 3300048906 | Bacteria | 1286 |
| 800 | Ga0496103_0238934 | 3300048906 | Bacteria | 1169 |
| 801 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 802 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 803 | Ga0496104_0000037 | 3300048907 | Bacteria | 178518 |
| 804 | Ga0496104_0001329 | 3300048907 | Bacteria | 21349 |
| 805 | Ga0496104_0004472 | 3300048907 | Bacteria | 12180 |
| 806 | Ga0496104_0042574 | 3300048907 | Bacteria | 4262 |
| 807 | Ga0496104_0058518 | 3300048907 | Bacteria | 3648 |
| 808 | Ga0496104_0192049 | 3300048907 | Bacteria | 1954 |
| 809 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 810 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 811 | Ga0496105_0000407 | 3300048908 | Bacteria | 28257 |
| 812 | Ga0496105_0003630 | 3300048908 | Bacteria | 11467 |
| 813 | Ga0496105_0019110 | 3300048908 | Bacteria | 5522 |
| 814 | Ga0496105_0076169 | 3300048908 | Bacteria | 2770 |
| 815 | Ga0496105_0213738 | 3300048908 | Bacteria | 1571 |
| 816 | Ga0496106_0000012 | 3300048909 | Bacteria | 205158 |
| 817 | Ga0496106_0000041 | 3300048909 | Bacteria | 107155 |
| 818 | Ga0496106_0000108 | 3300048909 | Bacteria | 64484 |
| 819 | Ga0496106_0001753 | 3300048909 | Bacteria | 16215 |
| 820 | Ga0496106_0006922 | 3300048909 | Bacteria | 8388 |
| 821 | Ga0496106_0036182 | 3300048909 | Bacteria | 3693 |
| 822 | Ga0496106_0077535 | 3300048909 | Bacteria | 2548 |
| 823 | Ga0496107_0000010 | 3300048910 | Bacteria | 205188 |
| 824 | Ga0496107_0000011 | 3300048910 | Bacteria | 201631 |
| 825 | Ga0496107_0150115 | 3300048910 | Bacteria | 1723 |
| 826 | Ga0496107_0247112 | 3300048910 | Bacteria | 1328 |
| 827 | Ga0496107_0248832 | 3300048910 | Bacteria | 1322 |
| 828 | Ga0496107_0279007 | 3300048910 | Bacteria | 1244 |
| 829 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 830 | Ga0496108_0000026 | 3300048911 | Bacteria | 172399 |
| 831 | Ga0496108_0000341 | 3300048911 | Bacteria | 39335 |
| 832 | Ga0496108_0001085 | 3300048911 | Bacteria | 21217 |
| 833 | Ga0496108_0009847 | 3300048911 | Bacteria | 7744 |
| 834 | Ga0496108_0018657 | 3300048911 | Bacteria | 5683 |
| 835 | Ga0496108_0046651 | 3300048911 | Bacteria | 3620 |
| 836 | Ga0496108_0070701 | 3300048911 | Bacteria | 2945 |
| 837 | Ga0496108_0099888 | 3300048911 | Bacteria | 2474 |
| 838 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 839 | Ga0496109_0000060 | 3300048912 | Bacteria | 115800 |
| 840 | Ga0496109_0000075 | 3300048912 | Bacteria | 105050 |
| 841 | Ga0496109_0000172 | 3300048912 | Bacteria | 64023 |
| 842 | Ga0496109_0000881 | 3300048912 | Bacteria | 25056 |
| 843 | Ga0496109_0003171 | 3300048912 | Bacteria | 13708 |
| 844 | Ga0496109_0007678 | 3300048912 | Bacteria | 9144 |
| 845 | Ga0496109_0011008 | 3300048912 | Bacteria | 7753 |
| 846 | Ga0496109_0030491 | 3300048912 | Bacteria | 4833 |
| 847 | Ga0496109_0060520 | 3300048912 | Bacteria | 3460 |
| 848 | Ga0496109_0064127 | 3300048912 | Bacteria | 3361 |
| 849 | Ga0496109_0067792 | 3300048912 | Bacteria | 3269 |
| 850 | Ga0496109_0077913 | 3300048912 | Bacteria | 3051 |
| 851 | Ga0496109_0256610 | 3300048912 | Bacteria | 1646 |
| 852 | Ga0496109_0322736 | 3300048912 | Bacteria | 1457 |
| 853 | Ga0496109_0357593 | 3300048912 | Bacteria | 1380 |
| 854 | Ga0496110_0000200 | 3300048913 | Bacteria | 38137 |
| 855 | Ga0496110_0000694 | 3300048913 | Bacteria | 23246 |
| 856 | Ga0496110_0004405 | 3300048913 | Bacteria | 10906 |
| 857 | Ga0496110_0006226 | 3300048913 | Bacteria | 9410 |
| 858 | Ga0496110_0009280 | 3300048913 | Bacteria | 7956 |
| 859 | Ga0496110_0072112 | 3300048913 | Bacteria | 3063 |
| 860 | Ga0496110_0123883 | 3300048913 | Bacteria | 2331 |
| 861 | Ga0496110_0125716 | 3300048913 | Bacteria | 2313 |
| 862 | Ga0496110_0138520 | 3300048913 | Bacteria | 2200 |
| 863 | Ga0496110_0153398 | 3300048913 | Bacteria | 2086 |
| 864 | Ga0496110_0153595 | 3300048913 | Bacteria | 2085 |
| 865 | Ga0496111_0000153 | 3300048914 | Bacteria | 30900 |
| 866 | Ga0496111_0008983 | 3300048914 | Bacteria | 6647 |
| 867 | Ga0496111_0032669 | 3300048914 | Bacteria | 3711 |
| 868 | Ga0496111_0035980 | 3300048914 | Bacteria | 3540 |
| 869 | Ga0496111_0171777 | 3300048914 | Bacteria | 1610 |
| 870 | Ga0496112_0000013 | 3300048915 | Bacteria | 237194 |
| 871 | Ga0496112_0001374 | 3300048915 | Bacteria | 18549 |
| 872 | Ga0496112_0032839 | 3300048915 | Bacteria | 5039 |
| 873 | Ga0496112_0035847 | 3300048915 | Bacteria | 4835 |
| 874 | Ga0496112_0045466 | 3300048915 | Bacteria | 4304 |
| 875 | Ga0496112_0064087 | 3300048915 | Bacteria | 3626 |
| 876 | Ga0496112_0071816 | 3300048915 | Bacteria | 3421 |
| 877 | Ga0496112_0166847 | 3300048915 | Bacteria | 2168 |
| 878 | Ga0496112_0174855 | 3300048915 | Bacteria | 2112 |
| 879 | Ga0496112_0209116 | 3300048915 | Bacteria | 1909 |
| 880 | Ga0496112_0211771 | 3300048915 | Bacteria | 1895 |
| 881 | Ga0496113_0000052 | 3300048916 | Bacteria | 49918 |
| 882 | Ga0496113_0004202 | 3300048916 | Bacteria | 8802 |
| 883 | Ga0496113_0030475 | 3300048916 | Bacteria | 3905 |
| 884 | Ga0496113_0054110 | 3300048916 | Bacteria | 3003 |
| 885 | Ga0496113_0056576 | 3300048916 | Bacteria | 2945 |
| 886 | Ga0496113_0088987 | 3300048916 | Bacteria | 2376 |
| 887 | Ga0496113_0239549 | 3300048916 | Bacteria | 1447 |
| 888 | Ga0496113_0275176 | 3300048916 | Bacteria | 1346 |
| 889 | Ga0496113_0366270 | 3300048916 | Bacteria | 1156 |
| 890 | Ga0496114_0000074 | 3300048917 | Bacteria | 71312 |
| 891 | Ga0496114_0007038 | 3300048917 | Bacteria | 8876 |
| 892 | Ga0496114_0027378 | 3300048917 | Bacteria | 4669 |
| 893 | Ga0496114_0041570 | 3300048917 | Bacteria | 3810 |
| 894 | Ga0496114_0128601 | 3300048917 | Bacteria | 2186 |
| 895 | Ga0496115_0000010 | 3300048918 | Bacteria | 227112 |
| 896 | Ga0496115_0000012 | 3300048918 | Bacteria | 215509 |
| 897 | Ga0496115_0000017 | 3300048918 | Bacteria | 185702 |
| 898 | Ga0496115_0002588 | 3300048918 | Bacteria | 12979 |
| 899 | Ga0496115_0004810 | 3300048918 | Bacteria | 9797 |
| 900 | Ga0496115_0015221 | 3300048918 | Bacteria | 5830 |
| 901 | Ga0496115_0033220 | 3300048918 | Bacteria | 4072 |
| 902 | Ga0496115_0191782 | 3300048918 | Bacteria | 1688 |
| 903 | Ga0496116_0000360 | 3300048919 | Bacteria | 70849 |
| 904 | Ga0496117_0006636 | 3300048920 | Bacteria | 11608 |
| 905 | Ga0496118_0001416 | 3300048921 | Bacteria | 36186 |
| 906 | Ga0496118_0057207 | 3300048921 | Bacteria | 2925 |
| 907 | Ga0496119_0002006 | 3300048922 | Bacteria | 23038 |
| 908 | Ga0496119_0002714 | 3300048922 | Bacteria | 19104 |
| 909 | Ga0496119_0016372 | 3300048922 | Bacteria | 5645 |
| 910 | Ga0496119_0036375 | 3300048922 | Bacteria | 3214 |
| 911 | Ga0496120_0005529 | 3300048923 | Bacteria | 10050 |
| 912 | Ga0496121_0002111 | 3300048924 | Bacteria | 31257 |
| 913 | Ga0496121_0016970 | 3300048924 | Bacteria | 7478 |
| 914 | Ga0496121_0045460 | 3300048924 | Bacteria | 3772 |
| 915 | Ga0496121_0205619 | 3300048924 | Bacteria | 1399 |
| 916 | Ga0496124_0248647 | 3300048927 | Bacteria | 1317 |
| 917 | Ga0496125_0043665 | 3300048928 | Bacteria | 3800 |
| 918 | Ga0496125_0085847 | 3300048928 | Bacteria | 2383 |
| 919 | Ga0496126_0351118 | 3300048929 | Bacteria | 1206 |
| 920 | Ga0496126_0413818 | 3300048929 | Bacteria | 1091 |
| 921 | Ga0501031_0000355 | 3300049568 | Bacteria | 26681 |
| 922 | Ga0501031_0239627 | 3300049568 | Bacteria | 1179 |
| 923 | Ga0501032_0000734 | 3300049569 | Bacteria | 26634 |
| 924 | Ga0501033_0000927 | 3300049570 | Bacteria | 26794 |
| 925 | Ga0501033_0117850 | 3300049570 | Bacteria | 1929 |
| 926 | Ga0501034_0008505 | 3300049571 | Bacteria | 10837 |
| 927 | Ga0501034_0219806 | 3300049571 | Bacteria | 1853 |
| 928 | Ga0501036_0000548 | 3300049572 | Bacteria | 26923 |
| 929 | Ga0501036_0147752 | 3300049572 | Bacteria | 1983 |
| 930 | Ga0501036_0267066 | 3300049572 | Bacteria | 1433 |
| 931 | Ga0501037_0000599 | 3300049573 | Bacteria | 28109 |
| 932 | Ga0501038_0000788 | 3300049574 | Bacteria | 28056 |
| 933 | Ga0501039_0004109 | 3300049575 | Bacteria | 10959 |
| 934 | Ga0501039_0036116 | 3300049575 | Bacteria | 3813 |
| 935 | Ga0501039_0241299 | 3300049575 | Bacteria | 1421 |
| 936 | Ga0501039_0435772 | 3300049575 | Bacteria | 1029 |
| 937 | Ga0501040_0033872 | 3300049576 | Bacteria | 3462 |
| 938 | Ga0501040_0077311 | 3300049576 | Bacteria | 2302 |
| 939 | Ga0501042_0016286 | 3300049578 | Bacteria | 5102 |
| 940 | Ga0501042_0183274 | 3300049578 | Bacteria | 1510 |
| 941 | Ga0501043_0000871 | 3300049579 | Bacteria | 26758 |
| 942 | Ga0501046_0000669 | 3300049580 | Bacteria | 33196 |
| 943 | Ga0501047_0001012 | 3300049581 | Bacteria | 28368 |
| 944 | Ga0501047_0107547 | 3300049581 | Bacteria | 2670 |
| 945 | Ga0501047_0320663 | 3300049581 | Bacteria | 1389 |
| 946 | Ga0501048_0001025 | 3300049582 | Bacteria | 20894 |
| 947 | Ga0501048_0130961 | 3300049582 | Bacteria | 1773 |
| 948 | Ga0501048_0241023 | 3300049582 | Bacteria | 1283 |
| 949 | Ga0501067_0054852 | 3300049583 | Bacteria | 2208 |
| 950 | Ga0501068_0196300 | 3300049584 | Bacteria | 1279 |
| 951 | Ga0501069_0011011 | 3300049585 | Bacteria | 4796 |
| 952 | Ga0501069_0014111 | 3300049585 | Bacteria | 4265 |
| 953 | Ga0501069_0031666 | 3300049585 | Bacteria | 2910 |
| 954 | Ga0501069_0099379 | 3300049585 | Bacteria | 1651 |
| 955 | Ga0501070_0000466 | 3300049586 | Bacteria | 36819 |
| 956 | Ga0501070_0264256 | 3300049586 | Bacteria | 1406 |
| 957 | Ga0501070_0278122 | 3300049586 | Bacteria | 1366 |
| 958 | Ga0501070_0327455 | 3300049586 | Bacteria | 1245 |
| 959 | Ga0501071_0177865 | 3300049587 | Bacteria | 1594 |
| 960 | Ga0501072_0011877 | 3300049588 | Bacteria | 6653 |
| 961 | Ga0501072_0030202 | 3300049588 | Bacteria | 4237 |
| 962 | Ga0501072_0032899 | 3300049588 | Bacteria | 4061 |
| 963 | Ga0501073_0000981 | 3300049589 | Bacteria | 20567 |
| 964 | Ga0501073_0002848 | 3300049589 | Bacteria | 12954 |
| 965 | Ga0501073_0132569 | 3300049589 | Bacteria | 1727 |
| 966 | Ga0501074_0008085 | 3300049590 | Bacteria | 7621 |
| 967 | Ga0501074_0044917 | 3300049590 | Bacteria | 3197 |
| 968 | Ga0501074_0054881 | 3300049590 | Bacteria | 2873 |
| 969 | Ga0501075_0001027 | 3300049591 | Bacteria | 17897 |
| 970 | Ga0501075_0216565 | 3300049591 | Bacteria | 1461 |
| 971 | Ga0501076_0004141 | 3300049592 | Bacteria | 10260 |
| 972 | Ga0501076_0013004 | 3300049592 | Bacteria | 6231 |
| 973 | Ga0501076_0163720 | 3300049592 | Bacteria | 1813 |
| 974 | Ga0501079_0009854 | 3300049741 | Bacteria | 7249 |
| 975 | Ga0501079_0077178 | 3300049741 | Bacteria | 2577 |
| 976 | Ga0501079_0146648 | 3300049741 | Bacteria | 1839 |
| 977 | Ga0501079_0384020 | 3300049741 | Bacteria | 1101 |
| 978 | Ga0501080_0002687 | 3300049742 | Bacteria | 15577 |
| 979 | Ga0501080_0006435 | 3300049742 | Bacteria | 10543 |
| 980 | Ga0501081_0059551 | 3300049743 | Bacteria | 2644 |
| 981 | Ga0501081_0204670 | 3300049743 | Bacteria | 1432 |
| 982 | Ga0501081_0237177 | 3300049743 | Bacteria | 1329 |
| 983 | Ga0501083_0000531 | 3300049744 | Bacteria | 24333 |
| 984 | Ga0501083_0000666 | 3300049744 | Bacteria | 22284 |
| 985 | Ga0501083_0010094 | 3300049744 | Bacteria | 6655 |
| 986 | Ga0501083_0027051 | 3300049744 | Bacteria | 3960 |
| 987 | Ga0501083_0228949 | 3300049744 | Bacteria | 1211 |
| 988 | Ga0501035_0001127 | 3300049822 | Bacteria | 27921 |
| 989 | Ga0501035_0090471 | 3300049822 | Bacteria | 2694 |
| 990 | Ga0501044_0001423 | 3300049823 | Bacteria | 28065 |
| 991 | Ga0501044_0081576 | 3300049823 | Bacteria | 3273 |
| 992 | Ga0501045_0006965 | 3300049824 | Bacteria | 7837 |
| 993 | Ga0501045_0008962 | 3300049824 | Bacteria | 6987 |
| 994 | Ga0501045_0127864 | 3300049824 | Bacteria | 1888 |
| 995 | Ga0501045_0267418 | 3300049824 | Bacteria | 1273 |
| 996 | nmdc:mga00v17_87294_c1 | 3300050491 | Bacteria | 1955 |
| 997 | nmdc:mga00v17_94822_c1 | 3300050491 | Bacteria | 1878 |
| 998 | nmdc:mga0yw44_165520_c1 | 3300050492 | Bacteria | 1449 |
| 999 | nmdc:mga0yw44_253506_c1 | 3300050492 | Bacteria | 1172 |
| 1000 | nmdc:mga0yw44_4753_c1 | 3300050492 | Bacteria | 6293 |
| 1001 | nmdc:mga0yw44_54693_c1 | 3300050492 | Bacteria | 2427 |
| 1002 | nmdc:mga06z11_50203_c1 | 3300050494 | Bacteria | 2131 |
| 1003 | nmdc:mga05p37_138550_c1 | 3300050507 | Bacteria | 2982 |
| 1004 | nmdc:mga05p37_160696_c1 | 3300050507 | Bacteria | 2744 |
| 1005 | nmdc:mga05p37_180960_c1 | 3300050507 | Bacteria | 2564 |
| 1006 | nmdc:mga05p37_208895_c1 | 3300050507 | Bacteria | 2361 |
| 1007 | nmdc:mga05p37_216918_c1 | 3300050507 | Bacteria | 2310 |
| 1008 | nmdc:mga05p37_284307_c1 | 3300050507 | Bacteria | 1667 |
| 1009 | nmdc:mga05p37_350029_c1 | 3300050507 | Bacteria | 1740 |
| 1010 | nmdc:mga05p37_39716_c1 | 3300050507 | Bacteria | 2635 |
| 1011 | nmdc:mga05p37_4288_c1 | 3300050507 | Bacteria | 16659 |
| 1012 | nmdc:mga05p37_640695_c1 | 3300050507 | Bacteria | 1192 |
| 1013 | nmdc:mga09592_26468_c1 | 3300050508 | Bacteria | 4806 |
| 1014 | nmdc:mga09592_48745_c1 | 3300050508 | Bacteria | 3571 |
| 1015 | nmdc:mga0qj67_7661_c1 | 3300050509 | Bacteria | 7978 |
| 1016 | nmdc:mga0qj67_86767_c1 | 3300050509 | Bacteria | 2511 |
| 1017 | nmdc:mga06r32_110560_c1 | 3300050510 | Bacteria | 2703 |
| 1018 | nmdc:mga06r32_135857_c1 | 3300050510 | Bacteria | 2434 |
| 1019 | nmdc:mga06r32_4342_c1 | 3300050510 | Bacteria | 12687 |
| 1020 | nmdc:mga06r32_49434_c1 | 3300050510 | Bacteria | 4021 |
| 1021 | nmdc:mga06r32_55917_c1 | 3300050510 | Bacteria | 3786 |
| 1022 | nmdc:mga08y16_10720_c1 | 3300050511 | Bacteria | 9618 |
| 1023 | nmdc:mga08y16_32841_c1 | 3300050511 | Bacteria | 5456 |
| 1024 | nmdc:mga08y16_426965_c1 | 3300050511 | Bacteria | 1354 |
| 1025 | nmdc:mga08y16_729063_c1 | 3300050511 | Bacteria | 989 |
| 1026 | nmdc:mga0n895_1290_c1 | 3300050512 | Bacteria | 18537 |
| 1027 | nmdc:mga0n895_173515_c1 | 3300050512 | Bacteria | 2188 |
| 1028 | nmdc:mga0n895_18266_c1 | 3300050512 | Bacteria | 6485 |
| 1029 | nmdc:mga0n895_85269_c1 | 3300050512 | Bacteria | 3153 |
| 1030 | nmdc:mga0n895_91074_c1 | 3300050512 | Bacteria | 3051 |
| 1031 | nmdc:mga0rr50_181999_c1 | 3300050513 | Bacteria | 1718 |
| 1032 | nmdc:mga0rr50_74488_c1 | 3300050513 | Bacteria | 2599 |
| 1033 | nmdc:mga08x19_323939_c1 | 3300050514 | Bacteria | 1073 |
| 1034 | nmdc:mga08x19_49438_c1 | 3300050514 | Bacteria | 2696 |
| 1035 | nmdc:mga0a205_12181_c1 | 3300050515 | Bacteria | 7952 |
| 1036 | nmdc:mga0a205_169690_c1 | 3300050515 | Bacteria | 2078 |
| 1037 | nmdc:mga0a205_40657_c1 | 3300050515 | Bacteria | 4476 |
| 1038 | nmdc:mga0a205_6_c1 | 3300050515 | Bacteria | 129758 |
| 1039 | Ga0495601_0000027 | 3300053077 | Bacteria | 116790 |
| 1040 | Ga0495601_0000617 | 3300053077 | Bacteria | 18929 |
| 1041 | Ga0495601_0001946 | 3300053077 | Bacteria | 11558 |
| 1042 | Ga0495601_0008060 | 3300053077 | Bacteria | 6210 |
| 1043 | Ga0495601_0045549 | 3300053077 | Bacteria | 2759 |
| 1044 | Ga0495601_0078051 | 3300053077 | Bacteria | 2121 |
| 1045 | Ga0495612_0000022 | 3300053078 | Bacteria | 119126 |
| 1046 | Ga0495612_0000072 | 3300053078 | Bacteria | 45740 |
| 1047 | Ga0495612_0001004 | 3300053078 | Bacteria | 11610 |
| 1048 | Ga0495612_0007683 | 3300053078 | Bacteria | 4404 |
| 1049 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 1050 | Ga0495655_0004484 | 3300053083 | Bacteria | 2389 |
| 1051 | Ga0495595_0000022 | 3300053084 | Bacteria | 110598 |
| 1052 | Ga0495595_0000140 | 3300053084 | Bacteria | 29997 |
| 1053 | Ga0495619_0000010 | 3300053085 | Bacteria | 302390 |
| 1054 | Ga0495619_0000070 | 3300053085 | Bacteria | 80588 |
| 1055 | Ga0495619_0000077 | 3300053085 | Bacteria | 73017 |
| 1056 | Ga0495619_0002106 | 3300053085 | Bacteria | 13197 |
| 1057 | Ga0495619_0004729 | 3300053085 | Bacteria | 8662 |
| 1058 | Ga0495619_0004935 | 3300053085 | Bacteria | 8473 |
| 1059 | Ga0495619_0019032 | 3300053085 | Bacteria | 4362 |
| 1060 | Ga0500566_0001344 | 3300053094 | Bacteria | 14356 |
| 1061 | Ga0500641_0006890 | 3300053096 | Bacteria | 4040 |
| 1062 | Ga0500556_0000780 | 3300053104 | Bacteria | 18803 |
| 1063 | Ga0500614_003327 | 3300053123 | Bacteria | 3467 |
| 1064 | Ga0500628_000073 | 3300053129 | Bacteria | 26096 |
| 1065 | Ga0500628_003565 | 3300053129 | Unclassified | 2573 |
| 1066 | Ga0500616_0009899 | 3300053153 | Bacteria | 5741 |
| 1067 | Ga0500637_0001373 | 3300053178 | Bacteria | 10330 |
| 1068 | Ga0500599_003742 | 3300053736 | Bacteria | 1865 |
| 1069 | Ga0501084_0045098 | 3300054114 | Bacteria | 3692 |
| 1070 | Ga0501082_0014568 | 3300060353 | Bacteria | 6772 |
| 1071 | Ga0501082_0173646 | 3300060353 | Bacteria | 1874 |
| 1072 | Ga0501082_0206784 | 3300060353 | Bacteria | 1708 |
| 1073 | Ga0501082_0367066 | 3300060353 | Bacteria | 1256 |
| 1074 | Ga0466962_0004305 | 3300061719 | Bacteria | 6825 |
| 1075 | Ga0466962_0064790 | 3300061719 | Bacteria | 1745 |
| 1076 | Ga0466962_0088312 | 3300061719 | Bacteria | 1485 |
| 1077 | Ga0530510_0009028 | 3300061734 | Bacteria | 6988 |
| 1078 | Ga0530510_0048891 | 3300061734 | Bacteria | 3056 |
| 1079 | Ga0530510_0304370 | 3300061734 | Bacteria | 1193 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048916 | Ga0496113_0275176 | Ga0496113_0275176_512_1306 | 263 |
| 2 | 3300046531 | Ga0495665_0208760 | Ga0495665_0208760_161_976 | 270 |
| 3 | 3300048908 | Ga0496105_0003630 | Ga0496105_0003630_5092_6084 | 287 |
| 4 | 3300048915 | Ga0496112_0174855 | Ga0496112_0174855_705_1697 | 287 |
| 5 | 3300014325 | Ga0163163_10168575 | Ga0163163_101685752 | 288 |
| 6 | 3300048915 | Ga0496112_0209116 | Ga0496112_0209116_711_1706 | 288 |
| 7 | 3300049741 | Ga0501079_0384020 | Ga0501079_0384020_201_1076 | 291 |
| 8 | 3300049589 | Ga0501073_0132569 | Ga0501073_0132569_10_951 | 294 |
| 9 | 3300046809 | Ga0495600_0047292 | Ga0495600_0047292_769_1770 | 298 |
| 10 | 3300053178 | Ga0500637_0001373 | Ga0500637_0001373_155_1168 | 298 |
| 11 | 3300050491 | nmdc:mga00v17_87294_c1 | nmdc:mga00v17_87294_c1_496_1488 | 300 |
| 12 | 3300032002 | Ga0307416_100451090 | Ga0307416_1004510902 | 304 |
| 13 | 3300048912 | Ga0496109_0007678 | Ga0496109_0007678_2579_3568 | 307 |
| 14 | 3300006847 | Ga0075431_100233256 | Ga0075431_1002332562 | 308 |
| 15 | 3300048913 | Ga0496110_0123883 | Ga0496110_0123883_1025_2029 | 308 |
| 16 | 3300048914 | Ga0496111_0035980 | Ga0496111_0035980_1445_2449 | 308 |
| 17 | 3300050510 | nmdc:mga06r32_55917_c1 | nmdc:mga06r32_55917_c1_2568_3572 | 308 |
| 18 | 3300050511 | nmdc:mga08y16_729063_c1 | nmdc:mga08y16_729063_c1_20_946 | 308 |
| 19 | 3300005518 | Ga0070699_100079328 | Ga0070699_1000793284 | 309 |
| 20 | 3300046536 | Ga0495587_0005182 | Ga0495587_0005182_2805_3803 | 312 |
| 21 | 3300047472 | Ga0495686_0002378 | Ga0495686_0002378_14926_15876 | 312 |
| 22 | 3300049585 | Ga0501069_0099379 | Ga0501069_0099379_354_1313 | 312 |
| 23 | 3300048927 | Ga0496124_0248647 | Ga0496124_0248647_256_1257 | 313 |
| 24 | 3300005435 | Ga0070714_100164642 | Ga0070714_1001646422 | 314 |
| 25 | 3300025929 | Ga0207664_10071622 | Ga0207664_100716223 | 314 |
| 26 | 3300049744 | Ga0501083_0000666 | Ga0501083_0000666_429_1436 | 314 |
| 27 | 3300049589 | Ga0501073_0002848 | Ga0501073_0002848_5905_6927 | 315 |
| 28 | 3300053085 | Ga0495619_0000077 | Ga0495619_0000077_43812_44798 | 317 |
| 29 | 3300005341 | Ga0070691_10000001 | Ga0070691_1000000136 | 319 |
| 30 | 3300009148 | Ga0105243_10440617 | Ga0105243_104406171 | 320 |
| 31 | 3300046463 | Ga0495653_0150783 | Ga0495653_0150783_128_1096 | 320 |
| 32 | 3300049570 | Ga0501033_0117850 | Ga0501033_0117850_511_1503 | 320 |
| 33 | 3300006028 | Ga0070717_10153196 | Ga0070717_101531962 | 321 |
| 34 | 3300025928 | Ga0207700_10038669 | Ga0207700_100386694 | 321 |
| 35 | 3300045976 | Ga0466967_0155266 | Ga0466967_0155266_1077_2069 | 321 |
| 36 | 3300009177 | Ga0105248_10128056 | Ga0105248_101280562 | 323 |
| 37 | 3300048903 | Ga0496100_0013715 | Ga0496100_0013715_1810_2844 | 323 |
| 38 | 3300005467 | Ga0070706_100010715 | Ga0070706_1000107156 | 324 |
| 39 | 3300005468 | Ga0070707_100217407 | Ga0070707_1002174072 | 324 |
| 40 | 3300005937 | Ga0081455_10007837 | Ga0081455_100078375 | 324 |
| 41 | 3300010375 | Ga0105239_10172957 | Ga0105239_101729573 | 324 |
| 42 | 3300013306 | Ga0163162_10459077 | Ga0163162_104590772 | 324 |
| 43 | 3300025910 | Ga0207684_10001611 | Ga0207684_100016113 | 324 |
| 44 | 3300025922 | Ga0207646_10057050 | Ga0207646_100570502 | 324 |
| 45 | 3300025927 | Ga0207687_10022929 | Ga0207687_100229292 | 324 |
| 46 | 3300028800 | Ga0265338_10012258 | Ga0265338_100122588 | 324 |
| 47 | 3300031251 | Ga0265327_10001436 | Ga0265327_1000143620 | 324 |
| 48 | 3300037312 | Ga0395899_0020250 | Ga0395899_0020250_1953_2936 | 324 |
| 49 | 3300037418 | Ga0395900_0166368 | Ga0395900_0166368_1114_2094 | 324 |
| 50 | 3300037466 | Ga0395898_0003141 | Ga0395898_0003141_1712_2695 | 324 |
| 51 | 3300037466 | Ga0395898_0067934 | Ga0395898_0067934_167_1147 | 324 |
| 52 | 3300037466 | Ga0395898_0293825 | Ga0395898_0293825_450_1430 | 324 |
| 53 | 3300037471 | Ga0395905_0021115 | Ga0395905_0021115_760_1743 | 324 |
| 54 | 3300038443 | Ga0395901_0023382 | Ga0395901_0023382_1634_2617 | 324 |
| 55 | 3300048905 | Ga0496102_0324241 | Ga0496102_0324241_210_1193 | 324 |
| 56 | 3300048915 | Ga0496112_0166847 | Ga0496112_0166847_876_1859 | 324 |
| 57 | 3300005439 | Ga0070711_100001716 | Ga0070711_1000017167 | 325 |
| 58 | 3300005937 | Ga0081455_10085414 | Ga0081455_100854142 | 325 |
| 59 | 3300005985 | Ga0081539_10003820 | Ga0081539_100038205 | 325 |
| 60 | 3300013308 | Ga0157375_10520165 | Ga0157375_105201652 | 325 |
| 61 | 3300017792 | Ga0163161_10336924 | Ga0163161_103369242 | 325 |
| 62 | 3300025912 | Ga0207707_10229762 | Ga0207707_102297622 | 325 |
| 63 | 3300025916 | Ga0207663_10012244 | Ga0207663_100122442 | 325 |
| 64 | 3300025928 | Ga0207700_10234380 | Ga0207700_102343802 | 325 |
| 65 | 3300025929 | Ga0207664_10090856 | Ga0207664_100908562 | 325 |
| 66 | 3300026067 | Ga0207678_10196534 | Ga0207678_101965342 | 325 |
| 67 | 3300044694 | Ga0466963_0003594 | Ga0466963_0003594_1887_2921 | 325 |
| 68 | 3300044694 | Ga0466963_0011029 | Ga0466963_0011029_1055_2038 | 325 |
| 69 | 3300044842 | Ga0466957_0032032 | Ga0466957_0032032_1528_2562 | 325 |
| 70 | 3300044842 | Ga0466957_0122175 | Ga0466957_0122175_473_1456 | 325 |
| 71 | 3300044901 | Ga0466960_0019437 | Ga0466960_0019437_1433_2416 | 325 |
| 72 | 3300045976 | Ga0466967_0005609 | Ga0466967_0005609_3882_4916 | 325 |
| 73 | 3300045976 | Ga0466967_0079502 | Ga0466967_0079502_1951_2934 | 325 |
| 74 | 3300048913 | Ga0496110_0153398 | Ga0496110_0153398_719_1699 | 325 |
| 75 | 3300048918 | Ga0496115_0191782 | Ga0496115_0191782_318_1301 | 325 |
| 76 | 3300050507 | nmdc:mga05p37_138550_c1 | nmdc:mga05p37_138550_c1_957_1937 | 325 |
| 77 | 3300005329 | Ga0070683_100062589 | Ga0070683_1000625893 | 326 |
| 78 | 3300005530 | Ga0070679_100219759 | Ga0070679_1002197592 | 326 |
| 79 | 3300005539 | Ga0068853_100159773 | Ga0068853_1001597731 | 326 |
| 80 | 3300005578 | Ga0068854_100207256 | Ga0068854_1002072562 | 326 |
| 81 | 3300005937 | Ga0081455_10114109 | Ga0081455_101141093 | 326 |
| 82 | 3300006871 | Ga0075434_100008022 | Ga0075434_1000080228 | 326 |
| 83 | 3300006871 | Ga0075434_100245894 | Ga0075434_1002458942 | 326 |
| 84 | 3300006914 | Ga0075436_100097051 | Ga0075436_1000970512 | 326 |
| 85 | 3300009093 | Ga0105240_10036442 | Ga0105240_100364424 | 326 |
| 86 | 3300009147 | Ga0114129_10000229 | Ga0114129_1000022972 | 326 |
| 87 | 3300013104 | Ga0157370_10077456 | Ga0157370_100774563 | 326 |
| 88 | 3300014969 | Ga0157376_10054029 | Ga0157376_100540294 | 326 |
| 89 | 3300025913 | Ga0207695_10006218 | Ga0207695_100062187 | 326 |
| 90 | 3300026041 | Ga0207639_10197162 | Ga0207639_101971622 | 326 |
| 91 | 3300026041 | Ga0207639_10302852 | Ga0207639_103028521 | 326 |
| 92 | 3300026121 | Ga0207683_10369127 | Ga0207683_103691271 | 326 |
| 93 | 3300028556 | Ga0265337_1020390 | Ga0265337_10203903 | 326 |
| 94 | 3300031251 | Ga0265327_10002767 | Ga0265327_100027678 | 326 |
| 95 | 3300031901 | Ga0307406_10029141 | Ga0307406_100291412 | 326 |
| 96 | 3300031901 | Ga0307406_10346300 | Ga0307406_103463001 | 326 |
| 97 | 3300031903 | Ga0307407_10070539 | Ga0307407_100705392 | 326 |
| 98 | 3300032002 | Ga0307416_100402665 | Ga0307416_1004026652 | 326 |
| 99 | 3300032005 | Ga0307411_10019425 | Ga0307411_100194253 | 326 |
| 100 | 3300037312 | Ga0395899_0058634 | Ga0395899_0058634_1430_2422 | 326 |
| 101 | 3300037418 | Ga0395900_0077025 | Ga0395900_0077025_2029_3021 | 326 |
| 102 | 3300037471 | Ga0395905_0019433 | Ga0395905_0019433_5029_6021 | 326 |
| 103 | 3300038443 | Ga0395901_0023591 | Ga0395901_0023591_421_1413 | 326 |
| 104 | 3300044693 | Ga0466961_0011845 | Ga0466961_0011845_2092_3087 | 326 |
| 105 | 3300044694 | Ga0466963_0027393 | Ga0466963_0027393_2584_3570 | 326 |
| 106 | 3300044901 | Ga0466960_0035547 | Ga0466960_0035547_317_1303 | 326 |
| 107 | 3300045049 | Ga0466959_0041894 | Ga0466959_0041894_1620_2615 | 326 |
| 108 | 3300045976 | Ga0466967_0078341 | Ga0466967_0078341_741_1730 | 326 |
| 109 | 3300046454 | Ga0495592_0015168 | Ga0495592_0015168_1532_2530 | 326 |
| 110 | 3300046559 | Ga0495667_0089911 | Ga0495667_0089911_370_1356 | 326 |
| 111 | 3300046559 | Ga0495667_0120399 | Ga0495667_0120399_377_1363 | 326 |
| 112 | 3300046663 | Ga0495635_0118943 | Ga0495635_0118943_788_1774 | 326 |
| 113 | 3300046683 | Ga0495658_0125692 | Ga0495658_0125692_509_1495 | 326 |
| 114 | 3300048904 | Ga0496101_0224926 | Ga0496101_0224926_190_1230 | 326 |
| 115 | 3300048905 | Ga0496102_0202423 | Ga0496102_0202423_723_1763 | 326 |
| 116 | 3300048908 | Ga0496105_0076169 | Ga0496105_0076169_691_1731 | 326 |
| 117 | 3300048910 | Ga0496107_0150115 | Ga0496107_0150115_309_1298 | 326 |
| 118 | 3300048911 | Ga0496108_0046651 | Ga0496108_0046651_471_1460 | 326 |
| 119 | 3300048912 | Ga0496109_0064127 | Ga0496109_0064127_2037_3026 | 326 |
| 120 | 3300048917 | Ga0496114_0007038 | Ga0496114_0007038_1778_2818 | 326 |
| 121 | 3300048918 | Ga0496115_0033220 | Ga0496115_0033220_1571_2611 | 326 |
| 122 | 3300048924 | Ga0496121_0002111 | Ga0496121_0002111_741_1754 | 326 |
| 123 | 3300049568 | Ga0501031_0239627 | Ga0501031_0239627_40_1029 | 326 |
| 124 | 3300049582 | Ga0501048_0241023 | Ga0501048_0241023_189_1178 | 326 |
| 125 | 3300049583 | Ga0501067_0054852 | Ga0501067_0054852_777_1760 | 326 |
| 126 | 3300049585 | Ga0501069_0031666 | Ga0501069_0031666_14_1054 | 326 |
| 127 | 3300049586 | Ga0501070_0278122 | Ga0501070_0278122_14_1003 | 326 |
| 128 | 3300049590 | Ga0501074_0044917 | Ga0501074_0044917_2131_3120 | 326 |
| 129 | 3300049744 | Ga0501083_0228949 | Ga0501083_0228949_202_1191 | 326 |
| 130 | 3300049824 | Ga0501045_0267418 | Ga0501045_0267418_210_1199 | 326 |
| 131 | 3300050507 | nmdc:mga05p37_4288_c1 | nmdc:mga05p37_4288_c1_9363_10352 | 326 |
| 132 | 3300050512 | nmdc:mga0n895_1290_c1 | nmdc:mga0n895_1290_c1_3187_4227 | 326 |
| 133 | 3300050512 | nmdc:mga0n895_85269_c1 | nmdc:mga0n895_85269_c1_622_1659 | 326 |
| 134 | 3300050513 | nmdc:mga0rr50_74488_c1 | nmdc:mga0rr50_74488_c1_1534_2574 | 326 |
| 135 | 3300053104 | Ga0500556_0000780 | Ga0500556_0000780_653_1645 | 326 |
| 136 | 3300053153 | Ga0500616_0009899 | Ga0500616_0009899_570_1562 | 326 |
| 137 | 3300053736 | Ga0500599_003742 | Ga0500599_003742_268_1260 | 326 |
| 138 | 3300061719 | Ga0466962_0064790 | Ga0466962_0064790_634_1620 | 326 |
| 139 | 3300061734 | Ga0530510_0009028 | Ga0530510_0009028_1702_2742 | 326 |
| 140 | 3300061734 | Ga0530510_0304370 | Ga0530510_0304370_33_1022 | 326 |
| 141 | 3300003203 | JGI25406J46586_10003262 | JGI25406J46586_100032628 | 327 |
| 142 | 3300005339 | Ga0070660_100013156 | Ga0070660_1000131562 | 327 |
| 143 | 3300005345 | Ga0070692_10012752 | Ga0070692_100127522 | 327 |
| 144 | 3300005366 | Ga0070659_100346998 | Ga0070659_1003469982 | 327 |
| 145 | 3300005435 | Ga0070714_100000137 | Ga0070714_10000013728 | 327 |
| 146 | 3300005441 | Ga0070700_100161929 | Ga0070700_1001619292 | 327 |
| 147 | 3300005981 | Ga0081538_10000909 | Ga0081538_100009095 | 327 |
| 148 | 3300005983 | Ga0081540_1000265 | Ga0081540_10002659 | 327 |
| 149 | 3300005985 | Ga0081539_10016831 | Ga0081539_100168315 | 327 |
| 150 | 3300005985 | Ga0081539_10035589 | Ga0081539_100355892 | 327 |
| 151 | 3300006048 | Ga0075363_100084439 | Ga0075363_1000844392 | 327 |
| 152 | 3300006051 | Ga0075364_10035244 | Ga0075364_100352442 | 327 |
| 153 | 3300006175 | Ga0070712_100000002 | Ga0070712_100000002172 | 327 |
| 154 | 3300006844 | Ga0075428_100156573 | Ga0075428_1001565732 | 327 |
| 155 | 3300006871 | Ga0075434_100446095 | Ga0075434_1004460952 | 327 |
| 156 | 3300006880 | Ga0075429_100023593 | Ga0075429_1000235933 | 327 |
| 157 | 3300006881 | Ga0068865_100047443 | Ga0068865_1000474434 | 327 |
| 158 | 3300009098 | Ga0105245_10024710 | Ga0105245_100247106 | 327 |
| 159 | 3300014325 | Ga0163163_10066087 | Ga0163163_100660874 | 327 |
| 160 | 3300021384 | Ga0213876_10039275 | Ga0213876_100392752 | 327 |
| 161 | 3300025915 | Ga0207693_10000014 | Ga0207693_1000001425 | 327 |
| 162 | 3300025929 | Ga0207664_10000006 | Ga0207664_10000006117 | 327 |
| 163 | 3300028563 | Ga0265319_1000323 | Ga0265319_10003232 | 327 |
| 164 | 3300028577 | Ga0265318_10015071 | Ga0265318_100150712 | 327 |
| 165 | 3300028800 | Ga0265338_10086363 | Ga0265338_100863632 | 327 |
| 166 | 3300031240 | Ga0265320_10018765 | Ga0265320_100187652 | 327 |
| 167 | 3300031240 | Ga0265320_10103011 | Ga0265320_101030112 | 327 |
| 168 | 3300037418 | Ga0395900_0435928 | Ga0395900_0435928_187_1173 | 327 |
| 169 | 3300037466 | Ga0395898_0063887 | Ga0395898_0063887_2094_3080 | 327 |
| 170 | 3300037466 | Ga0395898_0288586 | Ga0395898_0288586_35_1024 | 327 |
| 171 | 3300038443 | Ga0395901_0005774 | Ga0395901_0005774_11153_12142 | 327 |
| 172 | 3300038443 | Ga0395901_0064733 | Ga0395901_0064733_1511_2497 | 327 |
| 173 | 3300039437 | Ga0436365_0378539 | Ga0436365_0378539_6052_7038 | 327 |
| 174 | 3300039453 | Ga0436362_0570716 | Ga0436362_0570716_480_1472 | 327 |
| 175 | 3300039453 | Ga0436362_1091830 | Ga0436362_1091830_659_1645 | 327 |
| 176 | 3300044719 | Ga0466971_0007205 | Ga0466971_0007205_159_1145 | 327 |
| 177 | 3300044842 | Ga0466957_0045274 | Ga0466957_0045274_231_1217 | 327 |
| 178 | 3300045049 | Ga0466959_0047397 | Ga0466959_0047397_799_1785 | 327 |
| 179 | 3300046476 | Ga0495662_0065988 | Ga0495662_0065988_347_1339 | 327 |
| 180 | 3300046499 | Ga0495594_0000010 | Ga0495594_0000010_57354_58343 | 327 |
| 181 | 3300046517 | Ga0495630_0029400 | Ga0495630_0029400_2747_3760 | 327 |
| 182 | 3300046523 | Ga0495644_0000902 | Ga0495644_0000902_8383_9375 | 327 |
| 183 | 3300046615 | Ga0495656_0034837 | Ga0495656_0034837_865_1857 | 327 |
| 184 | 3300046683 | Ga0495658_0014050 | Ga0495658_0014050_2691_3683 | 327 |
| 185 | 3300047469 | Ga0495673_0007713 | Ga0495673_0007713_4101_5093 | 327 |
| 186 | 3300047472 | Ga0495686_0047528 | Ga0495686_0047528_1324_2316 | 327 |
| 187 | 3300048904 | Ga0496101_0257672 | Ga0496101_0257672_145_1131 | 327 |
| 188 | 3300048904 | Ga0496101_0268843 | Ga0496101_0268843_118_1113 | 327 |
| 189 | 3300048907 | Ga0496104_0192049 | Ga0496104_0192049_88_1074 | 327 |
| 190 | 3300048910 | Ga0496107_0279007 | Ga0496107_0279007_209_1195 | 327 |
| 191 | 3300048912 | Ga0496109_0077913 | Ga0496109_0077913_814_1800 | 327 |
| 192 | 3300048915 | Ga0496112_0001374 | Ga0496112_0001374_779_1765 | 327 |
| 193 | 3300048916 | Ga0496113_0088987 | Ga0496113_0088987_532_1518 | 327 |
| 194 | 3300050507 | nmdc:mga05p37_216918_c1 | nmdc:mga05p37_216918_c1_69_1073 | 327 |
| 195 | 3300050507 | nmdc:mga05p37_350029_c1 | nmdc:mga05p37_350029_c1_215_1201 | 327 |
| 196 | 3300050508 | nmdc:mga09592_26468_c1 | nmdc:mga09592_26468_c1_2726_3712 | 327 |
| 197 | 3300053129 | Ga0500628_003565 | Ga0500628_003565_678_1670 | 327 |
| 198 | 3300061719 | Ga0466962_0004305 | Ga0466962_0004305_193_1179 | 327 |
| 199 | 3300003659 | JGI25404J52841_10002501 | JGI25404J52841_100025012 | 328 |
| 200 | 3300005329 | Ga0070683_100073405 | Ga0070683_1000734053 | 328 |
| 201 | 3300005334 | Ga0068869_100104385 | Ga0068869_1001043853 | 328 |
| 202 | 3300005337 | Ga0070682_100006477 | Ga0070682_1000064772 | 328 |
| 203 | 3300005338 | Ga0068868_100006160 | Ga0068868_1000061607 | 328 |
| 204 | 3300005340 | Ga0070689_100062567 | Ga0070689_1000625673 | 328 |
| 205 | 3300005341 | Ga0070691_10032476 | Ga0070691_100324762 | 328 |
| 206 | 3300005344 | Ga0070661_100173092 | Ga0070661_1001730922 | 328 |
| 207 | 3300005347 | Ga0070668_100037834 | Ga0070668_1000378342 | 328 |
| 208 | 3300005353 | Ga0070669_100369034 | Ga0070669_1003690341 | 328 |
| 209 | 3300005354 | Ga0070675_100108017 | Ga0070675_1001080172 | 328 |
| 210 | 3300005356 | Ga0070674_100135857 | Ga0070674_1001358572 | 328 |
| 211 | 3300005366 | Ga0070659_100011575 | Ga0070659_1000115757 | 328 |
| 212 | 3300005435 | Ga0070714_100030023 | Ga0070714_1000300233 | 328 |
| 213 | 3300005435 | Ga0070714_100068311 | Ga0070714_1000683113 | 328 |
| 214 | 3300005436 | Ga0070713_100330713 | Ga0070713_1003307131 | 328 |
| 215 | 3300005438 | Ga0070701_10030805 | Ga0070701_100308052 | 328 |
| 216 | 3300005439 | Ga0070711_100006351 | Ga0070711_1000063513 | 328 |
| 217 | 3300005439 | Ga0070711_100146244 | Ga0070711_1001462441 | 328 |
| 218 | 3300005440 | Ga0070705_100306933 | Ga0070705_1003069331 | 328 |
| 219 | 3300005441 | Ga0070700_100006904 | Ga0070700_1000069045 | 328 |
| 220 | 3300005456 | Ga0070678_100006059 | Ga0070678_1000060599 | 328 |
| 221 | 3300005457 | Ga0070662_100146963 | Ga0070662_1001469632 | 328 |
| 222 | 3300005545 | Ga0070695_100042564 | Ga0070695_1000425643 | 328 |
| 223 | 3300005549 | Ga0070704_100106342 | Ga0070704_1001063421 | 328 |
| 224 | 3300005564 | Ga0070664_100007855 | Ga0070664_1000078554 | 328 |
| 225 | 3300005578 | Ga0068854_100165665 | Ga0068854_1001656652 | 328 |
| 226 | 3300005614 | Ga0068856_100056321 | Ga0068856_1000563215 | 328 |
| 227 | 3300005614 | Ga0068856_100219927 | Ga0068856_1002199271 | 328 |
| 228 | 3300005615 | Ga0070702_100159897 | Ga0070702_1001598972 | 328 |
| 229 | 3300005618 | Ga0068864_100311207 | Ga0068864_1003112072 | 328 |
| 230 | 3300005719 | Ga0068861_100002823 | Ga0068861_1000028232 | 328 |
| 231 | 3300005981 | Ga0081538_10000386 | Ga0081538_1000038640 | 328 |
| 232 | 3300005981 | Ga0081538_10001446 | Ga0081538_1000144615 | 328 |
| 233 | 3300005981 | Ga0081538_10005326 | Ga0081538_100053264 | 328 |
| 234 | 3300005981 | Ga0081538_10008613 | Ga0081538_100086133 | 328 |
| 235 | 3300005983 | Ga0081540_1000554 | Ga0081540_100055422 | 328 |
| 236 | 3300005983 | Ga0081540_1000650 | Ga0081540_100065022 | 328 |
| 237 | 3300006028 | Ga0070717_10002035 | Ga0070717_100020355 | 328 |
| 238 | 3300006028 | Ga0070717_10067208 | Ga0070717_100672082 | 328 |
| 239 | 3300006038 | Ga0075365_10017279 | Ga0075365_100172793 | 328 |
| 240 | 3300006038 | Ga0075365_10058623 | Ga0075365_100586232 | 328 |
| 241 | 3300006048 | Ga0075363_100081554 | Ga0075363_1000815542 | 328 |
| 242 | 3300006173 | Ga0070716_100039133 | Ga0070716_1000391332 | 328 |
| 243 | 3300006175 | Ga0070712_100002700 | Ga0070712_1000027008 | 328 |
| 244 | 3300006844 | Ga0075428_100008397 | Ga0075428_10000839711 | 328 |
| 245 | 3300006844 | Ga0075428_100015609 | Ga0075428_1000156094 | 328 |
| 246 | 3300006844 | Ga0075428_100053326 | Ga0075428_1000533262 | 328 |
| 247 | 3300006844 | Ga0075428_100093527 | Ga0075428_1000935272 | 328 |
| 248 | 3300006846 | Ga0075430_100002217 | Ga0075430_10000221710 | 328 |
| 249 | 3300006847 | Ga0075431_100037352 | Ga0075431_1000373527 | 328 |
| 250 | 3300006847 | Ga0075431_100076092 | Ga0075431_1000760923 | 328 |
| 251 | 3300006852 | Ga0075433_10031897 | Ga0075433_100318972 | 328 |
| 252 | 3300006880 | Ga0075429_100227752 | Ga0075429_1002277523 | 328 |
| 253 | 3300006914 | Ga0075436_100140264 | Ga0075436_1001402641 | 328 |
| 254 | 3300007076 | Ga0075435_100029836 | Ga0075435_1000298363 | 328 |
| 255 | 3300009093 | Ga0105240_10003665 | Ga0105240_100036656 | 328 |
| 256 | 3300009094 | Ga0111539_10052407 | Ga0111539_100524075 | 328 |
| 257 | 3300009094 | Ga0111539_10479514 | Ga0111539_104795142 | 328 |
| 258 | 3300009098 | Ga0105245_10011852 | Ga0105245_100118522 | 328 |
| 259 | 3300009098 | Ga0105245_10320307 | Ga0105245_103203072 | 328 |
| 260 | 3300009147 | Ga0114129_10488803 | Ga0114129_104888032 | 328 |
| 261 | 3300009177 | Ga0105248_10073668 | Ga0105248_100736682 | 328 |
| 262 | 3300009545 | Ga0105237_10001714 | Ga0105237_100017144 | 328 |
| 263 | 3300009553 | Ga0105249_10004662 | Ga0105249_100046627 | 328 |
| 264 | 3300009553 | Ga0105249_10315720 | Ga0105249_103157202 | 328 |
| 265 | 3300010375 | Ga0105239_10004095 | Ga0105239_1000409510 | 328 |
| 266 | 3300010375 | Ga0105239_10072024 | Ga0105239_100720243 | 328 |
| 267 | 3300011119 | Ga0105246_10148592 | Ga0105246_101485922 | 328 |
| 268 | 3300013296 | Ga0157374_10010688 | Ga0157374_1001068811 | 328 |
| 269 | 3300013307 | Ga0157372_10186378 | Ga0157372_101863784 | 328 |
| 270 | 3300013308 | Ga0157375_10157415 | Ga0157375_101574152 | 328 |
| 271 | 3300014325 | Ga0163163_10096176 | Ga0163163_100961763 | 328 |
| 272 | 3300014745 | Ga0157377_10001774 | Ga0157377_1000177412 | 328 |
| 273 | 3300021384 | Ga0213876_10016626 | Ga0213876_100166263 | 328 |
| 274 | 3300021384 | Ga0213876_10049019 | Ga0213876_100490192 | 328 |
| 275 | 3300021384 | Ga0213876_10099757 | Ga0213876_100997572 | 328 |
| 276 | 3300025898 | Ga0207692_10048285 | Ga0207692_100482851 | 328 |
| 277 | 3300025898 | Ga0207692_10115645 | Ga0207692_101156452 | 328 |
| 278 | 3300025901 | Ga0207688_10003516 | Ga0207688_1000351611 | 328 |
| 279 | 3300025901 | Ga0207688_10012330 | Ga0207688_100123306 | 328 |
| 280 | 3300025901 | Ga0207688_10131569 | Ga0207688_101315692 | 328 |
| 281 | 3300025915 | Ga0207693_10014178 | Ga0207693_100141785 | 328 |
| 282 | 3300025915 | Ga0207693_10142350 | Ga0207693_101423502 | 328 |
| 283 | 3300025916 | Ga0207663_10004337 | Ga0207663_100043372 | 328 |
| 284 | 3300025916 | Ga0207663_10115862 | Ga0207663_101158622 | 328 |
| 285 | 3300025926 | Ga0207659_10151820 | Ga0207659_101518202 | 328 |
| 286 | 3300025929 | Ga0207664_10030907 | Ga0207664_100309073 | 328 |
| 287 | 3300025929 | Ga0207664_10359207 | Ga0207664_103592071 | 328 |
| 288 | 3300025932 | Ga0207690_10053536 | Ga0207690_100535362 | 328 |
| 289 | 3300025933 | Ga0207706_10001715 | Ga0207706_1000171521 | 328 |
| 290 | 3300025933 | Ga0207706_10165567 | Ga0207706_101655672 | 328 |
| 291 | 3300025937 | Ga0207669_10158095 | Ga0207669_101580952 | 328 |
| 292 | 3300025938 | Ga0207704_10032887 | Ga0207704_100328873 | 328 |
| 293 | 3300025941 | Ga0207711_10057858 | Ga0207711_100578581 | 328 |
| 294 | 3300025942 | Ga0207689_10113518 | Ga0207689_101135182 | 328 |
| 295 | 3300025945 | Ga0207679_10007996 | Ga0207679_100079962 | 328 |
| 296 | 3300025945 | Ga0207679_10061831 | Ga0207679_100618314 | 328 |
| 297 | 3300025949 | Ga0207667_10452247 | Ga0207667_104522472 | 328 |
| 298 | 3300025961 | Ga0207712_10366304 | Ga0207712_103663042 | 328 |
| 299 | 3300025972 | Ga0207668_10011009 | Ga0207668_100110098 | 328 |
| 300 | 3300025972 | Ga0207668_10188129 | Ga0207668_101881292 | 328 |
| 301 | 3300026023 | Ga0207677_10028342 | Ga0207677_100283422 | 328 |
| 302 | 3300026075 | Ga0207708_10001166 | Ga0207708_100011667 | 328 |
| 303 | 3300026075 | Ga0207708_10001883 | Ga0207708_100018833 | 328 |
| 304 | 3300026078 | Ga0207702_10140831 | Ga0207702_101408312 | 328 |
| 305 | 3300026095 | Ga0207676_10217897 | Ga0207676_102178972 | 328 |
| 306 | 3300026116 | Ga0207674_10051341 | Ga0207674_100513415 | 328 |
| 307 | 3300026118 | Ga0207675_100000091 | Ga0207675_10000009118 | 328 |
| 308 | 3300026121 | Ga0207683_10039055 | Ga0207683_100390553 | 328 |
| 309 | 3300028556 | Ga0265337_1003682 | Ga0265337_10036822 | 328 |
| 310 | 3300028558 | Ga0265326_10004289 | Ga0265326_100042894 | 328 |
| 311 | 3300028563 | Ga0265319_1001236 | Ga0265319_10012367 | 328 |
| 312 | 3300028577 | Ga0265318_10000650 | Ga0265318_1000065014 | 328 |
| 313 | 3300028654 | Ga0265322_10004940 | Ga0265322_100049404 | 328 |
| 314 | 3300028666 | Ga0265336_10000002 | Ga0265336_1000000296 | 328 |
| 315 | 3300028800 | Ga0265338_10000001 | Ga0265338_10000001718 | 328 |
| 316 | 3300028800 | Ga0265338_10005918 | Ga0265338_1000591815 | 328 |
| 317 | 3300029957 | Ga0265324_10001753 | Ga0265324_100017537 | 328 |
| 318 | 3300031247 | Ga0265340_10000001 | Ga0265340_10000001717 | 328 |
| 319 | 3300031249 | Ga0265339_10019994 | Ga0265339_100199943 | 328 |
| 320 | 3300031344 | Ga0265316_10014142 | Ga0265316_100141423 | 328 |
| 321 | 3300031731 | Ga0307405_10035033 | Ga0307405_100350332 | 328 |
| 322 | 3300031824 | Ga0307413_10036602 | Ga0307413_100366023 | 328 |
| 323 | 3300031824 | Ga0307413_10102556 | Ga0307413_101025562 | 328 |
| 324 | 3300031824 | Ga0307413_10229887 | Ga0307413_102298871 | 328 |
| 325 | 3300031852 | Ga0307410_10015552 | Ga0307410_100155522 | 328 |
| 326 | 3300031901 | Ga0307406_10009961 | Ga0307406_100099612 | 328 |
| 327 | 3300031901 | Ga0307406_10024976 | Ga0307406_100249765 | 328 |
| 328 | 3300031901 | Ga0307406_10301037 | Ga0307406_103010372 | 328 |
| 329 | 3300031901 | Ga0307406_10337463 | Ga0307406_103374631 | 328 |
| 330 | 3300031903 | Ga0307407_10030563 | Ga0307407_100305632 | 328 |
| 331 | 3300031995 | Ga0307409_100045253 | Ga0307409_1000452533 | 328 |
| 332 | 3300031995 | Ga0307409_100047478 | Ga0307409_1000474783 | 328 |
| 333 | 3300031995 | Ga0307409_100089555 | Ga0307409_1000895554 | 328 |
| 334 | 3300031995 | Ga0307409_100099139 | Ga0307409_1000991392 | 328 |
| 335 | 3300032002 | Ga0307416_100052310 | Ga0307416_1000523103 | 328 |
| 336 | 3300032002 | Ga0307416_100089091 | Ga0307416_1000890911 | 328 |
| 337 | 3300032002 | Ga0307416_100423565 | Ga0307416_1004235651 | 328 |
| 338 | 3300032126 | Ga0307415_100027638 | Ga0307415_1000276383 | 328 |
| 339 | 3300032126 | Ga0307415_100038515 | Ga0307415_1000385154 | 328 |
| 340 | 3300032126 | Ga0307415_100219967 | Ga0307415_1002199672 | 328 |
| 341 | 3300032126 | Ga0307415_100242214 | Ga0307415_1002422141 | 328 |
| 342 | 3300032126 | Ga0307415_100383258 | Ga0307415_1003832581 | 328 |
| 343 | 3300035121 | Ga0373960_0002815 | Ga0373960_0002815_159_1148 | 328 |
| 344 | 3300035691 | Ga0373931_0028618 | Ga0373931_0028618_803_1792 | 328 |
| 345 | 3300037418 | Ga0395900_0205142 | Ga0395900_0205142_582_1577 | 328 |
| 346 | 3300037466 | Ga0395898_0402724 | Ga0395898_0402724_299_1288 | 328 |
| 347 | 3300037853 | Ga0436364_0240449 | Ga0436364_0240449_192_1187 | 328 |
| 348 | 3300037853 | Ga0436364_0815220 | Ga0436364_0815220_318_1313 | 328 |
| 349 | 3300037853 | Ga0436364_1477052 | Ga0436364_1477052_12497_13492 | 328 |
| 350 | 3300038443 | Ga0395901_0100570 | Ga0395901_0100570_66_1055 | 328 |
| 351 | 3300039437 | Ga0436365_0000795 | Ga0436365_0000795_2750_3745 | 328 |
| 352 | 3300039437 | Ga0436365_0807310 | Ga0436365_0807310_3640_4641 | 328 |
| 353 | 3300039437 | Ga0436365_1395668 | Ga0436365_1395668_1763_2767 | 328 |
| 354 | 3300039437 | Ga0436365_1487643 | Ga0436365_1487643_6373_7368 | 328 |
| 355 | 3300039437 | Ga0436365_1549123 | Ga0436365_1549123_4498_5493 | 328 |
| 356 | 3300039450 | Ga0436363_0805533 | Ga0436363_0805533_36426_37427 | 328 |
| 357 | 3300039453 | Ga0436362_0170227 | Ga0436362_0170227_161_1156 | 328 |
| 358 | 3300039453 | Ga0436362_0857091 | Ga0436362_0857091_1836_2831 | 328 |
| 359 | 3300039453 | Ga0436362_1078989 | Ga0436362_1078989_755_1759 | 328 |
| 360 | 3300039453 | Ga0436362_1156991 | Ga0436362_1156991_15_1004 | 328 |
| 361 | 3300042993 | Ga0439440_0002839 | Ga0439440_0002839_1803_2792 | 328 |
| 362 | 3300044684 | Ga0466966_0141494 | Ga0466966_0141494_161_1156 | 328 |
| 363 | 3300044693 | Ga0466961_0008158 | Ga0466961_0008158_5198_6193 | 328 |
| 364 | 3300044693 | Ga0466961_0065974 | Ga0466961_0065974_1292_2287 | 328 |
| 365 | 3300044693 | Ga0466961_0224164 | Ga0466961_0224164_106_1122 | 328 |
| 366 | 3300044694 | Ga0466963_0007404 | Ga0466963_0007404_66_1082 | 328 |
| 367 | 3300044694 | Ga0466963_0014580 | Ga0466963_0014580_220_1215 | 328 |
| 368 | 3300044694 | Ga0466963_0077408 | Ga0466963_0077408_641_1636 | 328 |
| 369 | 3300044735 | Ga0466968_0030758 | Ga0466968_0030758_25_1020 | 328 |
| 370 | 3300044735 | Ga0466968_0086922 | Ga0466968_0086922_221_1237 | 328 |
| 371 | 3300044765 | Ga0466970_0035935 | Ga0466970_0035935_97_1113 | 328 |
| 372 | 3300044765 | Ga0466970_0104245 | Ga0466970_0104245_273_1289 | 328 |
| 373 | 3300044842 | Ga0466957_0014919 | Ga0466957_0014919_3171_4187 | 328 |
| 374 | 3300044901 | Ga0466960_0049897 | Ga0466960_0049897_577_1578 | 328 |
| 375 | 3300045049 | Ga0466959_0000352 | Ga0466959_0000352_12636_13631 | 328 |
| 376 | 3300045049 | Ga0466959_0039628 | Ga0466959_0039628_1306_2301 | 328 |
| 377 | 3300045049 | Ga0466959_0042350 | Ga0466959_0042350_1281_2276 | 328 |
| 378 | 3300045049 | Ga0466959_0110195 | Ga0466959_0110195_245_1240 | 328 |
| 379 | 3300045049 | Ga0466959_0176315 | Ga0466959_0176315_99_1094 | 328 |
| 380 | 3300045836 | Ga0466958_0000550 | Ga0466958_0000550_61_1056 | 328 |
| 381 | 3300045836 | Ga0466958_0003128 | Ga0466958_0003128_171_1187 | 328 |
| 382 | 3300045836 | Ga0466958_0005509 | Ga0466958_0005509_303_1298 | 328 |
| 383 | 3300045976 | Ga0466967_0000217 | Ga0466967_0000217_14787_15782 | 328 |
| 384 | 3300046462 | Ga0495651_0110277 | Ga0495651_0110277_817_1830 | 328 |
| 385 | 3300046463 | Ga0495653_0000982 | Ga0495653_0000982_16099_17112 | 328 |
| 386 | 3300046475 | Ga0495639_0073494 | Ga0495639_0073494_527_1537 | 328 |
| 387 | 3300046477 | Ga0495664_0000032 | Ga0495664_0000032_12496_13512 | 328 |
| 388 | 3300046514 | Ga0495618_0000113 | Ga0495618_0000113_346_1359 | 328 |
| 389 | 3300046516 | Ga0495628_0116689 | Ga0495628_0116689_975_1961 | 328 |
| 390 | 3300046517 | Ga0495630_0000145 | Ga0495630_0000145_11740_12726 | 328 |
| 391 | 3300046517 | Ga0495630_0009696 | Ga0495630_0009696_3496_4509 | 328 |
| 392 | 3300046517 | Ga0495630_0041247 | Ga0495630_0041247_2368_3354 | 328 |
| 393 | 3300046529 | Ga0495652_0152823 | Ga0495652_0152823_675_1670 | 328 |
| 394 | 3300046543 | Ga0495645_0000021 | Ga0495645_0000021_4644_5648 | 328 |
| 395 | 3300046557 | Ga0495622_0000104 | Ga0495622_0000104_8954_9946 | 328 |
| 396 | 3300046675 | Ga0495657_0000013 | Ga0495657_0000013_913_1926 | 328 |
| 397 | 3300046675 | Ga0495657_0049342 | Ga0495657_0049342_820_1806 | 328 |
| 398 | 3300046680 | Ga0495646_0025126 | Ga0495646_0025126_730_1737 | 328 |
| 399 | 3300047317 | Ga0495604_0000158 | Ga0495604_0000158_4541_5548 | 328 |
| 400 | 3300047471 | Ga0495684_0006606 | Ga0495684_0006606_7200_8213 | 328 |
| 401 | 3300048903 | Ga0496100_0000156 | Ga0496100_0000156_15683_16675 | 328 |
| 402 | 3300048903 | Ga0496100_0036184 | Ga0496100_0036184_483_1478 | 328 |
| 403 | 3300048903 | Ga0496100_0119669 | Ga0496100_0119669_430_1419 | 328 |
| 404 | 3300048904 | Ga0496101_0016622 | Ga0496101_0016622_2874_3869 | 328 |
| 405 | 3300048904 | Ga0496101_0117600 | Ga0496101_0117600_350_1339 | 328 |
| 406 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_144181_145182 | 328 |
| 407 | 3300048905 | Ga0496102_0014625 | Ga0496102_0014625_174_1169 | 328 |
| 408 | 3300048905 | Ga0496102_0029110 | Ga0496102_0029110_2295_3284 | 328 |
| 409 | 3300048906 | Ga0496103_0000047 | Ga0496103_0000047_4820_5821 | 328 |
| 410 | 3300048906 | Ga0496103_0085303 | Ga0496103_0085303_49_1062 | 328 |
| 411 | 3300048906 | Ga0496103_0238934 | Ga0496103_0238934_46_1047 | 328 |
| 412 | 3300048907 | Ga0496104_0000037 | Ga0496104_0000037_27026_28066 | 328 |
| 413 | 3300048908 | Ga0496105_0213738 | Ga0496105_0213738_390_1391 | 328 |
| 414 | 3300048909 | Ga0496106_0001753 | Ga0496106_0001753_4759_5754 | 328 |
| 415 | 3300048909 | Ga0496106_0036182 | Ga0496106_0036182_379_1368 | 328 |
| 416 | 3300048910 | Ga0496107_0248832 | Ga0496107_0248832_238_1233 | 328 |
| 417 | 3300048911 | Ga0496108_0018657 | Ga0496108_0018657_4669_5658 | 328 |
| 418 | 3300048911 | Ga0496108_0099888 | Ga0496108_0099888_407_1408 | 328 |
| 419 | 3300048912 | Ga0496109_0003171 | Ga0496109_0003171_3349_4416 | 328 |
| 420 | 3300048912 | Ga0496109_0011008 | Ga0496109_0011008_4373_5365 | 328 |
| 421 | 3300048912 | Ga0496109_0030491 | Ga0496109_0030491_1901_2890 | 328 |
| 422 | 3300048912 | Ga0496109_0322736 | Ga0496109_0322736_253_1248 | 328 |
| 423 | 3300048912 | Ga0496109_0357593 | Ga0496109_0357593_172_1173 | 328 |
| 424 | 3300048913 | Ga0496110_0000694 | Ga0496110_0000694_10663_11703 | 328 |
| 425 | 3300048913 | Ga0496110_0004405 | Ga0496110_0004405_697_1686 | 328 |
| 426 | 3300048913 | Ga0496110_0153595 | Ga0496110_0153595_136_1131 | 328 |
| 427 | 3300048915 | Ga0496112_0032839 | Ga0496112_0032839_3570_4565 | 328 |
| 428 | 3300048915 | Ga0496112_0064087 | Ga0496112_0064087_1760_2761 | 328 |
| 429 | 3300048916 | Ga0496113_0004202 | Ga0496113_0004202_4488_5477 | 328 |
| 430 | 3300048917 | Ga0496114_0128601 | Ga0496114_0128601_899_1891 | 328 |
| 431 | 3300048918 | Ga0496115_0000012 | Ga0496115_0000012_155865_156878 | 328 |
| 432 | 3300048918 | Ga0496115_0000017 | Ga0496115_0000017_65570_66583 | 328 |
| 433 | 3300048918 | Ga0496115_0004810 | Ga0496115_0004810_24_1019 | 328 |
| 434 | 3300048924 | Ga0496121_0205619 | Ga0496121_0205619_334_1335 | 328 |
| 435 | 3300049571 | Ga0501034_0219806 | Ga0501034_0219806_32_1033 | 328 |
| 436 | 3300049572 | Ga0501036_0147752 | Ga0501036_0147752_170_1159 | 328 |
| 437 | 3300049572 | Ga0501036_0267066 | Ga0501036_0267066_398_1387 | 328 |
| 438 | 3300049575 | Ga0501039_0435772 | Ga0501039_0435772_16_1005 | 328 |
| 439 | 3300049576 | Ga0501040_0033872 | Ga0501040_0033872_1204_2193 | 328 |
| 440 | 3300049576 | Ga0501040_0077311 | Ga0501040_0077311_535_1524 | 328 |
| 441 | 3300049578 | Ga0501042_0183274 | Ga0501042_0183274_312_1301 | 328 |
| 442 | 3300049582 | Ga0501048_0130961 | Ga0501048_0130961_728_1717 | 328 |
| 443 | 3300049587 | Ga0501071_0177865 | Ga0501071_0177865_289_1287 | 328 |
| 444 | 3300049590 | Ga0501074_0054881 | Ga0501074_0054881_848_1855 | 328 |
| 445 | 3300049592 | Ga0501076_0013004 | Ga0501076_0013004_2389_3378 | 328 |
| 446 | 3300049592 | Ga0501076_0163720 | Ga0501076_0163720_619_1614 | 328 |
| 447 | 3300049741 | Ga0501079_0077178 | Ga0501079_0077178_379_1386 | 328 |
| 448 | 3300049741 | Ga0501079_0146648 | Ga0501079_0146648_576_1565 | 328 |
| 449 | 3300049742 | Ga0501080_0006435 | Ga0501080_0006435_660_1667 | 328 |
| 450 | 3300049743 | Ga0501081_0237177 | Ga0501081_0237177_257_1246 | 328 |
| 451 | 3300049824 | Ga0501045_0008962 | Ga0501045_0008962_148_1137 | 328 |
| 452 | 3300049824 | Ga0501045_0127864 | Ga0501045_0127864_462_1451 | 328 |
| 453 | 3300050492 | nmdc:mga0yw44_165520_c1 | nmdc:mga0yw44_165520_c1_65_1063 | 328 |
| 454 | 3300050492 | nmdc:mga0yw44_253506_c1 | nmdc:mga0yw44_253506_c1_13_1005 | 328 |
| 455 | 3300050507 | nmdc:mga05p37_180960_c1 | nmdc:mga05p37_180960_c1_770_1759 | 328 |
| 456 | 3300050507 | nmdc:mga05p37_208895_c1 | nmdc:mga05p37_208895_c1_835_1824 | 328 |
| 457 | 3300050507 | nmdc:mga05p37_640695_c1 | nmdc:mga05p37_640695_c1_103_1092 | 328 |
| 458 | 3300050508 | nmdc:mga09592_48745_c1 | nmdc:mga09592_48745_c1_1515_2504 | 328 |
| 459 | 3300050510 | nmdc:mga06r32_110560_c1 | nmdc:mga06r32_110560_c1_1002_2000 | 328 |
| 460 | 3300050510 | nmdc:mga06r32_135857_c1 | nmdc:mga06r32_135857_c1_530_1519 | 328 |
| 461 | 3300050510 | nmdc:mga06r32_4342_c1 | nmdc:mga06r32_4342_c1_2200_3189 | 328 |
| 462 | 3300050511 | nmdc:mga08y16_426965_c1 | nmdc:mga08y16_426965_c1_133_1122 | 328 |
| 463 | 3300050512 | nmdc:mga0n895_173515_c1 | nmdc:mga0n895_173515_c1_77_1066 | 328 |
| 464 | 3300050513 | nmdc:mga0rr50_181999_c1 | nmdc:mga0rr50_181999_c1_649_1662 | 328 |
| 465 | 3300050515 | nmdc:mga0a205_169690_c1 | nmdc:mga0a205_169690_c1_183_1172 | 328 |
| 466 | 3300053077 | Ga0495601_0001946 | Ga0495601_0001946_4552_5565 | 328 |
| 467 | 3300053077 | Ga0495601_0008060 | Ga0495601_0008060_4297_5304 | 328 |
| 468 | 3300053077 | Ga0495601_0078051 | Ga0495601_0078051_480_1466 | 328 |
| 469 | 3300053078 | Ga0495612_0000072 | Ga0495612_0000072_10220_11233 | 328 |
| 470 | 3300053096 | Ga0500641_0006890 | Ga0500641_0006890_2395_3381 | 328 |
| 471 | 3300054114 | Ga0501084_0045098 | Ga0501084_0045098_1828_2817 | 328 |
| 472 | 3300060353 | Ga0501082_0173646 | Ga0501082_0173646_549_1538 | 328 |
| 473 | 3300060353 | Ga0501082_0206784 | Ga0501082_0206784_279_1271 | 328 |
| 474 | 3300061719 | Ga0466962_0088312 | Ga0466962_0088312_305_1300 | 328 |
| 475 | 3300061734 | Ga0530510_0048891 | Ga0530510_0048891_541_1530 | 328 |
| 476 | 3300003203 | JGI25406J46586_10035344 | JGI25406J46586_100353442 | 329 |
| 477 | 3300005327 | Ga0070658_10073527 | Ga0070658_100735273 | 329 |
| 478 | 3300005329 | Ga0070683_100042159 | Ga0070683_1000421595 | 329 |
| 479 | 3300005329 | Ga0070683_100075467 | Ga0070683_1000754671 | 329 |
| 480 | 3300005329 | Ga0070683_100376039 | Ga0070683_1003760392 | 329 |
| 481 | 3300005330 | Ga0070690_100062046 | Ga0070690_1000620462 | 329 |
| 482 | 3300005334 | Ga0068869_100139148 | Ga0068869_1001391482 | 329 |
| 483 | 3300005335 | Ga0070666_10012316 | Ga0070666_100123166 | 329 |
| 484 | 3300005336 | Ga0070680_100166436 | Ga0070680_1001664361 | 329 |
| 485 | 3300005339 | Ga0070660_100024817 | Ga0070660_1000248175 | 329 |
| 486 | 3300005366 | Ga0070659_100068926 | Ga0070659_1000689262 | 329 |
| 487 | 3300005367 | Ga0070667_100004009 | Ga0070667_1000040093 | 329 |
| 488 | 3300005439 | Ga0070711_100097109 | Ga0070711_1000971092 | 329 |
| 489 | 3300005455 | Ga0070663_100078773 | Ga0070663_1000787732 | 329 |
| 490 | 3300005466 | Ga0070685_10045276 | Ga0070685_100452762 | 329 |
| 491 | 3300005530 | Ga0070679_100030794 | Ga0070679_1000307944 | 329 |
| 492 | 3300005530 | Ga0070679_100083807 | Ga0070679_1000838072 | 329 |
| 493 | 3300005535 | Ga0070684_100323033 | Ga0070684_1003230332 | 329 |
| 494 | 3300005548 | Ga0070665_100009749 | Ga0070665_10000974911 | 329 |
| 495 | 3300005563 | Ga0068855_100590323 | Ga0068855_1005903232 | 329 |
| 496 | 3300005564 | Ga0070664_100154111 | Ga0070664_1001541112 | 329 |
| 497 | 3300005614 | Ga0068856_100025704 | Ga0068856_1000257044 | 329 |
| 498 | 3300005615 | Ga0070702_100071332 | Ga0070702_1000713322 | 329 |
| 499 | 3300005616 | Ga0068852_100046949 | Ga0068852_1000469493 | 329 |
| 500 | 3300005617 | Ga0068859_100205860 | Ga0068859_1002058601 | 329 |
| 501 | 3300005937 | Ga0081455_10025676 | Ga0081455_100256765 | 329 |
| 502 | 3300005981 | Ga0081538_10000035 | Ga0081538_1000003572 | 329 |
| 503 | 3300005981 | Ga0081538_10002436 | Ga0081538_100024364 | 329 |
| 504 | 3300005981 | Ga0081538_10012736 | Ga0081538_100127362 | 329 |
| 505 | 3300005981 | Ga0081538_10042930 | Ga0081538_100429304 | 329 |
| 506 | 3300005981 | Ga0081538_10081679 | Ga0081538_100816792 | 329 |
| 507 | 3300005985 | Ga0081539_10057279 | Ga0081539_100572792 | 329 |
| 508 | 3300006038 | Ga0075365_10018927 | Ga0075365_100189274 | 329 |
| 509 | 3300006237 | Ga0097621_100045919 | Ga0097621_1000459192 | 329 |
| 510 | 3300006846 | Ga0075430_100004849 | Ga0075430_10000484911 | 329 |
| 511 | 3300006852 | Ga0075433_10107486 | Ga0075433_101074863 | 329 |
| 512 | 3300006871 | Ga0075434_100092872 | Ga0075434_1000928722 | 329 |
| 513 | 3300006931 | Ga0097620_100205850 | Ga0097620_1002058501 | 329 |
| 514 | 3300007076 | Ga0075435_100037672 | Ga0075435_1000376724 | 329 |
| 515 | 3300009098 | Ga0105245_10065785 | Ga0105245_100657852 | 329 |
| 516 | 3300009148 | Ga0105243_10312181 | Ga0105243_103121811 | 329 |
| 517 | 3300009176 | Ga0105242_10137492 | Ga0105242_101374922 | 329 |
| 518 | 3300009551 | Ga0105238_10231600 | Ga0105238_102316002 | 329 |
| 519 | 3300009553 | Ga0105249_10089249 | Ga0105249_100892492 | 329 |
| 520 | 3300013307 | Ga0157372_10235069 | Ga0157372_102350692 | 329 |
| 521 | 3300025899 | Ga0207642_10101382 | Ga0207642_101013821 | 329 |
| 522 | 3300025908 | Ga0207643_10077699 | Ga0207643_100776992 | 329 |
| 523 | 3300025914 | Ga0207671_10123230 | Ga0207671_101232301 | 329 |
| 524 | 3300025916 | Ga0207663_10084925 | Ga0207663_100849252 | 329 |
| 525 | 3300025919 | Ga0207657_10124941 | Ga0207657_101249412 | 329 |
| 526 | 3300025919 | Ga0207657_10254047 | Ga0207657_102540471 | 329 |
| 527 | 3300025921 | Ga0207652_10023036 | Ga0207652_100230364 | 329 |
| 528 | 3300025927 | Ga0207687_10116589 | Ga0207687_101165892 | 329 |
| 529 | 3300025932 | Ga0207690_10092269 | Ga0207690_100922692 | 329 |
| 530 | 3300025932 | Ga0207690_10104340 | Ga0207690_101043402 | 329 |
| 531 | 3300025944 | Ga0207661_10109553 | Ga0207661_101095533 | 329 |
| 532 | 3300025944 | Ga0207661_10254744 | Ga0207661_102547441 | 329 |
| 533 | 3300025944 | Ga0207661_10391491 | Ga0207661_103914911 | 329 |
| 534 | 3300025945 | Ga0207679_10009512 | Ga0207679_100095122 | 329 |
| 535 | 3300026023 | Ga0207677_10317993 | Ga0207677_103179932 | 329 |
| 536 | 3300026067 | Ga0207678_10024623 | Ga0207678_100246231 | 329 |
| 537 | 3300026075 | Ga0207708_10099467 | Ga0207708_100994672 | 329 |
| 538 | 3300026116 | Ga0207674_10021899 | Ga0207674_100218997 | 329 |
| 539 | 3300028379 | Ga0268266_10001143 | Ga0268266_1000114310 | 329 |
| 540 | 3300031852 | Ga0307410_10153873 | Ga0307410_101538732 | 329 |
| 541 | 3300031852 | Ga0307410_10218850 | Ga0307410_102188502 | 329 |
| 542 | 3300031901 | Ga0307406_10230666 | Ga0307406_102306662 | 329 |
| 543 | 3300031903 | Ga0307407_10014776 | Ga0307407_100147762 | 329 |
| 544 | 3300031995 | Ga0307409_100147053 | Ga0307409_1001470532 | 329 |
| 545 | 3300031995 | Ga0307409_100181402 | Ga0307409_1001814022 | 329 |
| 546 | 3300032002 | Ga0307416_100092075 | Ga0307416_1000920752 | 329 |
| 547 | 3300032005 | Ga0307411_10143917 | Ga0307411_101439172 | 329 |
| 548 | 3300037312 | Ga0395899_0020569 | Ga0395899_0020569_552_1547 | 329 |
| 549 | 3300037418 | Ga0395900_0019376 | Ga0395900_0019376_4244_5239 | 329 |
| 550 | 3300037418 | Ga0395900_0382200 | Ga0395900_0382200_75_1085 | 329 |
| 551 | 3300037466 | Ga0395898_0006287 | Ga0395898_0006287_9510_10505 | 329 |
| 552 | 3300037466 | Ga0395898_0122780 | Ga0395898_0122780_777_1787 | 329 |
| 553 | 3300037466 | Ga0395898_0201989 | Ga0395898_0201989_591_1586 | 329 |
| 554 | 3300037471 | Ga0395905_0170345 | Ga0395905_0170345_987_1982 | 329 |
| 555 | 3300038443 | Ga0395901_0278375 | Ga0395901_0278375_332_1342 | 329 |
| 556 | 3300038443 | Ga0395901_0369543 | Ga0395901_0369543_260_1255 | 329 |
| 557 | 3300042008 | Ga0439450_021683 | Ga0439450_021683_56_1066 | 329 |
| 558 | 3300044719 | Ga0466971_0062070 | Ga0466971_0062070_424_1422 | 329 |
| 559 | 3300045976 | Ga0466967_0092564 | Ga0466967_0092564_1504_2517 | 329 |
| 560 | 3300045976 | Ga0466967_0102252 | Ga0466967_0102252_954_1958 | 329 |
| 561 | 3300046474 | Ga0495605_0075081 | Ga0495605_0075081_296_1294 | 329 |
| 562 | 3300046491 | Ga0495584_0020785 | Ga0495584_0020785_1775_2773 | 329 |
| 563 | 3300046543 | Ga0495645_0001238 | Ga0495645_0001238_867_1967 | 329 |
| 564 | 3300046558 | Ga0495633_0118090 | Ga0495633_0118090_48_1058 | 329 |
| 565 | 3300046642 | Ga0495634_0005924 | Ga0495634_0005924_4959_5948 | 329 |
| 566 | 3300047321 | Ga0495676_0057767 | Ga0495676_0057767_277_1356 | 329 |
| 567 | 3300047472 | Ga0495686_0198100 | Ga0495686_0198100_42_1046 | 329 |
| 568 | 3300048904 | Ga0496101_0301027 | Ga0496101_0301027_60_1055 | 329 |
| 569 | 3300048905 | Ga0496102_0033594 | Ga0496102_0033594_1618_2616 | 329 |
| 570 | 3300048905 | Ga0496102_0163015 | Ga0496102_0163015_522_1517 | 329 |
| 571 | 3300048906 | Ga0496103_0144315 | Ga0496103_0144315_429_1424 | 329 |
| 572 | 3300048906 | Ga0496103_0199585 | Ga0496103_0199585_25_1023 | 329 |
| 573 | 3300048907 | Ga0496104_0004472 | Ga0496104_0004472_5263_6261 | 329 |
| 574 | 3300048907 | Ga0496104_0058518 | Ga0496104_0058518_501_1496 | 329 |
| 575 | 3300048909 | Ga0496106_0077535 | Ga0496106_0077535_374_1372 | 329 |
| 576 | 3300048910 | Ga0496107_0247112 | Ga0496107_0247112_98_1108 | 329 |
| 577 | 3300048911 | Ga0496108_0001085 | Ga0496108_0001085_19063_20061 | 329 |
| 578 | 3300048912 | Ga0496109_0000881 | Ga0496109_0000881_3291_4289 | 329 |
| 579 | 3300048912 | Ga0496109_0060520 | Ga0496109_0060520_1269_2267 | 329 |
| 580 | 3300048913 | Ga0496110_0006226 | Ga0496110_0006226_2965_3963 | 329 |
| 581 | 3300048913 | Ga0496110_0072112 | Ga0496110_0072112_1775_2773 | 329 |
| 582 | 3300048913 | Ga0496110_0138520 | Ga0496110_0138520_352_1347 | 329 |
| 583 | 3300048914 | Ga0496111_0008983 | Ga0496111_0008983_3349_4347 | 329 |
| 584 | 3300048914 | Ga0496111_0171777 | Ga0496111_0171777_328_1317 | 329 |
| 585 | 3300048915 | Ga0496112_0035847 | Ga0496112_0035847_1519_2517 | 329 |
| 586 | 3300048915 | Ga0496112_0071816 | Ga0496112_0071816_1156_2154 | 329 |
| 587 | 3300048915 | Ga0496112_0211771 | Ga0496112_0211771_258_1247 | 329 |
| 588 | 3300048916 | Ga0496113_0056576 | Ga0496113_0056576_1687_2676 | 329 |
| 589 | 3300048916 | Ga0496113_0366270 | Ga0496113_0366270_32_1030 | 329 |
| 590 | 3300048919 | Ga0496116_0000360 | Ga0496116_0000360_48056_49051 | 329 |
| 591 | 3300048920 | Ga0496117_0006636 | Ga0496117_0006636_61_1056 | 329 |
| 592 | 3300048921 | Ga0496118_0001416 | Ga0496118_0001416_27076_28071 | 329 |
| 593 | 3300048921 | Ga0496118_0057207 | Ga0496118_0057207_1340_2335 | 329 |
| 594 | 3300048922 | Ga0496119_0002006 | Ga0496119_0002006_8256_9251 | 329 |
| 595 | 3300048922 | Ga0496119_0002714 | Ga0496119_0002714_15686_16681 | 329 |
| 596 | 3300048922 | Ga0496119_0016372 | Ga0496119_0016372_1923_2918 | 329 |
| 597 | 3300048923 | Ga0496120_0005529 | Ga0496120_0005529_5591_6586 | 329 |
| 598 | 3300048924 | Ga0496121_0016970 | Ga0496121_0016970_1061_2056 | 329 |
| 599 | 3300048924 | Ga0496121_0045460 | Ga0496121_0045460_1368_2363 | 329 |
| 600 | 3300048928 | Ga0496125_0043665 | Ga0496125_0043665_347_1342 | 329 |
| 601 | 3300048928 | Ga0496125_0085847 | Ga0496125_0085847_51_1046 | 329 |
| 602 | 3300048929 | Ga0496126_0351118 | Ga0496126_0351118_136_1131 | 329 |
| 603 | 3300048929 | Ga0496126_0413818 | Ga0496126_0413818_39_1034 | 329 |
| 604 | 3300049568 | Ga0501031_0000355 | Ga0501031_0000355_4026_5021 | 329 |
| 605 | 3300049569 | Ga0501032_0000734 | Ga0501032_0000734_3978_4973 | 329 |
| 606 | 3300049570 | Ga0501033_0000927 | Ga0501033_0000927_4139_5134 | 329 |
| 607 | 3300049571 | Ga0501034_0008505 | Ga0501034_0008505_4433_5428 | 329 |
| 608 | 3300049572 | Ga0501036_0000548 | Ga0501036_0000548_21662_22657 | 329 |
| 609 | 3300049573 | Ga0501037_0000599 | Ga0501037_0000599_5454_6449 | 329 |
| 610 | 3300049574 | Ga0501038_0000788 | Ga0501038_0000788_21645_22640 | 329 |
| 611 | 3300049575 | Ga0501039_0004109 | Ga0501039_0004109_387_1382 | 329 |
| 612 | 3300049579 | Ga0501043_0000871 | Ga0501043_0000871_21661_22656 | 329 |
| 613 | 3300049580 | Ga0501046_0000669 | Ga0501046_0000669_21619_22614 | 329 |
| 614 | 3300049581 | Ga0501047_0001012 | Ga0501047_0001012_21661_22656 | 329 |
| 615 | 3300049581 | Ga0501047_0107547 | Ga0501047_0107547_1482_2477 | 329 |
| 616 | 3300049581 | Ga0501047_0320663 | Ga0501047_0320663_63_1061 | 329 |
| 617 | 3300049582 | Ga0501048_0001025 | Ga0501048_0001025_14446_15441 | 329 |
| 618 | 3300049584 | Ga0501068_0196300 | Ga0501068_0196300_10_1005 | 329 |
| 619 | 3300049585 | Ga0501069_0014111 | Ga0501069_0014111_1219_2214 | 329 |
| 620 | 3300049586 | Ga0501070_0000466 | Ga0501070_0000466_21661_22656 | 329 |
| 621 | 3300049589 | Ga0501073_0000981 | Ga0501073_0000981_16084_17079 | 329 |
| 622 | 3300049590 | Ga0501074_0008085 | Ga0501074_0008085_4128_5123 | 329 |
| 623 | 3300049741 | Ga0501079_0009854 | Ga0501079_0009854_3136_4131 | 329 |
| 624 | 3300049742 | Ga0501080_0002687 | Ga0501080_0002687_13038_14033 | 329 |
| 625 | 3300049744 | Ga0501083_0000531 | Ga0501083_0000531_19416_20411 | 329 |
| 626 | 3300049744 | Ga0501083_0010094 | Ga0501083_0010094_2993_3991 | 329 |
| 627 | 3300049744 | Ga0501083_0027051 | Ga0501083_0027051_2010_3005 | 329 |
| 628 | 3300049822 | Ga0501035_0001127 | Ga0501035_0001127_5266_6261 | 329 |
| 629 | 3300049822 | Ga0501035_0090471 | Ga0501035_0090471_513_1508 | 329 |
| 630 | 3300049823 | Ga0501044_0001423 | Ga0501044_0001423_21661_22656 | 329 |
| 631 | 3300049823 | Ga0501044_0081576 | Ga0501044_0081576_277_1272 | 329 |
| 632 | 3300049824 | Ga0501045_0006965 | Ga0501045_0006965_4043_5038 | 329 |
| 633 | 3300050491 | nmdc:mga00v17_94822_c1 | nmdc:mga00v17_94822_c1_594_1586 | 329 |
| 634 | 3300050509 | nmdc:mga0qj67_7661_c1 | nmdc:mga0qj67_7661_c1_5592_6590 | 329 |
| 635 | 3300050511 | nmdc:mga08y16_32841_c1 | nmdc:mga08y16_32841_c1_3576_4586 | 329 |
| 636 | 3300050512 | nmdc:mga0n895_91074_c1 | nmdc:mga0n895_91074_c1_62_1060 | 329 |
| 637 | 3300050514 | nmdc:mga08x19_323939_c1 | nmdc:mga08x19_323939_c1_63_1058 | 329 |
| 638 | 3300053078 | Ga0495612_0000022 | Ga0495612_0000022_85456_86445 | 329 |
| 639 | 3300053085 | Ga0495619_0019032 | Ga0495619_0019032_2585_3628 | 329 |
| 640 | 3300060353 | Ga0501082_0014568 | Ga0501082_0014568_2152_3147 | 329 |
| 641 | 3300005328 | Ga0070676_10115690 | Ga0070676_101156902 | 330 |
| 642 | 3300005337 | Ga0070682_100000017 | Ga0070682_10000001786 | 330 |
| 643 | 3300005338 | Ga0068868_100116141 | Ga0068868_1001161412 | 330 |
| 644 | 3300005344 | Ga0070661_100087761 | Ga0070661_1000877612 | 330 |
| 645 | 3300005345 | Ga0070692_10029433 | Ga0070692_100294332 | 330 |
| 646 | 3300005355 | Ga0070671_100306354 | Ga0070671_1003063541 | 330 |
| 647 | 3300005356 | Ga0070674_100117209 | Ga0070674_1001172092 | 330 |
| 648 | 3300005364 | Ga0070673_100047121 | Ga0070673_1000471215 | 330 |
| 649 | 3300005439 | Ga0070711_100244943 | Ga0070711_1002449432 | 330 |
| 650 | 3300005441 | Ga0070700_100021303 | Ga0070700_1000213035 | 330 |
| 651 | 3300005445 | Ga0070708_100340298 | Ga0070708_1003402981 | 330 |
| 652 | 3300005455 | Ga0070663_100152699 | Ga0070663_1001526992 | 330 |
| 653 | 3300005456 | Ga0070678_100015270 | Ga0070678_1000152702 | 330 |
| 654 | 3300005458 | Ga0070681_10056027 | Ga0070681_100560274 | 330 |
| 655 | 3300005459 | Ga0068867_100045794 | Ga0068867_1000457942 | 330 |
| 656 | 3300005466 | Ga0070685_10042553 | Ga0070685_100425532 | 330 |
| 657 | 3300005530 | Ga0070679_100000245 | Ga0070679_1000002459 | 330 |
| 658 | 3300005539 | Ga0068853_100240043 | Ga0068853_1002400432 | 330 |
| 659 | 3300005544 | Ga0070686_100107402 | Ga0070686_1001074022 | 330 |
| 660 | 3300005548 | Ga0070665_100000040 | Ga0070665_100000040287 | 330 |
| 661 | 3300005549 | Ga0070704_100028722 | Ga0070704_1000287224 | 330 |
| 662 | 3300005614 | Ga0068856_100003952 | Ga0068856_10000395214 | 330 |
| 663 | 3300005614 | Ga0068856_100273226 | Ga0068856_1002732262 | 330 |
| 664 | 3300005616 | Ga0068852_100569808 | Ga0068852_1005698081 | 330 |
| 665 | 3300005719 | Ga0068861_100089830 | Ga0068861_1000898302 | 330 |
| 666 | 3300005841 | Ga0068863_100000170 | Ga0068863_10000017028 | 330 |
| 667 | 3300005842 | Ga0068858_100001457 | Ga0068858_10000145710 | 330 |
| 668 | 3300005842 | Ga0068858_100108226 | Ga0068858_1001082263 | 330 |
| 669 | 3300005937 | Ga0081455_10034998 | Ga0081455_100349984 | 330 |
| 670 | 3300006038 | Ga0075365_10042336 | Ga0075365_100423364 | 330 |
| 671 | 3300006038 | Ga0075365_10157485 | Ga0075365_101574851 | 330 |
| 672 | 3300006038 | Ga0075365_10273791 | Ga0075365_102737911 | 330 |
| 673 | 3300006048 | Ga0075363_100066793 | Ga0075363_1000667932 | 330 |
| 674 | 3300006173 | Ga0070716_100084330 | Ga0070716_1000843303 | 330 |
| 675 | 3300006175 | Ga0070712_100005751 | Ga0070712_1000057512 | 330 |
| 676 | 3300006847 | Ga0075431_100031776 | Ga0075431_1000317766 | 330 |
| 677 | 3300006852 | Ga0075433_10000556 | Ga0075433_1000055617 | 330 |
| 678 | 3300006871 | Ga0075434_100020344 | Ga0075434_1000203446 | 330 |
| 679 | 3300006881 | Ga0068865_100120979 | Ga0068865_1001209792 | 330 |
| 680 | 3300009094 | Ga0111539_10050403 | Ga0111539_100504034 | 330 |
| 681 | 3300009098 | Ga0105245_10002293 | Ga0105245_100022937 | 330 |
| 682 | 3300009147 | Ga0114129_10023002 | Ga0114129_100230023 | 330 |
| 683 | 3300009147 | Ga0114129_10036577 | Ga0114129_100365777 | 330 |
| 684 | 3300009147 | Ga0114129_10769486 | Ga0114129_107694862 | 330 |
| 685 | 3300009148 | Ga0105243_10040129 | Ga0105243_100401291 | 330 |
| 686 | 3300009176 | Ga0105242_10059700 | Ga0105242_100597002 | 330 |
| 687 | 3300009177 | Ga0105248_10372090 | Ga0105248_103720902 | 330 |
| 688 | 3300011119 | Ga0105246_10179186 | Ga0105246_101791862 | 330 |
| 689 | 3300013296 | Ga0157374_10015151 | Ga0157374_100151511 | 330 |
| 690 | 3300013306 | Ga0163162_10072950 | Ga0163162_100729503 | 330 |
| 691 | 3300013306 | Ga0163162_10334238 | Ga0163162_103342382 | 330 |
| 692 | 3300014968 | Ga0157379_10225573 | Ga0157379_102255731 | 330 |
| 693 | 3300025901 | Ga0207688_10137918 | Ga0207688_101379182 | 330 |
| 694 | 3300025907 | Ga0207645_10163847 | Ga0207645_101638472 | 330 |
| 695 | 3300025912 | Ga0207707_10041141 | Ga0207707_100411415 | 330 |
| 696 | 3300025915 | Ga0207693_10008348 | Ga0207693_100083489 | 330 |
| 697 | 3300025916 | Ga0207663_10243367 | Ga0207663_102433672 | 330 |
| 698 | 3300025921 | Ga0207652_10001906 | Ga0207652_100019069 | 330 |
| 699 | 3300025932 | Ga0207690_10112246 | Ga0207690_101122462 | 330 |
| 700 | 3300025937 | Ga0207669_10163373 | Ga0207669_101633732 | 330 |
| 701 | 3300025938 | Ga0207704_10031608 | Ga0207704_100316083 | 330 |
| 702 | 3300025939 | Ga0207665_10056858 | Ga0207665_100568583 | 330 |
| 703 | 3300025942 | Ga0207689_10208465 | Ga0207689_102084652 | 330 |
| 704 | 3300025944 | Ga0207661_10255974 | Ga0207661_102559742 | 330 |
| 705 | 3300025961 | Ga0207712_10061889 | Ga0207712_100618893 | 330 |
| 706 | 3300025961 | Ga0207712_10063009 | Ga0207712_100630093 | 330 |
| 707 | 3300025981 | Ga0207640_10043408 | Ga0207640_100434082 | 330 |
| 708 | 3300026023 | Ga0207677_10024474 | Ga0207677_100244743 | 330 |
| 709 | 3300026035 | Ga0207703_10000078 | Ga0207703_1000007811 | 330 |
| 710 | 3300026041 | Ga0207639_10000747 | Ga0207639_100007479 | 330 |
| 711 | 3300026067 | Ga0207678_10239182 | Ga0207678_102391822 | 330 |
| 712 | 3300026075 | Ga0207708_10019391 | Ga0207708_100193916 | 330 |
| 713 | 3300026078 | Ga0207702_10003603 | Ga0207702_1000360314 | 330 |
| 714 | 3300026088 | Ga0207641_10000301 | Ga0207641_1000030131 | 330 |
| 715 | 3300026118 | Ga0207675_100038624 | Ga0207675_1000386245 | 330 |
| 716 | 3300026121 | Ga0207683_10027531 | Ga0207683_100275312 | 330 |
| 717 | 3300026142 | Ga0207698_10589241 | Ga0207698_105892411 | 330 |
| 718 | 3300027907 | Ga0207428_10020740 | Ga0207428_100207407 | 330 |
| 719 | 3300028379 | Ga0268266_10000045 | Ga0268266_10000045288 | 330 |
| 720 | 3300028381 | Ga0268264_10376295 | Ga0268264_103762952 | 330 |
| 721 | 3300031731 | Ga0307405_10150056 | Ga0307405_101500562 | 330 |
| 722 | 3300031901 | Ga0307406_10136958 | Ga0307406_101369582 | 330 |
| 723 | 3300032002 | Ga0307416_100056695 | Ga0307416_1000566952 | 330 |
| 724 | 3300032126 | Ga0307415_100199266 | Ga0307415_1001992662 | 330 |
| 725 | 3300034816 | Ga0373930_0023452 | Ga0373930_0023452_161_1165 | 330 |
| 726 | 3300035120 | Ga0373957_0070803 | Ga0373957_0070803_280_1272 | 330 |
| 727 | 3300036401 | Ga0373937_0039385 | Ga0373937_0039385_1540_2532 | 330 |
| 728 | 3300037312 | Ga0395899_0026257 | Ga0395899_0026257_146_1144 | 330 |
| 729 | 3300037418 | Ga0395900_0046056 | Ga0395900_0046056_3466_4464 | 330 |
| 730 | 3300037466 | Ga0395898_0002543 | Ga0395898_0002543_5526_6524 | 330 |
| 731 | 3300037471 | Ga0395905_0006210 | Ga0395905_0006210_1593_2591 | 330 |
| 732 | 3300045976 | Ga0466967_0240892 | Ga0466967_0240892_167_1174 | 330 |
| 733 | 3300046459 | Ga0495629_0029468 | Ga0495629_0029468_469_1461 | 330 |
| 734 | 3300046461 | Ga0495641_0000050 | Ga0495641_0000050_69642_70634 | 330 |
| 735 | 3300046473 | Ga0495582_0071872 | Ga0495582_0071872_51_1052 | 330 |
| 736 | 3300046511 | Ga0495608_0010082 | Ga0495608_0010082_4021_5013 | 330 |
| 737 | 3300046535 | Ga0495586_0008489 | Ga0495586_0008489_1347_2339 | 330 |
| 738 | 3300046663 | Ga0495635_0071907 | Ga0495635_0071907_880_1872 | 330 |
| 739 | 3300046681 | Ga0495647_0001315 | Ga0495647_0001315_5243_6235 | 330 |
| 740 | 3300046690 | Ga0495624_0052824 | Ga0495624_0052824_81_1073 | 330 |
| 741 | 3300047317 | Ga0495604_0037209 | Ga0495604_0037209_221_1213 | 330 |
| 742 | 3300047321 | Ga0495676_0001265 | Ga0495676_0001265_14932_15924 | 330 |
| 743 | 3300047322 | Ga0495680_0002644 | Ga0495680_0002644_11195_12187 | 330 |
| 744 | 3300048903 | Ga0496100_0343536 | Ga0496100_0343536_98_1105 | 330 |
| 745 | 3300048904 | Ga0496101_0047037 | Ga0496101_0047037_1867_2868 | 330 |
| 746 | 3300048905 | Ga0496102_0010557 | Ga0496102_0010557_5545_6546 | 330 |
| 747 | 3300048906 | Ga0496103_0001442 | Ga0496103_0001442_9539_10540 | 330 |
| 748 | 3300048907 | Ga0496104_0042574 | Ga0496104_0042574_2448_3449 | 330 |
| 749 | 3300048908 | Ga0496105_0019110 | Ga0496105_0019110_1695_2696 | 330 |
| 750 | 3300048909 | Ga0496106_0006922 | Ga0496106_0006922_470_1471 | 330 |
| 751 | 3300048911 | Ga0496108_0070701 | Ga0496108_0070701_400_1401 | 330 |
| 752 | 3300048912 | Ga0496109_0067792 | Ga0496109_0067792_466_1467 | 330 |
| 753 | 3300048913 | Ga0496110_0009280 | Ga0496110_0009280_1197_2189 | 330 |
| 754 | 3300048913 | Ga0496110_0125716 | Ga0496110_0125716_574_1575 | 330 |
| 755 | 3300048916 | Ga0496113_0054110 | Ga0496113_0054110_1887_2888 | 330 |
| 756 | 3300048917 | Ga0496114_0027378 | Ga0496114_0027378_2080_3072 | 330 |
| 757 | 3300048917 | Ga0496114_0041570 | Ga0496114_0041570_957_1958 | 330 |
| 758 | 3300048918 | Ga0496115_0015221 | Ga0496115_0015221_3881_4882 | 330 |
| 759 | 3300049575 | Ga0501039_0036116 | Ga0501039_0036116_1647_2645 | 330 |
| 760 | 3300049588 | Ga0501072_0030202 | Ga0501072_0030202_1978_2976 | 330 |
| 761 | 3300049588 | Ga0501072_0032899 | Ga0501072_0032899_123_1133 | 330 |
| 762 | 3300049591 | Ga0501075_0216565 | Ga0501075_0216565_394_1392 | 330 |
| 763 | 3300049592 | Ga0501076_0004141 | Ga0501076_0004141_356_1354 | 330 |
| 764 | 3300049743 | Ga0501081_0059551 | Ga0501081_0059551_1290_2288 | 330 |
| 765 | 3300050492 | nmdc:mga0yw44_4753_c1 | nmdc:mga0yw44_4753_c1_3625_4626 | 330 |
| 766 | 3300050492 | nmdc:mga0yw44_54693_c1 | nmdc:mga0yw44_54693_c1_684_1685 | 330 |
| 767 | 3300050494 | nmdc:mga06z11_50203_c1 | nmdc:mga06z11_50203_c1_32_1069 | 330 |
| 768 | 3300050507 | nmdc:mga05p37_160696_c1 | nmdc:mga05p37_160696_c1_328_1329 | 330 |
| 769 | 3300050507 | nmdc:mga05p37_284307_c1 | nmdc:mga05p37_284307_c1_136_1137 | 330 |
| 770 | 3300050507 | nmdc:mga05p37_39716_c1 | nmdc:mga05p37_39716_c1_793_1794 | 330 |
| 771 | 3300050510 | nmdc:mga06r32_49434_c1 | nmdc:mga06r32_49434_c1_1222_2223 | 330 |
| 772 | 3300050511 | nmdc:mga08y16_10720_c1 | nmdc:mga08y16_10720_c1_5425_6426 | 330 |
| 773 | 3300050512 | nmdc:mga0n895_18266_c1 | nmdc:mga0n895_18266_c1_4200_5201 | 330 |
| 774 | 3300050515 | nmdc:mga0a205_40657_c1 | nmdc:mga0a205_40657_c1_762_1763 | 330 |
| 775 | 3300050515 | nmdc:mga0a205_6_c1 | nmdc:mga0a205_6_c1_34656_35651 | 330 |
| 776 | 3300053077 | Ga0495601_0000617 | Ga0495601_0000617_14101_15093 | 330 |
| 777 | 3300053123 | Ga0500614_003327 | Ga0500614_003327_1312_2304 | 330 |
| 778 | 3300001979 | JGI24740J21852_10008667 | JGI24740J21852_100086672 | 331 |
| 779 | 3300005333 | Ga0070677_10000190 | Ga0070677_1000019011 | 331 |
| 780 | 3300005344 | Ga0070661_100000492 | Ga0070661_10000049214 | 331 |
| 781 | 3300005356 | Ga0070674_100000005 | Ga0070674_100000005171 | 331 |
| 782 | 3300005356 | Ga0070674_100000009 | Ga0070674_100000009130 | 331 |
| 783 | 3300005364 | Ga0070673_100022147 | Ga0070673_1000221474 | 331 |
| 784 | 3300005365 | Ga0070688_100000069 | Ga0070688_10000006911 | 331 |
| 785 | 3300005436 | Ga0070713_100000079 | Ga0070713_10000007945 | 331 |
| 786 | 3300005456 | Ga0070678_100288326 | Ga0070678_1002883261 | 331 |
| 787 | 3300005459 | Ga0068867_100002520 | Ga0068867_10000252012 | 331 |
| 788 | 3300005466 | Ga0070685_10000024 | Ga0070685_1000002462 | 331 |
| 789 | 3300005548 | Ga0070665_100004387 | Ga0070665_1000043872 | 331 |
| 790 | 3300005563 | Ga0068855_100112334 | Ga0068855_1001123343 | 331 |
| 791 | 3300005577 | Ga0068857_100226217 | Ga0068857_1002262172 | 331 |
| 792 | 3300005578 | Ga0068854_100098115 | Ga0068854_1000981152 | 331 |
| 793 | 3300005614 | Ga0068856_100000635 | Ga0068856_10000063540 | 331 |
| 794 | 3300005718 | Ga0068866_10000003 | Ga0068866_1000000313 | 331 |
| 795 | 3300005718 | Ga0068866_10000389 | Ga0068866_100003898 | 331 |
| 796 | 3300005834 | Ga0068851_10000339 | Ga0068851_1000033917 | 331 |
| 797 | 3300005841 | Ga0068863_100075609 | Ga0068863_1000756092 | 331 |
| 798 | 3300005937 | Ga0081455_10089357 | Ga0081455_100893574 | 331 |
| 799 | 3300005981 | Ga0081538_10050023 | Ga0081538_100500233 | 331 |
| 800 | 3300005983 | Ga0081540_1073886 | Ga0081540_10738861 | 331 |
| 801 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001534 | 331 |
| 802 | 3300006175 | Ga0070712_100012205 | Ga0070712_1000122056 | 331 |
| 803 | 3300009098 | Ga0105245_10015606 | Ga0105245_100156062 | 331 |
| 804 | 3300009101 | Ga0105247_10000892 | Ga0105247_1000089215 | 331 |
| 805 | 3300009551 | Ga0105238_10000009 | Ga0105238_1000000933 | 331 |
| 806 | 3300009553 | Ga0105249_10000050 | Ga0105249_10000050142 | 331 |
| 807 | 3300013102 | Ga0157371_10002052 | Ga0157371_1000205218 | 331 |
| 808 | 3300013104 | Ga0157370_10036245 | Ga0157370_100362456 | 331 |
| 809 | 3300014326 | Ga0157380_10000167 | Ga0157380_1000016727 | 331 |
| 810 | 3300014326 | Ga0157380_10000179 | Ga0157380_1000017921 | 331 |
| 811 | 3300014968 | Ga0157379_10015709 | Ga0157379_100157091 | 331 |
| 812 | 3300025321 | Ga0207656_10000124 | Ga0207656_1000012417 | 331 |
| 813 | 3300025885 | Ga0207653_10074537 | Ga0207653_100745371 | 331 |
| 814 | 3300025893 | Ga0207682_10000045 | Ga0207682_1000004542 | 331 |
| 815 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002264 | 331 |
| 816 | 3300025899 | Ga0207642_10000238 | Ga0207642_1000023811 | 331 |
| 817 | 3300025900 | Ga0207710_10000548 | Ga0207710_100005489 | 331 |
| 818 | 3300025900 | Ga0207710_10048481 | Ga0207710_100484812 | 331 |
| 819 | 3300025905 | Ga0207685_10000005 | Ga0207685_10000005198 | 331 |
| 820 | 3300025913 | Ga0207695_10005035 | Ga0207695_100050352 | 331 |
| 821 | 3300025914 | Ga0207671_10001437 | Ga0207671_1000143722 | 331 |
| 822 | 3300025915 | Ga0207693_10016044 | Ga0207693_100160442 | 331 |
| 823 | 3300025918 | Ga0207662_10072934 | Ga0207662_100729342 | 331 |
| 824 | 3300025920 | Ga0207649_10000009 | Ga0207649_1000000945 | 331 |
| 825 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004262 | 331 |
| 826 | 3300025927 | Ga0207687_10000013 | Ga0207687_10000013236 | 331 |
| 827 | 3300025927 | Ga0207687_10015729 | Ga0207687_100157294 | 331 |
| 828 | 3300025928 | Ga0207700_10000007 | Ga0207700_1000000776 | 331 |
| 829 | 3300025937 | Ga0207669_10000001 | Ga0207669_10000001278 | 331 |
| 830 | 3300025937 | Ga0207669_10000006 | Ga0207669_1000000622 | 331 |
| 831 | 3300025944 | Ga0207661_10000707 | Ga0207661_100007072 | 331 |
| 832 | 3300025949 | Ga0207667_10043085 | Ga0207667_100430853 | 331 |
| 833 | 3300025960 | Ga0207651_10014173 | Ga0207651_100141734 | 331 |
| 834 | 3300025961 | Ga0207712_10000019 | Ga0207712_1000001926 | 331 |
| 835 | 3300025981 | Ga0207640_10005821 | Ga0207640_100058217 | 331 |
| 836 | 3300025986 | Ga0207658_10139099 | Ga0207658_101390992 | 331 |
| 837 | 3300026078 | Ga0207702_10000360 | Ga0207702_1000036044 | 331 |
| 838 | 3300026088 | Ga0207641_10035210 | Ga0207641_100352103 | 331 |
| 839 | 3300026089 | Ga0207648_10017132 | Ga0207648_100171326 | 331 |
| 840 | 3300026121 | Ga0207683_10093205 | Ga0207683_100932053 | 331 |
| 841 | 3300041491 | Ga0451833_0087528 | Ga0451833_0087528_560_1558 | 331 |
| 842 | 3300044694 | Ga0466963_0000075 | Ga0466963_0000075_21919_22914 | 331 |
| 843 | 3300044842 | Ga0466957_0003008 | Ga0466957_0003008_793_1788 | 331 |
| 844 | 3300045976 | Ga0466967_0000019 | Ga0466967_0000019_10082_11077 | 331 |
| 845 | 3300045976 | Ga0466967_0129745 | Ga0466967_0129745_1117_2124 | 331 |
| 846 | 3300046455 | Ga0495603_0006166 | Ga0495603_0006166_2454_3449 | 331 |
| 847 | 3300046459 | Ga0495629_0001110 | Ga0495629_0001110_18011_19006 | 331 |
| 848 | 3300046461 | Ga0495641_0136187 | Ga0495641_0136187_40_1035 | 331 |
| 849 | 3300046473 | Ga0495582_0000004 | Ga0495582_0000004_83130_84125 | 331 |
| 850 | 3300046507 | Ga0495606_0000072 | Ga0495606_0000072_159832_160827 | 331 |
| 851 | 3300046514 | Ga0495618_0000008 | Ga0495618_0000008_191934_192929 | 331 |
| 852 | 3300046515 | Ga0495620_0000247 | Ga0495620_0000247_31040_32035 | 331 |
| 853 | 3300046516 | Ga0495628_0065563 | Ga0495628_0065563_1395_2390 | 331 |
| 854 | 3300046517 | Ga0495630_0000012 | Ga0495630_0000012_60011_61006 | 331 |
| 855 | 3300046517 | Ga0495630_0233502 | Ga0495630_0233502_374_1369 | 331 |
| 856 | 3300046523 | Ga0495644_0001127 | Ga0495644_0001127_157_1152 | 331 |
| 857 | 3300046559 | Ga0495667_0119247 | Ga0495667_0119247_321_1316 | 331 |
| 858 | 3300046678 | Ga0495599_0038243 | Ga0495599_0038243_1855_2850 | 331 |
| 859 | 3300046681 | Ga0495647_0018848 | Ga0495647_0018848_1392_2387 | 331 |
| 860 | 3300046683 | Ga0495658_0000004 | Ga0495658_0000004_55431_56426 | 331 |
| 861 | 3300046684 | Ga0495669_0000030 | Ga0495669_0000030_23149_24144 | 331 |
| 862 | 3300046689 | Ga0495613_0000850 | Ga0495613_0000850_20946_21941 | 331 |
| 863 | 3300046690 | Ga0495624_0007692 | Ga0495624_0007692_62_1057 | 331 |
| 864 | 3300046809 | Ga0495600_0014884 | Ga0495600_0014884_2538_3533 | 331 |
| 865 | 3300047317 | Ga0495604_0000071 | Ga0495604_0000071_18053_19048 | 331 |
| 866 | 3300047317 | Ga0495604_0000106 | Ga0495604_0000106_57396_58391 | 331 |
| 867 | 3300047317 | Ga0495604_0011719 | Ga0495604_0011719_4538_5533 | 331 |
| 868 | 3300047319 | Ga0495674_0000019 | Ga0495674_0000019_8345_9340 | 331 |
| 869 | 3300047320 | Ga0495672_0005626 | Ga0495672_0005626_8293_9348 | 331 |
| 870 | 3300047322 | Ga0495680_0000569 | Ga0495680_0000569_37173_38171 | 331 |
| 871 | 3300047471 | Ga0495684_0119730 | Ga0495684_0119730_632_1630 | 331 |
| 872 | 3300048088 | Ga0495602_0000142 | Ga0495602_0000142_43991_44986 | 331 |
| 873 | 3300048088 | Ga0495602_0102358 | Ga0495602_0102358_1218_2213 | 331 |
| 874 | 3300048903 | Ga0496100_0000010 | Ga0496100_0000010_117211_118206 | 331 |
| 875 | 3300048904 | Ga0496101_0000025 | Ga0496101_0000025_117211_118206 | 331 |
| 876 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_504996_505991 | 331 |
| 877 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_415048_416043 | 331 |
| 878 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_135840_136835 | 331 |
| 879 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_72013_73008 | 331 |
| 880 | 3300048909 | Ga0496106_0000012 | Ga0496106_0000012_86971_87966 | 331 |
| 881 | 3300048909 | Ga0496106_0000041 | Ga0496106_0000041_95296_96291 | 331 |
| 882 | 3300048910 | Ga0496107_0000010 | Ga0496107_0000010_86983_87978 | 331 |
| 883 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_853500_854495 | 331 |
| 884 | 3300048912 | Ga0496109_0000004 | Ga0496109_0000004_107311_108306 | 331 |
| 885 | 3300048912 | Ga0496109_0000075 | Ga0496109_0000075_2821_3816 | 331 |
| 886 | 3300048914 | Ga0496111_0032669 | Ga0496111_0032669_1970_3043 | 331 |
| 887 | 3300048915 | Ga0496112_0045466 | Ga0496112_0045466_1852_2847 | 331 |
| 888 | 3300048916 | Ga0496113_0000052 | Ga0496113_0000052_38511_39506 | 331 |
| 889 | 3300048916 | Ga0496113_0239549 | Ga0496113_0239549_43_1038 | 331 |
| 890 | 3300048917 | Ga0496114_0000074 | Ga0496114_0000074_58367_59362 | 331 |
| 891 | 3300048918 | Ga0496115_0000010 | Ga0496115_0000010_9814_10809 | 331 |
| 892 | 3300048918 | Ga0496115_0002588 | Ga0496115_0002588_34_1029 | 331 |
| 893 | 3300048922 | Ga0496119_0036375 | Ga0496119_0036375_840_1835 | 331 |
| 894 | 3300049575 | Ga0501039_0241299 | Ga0501039_0241299_74_1072 | 331 |
| 895 | 3300049586 | Ga0501070_0264256 | Ga0501070_0264256_256_1251 | 331 |
| 896 | 3300049588 | Ga0501072_0011877 | Ga0501072_0011877_3253_4251 | 331 |
| 897 | 3300049743 | Ga0501081_0204670 | Ga0501081_0204670_57_1052 | 331 |
| 898 | 3300053077 | Ga0495601_0000027 | Ga0495601_0000027_62430_63425 | 331 |
| 899 | 3300053078 | Ga0495612_0001004 | Ga0495612_0001004_9192_10187 | 331 |
| 900 | 3300053078 | Ga0495612_0007683 | Ga0495612_0007683_1451_2446 | 331 |
| 901 | 3300053085 | Ga0495619_0000010 | Ga0495619_0000010_182318_183313 | 331 |
| 902 | 3300053094 | Ga0500566_0001344 | Ga0500566_0001344_1467_2462 | 331 |
| 903 | 3300060353 | Ga0501082_0367066 | Ga0501082_0367066_192_1187 | 331 |
| 904 | 3300002074 | JGI24748J21848_1001192 | JGI24748J21848_10011922 | 332 |
| 905 | 3300002239 | JGI24034J26672_10002685 | JGI24034J26672_100026852 | 332 |
| 906 | 3300002244 | JGI24742J22300_10005449 | JGI24742J22300_100054492 | 332 |
| 907 | 3300005329 | Ga0070683_100025124 | Ga0070683_1000251242 | 332 |
| 908 | 3300005337 | Ga0070682_100000049 | Ga0070682_10000004922 | 332 |
| 909 | 3300005338 | Ga0068868_100000026 | Ga0068868_10000002655 | 332 |
| 910 | 3300005340 | Ga0070689_100137471 | Ga0070689_1001374712 | 332 |
| 911 | 3300005341 | Ga0070691_10011263 | Ga0070691_100112633 | 332 |
| 912 | 3300005435 | Ga0070714_100075381 | Ga0070714_1000753812 | 332 |
| 913 | 3300005457 | Ga0070662_100000009 | Ga0070662_10000000924 | 332 |
| 914 | 3300005535 | Ga0070684_100057855 | Ga0070684_1000578552 | 332 |
| 915 | 3300005543 | Ga0070672_100000283 | Ga0070672_10000028315 | 332 |
| 916 | 3300005618 | Ga0068864_100000031 | Ga0068864_100000031166 | 332 |
| 917 | 3300005981 | Ga0081538_10000103 | Ga0081538_1000010324 | 332 |
| 918 | 3300005985 | Ga0081539_10010669 | Ga0081539_100106698 | 332 |
| 919 | 3300005985 | Ga0081539_10116686 | Ga0081539_101166862 | 332 |
| 920 | 3300006914 | Ga0075436_100057057 | Ga0075436_1000570572 | 332 |
| 921 | 3300009176 | Ga0105242_10000473 | Ga0105242_1000047313 | 332 |
| 922 | 3300013307 | Ga0157372_10000610 | Ga0157372_1000061010 | 332 |
| 923 | 3300017792 | Ga0163161_10000021 | Ga0163161_1000002191 | 332 |
| 924 | 3300025929 | Ga0207664_10012727 | Ga0207664_100127273 | 332 |
| 925 | 3300025932 | Ga0207690_10072124 | Ga0207690_100721242 | 332 |
| 926 | 3300025932 | Ga0207690_10226983 | Ga0207690_102269832 | 332 |
| 927 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001129 | 332 |
| 928 | 3300025934 | Ga0207686_10000644 | Ga0207686_1000064413 | 332 |
| 929 | 3300025936 | Ga0207670_10021953 | Ga0207670_100219532 | 332 |
| 930 | 3300025937 | Ga0207669_10059794 | Ga0207669_100597942 | 332 |
| 931 | 3300025940 | Ga0207691_10000934 | Ga0207691_1000093415 | 332 |
| 932 | 3300025944 | Ga0207661_10012761 | Ga0207661_100127612 | 332 |
| 933 | 3300026023 | Ga0207677_10000106 | Ga0207677_1000010642 | 332 |
| 934 | 3300026095 | Ga0207676_10000031 | Ga0207676_10000031165 | 332 |
| 935 | 3300028556 | Ga0265337_1000006 | Ga0265337_100000686 | 332 |
| 936 | 3300028558 | Ga0265326_10000066 | Ga0265326_1000006646 | 332 |
| 937 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001504 | 332 |
| 938 | 3300028666 | Ga0265336_10002244 | Ga0265336_100022448 | 332 |
| 939 | 3300029957 | Ga0265324_10000563 | Ga0265324_1000056313 | 332 |
| 940 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002503 | 332 |
| 941 | 3300031242 | Ga0265329_10003034 | Ga0265329_100030345 | 332 |
| 942 | 3300031249 | Ga0265339_10011892 | Ga0265339_100118922 | 332 |
| 943 | 3300031250 | Ga0265331_10003440 | Ga0265331_100034408 | 332 |
| 944 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011503 | 332 |
| 945 | 3300031344 | Ga0265316_10008459 | Ga0265316_100084599 | 332 |
| 946 | 3300031711 | Ga0265314_10000726 | Ga0265314_100007268 | 332 |
| 947 | 3300032126 | Ga0307415_100029921 | Ga0307415_1000299215 | 332 |
| 948 | 3300041512 | Ga0451853_1497798 | Ga0451853_1497798_52_1050 | 332 |
| 949 | 3300046455 | Ga0495603_0000828 | Ga0495603_0000828_5206_6204 | 332 |
| 950 | 3300046459 | Ga0495629_0000145 | Ga0495629_0000145_16565_17563 | 332 |
| 951 | 3300046462 | Ga0495651_0110944 | Ga0495651_0110944_187_1185 | 332 |
| 952 | 3300046463 | Ga0495653_0050898 | Ga0495653_0050898_899_1897 | 332 |
| 953 | 3300046463 | Ga0495653_0252695 | Ga0495653_0252695_138_1136 | 332 |
| 954 | 3300046476 | Ga0495662_0012304 | Ga0495662_0012304_1755_2753 | 332 |
| 955 | 3300046511 | Ga0495608_0000023 | Ga0495608_0000023_45961_46977 | 332 |
| 956 | 3300046511 | Ga0495608_0000891 | Ga0495608_0000891_10520_11518 | 332 |
| 957 | 3300046516 | Ga0495628_0000165 | Ga0495628_0000165_52992_53990 | 332 |
| 958 | 3300046516 | Ga0495628_0001530 | Ga0495628_0001530_18266_19264 | 332 |
| 959 | 3300046529 | Ga0495652_0000346 | Ga0495652_0000346_19577_20575 | 332 |
| 960 | 3300046529 | Ga0495652_0013007 | Ga0495652_0013007_2090_3088 | 332 |
| 961 | 3300046543 | Ga0495645_0040166 | Ga0495645_0040166_1337_2335 | 332 |
| 962 | 3300046559 | Ga0495667_0000047 | Ga0495667_0000047_63442_64440 | 332 |
| 963 | 3300046615 | Ga0495656_0001137 | Ga0495656_0001137_77_1075 | 332 |
| 964 | 3300046642 | Ga0495634_0005892 | Ga0495634_0005892_4893_5912 | 332 |
| 965 | 3300046642 | Ga0495634_0048539 | Ga0495634_0048539_252_1250 | 332 |
| 966 | 3300046663 | Ga0495635_0000034 | Ga0495635_0000034_50077_51075 | 332 |
| 967 | 3300046674 | Ga0495588_0000422 | Ga0495588_0000422_21657_22655 | 332 |
| 968 | 3300046675 | Ga0495657_0000020 | Ga0495657_0000020_45961_46977 | 332 |
| 969 | 3300046675 | Ga0495657_0026853 | Ga0495657_0026853_1478_2476 | 332 |
| 970 | 3300046678 | Ga0495599_0149180 | Ga0495599_0149180_28_1026 | 332 |
| 971 | 3300046689 | Ga0495613_0000251 | Ga0495613_0000251_1448_2452 | 332 |
| 972 | 3300046690 | Ga0495624_0060732 | Ga0495624_0060732_21_1019 | 332 |
| 973 | 3300047321 | Ga0495676_0010945 | Ga0495676_0010945_55_1053 | 332 |
| 974 | 3300047322 | Ga0495680_0003506 | Ga0495680_0003506_10117_11115 | 332 |
| 975 | 3300047444 | Ga0495675_0000561 | Ga0495675_0000561_2246_3262 | 332 |
| 976 | 3300047447 | Ga0495685_015775 | Ga0495685_015775_1410_2408 | 332 |
| 977 | 3300048088 | Ga0495602_0013667 | Ga0495602_0013667_1397_2395 | 332 |
| 978 | 3300048907 | Ga0496104_0001329 | Ga0496104_0001329_12463_13464 | 332 |
| 979 | 3300048908 | Ga0496105_0000407 | Ga0496105_0000407_8597_9598 | 332 |
| 980 | 3300048913 | Ga0496110_0000200 | Ga0496110_0000200_7600_8598 | 332 |
| 981 | 3300048914 | Ga0496111_0000153 | Ga0496111_0000153_15589_16587 | 332 |
| 982 | 3300048915 | Ga0496112_0000013 | Ga0496112_0000013_226178_227176 | 332 |
| 983 | 3300048916 | Ga0496113_0030475 | Ga0496113_0030475_1112_2110 | 332 |
| 984 | 3300049578 | Ga0501042_0016286 | Ga0501042_0016286_2986_3987 | 332 |
| 985 | 3300049591 | Ga0501075_0001027 | Ga0501075_0001027_8380_9378 | 332 |
| 986 | 3300050514 | nmdc:mga08x19_49438_c1 | nmdc:mga08x19_49438_c1_162_1160 | 332 |
| 987 | 3300053077 | Ga0495601_0045549 | Ga0495601_0045549_421_1419 | 332 |
| 988 | 3300053084 | Ga0495595_0000022 | Ga0495595_0000022_63622_64638 | 332 |
| 989 | 3300053084 | Ga0495595_0000140 | Ga0495595_0000140_27207_28205 | 332 |
| 990 | 3300053085 | Ga0495619_0000070 | Ga0495619_0000070_63561_64577 | 332 |
| 991 | 3300053085 | Ga0495619_0002106 | Ga0495619_0002106_10103_11101 | 332 |
| 992 | 3300053085 | Ga0495619_0004729 | Ga0495619_0004729_2969_3967 | 332 |
| 993 | 3300053085 | Ga0495619_0004935 | Ga0495619_0004935_5220_6218 | 332 |
| 994 | 3300001977 | JGI24746J21847_1000008 | JGI24746J21847_10000084 | 333 |
| 995 | 3300005338 | Ga0068868_100056518 | Ga0068868_1000565182 | 333 |
| 996 | 3300005347 | Ga0070668_100003085 | Ga0070668_10000308510 | 333 |
| 997 | 3300005354 | Ga0070675_100000025 | Ga0070675_10000002539 | 333 |
| 998 | 3300005365 | Ga0070688_100000099 | Ga0070688_10000009933 | 333 |
| 999 | 3300005366 | Ga0070659_100010269 | Ga0070659_1000102696 | 333 |
| 1000 | 3300005367 | Ga0070667_100000625 | Ga0070667_10000062515 | 333 |
| 1001 | 3300005466 | Ga0070685_10000025 | Ga0070685_1000002515 | 333 |
| 1002 | 3300005547 | Ga0070693_100022499 | Ga0070693_1000224992 | 333 |
| 1003 | 3300005549 | Ga0070704_100252601 | Ga0070704_1002526011 | 333 |
| 1004 | 3300005578 | Ga0068854_100000065 | Ga0068854_10000006524 | 333 |
| 1005 | 3300005614 | Ga0068856_100024767 | Ga0068856_1000247676 | 333 |
| 1006 | 3300005616 | Ga0068852_100000094 | Ga0068852_1000000949 | 333 |
| 1007 | 3300005616 | Ga0068852_100383203 | Ga0068852_1003832032 | 333 |
| 1008 | 3300005617 | Ga0068859_100563043 | Ga0068859_1005630432 | 333 |
| 1009 | 3300005718 | Ga0068866_10094595 | Ga0068866_100945952 | 333 |
| 1010 | 3300005834 | Ga0068851_10010203 | Ga0068851_100102037 | 333 |
| 1011 | 3300005841 | Ga0068863_100007521 | Ga0068863_1000075217 | 333 |
| 1012 | 3300005842 | Ga0068858_100000069 | Ga0068858_10000006988 | 333 |
| 1013 | 3300005843 | Ga0068860_100174128 | Ga0068860_1001741282 | 333 |
| 1014 | 3300005844 | Ga0068862_100001642 | Ga0068862_10000164210 | 333 |
| 1015 | 3300005937 | Ga0081455_10012576 | Ga0081455_100125767 | 333 |
| 1016 | 3300006846 | Ga0075430_100103456 | Ga0075430_1001034562 | 333 |
| 1017 | 3300006881 | Ga0068865_100000034 | Ga0068865_1000000342 | 333 |
| 1018 | 3300006931 | Ga0097620_100563100 | Ga0097620_1005631002 | 333 |
| 1019 | 3300009098 | Ga0105245_10000135 | Ga0105245_1000013515 | 333 |
| 1020 | 3300009176 | Ga0105242_10005668 | Ga0105242_100056682 | 333 |
| 1021 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008148 | 333 |
| 1022 | 3300009553 | Ga0105249_10052691 | Ga0105249_100526913 | 333 |
| 1023 | 3300013104 | Ga0157370_10008177 | Ga0157370_1000817712 | 333 |
| 1024 | 3300013105 | Ga0157369_10000020 | Ga0157369_100000205 | 333 |
| 1025 | 3300013308 | Ga0157375_10000236 | Ga0157375_1000023622 | 333 |
| 1026 | 3300013308 | Ga0157375_10002341 | Ga0157375_1000234111 | 333 |
| 1027 | 3300014969 | Ga0157376_10041111 | Ga0157376_100411112 | 333 |
| 1028 | 3300020070 | Ga0206356_10475672 | Ga0206356_104756722 | 333 |
| 1029 | 3300025321 | Ga0207656_10039829 | Ga0207656_100398292 | 333 |
| 1030 | 3300025916 | Ga0207663_10028817 | Ga0207663_100288172 | 333 |
| 1031 | 3300025926 | Ga0207659_10000033 | Ga0207659_1000003331 | 333 |
| 1032 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007594 | 333 |
| 1033 | 3300025932 | Ga0207690_10012005 | Ga0207690_100120054 | 333 |
| 1034 | 3300025934 | Ga0207686_10000300 | Ga0207686_1000030031 | 333 |
| 1035 | 3300025938 | Ga0207704_10000059 | Ga0207704_100000592 | 333 |
| 1036 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006544 | 333 |
| 1037 | 3300025972 | Ga0207668_10002210 | Ga0207668_100022105 | 333 |
| 1038 | 3300025981 | Ga0207640_10000151 | Ga0207640_1000015122 | 333 |
| 1039 | 3300025986 | Ga0207658_10000506 | Ga0207658_1000050624 | 333 |
| 1040 | 3300026023 | Ga0207677_10001102 | Ga0207677_100011029 | 333 |
| 1041 | 3300026035 | Ga0207703_10000257 | Ga0207703_1000025734 | 333 |
| 1042 | 3300026078 | Ga0207702_10019703 | Ga0207702_100197032 | 333 |
| 1043 | 3300026088 | Ga0207641_10010509 | Ga0207641_100105097 | 333 |
| 1044 | 3300026142 | Ga0207698_10000013 | Ga0207698_10000013195 | 333 |
| 1045 | 3300026142 | Ga0207698_10052769 | Ga0207698_100527694 | 333 |
| 1046 | 3300028379 | Ga0268266_10120741 | Ga0268266_101207412 | 333 |
| 1047 | 3300028380 | Ga0268265_10005906 | Ga0268265_100059066 | 333 |
| 1048 | 3300028381 | Ga0268264_10255537 | Ga0268264_102555372 | 333 |
| 1049 | 3300028563 | Ga0265319_1000073 | Ga0265319_100007320 | 333 |
| 1050 | 3300028800 | Ga0265338_10002303 | Ga0265338_100023034 | 333 |
| 1051 | 3300031241 | Ga0265325_10006312 | Ga0265325_100063122 | 333 |
| 1052 | 3300045836 | Ga0466958_0100493 | Ga0466958_0100493_746_1753 | 333 |
| 1053 | 3300046459 | Ga0495629_0001588 | Ga0495629_0001588_3209_4210 | 333 |
| 1054 | 3300046511 | Ga0495608_0015492 | Ga0495608_0015492_71_1075 | 333 |
| 1055 | 3300046512 | Ga0495610_0085075 | Ga0495610_0085075_50_1054 | 333 |
| 1056 | 3300046642 | Ga0495634_0000034 | Ga0495634_0000034_61951_62955 | 333 |
| 1057 | 3300046660 | Ga0495625_0001243 | Ga0495625_0001243_11316_12323 | 333 |
| 1058 | 3300046683 | Ga0495658_0030299 | Ga0495658_0030299_546_1550 | 333 |
| 1059 | 3300047320 | Ga0495672_0029855 | Ga0495672_0029855_1362_2381 | 333 |
| 1060 | 3300047321 | Ga0495676_0010845 | Ga0495676_0010845_1883_2884 | 333 |
| 1061 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_158545_159546 | 333 |
| 1062 | 3300048904 | Ga0496101_0000022 | Ga0496101_0000022_82140_83141 | 333 |
| 1063 | 3300048905 | Ga0496102_0000572 | Ga0496102_0000572_9679_10680 | 333 |
| 1064 | 3300048906 | Ga0496103_0000031 | Ga0496103_0000031_181742_182743 | 333 |
| 1065 | 3300048909 | Ga0496106_0000108 | Ga0496106_0000108_42457_43458 | 333 |
| 1066 | 3300048910 | Ga0496107_0000011 | Ga0496107_0000011_152337_153338 | 333 |
| 1067 | 3300048911 | Ga0496108_0000026 | Ga0496108_0000026_80602_81612 | 333 |
| 1068 | 3300048911 | Ga0496108_0000341 | Ga0496108_0000341_27674_28675 | 333 |
| 1069 | 3300048911 | Ga0496108_0009847 | Ga0496108_0009847_4711_5715 | 333 |
| 1070 | 3300048912 | Ga0496109_0000060 | Ga0496109_0000060_6794_7804 | 333 |
| 1071 | 3300048912 | Ga0496109_0000172 | Ga0496109_0000172_35529_36530 | 333 |
| 1072 | 3300048912 | Ga0496109_0256610 | Ga0496109_0256610_55_1059 | 333 |
| 1073 | 3300049585 | Ga0501069_0011011 | Ga0501069_0011011_170_1183 | 333 |
| 1074 | 3300049586 | Ga0501070_0327455 | Ga0501070_0327455_63_1076 | 333 |
| 1075 | 3300050509 | nmdc:mga0qj67_86767_c1 | nmdc:mga0qj67_86767_c1_1485_2489 | 333 |
| 1076 | 3300050515 | nmdc:mga0a205_12181_c1 | nmdc:mga0a205_12181_c1_6257_7261 | 333 |
| 1077 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_417134_418138 | 333 |
| 1078 | 3300053083 | Ga0495655_0004484 | Ga0495655_0004484_1334_2335 | 333 |
| 1079 | 3300053129 | Ga0500628_000073 | Ga0500628_000073_23743_24747 | 333 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7elt-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase complexed with trp-amp | 0.9706 | 6 | 330 |
| 5ekd-assembly1.cif.gz_B | human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp. | 0.9673 | 1 | 327 |
| 7ev2-assembly1.cif.gz_A-2 | crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase complexed with y-11 and atp | 0.9661 | 2 | 330 |
| 7el8-assembly1.cif.gz_A-2 | crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase | 0.9658 | 3 | 330 |
| 5ekd-assembly1.cif.gz_A | human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp. | 0.9638 | 4 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fhjF02 | Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase | 0.9748 | 187 | 292 | 1.10.240.10 |
| af_Q86A90_233_346_1.10.240.10 | Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase | 0.9669 | 187 | 288 | 1.10.240.10 |
| 3fi0I02 | Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase | 0.9669 | 188 | 292 | 1.10.240.10 |
| 5ekdB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9667 | 1 | 182 | 3.40.50.620 |
| 3n9iB02 | Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase | 0.9652 | 187 | 296 | 1.10.240.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1N483-F1-model_v4 | Tryptophan--tRNA ligase (EC 6.1.1.2) | 0.9813 | 76 | 330 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-A0A5S9M6P4-F1-model_v4 | Tryptophan--tRNA ligase (EC 6.1.1.2) | 0.9783 | 38 | 196 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-A0A821SYS9-F1-model_v4 | tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) | 0.9761 | 4 | 329 |
GO:0004830
GO:0005524 GO:0005759 GO:0070183 |
| AF-A0A2H0W900-F1-model_v4 | Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) | 0.9756 | 4 | 330 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-A0A2K5RVG5-F1-model_v4 | tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) | 0.9753 | 2 | 329 |
GO:0001570
GO:0004830 GO:0005524 GO:0005654 GO:0005759 GO:0005886 GO:0070183 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar