F489635

General Info

Members Datasets Scaffolds Average Seq Length
1079 377 1079 332

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100306354|Ga0070671_1003063541
Length 377
Sequence MPPEAGQAGRRSGALGVEQPPTRRGTPERRPRVPPRDRRARFVGLVRIFSGIQPTGRKHLGNYIGAIRQYVEGQDRGDPAIYCIVDLHAITVAYEPSELRERLYDTTAILIAAGLDPERCILFRQSDVREHTELCWLLSSVTAIGELNRMHQFRDKSLAQRELVSSGLLFYPVLQAADVLAYRAHEVPVGEDQREHLELMRDVARRFNARYGEDILVVPEHRIPEVGARIMDLQEPTRKMSTTGGTEEGTVLVLDDPKTIEKKIKRAVTDSGTEILRAPDKPGVSNLIDVLAVARGVSPAAVEEDMRSARGYGDLKGAVAEAVVGMLAPVRERYAEIRPDEDRLEAILAQGADKARTLASATLADVRDAMGVGAPPQ

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
185 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
186 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
187 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
188 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
189 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
227 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
289 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
335 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
336 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
345 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
363 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
364 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
365 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
366 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
367 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
368 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
369 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
370 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
373 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
374 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 12.42
Rhizosphere 82.02
Stem 0
Stem Tuber 0
Unclassified 3.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000008 3300001977 Bacteria 19234
2 JGI24740J21852_10008667 3300001979 Bacteria 4037
3 JGI24748J21848_1001192 3300002074 Bacteria 2834
4 JGI24034J26672_10002685 3300002239 Bacteria 2450
5 JGI24742J22300_10005449 3300002244 Bacteria 2093
6 JGI25406J46586_10003262 3300003203 Bacteria 7639
7 JGI25406J46586_10035344 3300003203 Bacteria 1825
8 JGI25404J52841_10002501 3300003659 Bacteria 3486
9 Ga0070658_10073527 3300005327 Bacteria 2803
10 Ga0070676_10115690 3300005328 Bacteria 1676
11 Ga0070683_100025124 3300005329 Bacteria 5346
12 Ga0070683_100042159 3300005329 Bacteria 4202
13 Ga0070683_100062589 3300005329 Bacteria 3460
14 Ga0070683_100073405 3300005329 Bacteria 3195
15 Ga0070683_100075467 3300005329 Bacteria 3150
16 Ga0070683_100376039 3300005329 Bacteria 1354
17 Ga0070690_100062046 3300005330 Bacteria 2410
18 Ga0070677_10000190 3300005333 Bacteria 21167
19 Ga0068869_100104385 3300005334 Bacteria 2148
20 Ga0068869_100139148 3300005334 Bacteria 1873
21 Ga0070666_10012316 3300005335 Bacteria 5392
22 Ga0070680_100166436 3300005336 Bacteria 1854
23 Ga0070682_100000017 3300005337 Bacteria 235228
24 Ga0070682_100000049 3300005337 Bacteria 127229
25 Ga0070682_100006477 3300005337 Bacteria 6583
26 Ga0068868_100000026 3300005338 Bacteria 81980
27 Ga0068868_100006160 3300005338 Bacteria 8479
28 Ga0068868_100056518 3300005338 Bacteria 3099
29 Ga0068868_100116141 3300005338 Bacteria 2179
30 Ga0070660_100013156 3300005339 Bacteria 5930
31 Ga0070660_100024817 3300005339 Bacteria 4452
32 Ga0070689_100062567 3300005340 Bacteria 2896
33 Ga0070689_100137471 3300005340 Bacteria 1963
34 Ga0070691_10000001 3300005341 Bacteria 94744
35 Ga0070691_10011263 3300005341 Bacteria 4081
36 Ga0070691_10032476 3300005341 Bacteria 2453
37 Ga0070661_100000492 3300005344 Bacteria 30277
38 Ga0070661_100087761 3300005344 Bacteria 2301
39 Ga0070661_100173092 3300005344 Bacteria 1640
40 Ga0070692_10012752 3300005345 Bacteria 3902
41 Ga0070692_10029433 3300005345 Bacteria 2737
42 Ga0070668_100003085 3300005347 Bacteria 12311
43 Ga0070668_100037834 3300005347 Bacteria 3686
44 Ga0070669_100369034 3300005353 Bacteria 1169
45 Ga0070675_100000025 3300005354 Bacteria 115134
46 Ga0070675_100108017 3300005354 Bacteria 2350
47 Ga0070671_100306354 3300005355 Bacteria 1352
48 Ga0070674_100000005 3300005356 Bacteria 168443
49 Ga0070674_100000009 3300005356 Bacteria 143336
50 Ga0070674_100117209 3300005356 Bacteria 1966
51 Ga0070674_100135857 3300005356 Bacteria 1839
52 Ga0070673_100022147 3300005364 Bacteria 4621
53 Ga0070673_100047121 3300005364 Bacteria 3352
54 Ga0070688_100000069 3300005365 Bacteria 50704
55 Ga0070688_100000099 3300005365 Bacteria 44288
56 Ga0070659_100010269 3300005366 Bacteria 6888
57 Ga0070659_100011575 3300005366 Bacteria 6529
58 Ga0070659_100068926 3300005366 Bacteria 2807
59 Ga0070659_100346998 3300005366 Bacteria 1245
60 Ga0070667_100000625 3300005367 Bacteria 34457
61 Ga0070667_100004009 3300005367 Bacteria 12469
62 Ga0070714_100000137 3300005435 Bacteria 58260
63 Ga0070714_100030023 3300005435 Bacteria 4523
64 Ga0070714_100068311 3300005435 Bacteria 3066
65 Ga0070714_100075381 3300005435 Bacteria 2927
66 Ga0070714_100164642 3300005435 Bacteria 2009
67 Ga0070713_100000079 3300005436 Bacteria 60238
68 Ga0070713_100330713 3300005436 Bacteria 1409
69 Ga0070701_10030805 3300005438 Bacteria 2657
70 Ga0070711_100001716 3300005439 Bacteria 12150
71 Ga0070711_100006351 3300005439 Bacteria 7120
72 Ga0070711_100097109 3300005439 Bacteria 2136
73 Ga0070711_100146244 3300005439 Bacteria 1778
74 Ga0070711_100244943 3300005439 Bacteria 1403
75 Ga0070705_100306933 3300005440 Bacteria 1140
76 Ga0070700_100006904 3300005441 Bacteria 6096
77 Ga0070700_100021303 3300005441 Bacteria 3767
78 Ga0070700_100161929 3300005441 Bacteria 1541
79 Ga0070708_100340298 3300005445 Bacteria 1414
80 Ga0070663_100078773 3300005455 Bacteria 2416
81 Ga0070663_100152699 3300005455 Bacteria 1772
82 Ga0070678_100006059 3300005456 Bacteria 7055
83 Ga0070678_100015270 3300005456 Bacteria 4876
84 Ga0070678_100288326 3300005456 Bacteria 1391
85 Ga0070662_100000009 3300005457 Bacteria 142979
86 Ga0070662_100146963 3300005457 Bacteria 1832
87 Ga0070681_10056027 3300005458 Bacteria 3924
88 Ga0068867_100002520 3300005459 Bacteria 12885
89 Ga0068867_100045794 3300005459 Bacteria 3210
90 Ga0070685_10000024 3300005466 Bacteria 101602
91 Ga0070685_10000025 3300005466 Bacteria 100621
92 Ga0070685_10042553 3300005466 Bacteria 2592
93 Ga0070685_10045276 3300005466 Bacteria 2522
94 Ga0070706_100010715 3300005467 Bacteria 8509
95 Ga0070707_100217407 3300005468 Bacteria 1862
96 Ga0070699_100079328 3300005518 Bacteria 2860
97 Ga0070679_100000245 3300005530 Bacteria 45408
98 Ga0070679_100030794 3300005530 Bacteria 5300
99 Ga0070679_100083807 3300005530 Bacteria 3176
100 Ga0070679_100219759 3300005530 Bacteria 1861
101 Ga0070684_100057855 3300005535 Bacteria 3386
102 Ga0070684_100323033 3300005535 Bacteria 1418
103 Ga0068853_100159773 3300005539 Bacteria 2033
104 Ga0068853_100240043 3300005539 Bacteria 1661
105 Ga0070672_100000283 3300005543 Bacteria 28861
106 Ga0070686_100107402 3300005544 Bacteria 1895
107 Ga0070695_100042564 3300005545 Bacteria 2884
108 Ga0070693_100022499 3300005547 Bacteria 3353
109 Ga0070665_100000040 3300005548 Bacteria 305480
110 Ga0070665_100004387 3300005548 Bacteria 14836
111 Ga0070665_100009749 3300005548 Bacteria 9712
112 Ga0070704_100028722 3300005549 Bacteria 3704
113 Ga0070704_100106342 3300005549 Bacteria 2126
114 Ga0070704_100252601 3300005549 Bacteria 1449
115 Ga0068855_100112334 3300005563 Bacteria 3127
116 Ga0068855_100590323 3300005563 Bacteria 1199
117 Ga0070664_100007855 3300005564 Bacteria 8617
118 Ga0070664_100154111 3300005564 Bacteria 2029
119 Ga0068857_100226217 3300005577 Bacteria 1710
120 Ga0068854_100000065 3300005578 Bacteria 76046
121 Ga0068854_100098115 3300005578 Bacteria 2192
122 Ga0068854_100165665 3300005578 Bacteria 1716
123 Ga0068854_100207256 3300005578 Bacteria 1544
124 Ga0068856_100000635 3300005614 Bacteria 38196
125 Ga0068856_100003952 3300005614 Bacteria 14848
126 Ga0068856_100024767 3300005614 Bacteria 5845
127 Ga0068856_100025704 3300005614 Bacteria 5741
128 Ga0068856_100056321 3300005614 Bacteria 3879
129 Ga0068856_100219927 3300005614 Bacteria 1915
130 Ga0068856_100273226 3300005614 Bacteria 1706
131 Ga0070702_100071332 3300005615 Bacteria 2053
132 Ga0070702_100159897 3300005615 Bacteria 1455
133 Ga0068852_100000094 3300005616 Bacteria 59653
134 Ga0068852_100046949 3300005616 Bacteria 3682
135 Ga0068852_100383203 3300005616 Bacteria 1380
136 Ga0068852_100569808 3300005616 Bacteria 1134
137 Ga0068859_100205860 3300005617 Bacteria 2053
138 Ga0068859_100563043 3300005617 Bacteria 1234
139 Ga0068864_100000031 3300005618 Bacteria 215331
140 Ga0068864_100311207 3300005618 Bacteria 1476
141 Ga0068866_10000003 3300005718 Bacteria 281675
142 Ga0068866_10000389 3300005718 Bacteria 20645
143 Ga0068866_10094595 3300005718 Bacteria 1635
144 Ga0068861_100002823 3300005719 Bacteria 11419
145 Ga0068861_100089830 3300005719 Bacteria 2422
146 Ga0068851_10000339 3300005834 Bacteria 21112
147 Ga0068851_10010203 3300005834 Bacteria 4379
148 Ga0068863_100000170 3300005841 Bacteria 70180
149 Ga0068863_100007521 3300005841 Bacteria 10655
150 Ga0068863_100075609 3300005841 Bacteria 3187
151 Ga0068858_100000069 3300005842 Bacteria 105617
152 Ga0068858_100001457 3300005842 Bacteria 24338
153 Ga0068858_100108226 3300005842 Bacteria 2595
154 Ga0068860_100174128 3300005843 Bacteria 2079
155 Ga0068862_100001642 3300005844 Bacteria 20337
156 Ga0081455_10007837 3300005937 Bacteria 11182
157 Ga0081455_10012576 3300005937 Bacteria 8440
158 Ga0081455_10025676 3300005937 Bacteria 5433
159 Ga0081455_10034998 3300005937 Bacteria 4494
160 Ga0081455_10085414 3300005937 Bacteria 2573
161 Ga0081455_10089357 3300005937 Bacteria 2500
162 Ga0081455_10114109 3300005937 Bacteria 2141
163 Ga0081538_10000035 3300005981 Bacteria 120009
164 Ga0081538_10000103 3300005981 Bacteria 83685
165 Ga0081538_10000386 3300005981 Bacteria 50093
166 Ga0081538_10000909 3300005981 Bacteria 31949
167 Ga0081538_10001446 3300005981 Bacteria 24414
168 Ga0081538_10002436 3300005981 Bacteria 18209
169 Ga0081538_10005326 3300005981 Bacteria 11582
170 Ga0081538_10008613 3300005981 Bacteria 8630
171 Ga0081538_10012736 3300005981 Bacteria 6718
172 Ga0081538_10042930 3300005981 Bacteria 2846
173 Ga0081538_10050023 3300005981 Bacteria 2529
174 Ga0081538_10081679 3300005981 Bacteria 1718
175 Ga0081540_1000265 3300005983 Bacteria 55107
176 Ga0081540_1000554 3300005983 Bacteria 36225
177 Ga0081540_1000650 3300005983 Bacteria 32779
178 Ga0081540_1073886 3300005983 Bacteria 1565
179 Ga0081539_10003820 3300005985 Bacteria 17708
180 Ga0081539_10010669 3300005985 Bacteria 7412
181 Ga0081539_10016831 3300005985 Bacteria 5186
182 Ga0081539_10035589 3300005985 Bacteria 2989
183 Ga0081539_10057279 3300005985 Bacteria 2158
184 Ga0081539_10116686 3300005985 Bacteria 1333
185 Ga0070717_10002035 3300006028 Bacteria 14160
186 Ga0070717_10067208 3300006028 Bacteria 2982
187 Ga0070717_10153196 3300006028 Bacteria 1996
188 Ga0075365_10017279 3300006038 Bacteria 4410
189 Ga0075365_10018927 3300006038 Bacteria 4241
190 Ga0075365_10042336 3300006038 Bacteria 2977
191 Ga0075365_10058623 3300006038 Bacteria 2564
192 Ga0075365_10157485 3300006038 Bacteria 1581
193 Ga0075365_10273791 3300006038 Bacteria 1187
194 Ga0075363_100066793 3300006048 Bacteria 1947
195 Ga0075363_100081554 3300006048 Bacteria 1770
196 Ga0075363_100084439 3300006048 Bacteria 1741
197 Ga0075364_10035244 3300006051 Bacteria 3233
198 Ga0070715_10000001 3300006163 Bacteria 693690
199 Ga0070716_100039133 3300006173 Bacteria 2630
200 Ga0070716_100084330 3300006173 Bacteria 1905
201 Ga0070712_100000002 3300006175 Bacteria 288475
202 Ga0070712_100002700 3300006175 Bacteria 10958
203 Ga0070712_100005751 3300006175 Bacteria 7665
204 Ga0070712_100012205 3300006175 Bacteria 5461
205 Ga0097621_100045919 3300006237 Bacteria 3531
206 Ga0075428_100008397 3300006844 Bacteria 11449
207 Ga0075428_100015609 3300006844 Bacteria 8419
208 Ga0075428_100053326 3300006844 Bacteria 4430
209 Ga0075428_100093527 3300006844 Bacteria 3278
210 Ga0075428_100156573 3300006844 Bacteria 2475
211 Ga0075430_100002217 3300006846 Bacteria 16112
212 Ga0075430_100004849 3300006846 Bacteria 11317
213 Ga0075430_100103456 3300006846 Bacteria 2377
214 Ga0075431_100031776 3300006847 Bacteria 5438
215 Ga0075431_100037352 3300006847 Bacteria 5004
216 Ga0075431_100076092 3300006847 Bacteria 3464
217 Ga0075431_100233256 3300006847 Bacteria 1874
218 Ga0075433_10000556 3300006852 Bacteria 24597
219 Ga0075433_10031897 3300006852 Bacteria 4508
220 Ga0075433_10107486 3300006852 Bacteria 2474
221 Ga0075434_100008022 3300006871 Bacteria 9785
222 Ga0075434_100020344 3300006871 Bacteria 6436
223 Ga0075434_100092872 3300006871 Bacteria 3020
224 Ga0075434_100245894 3300006871 Bacteria 1808
225 Ga0075434_100446095 3300006871 Bacteria 1315
226 Ga0075429_100023593 3300006880 Bacteria 5339
227 Ga0075429_100227752 3300006880 Bacteria 1633
228 Ga0068865_100000034 3300006881 Bacteria 84043
229 Ga0068865_100047443 3300006881 Bacteria 2951
230 Ga0068865_100120979 3300006881 Bacteria 1946
231 Ga0075436_100057057 3300006914 Bacteria 2697
232 Ga0075436_100097051 3300006914 Bacteria 2050
233 Ga0075436_100140264 3300006914 Bacteria 1698
234 Ga0097620_100205850 3300006931 Bacteria 2053
235 Ga0097620_100563100 3300006931 Bacteria 1234
236 Ga0075435_100029836 3300007076 Bacteria 4283
237 Ga0075435_100037672 3300007076 Bacteria 3851
238 Ga0105240_10003665 3300009093 Bacteria 23758
239 Ga0105240_10036442 3300009093 Bacteria 6327
240 Ga0111539_10050403 3300009094 Bacteria 4959
241 Ga0111539_10052407 3300009094 Bacteria 4857
242 Ga0111539_10479514 3300009094 Bacteria 1449
243 Ga0105245_10000135 3300009098 Bacteria 70480
244 Ga0105245_10002293 3300009098 Bacteria 17319
245 Ga0105245_10011852 3300009098 Bacteria 7585
246 Ga0105245_10015606 3300009098 Bacteria 6625
247 Ga0105245_10024710 3300009098 Bacteria 5278
248 Ga0105245_10065785 3300009098 Bacteria 3279
249 Ga0105245_10320307 3300009098 Bacteria 1527
250 Ga0105247_10000892 3300009101 Bacteria 22478
251 Ga0114129_10000229 3300009147 Bacteria 62652
252 Ga0114129_10023002 3300009147 Bacteria 8842
253 Ga0114129_10036577 3300009147 Bacteria 6932
254 Ga0114129_10488803 3300009147 Bacteria 1609
255 Ga0114129_10769486 3300009147 Bacteria 1231
256 Ga0105243_10040129 3300009148 Bacteria 3654
257 Ga0105243_10312181 3300009148 Bacteria 1429
258 Ga0105243_10440617 3300009148 Bacteria 1220
259 Ga0105242_10000473 3300009176 Bacteria 31915
260 Ga0105242_10005668 3300009176 Bacteria 9637
261 Ga0105242_10059700 3300009176 Bacteria 3130
262 Ga0105242_10137492 3300009176 Bacteria 2116
263 Ga0105248_10000008 3300009177 Bacteria 403910
264 Ga0105248_10073668 3300009177 Bacteria 3838
265 Ga0105248_10128056 3300009177 Bacteria 2864
266 Ga0105248_10372090 3300009177 Bacteria 1608
267 Ga0105237_10001714 3300009545 Bacteria 28350
268 Ga0105238_10000009 3300009551 Bacteria 288729
269 Ga0105238_10231600 3300009551 Bacteria 1824
270 Ga0105249_10000050 3300009553 Bacteria 169617
271 Ga0105249_10004662 3300009553 Bacteria 11840
272 Ga0105249_10052691 3300009553 Bacteria 3717
273 Ga0105249_10089249 3300009553 Bacteria 2880
274 Ga0105249_10315720 3300009553 Bacteria 1572
275 Ga0105239_10004095 3300010375 Bacteria 17531
276 Ga0105239_10072024 3300010375 Bacteria 3798
277 Ga0105239_10172957 3300010375 Bacteria 2416
278 Ga0105246_10148592 3300011119 Bacteria 1771
279 Ga0105246_10179186 3300011119 Bacteria 1630
280 Ga0157371_10002052 3300013102 Bacteria 19848
281 Ga0157370_10008177 3300013104 Bacteria 11308
282 Ga0157370_10036245 3300013104 Bacteria 4788
283 Ga0157370_10077456 3300013104 Bacteria 3132
284 Ga0157369_10000020 3300013105 Bacteria 241679
285 Ga0157374_10010688 3300013296 Bacteria 7907
286 Ga0157374_10015151 3300013296 Bacteria 6761
287 Ga0163162_10072950 3300013306 Bacteria 3487
288 Ga0163162_10334238 3300013306 Bacteria 1647
289 Ga0163162_10459077 3300013306 Bacteria 1405
290 Ga0157372_10000610 3300013307 Bacteria 39073
291 Ga0157372_10186378 3300013307 Bacteria 2403
292 Ga0157372_10235069 3300013307 Bacteria 2125
293 Ga0157375_10000236 3300013308 Bacteria 51196
294 Ga0157375_10002341 3300013308 Bacteria 16367
295 Ga0157375_10157415 3300013308 Bacteria 2411
296 Ga0157375_10520165 3300013308 Bacteria 1353
297 Ga0163163_10066087 3300014325 Bacteria 3591
298 Ga0163163_10096176 3300014325 Bacteria 2982
299 Ga0163163_10168575 3300014325 Bacteria 2236
300 Ga0157380_10000167 3300014326 Bacteria 37815
301 Ga0157380_10000179 3300014326 Bacteria 36685
302 Ga0157377_10001774 3300014745 Bacteria 9412
303 Ga0157379_10015709 3300014968 Bacteria 6653
304 Ga0157379_10225573 3300014968 Bacteria 1698
305 Ga0157376_10041111 3300014969 Bacteria 3783
306 Ga0157376_10054029 3300014969 Bacteria 3347
307 Ga0163161_10000021 3300017792 Bacteria 208779
308 Ga0163161_10336924 3300017792 Bacteria 1196
309 Ga0206356_10475672 3300020070 Bacteria 1993
310 Ga0213876_10016626 3300021384 Bacteria 3887
311 Ga0213876_10039275 3300021384 Bacteria 2500
312 Ga0213876_10049019 3300021384 Bacteria 2231
313 Ga0213876_10099757 3300021384 Bacteria 1539
314 Ga0207656_10000124 3300025321 Bacteria 29553
315 Ga0207656_10039829 3300025321 Bacteria 1990
316 Ga0207653_10074537 3300025885 Bacteria 1165
317 Ga0207682_10000045 3300025893 Bacteria 51744
318 Ga0207692_10048285 3300025898 Bacteria 2142
319 Ga0207692_10115645 3300025898 Bacteria 1495
320 Ga0207642_10000002 3300025899 Bacteria 658166
321 Ga0207642_10000238 3300025899 Bacteria 16455
322 Ga0207642_10101382 3300025899 Bacteria 1446
323 Ga0207710_10000548 3300025900 Bacteria 22601
324 Ga0207710_10048481 3300025900 Bacteria 1901
325 Ga0207688_10003516 3300025901 Bacteria 8553
326 Ga0207688_10012330 3300025901 Bacteria 4652
327 Ga0207688_10131569 3300025901 Bacteria 1467
328 Ga0207688_10137918 3300025901 Bacteria 1434
329 Ga0207685_10000005 3300025905 Bacteria 289944
330 Ga0207645_10163847 3300025907 Bacteria 1455
331 Ga0207643_10077699 3300025908 Bacteria 1919
332 Ga0207684_10001611 3300025910 Bacteria 23952
333 Ga0207707_10041141 3300025912 Bacteria 4036
334 Ga0207707_10229762 3300025912 Bacteria 1614
335 Ga0207695_10005035 3300025913 Bacteria 17747
336 Ga0207695_10006218 3300025913 Bacteria 15545
337 Ga0207671_10001437 3300025914 Bacteria 27616
338 Ga0207671_10123230 3300025914 Bacteria 1983
339 Ga0207693_10000014 3300025915 Bacteria 148984
340 Ga0207693_10008348 3300025915 Bacteria 8476
341 Ga0207693_10014178 3300025915 Bacteria 6417
342 Ga0207693_10016044 3300025915 Bacteria 5995
343 Ga0207693_10142350 3300025915 Bacteria 1885
344 Ga0207663_10004337 3300025916 Bacteria 7042
345 Ga0207663_10012244 3300025916 Bacteria 4631
346 Ga0207663_10028817 3300025916 Bacteria 3254
347 Ga0207663_10084925 3300025916 Bacteria 2083
348 Ga0207663_10115862 3300025916 Bacteria 1826
349 Ga0207663_10243367 3300025916 Bacteria 1320
350 Ga0207662_10072934 3300025918 Bacteria 2082
351 Ga0207657_10124941 3300025919 Bacteria 2114
352 Ga0207657_10254047 3300025919 Bacteria 1400
353 Ga0207649_10000009 3300025920 Bacteria 295544
354 Ga0207652_10001906 3300025921 Bacteria 18072
355 Ga0207652_10023036 3300025921 Bacteria 5158
356 Ga0207646_10057050 3300025922 Bacteria 3489
357 Ga0207694_10000004 3300025924 Bacteria 967075
358 Ga0207659_10000033 3300025926 Bacteria 113729
359 Ga0207659_10151820 3300025926 Bacteria 1809
360 Ga0207687_10000007 3300025927 Bacteria 604185
361 Ga0207687_10000013 3300025927 Bacteria 299826
362 Ga0207687_10015729 3300025927 Bacteria 4965
363 Ga0207687_10022929 3300025927 Bacteria 4157
364 Ga0207687_10116589 3300025927 Bacteria 1991
365 Ga0207700_10000007 3300025928 Bacteria 345720
366 Ga0207700_10038669 3300025928 Bacteria 3465
367 Ga0207700_10234380 3300025928 Bacteria 1562
368 Ga0207664_10000006 3300025929 Bacteria 408702
369 Ga0207664_10012727 3300025929 Bacteria 6021
370 Ga0207664_10030907 3300025929 Bacteria 4093
371 Ga0207664_10071622 3300025929 Bacteria 2793
372 Ga0207664_10090856 3300025929 Bacteria 2503
373 Ga0207664_10359207 3300025929 Bacteria 1290
374 Ga0207690_10012005 3300025932 Bacteria 5180
375 Ga0207690_10053536 3300025932 Bacteria 2708
376 Ga0207690_10072124 3300025932 Bacteria 2384
377 Ga0207690_10092269 3300025932 Bacteria 2142
378 Ga0207690_10104340 3300025932 Bacteria 2031
379 Ga0207690_10112246 3300025932 Bacteria 1965
380 Ga0207690_10226983 3300025932 Bacteria 1432
381 Ga0207706_10000001 3300025933 Bacteria 423014
382 Ga0207706_10001715 3300025933 Bacteria 21601
383 Ga0207706_10165567 3300025933 Bacteria 1943
384 Ga0207686_10000300 3300025934 Bacteria 36083
385 Ga0207686_10000644 3300025934 Bacteria 21471
386 Ga0207670_10021953 3300025936 Bacteria 3946
387 Ga0207669_10000001 3300025937 Bacteria 377747
388 Ga0207669_10000006 3300025937 Bacteria 176348
389 Ga0207669_10059794 3300025937 Bacteria 2333
390 Ga0207669_10158095 3300025937 Bacteria 1597
391 Ga0207669_10163373 3300025937 Bacteria 1576
392 Ga0207704_10000059 3300025938 Bacteria 76643
393 Ga0207704_10031608 3300025938 Bacteria 2985
394 Ga0207704_10032887 3300025938 Bacteria 2942
395 Ga0207665_10056858 3300025939 Bacteria 2642
396 Ga0207691_10000934 3300025940 Bacteria 28991
397 Ga0207711_10000006 3300025941 Bacteria 792692
398 Ga0207711_10057858 3300025941 Bacteria 3333
399 Ga0207689_10113518 3300025942 Bacteria 2227
400 Ga0207689_10208465 3300025942 Bacteria 1614
401 Ga0207661_10000707 3300025944 Bacteria 21658
402 Ga0207661_10012761 3300025944 Bacteria 6121
403 Ga0207661_10109553 3300025944 Bacteria 2333
404 Ga0207661_10254744 3300025944 Bacteria 1561
405 Ga0207661_10255974 3300025944 Bacteria 1558
406 Ga0207661_10391491 3300025944 Bacteria 1259
407 Ga0207679_10007996 3300025945 Bacteria 6725
408 Ga0207679_10009512 3300025945 Bacteria 6231
409 Ga0207679_10061831 3300025945 Bacteria 2789
410 Ga0207667_10043085 3300025949 Bacteria 4791
411 Ga0207667_10452247 3300025949 Bacteria 1305
412 Ga0207651_10014173 3300025960 Bacteria 4594
413 Ga0207712_10000019 3300025961 Bacteria 317060
414 Ga0207712_10061889 3300025961 Bacteria 2658
415 Ga0207712_10063009 3300025961 Bacteria 2638
416 Ga0207712_10366304 3300025961 Bacteria 1202
417 Ga0207668_10002210 3300025972 Bacteria 11349
418 Ga0207668_10011009 3300025972 Bacteria 5485
419 Ga0207668_10188129 3300025972 Bacteria 1634
420 Ga0207640_10000151 3300025981 Bacteria 50644
421 Ga0207640_10005821 3300025981 Bacteria 6722
422 Ga0207640_10043408 3300025981 Bacteria 2873
423 Ga0207658_10000506 3300025986 Bacteria 35648
424 Ga0207658_10139099 3300025986 Bacteria 1962
425 Ga0207677_10000106 3300026023 Bacteria 68108
426 Ga0207677_10001102 3300026023 Bacteria 14732
427 Ga0207677_10024474 3300026023 Bacteria 3752
428 Ga0207677_10028342 3300026023 Bacteria 3539
429 Ga0207677_10317993 3300026023 Bacteria 1292
430 Ga0207703_10000078 3300026035 Bacteria 115634
431 Ga0207703_10000257 3300026035 Bacteria 59688
432 Ga0207639_10000747 3300026041 Bacteria 22193
433 Ga0207639_10197162 3300026041 Bacteria 1724
434 Ga0207639_10302852 3300026041 Bacteria 1413
435 Ga0207678_10024623 3300026067 Bacteria 5257
436 Ga0207678_10196534 3300026067 Bacteria 1724
437 Ga0207678_10239182 3300026067 Bacteria 1555
438 Ga0207708_10001166 3300026075 Bacteria 19795
439 Ga0207708_10001883 3300026075 Bacteria 15485
440 Ga0207708_10019391 3300026075 Bacteria 5126
441 Ga0207708_10099467 3300026075 Bacteria 2250
442 Ga0207702_10000360 3300026078 Bacteria 52006
443 Ga0207702_10003603 3300026078 Bacteria 14075
444 Ga0207702_10019703 3300026078 Bacteria 5585
445 Ga0207702_10140831 3300026078 Bacteria 2182
446 Ga0207641_10000301 3300026088 Bacteria 61780
447 Ga0207641_10010509 3300026088 Bacteria 7598
448 Ga0207641_10035210 3300026088 Bacteria 4170
449 Ga0207648_10017132 3300026089 Bacteria 6603
450 Ga0207676_10000031 3300026095 Bacteria 215877
451 Ga0207676_10217897 3300026095 Bacteria 1698
452 Ga0207674_10021899 3300026116 Bacteria 6876
453 Ga0207674_10051341 3300026116 Bacteria 4209
454 Ga0207675_100000091 3300026118 Bacteria 70559
455 Ga0207675_100038624 3300026118 Bacteria 4455
456 Ga0207683_10027531 3300026121 Bacteria 4912
457 Ga0207683_10039055 3300026121 Bacteria 4140
458 Ga0207683_10093205 3300026121 Bacteria 2684
459 Ga0207683_10369127 3300026121 Bacteria 1318
460 Ga0207698_10000013 3300026142 Bacteria 255414
461 Ga0207698_10052769 3300026142 Bacteria 3117
462 Ga0207698_10589241 3300026142 Bacteria 1095
463 Ga0207428_10020740 3300027907 Bacteria 5574
464 Ga0268266_10000045 3300028379 Bacteria 312955
465 Ga0268266_10001143 3300028379 Bacteria 32951
466 Ga0268266_10120741 3300028379 Bacteria 2332
467 Ga0268265_10005906 3300028380 Bacteria 8341
468 Ga0268264_10255537 3300028381 Bacteria 1630
469 Ga0268264_10376295 3300028381 Bacteria 1359
470 Ga0265337_1000006 3300028556 Bacteria 99562
471 Ga0265337_1003682 3300028556 Bacteria 6561
472 Ga0265337_1020390 3300028556 Bacteria 2077
473 Ga0265326_10000066 3300028558 Bacteria 59893
474 Ga0265326_10004289 3300028558 Bacteria 4582
475 Ga0265319_1000073 3300028563 Bacteria 81138
476 Ga0265319_1000323 3300028563 Bacteria 35477
477 Ga0265319_1001236 3300028563 Bacteria 15700
478 Ga0265318_10000650 3300028577 Bacteria 23762
479 Ga0265318_10015071 3300028577 Bacteria 3227
480 Ga0265322_10000001 3300028654 Bacteria 543854
481 Ga0265322_10004940 3300028654 Bacteria 3956
482 Ga0265336_10000002 3300028666 Bacteria 830172
483 Ga0265336_10002244 3300028666 Bacteria 8097
484 Ga0265338_10000001 3300028800 Bacteria 1177449
485 Ga0265338_10002303 3300028800 Bacteria 29010
486 Ga0265338_10005918 3300028800 Bacteria 15760
487 Ga0265338_10012258 3300028800 Bacteria 9789
488 Ga0265338_10086363 3300028800 Bacteria 2611
489 Ga0265324_10000563 3300029957 Bacteria 25385
490 Ga0265324_10001753 3300029957 Bacteria 11934
491 Ga0265320_10000002 3300031240 Bacteria 542875
492 Ga0265320_10018765 3300031240 Bacteria 3799
493 Ga0265320_10103011 3300031240 Bacteria 1313
494 Ga0265325_10006312 3300031241 Bacteria 7213
495 Ga0265329_10003034 3300031242 Bacteria 7455
496 Ga0265340_10000001 3300031247 Bacteria 1647668
497 Ga0265339_10011892 3300031249 Bacteria 5337
498 Ga0265339_10019994 3300031249 Bacteria 3919
499 Ga0265331_10003440 3300031250 Bacteria 10239
500 Ga0265327_10000011 3300031251 Bacteria 543807
501 Ga0265327_10001436 3300031251 Bacteria 30052
502 Ga0265327_10002767 3300031251 Bacteria 17760
503 Ga0265316_10008459 3300031344 Bacteria 9545
504 Ga0265316_10014142 3300031344 Bacteria 7040
505 Ga0265314_10000726 3300031711 Bacteria 39827
506 Ga0307405_10035033 3300031731 Bacteria 2994
507 Ga0307405_10150056 3300031731 Bacteria 1638
508 Ga0307413_10036602 3300031824 Bacteria 2827
509 Ga0307413_10102556 3300031824 Bacteria 1894
510 Ga0307413_10229887 3300031824 Bacteria 1361
511 Ga0307410_10015552 3300031852 Bacteria 4517
512 Ga0307410_10153873 3300031852 Bacteria 1715
513 Ga0307410_10218850 3300031852 Bacteria 1464
514 Ga0307406_10009961 3300031901 Bacteria 5346
515 Ga0307406_10024976 3300031901 Bacteria 3573
516 Ga0307406_10029141 3300031901 Bacteria 3341
517 Ga0307406_10136958 3300031901 Bacteria 1727
518 Ga0307406_10230666 3300031901 Bacteria 1382
519 Ga0307406_10301037 3300031901 Bacteria 1232
520 Ga0307406_10337463 3300031901 Bacteria 1173
521 Ga0307406_10346300 3300031901 Bacteria 1159
522 Ga0307407_10014776 3300031903 Bacteria 3835
523 Ga0307407_10030563 3300031903 Bacteria 2907
524 Ga0307407_10070539 3300031903 Bacteria 2077
525 Ga0307409_100045253 3300031995 Bacteria 3321
526 Ga0307409_100047478 3300031995 Bacteria 3259
527 Ga0307409_100089555 3300031995 Bacteria 2516
528 Ga0307409_100099139 3300031995 Bacteria 2412
529 Ga0307409_100147053 3300031995 Bacteria 2039
530 Ga0307409_100181402 3300031995 Bacteria 1864
531 Ga0307416_100052310 3300032002 Bacteria 3269
532 Ga0307416_100056695 3300032002 Bacteria 3164
533 Ga0307416_100089091 3300032002 Bacteria 2641
534 Ga0307416_100092075 3300032002 Bacteria 2606
535 Ga0307416_100402665 3300032002 Bacteria 1406
536 Ga0307416_100423565 3300032002 Bacteria 1376
537 Ga0307416_100451090 3300032002 Bacteria 1339
538 Ga0307411_10019425 3300032005 Bacteria 3926
539 Ga0307411_10143917 3300032005 Bacteria 1762
540 Ga0307415_100027638 3300032126 Bacteria 3597
541 Ga0307415_100029921 3300032126 Bacteria 3487
542 Ga0307415_100038515 3300032126 Bacteria 3152
543 Ga0307415_100199266 3300032126 Bacteria 1587
544 Ga0307415_100219967 3300032126 Bacteria 1522
545 Ga0307415_100242214 3300032126 Bacteria 1459
546 Ga0307415_100383258 3300032126 Bacteria 1194
547 Ga0373930_0023452 3300034816 Bacteria 1227
548 Ga0373957_0070803 3300035120 Bacteria 1364
549 Ga0373960_0002815 3300035121 Bacteria 3939
550 Ga0373931_0028618 3300035691 Bacteria 2855
551 Ga0373937_0039385 3300036401 Bacteria 4307
552 Ga0395899_0020250 3300037312 Bacteria 5048
553 Ga0395899_0020569 3300037312 Bacteria 5002
554 Ga0395899_0026257 3300037312 Bacteria 4395
555 Ga0395899_0058634 3300037312 Bacteria 2839
556 Ga0395900_0019376 3300037418 Bacteria 6939
557 Ga0395900_0046056 3300037418 Bacteria 4491
558 Ga0395900_0077025 3300037418 Bacteria 3426
559 Ga0395900_0166368 3300037418 Bacteria 2247
560 Ga0395900_0205142 3300037418 Bacteria 1992
561 Ga0395900_0382200 3300037418 Bacteria 1376
562 Ga0395900_0435928 3300037418 Bacteria 1269
563 Ga0395898_0002543 3300037466 Bacteria 21393
564 Ga0395898_0003141 3300037466 Bacteria 18655
565 Ga0395898_0006287 3300037466 Bacteria 12695
566 Ga0395898_0063887 3300037466 Bacteria 3572
567 Ga0395898_0067934 3300037466 Bacteria 3450
568 Ga0395898_0122780 3300037466 Bacteria 2489
569 Ga0395898_0201989 3300037466 Bacteria 1897
570 Ga0395898_0288586 3300037466 Bacteria 1565
571 Ga0395898_0293825 3300037466 Bacteria 1550
572 Ga0395898_0402724 3300037466 Bacteria 1305
573 Ga0395905_0006210 3300037471 Bacteria 12058
574 Ga0395905_0019433 3300037471 Bacteria 6441
575 Ga0395905_0021115 3300037471 Bacteria 6165
576 Ga0395905_0170345 3300037471 Bacteria 2045
577 Ga0436364_0240449 3300037853 Bacteria 25321
578 Ga0436364_0815220 3300037853 Bacteria 1715
579 Ga0436364_1477052 3300037853 Bacteria 18241
580 Ga0395901_0005774 3300038443 Bacteria 12531
581 Ga0395901_0023382 3300038443 Bacteria 6334
582 Ga0395901_0023591 3300038443 Bacteria 6307
583 Ga0395901_0064733 3300038443 Bacteria 3806
584 Ga0395901_0100570 3300038443 Bacteria 3033
585 Ga0395901_0278375 3300038443 Bacteria 1739
586 Ga0395901_0369543 3300038443 Bacteria 1477
587 Ga0436365_0000795 3300039437 Bacteria 3798
588 Ga0436365_0378539 3300039437 Bacteria 21711
589 Ga0436365_0807310 3300039437 Bacteria 5094
590 Ga0436365_1395668 3300039437 Bacteria 2872
591 Ga0436365_1487643 3300039437 Bacteria 7653
592 Ga0436365_1549123 3300039437 Bacteria 9132
593 Ga0436363_0805533 3300039450 Bacteria 51825
594 Ga0436362_0170227 3300039453 Bacteria 1492
595 Ga0436362_0570716 3300039453 Bacteria 2239
596 Ga0436362_0857091 3300039453 Bacteria 3844
597 Ga0436362_1078989 3300039453 Bacteria 2184
598 Ga0436362_1091830 3300039453 Bacteria 1753
599 Ga0436362_1156991 3300039453 Bacteria 1073
600 Ga0451833_0087528 3300041491 Bacteria 1953
601 Ga0451853_1497798 3300041512 Bacteria 2824
602 Ga0439450_021683 3300042008 Bacteria 1381
603 Ga0439440_0002839 3300042993 Bacteria 3293
604 Ga0466966_0141494 3300044684 Bacteria 1470
605 Ga0466961_0008158 3300044693 Bacteria 6671
606 Ga0466961_0011845 3300044693 Bacteria 5574
607 Ga0466961_0065974 3300044693 Bacteria 2300
608 Ga0466961_0224164 3300044693 Bacteria 1158
609 Ga0466963_0000075 3300044694 Bacteria 34739
610 Ga0466963_0003594 3300044694 Bacteria 8913
611 Ga0466963_0007404 3300044694 Bacteria 6541
612 Ga0466963_0011029 3300044694 Bacteria 5494
613 Ga0466963_0014580 3300044694 Bacteria 4850
614 Ga0466963_0027393 3300044694 Bacteria 3649
615 Ga0466963_0077408 3300044694 Bacteria 2247
616 Ga0466971_0007205 3300044719 Bacteria 4843
617 Ga0466971_0062070 3300044719 Bacteria 1691
618 Ga0466968_0030758 3300044735 Bacteria 2225
619 Ga0466968_0086922 3300044735 Bacteria 1380
620 Ga0466970_0035935 3300044765 Bacteria 2624
621 Ga0466970_0104245 3300044765 Bacteria 1546
622 Ga0466957_0003008 3300044842 Bacteria 9152
623 Ga0466957_0014919 3300044842 Bacteria 4532
624 Ga0466957_0032032 3300044842 Bacteria 3146
625 Ga0466957_0045274 3300044842 Bacteria 2669
626 Ga0466957_0122175 3300044842 Bacteria 1661
627 Ga0466960_0019437 3300044901 Bacteria 2994
628 Ga0466960_0035547 3300044901 Bacteria 2329
629 Ga0466960_0049897 3300044901 Bacteria 2016
630 Ga0466959_0000352 3300045049 Bacteria 27249
631 Ga0466959_0039628 3300045049 Bacteria 3482
632 Ga0466959_0041894 3300045049 Bacteria 3379
633 Ga0466959_0042350 3300045049 Bacteria 3359
634 Ga0466959_0047397 3300045049 Bacteria 3161
635 Ga0466959_0110195 3300045049 Bacteria 1965
636 Ga0466959_0176315 3300045049 Bacteria 1497
637 Ga0466958_0000550 3300045836 Bacteria 15964
638 Ga0466958_0003128 3300045836 Bacteria 8514
639 Ga0466958_0005509 3300045836 Bacteria 6828
640 Ga0466958_0100493 3300045836 Bacteria 1798
641 Ga0466967_0000019 3300045976 Bacteria 79629
642 Ga0466967_0000217 3300045976 Bacteria 24528
643 Ga0466967_0005609 3300045976 Bacteria 8726
644 Ga0466967_0078341 3300045976 Bacteria 2977
645 Ga0466967_0079502 3300045976 Bacteria 2956
646 Ga0466967_0092564 3300045976 Bacteria 2749
647 Ga0466967_0102252 3300045976 Bacteria 2621
648 Ga0466967_0129745 3300045976 Bacteria 2339
649 Ga0466967_0155266 3300045976 Bacteria 2143
650 Ga0466967_0240892 3300045976 Bacteria 1725
651 Ga0495592_0015168 3300046454 Bacteria 5852
652 Ga0495603_0000828 3300046455 Bacteria 17765
653 Ga0495603_0006166 3300046455 Bacteria 7168
654 Ga0495629_0000145 3300046459 Bacteria 61915
655 Ga0495629_0001110 3300046459 Bacteria 21316
656 Ga0495629_0001588 3300046459 Bacteria 17867
657 Ga0495629_0029468 3300046459 Bacteria 3892
658 Ga0495641_0000050 3300046461 Bacteria 73259
659 Ga0495641_0136187 3300046461 Bacteria 1096
660 Ga0495651_0110277 3300046462 Bacteria 2036
661 Ga0495651_0110944 3300046462 Bacteria 2028
662 Ga0495653_0000982 3300046463 Bacteria 21923
663 Ga0495653_0050898 3300046463 Bacteria 3184
664 Ga0495653_0150783 3300046463 Bacteria 1625
665 Ga0495653_0252695 3300046463 Bacteria 1169
666 Ga0495582_0000004 3300046473 Bacteria 168322
667 Ga0495582_0071872 3300046473 Bacteria 1914
668 Ga0495605_0075081 3300046474 Bacteria 1590
669 Ga0495639_0073494 3300046475 Bacteria 1583
670 Ga0495662_0012304 3300046476 Bacteria 4176
671 Ga0495662_0065988 3300046476 Bacteria 1750
672 Ga0495664_0000032 3300046477 Bacteria 85909
673 Ga0495584_0020785 3300046491 Bacteria 3334
674 Ga0495594_0000010 3300046499 Bacteria 118481
675 Ga0495606_0000072 3300046507 Bacteria 173678
676 Ga0495608_0000023 3300046511 Bacteria 160090
677 Ga0495608_0000891 3300046511 Bacteria 20918
678 Ga0495608_0010082 3300046511 Bacteria 6592
679 Ga0495608_0015492 3300046511 Bacteria 5287
680 Ga0495610_0085075 3300046512 Bacteria 1444
681 Ga0495618_0000008 3300046514 Bacteria 204578
682 Ga0495618_0000113 3300046514 Bacteria 59243
683 Ga0495620_0000247 3300046515 Bacteria 40394
684 Ga0495628_0000165 3300046516 Bacteria 57669
685 Ga0495628_0001530 3300046516 Bacteria 21206
686 Ga0495628_0065563 3300046516 Bacteria 2840
687 Ga0495628_0116689 3300046516 Bacteria 2050
688 Ga0495630_0000012 3300046517 Bacteria 223330
689 Ga0495630_0000145 3300046517 Bacteria 54974
690 Ga0495630_0009696 3300046517 Bacteria 6925
691 Ga0495630_0029400 3300046517 Bacteria 4086
692 Ga0495630_0041247 3300046517 Bacteria 3446
693 Ga0495630_0233502 3300046517 Bacteria 1405
694 Ga0495644_0000902 3300046523 Bacteria 12289
695 Ga0495644_0001127 3300046523 Bacteria 10971
696 Ga0495652_0000346 3300046529 Bacteria 55138
697 Ga0495652_0013007 3300046529 Bacteria 7501
698 Ga0495652_0152823 3300046529 Bacteria 1801
699 Ga0495665_0208760 3300046531 Bacteria 1011
700 Ga0495586_0008489 3300046535 Bacteria 5466
701 Ga0495587_0005182 3300046536 Bacteria 8519
702 Ga0495645_0000021 3300046543 Bacteria 137604
703 Ga0495645_0001238 3300046543 Bacteria 17431
704 Ga0495645_0040166 3300046543 Bacteria 3413
705 Ga0495622_0000104 3300046557 Bacteria 73828
706 Ga0495633_0118090 3300046558 Bacteria 1229
707 Ga0495667_0000047 3300046559 Bacteria 117718
708 Ga0495667_0089911 3300046559 Bacteria 1990
709 Ga0495667_0119247 3300046559 Bacteria 1704
710 Ga0495667_0120399 3300046559 Bacteria 1695
711 Ga0495656_0001137 3300046615 Bacteria 8646
712 Ga0495656_0034837 3300046615 Bacteria 2064
713 Ga0495634_0000034 3300046642 Bacteria 106338
714 Ga0495634_0005892 3300046642 Bacteria 9363
715 Ga0495634_0005924 3300046642 Bacteria 9338
716 Ga0495634_0048539 3300046642 Bacteria 2858
717 Ga0495625_0001243 3300046660 Bacteria 32172
718 Ga0495635_0000034 3300046663 Bacteria 96408
719 Ga0495635_0071907 3300046663 Bacteria 2371
720 Ga0495635_0118943 3300046663 Bacteria 1803
721 Ga0495588_0000422 3300046674 Bacteria 22711
722 Ga0495657_0000013 3300046675 Bacteria 195590
723 Ga0495657_0000020 3300046675 Bacteria 160089
724 Ga0495657_0026853 3300046675 Bacteria 4072
725 Ga0495657_0049342 3300046675 Bacteria 2836
726 Ga0495599_0038243 3300046678 Bacteria 3015
727 Ga0495599_0149180 3300046678 Bacteria 1449
728 Ga0495646_0025126 3300046680 Bacteria 3748
729 Ga0495647_0001315 3300046681 Bacteria 7645
730 Ga0495647_0018848 3300046681 Bacteria 2463
731 Ga0495658_0000004 3300046683 Bacteria 173598
732 Ga0495658_0014050 3300046683 Bacteria 4082
733 Ga0495658_0030299 3300046683 Bacteria 2937
734 Ga0495658_0125692 3300046683 Bacteria 1556
735 Ga0495669_0000030 3300046684 Bacteria 102988
736 Ga0495613_0000251 3300046689 Bacteria 50730
737 Ga0495613_0000850 3300046689 Bacteria 23420
738 Ga0495624_0007692 3300046690 Bacteria 7559
739 Ga0495624_0052824 3300046690 Bacteria 2567
740 Ga0495624_0060732 3300046690 Bacteria 2369
741 Ga0495600_0014884 3300046809 Bacteria 4909
742 Ga0495600_0047292 3300046809 Bacteria 2806
743 Ga0495604_0000071 3300047317 Bacteria 89185
744 Ga0495604_0000106 3300047317 Bacteria 69765
745 Ga0495604_0000158 3300047317 Bacteria 59386
746 Ga0495604_0011719 3300047317 Bacteria 6972
747 Ga0495604_0037209 3300047317 Bacteria 3834
748 Ga0495674_0000019 3300047319 Bacteria 185107
749 Ga0495672_0005626 3300047320 Bacteria 9889
750 Ga0495672_0029855 3300047320 Bacteria 3427
751 Ga0495676_0001265 3300047321 Bacteria 21690
752 Ga0495676_0010845 3300047321 Bacteria 8242
753 Ga0495676_0010945 3300047321 Bacteria 8200
754 Ga0495676_0057767 3300047321 Bacteria 3057
755 Ga0495680_0000569 3300047322 Bacteria 41472
756 Ga0495680_0002644 3300047322 Bacteria 18142
757 Ga0495680_0003506 3300047322 Bacteria 15387
758 Ga0495675_0000561 3300047444 Bacteria 23982
759 Ga0495685_015775 3300047447 Bacteria 2580
760 Ga0495673_0007713 3300047469 Bacteria 6145
761 Ga0495684_0006606 3300047471 Bacteria 8994
762 Ga0495684_0119730 3300047471 Bacteria 1984
763 Ga0495686_0002378 3300047472 Bacteria 17896
764 Ga0495686_0047528 3300047472 Bacteria 2709
765 Ga0495686_0198100 3300047472 Bacteria 1154
766 Ga0495602_0000142 3300048088 Bacteria 66941
767 Ga0495602_0013667 3300048088 Bacteria 8283
768 Ga0495602_0102358 3300048088 Bacteria 2347
769 Ga0496100_0000005 3300048903 Bacteria 312112
770 Ga0496100_0000010 3300048903 Bacteria 205204
771 Ga0496100_0000156 3300048903 Bacteria 38167
772 Ga0496100_0013715 3300048903 Bacteria 4685
773 Ga0496100_0036184 3300048903 Bacteria 3111
774 Ga0496100_0119669 3300048903 Bacteria 1840
775 Ga0496100_0343536 3300048903 Bacteria 1126
776 Ga0496101_0000022 3300048904 Bacteria 216728
777 Ga0496101_0000025 3300048904 Bacteria 205204
778 Ga0496101_0016622 3300048904 Bacteria 4976
779 Ga0496101_0047037 3300048904 Bacteria 3096
780 Ga0496101_0117600 3300048904 Bacteria 2007
781 Ga0496101_0224926 3300048904 Bacteria 1457
782 Ga0496101_0257672 3300048904 Bacteria 1360
783 Ga0496101_0268843 3300048904 Bacteria 1331
784 Ga0496101_0301027 3300048904 Bacteria 1256
785 Ga0496102_0000002 3300048905 Bacteria 814588
786 Ga0496102_0000572 3300048905 Bacteria 39087
787 Ga0496102_0010557 3300048905 Bacteria 7953
788 Ga0496102_0014625 3300048905 Bacteria 6822
789 Ga0496102_0029110 3300048905 Bacteria 4939
790 Ga0496102_0033594 3300048905 Bacteria 4610
791 Ga0496102_0163015 3300048905 Bacteria 2097
792 Ga0496102_0202423 3300048905 Bacteria 1871
793 Ga0496102_0324241 3300048905 Bacteria 1451
794 Ga0496103_0000031 3300048906 Bacteria 204016
795 Ga0496103_0000047 3300048906 Bacteria 161130
796 Ga0496103_0001442 3300048906 Bacteria 15951
797 Ga0496103_0085303 3300048906 Bacteria 1990
798 Ga0496103_0144315 3300048906 Bacteria 1523
799 Ga0496103_0199585 3300048906 Bacteria 1286
800 Ga0496103_0238934 3300048906 Bacteria 1169
801 Ga0496104_0000004 3300048907 Bacteria 641830
802 Ga0496104_0000009 3300048907 Bacteria 488055
803 Ga0496104_0000037 3300048907 Bacteria 178518
804 Ga0496104_0001329 3300048907 Bacteria 21349
805 Ga0496104_0004472 3300048907 Bacteria 12180
806 Ga0496104_0042574 3300048907 Bacteria 4262
807 Ga0496104_0058518 3300048907 Bacteria 3648
808 Ga0496104_0192049 3300048907 Bacteria 1954
809 Ga0496105_0000001 3300048908 Bacteria 1328178
810 Ga0496105_0000007 3300048908 Bacteria 339658
811 Ga0496105_0000407 3300048908 Bacteria 28257
812 Ga0496105_0003630 3300048908 Bacteria 11467
813 Ga0496105_0019110 3300048908 Bacteria 5522
814 Ga0496105_0076169 3300048908 Bacteria 2770
815 Ga0496105_0213738 3300048908 Bacteria 1571
816 Ga0496106_0000012 3300048909 Bacteria 205158
817 Ga0496106_0000041 3300048909 Bacteria 107155
818 Ga0496106_0000108 3300048909 Bacteria 64484
819 Ga0496106_0001753 3300048909 Bacteria 16215
820 Ga0496106_0006922 3300048909 Bacteria 8388
821 Ga0496106_0036182 3300048909 Bacteria 3693
822 Ga0496106_0077535 3300048909 Bacteria 2548
823 Ga0496107_0000010 3300048910 Bacteria 205188
824 Ga0496107_0000011 3300048910 Bacteria 201631
825 Ga0496107_0150115 3300048910 Bacteria 1723
826 Ga0496107_0247112 3300048910 Bacteria 1328
827 Ga0496107_0248832 3300048910 Bacteria 1322
828 Ga0496107_0279007 3300048910 Bacteria 1244
829 Ga0496108_0000001 3300048911 Bacteria 919044
830 Ga0496108_0000026 3300048911 Bacteria 172399
831 Ga0496108_0000341 3300048911 Bacteria 39335
832 Ga0496108_0001085 3300048911 Bacteria 21217
833 Ga0496108_0009847 3300048911 Bacteria 7744
834 Ga0496108_0018657 3300048911 Bacteria 5683
835 Ga0496108_0046651 3300048911 Bacteria 3620
836 Ga0496108_0070701 3300048911 Bacteria 2945
837 Ga0496108_0099888 3300048911 Bacteria 2474
838 Ga0496109_0000004 3300048912 Bacteria 404818
839 Ga0496109_0000060 3300048912 Bacteria 115800
840 Ga0496109_0000075 3300048912 Bacteria 105050
841 Ga0496109_0000172 3300048912 Bacteria 64023
842 Ga0496109_0000881 3300048912 Bacteria 25056
843 Ga0496109_0003171 3300048912 Bacteria 13708
844 Ga0496109_0007678 3300048912 Bacteria 9144
845 Ga0496109_0011008 3300048912 Bacteria 7753
846 Ga0496109_0030491 3300048912 Bacteria 4833
847 Ga0496109_0060520 3300048912 Bacteria 3460
848 Ga0496109_0064127 3300048912 Bacteria 3361
849 Ga0496109_0067792 3300048912 Bacteria 3269
850 Ga0496109_0077913 3300048912 Bacteria 3051
851 Ga0496109_0256610 3300048912 Bacteria 1646
852 Ga0496109_0322736 3300048912 Bacteria 1457
853 Ga0496109_0357593 3300048912 Bacteria 1380
854 Ga0496110_0000200 3300048913 Bacteria 38137
855 Ga0496110_0000694 3300048913 Bacteria 23246
856 Ga0496110_0004405 3300048913 Bacteria 10906
857 Ga0496110_0006226 3300048913 Bacteria 9410
858 Ga0496110_0009280 3300048913 Bacteria 7956
859 Ga0496110_0072112 3300048913 Bacteria 3063
860 Ga0496110_0123883 3300048913 Bacteria 2331
861 Ga0496110_0125716 3300048913 Bacteria 2313
862 Ga0496110_0138520 3300048913 Bacteria 2200
863 Ga0496110_0153398 3300048913 Bacteria 2086
864 Ga0496110_0153595 3300048913 Bacteria 2085
865 Ga0496111_0000153 3300048914 Bacteria 30900
866 Ga0496111_0008983 3300048914 Bacteria 6647
867 Ga0496111_0032669 3300048914 Bacteria 3711
868 Ga0496111_0035980 3300048914 Bacteria 3540
869 Ga0496111_0171777 3300048914 Bacteria 1610
870 Ga0496112_0000013 3300048915 Bacteria 237194
871 Ga0496112_0001374 3300048915 Bacteria 18549
872 Ga0496112_0032839 3300048915 Bacteria 5039
873 Ga0496112_0035847 3300048915 Bacteria 4835
874 Ga0496112_0045466 3300048915 Bacteria 4304
875 Ga0496112_0064087 3300048915 Bacteria 3626
876 Ga0496112_0071816 3300048915 Bacteria 3421
877 Ga0496112_0166847 3300048915 Bacteria 2168
878 Ga0496112_0174855 3300048915 Bacteria 2112
879 Ga0496112_0209116 3300048915 Bacteria 1909
880 Ga0496112_0211771 3300048915 Bacteria 1895
881 Ga0496113_0000052 3300048916 Bacteria 49918
882 Ga0496113_0004202 3300048916 Bacteria 8802
883 Ga0496113_0030475 3300048916 Bacteria 3905
884 Ga0496113_0054110 3300048916 Bacteria 3003
885 Ga0496113_0056576 3300048916 Bacteria 2945
886 Ga0496113_0088987 3300048916 Bacteria 2376
887 Ga0496113_0239549 3300048916 Bacteria 1447
888 Ga0496113_0275176 3300048916 Bacteria 1346
889 Ga0496113_0366270 3300048916 Bacteria 1156
890 Ga0496114_0000074 3300048917 Bacteria 71312
891 Ga0496114_0007038 3300048917 Bacteria 8876
892 Ga0496114_0027378 3300048917 Bacteria 4669
893 Ga0496114_0041570 3300048917 Bacteria 3810
894 Ga0496114_0128601 3300048917 Bacteria 2186
895 Ga0496115_0000010 3300048918 Bacteria 227112
896 Ga0496115_0000012 3300048918 Bacteria 215509
897 Ga0496115_0000017 3300048918 Bacteria 185702
898 Ga0496115_0002588 3300048918 Bacteria 12979
899 Ga0496115_0004810 3300048918 Bacteria 9797
900 Ga0496115_0015221 3300048918 Bacteria 5830
901 Ga0496115_0033220 3300048918 Bacteria 4072
902 Ga0496115_0191782 3300048918 Bacteria 1688
903 Ga0496116_0000360 3300048919 Bacteria 70849
904 Ga0496117_0006636 3300048920 Bacteria 11608
905 Ga0496118_0001416 3300048921 Bacteria 36186
906 Ga0496118_0057207 3300048921 Bacteria 2925
907 Ga0496119_0002006 3300048922 Bacteria 23038
908 Ga0496119_0002714 3300048922 Bacteria 19104
909 Ga0496119_0016372 3300048922 Bacteria 5645
910 Ga0496119_0036375 3300048922 Bacteria 3214
911 Ga0496120_0005529 3300048923 Bacteria 10050
912 Ga0496121_0002111 3300048924 Bacteria 31257
913 Ga0496121_0016970 3300048924 Bacteria 7478
914 Ga0496121_0045460 3300048924 Bacteria 3772
915 Ga0496121_0205619 3300048924 Bacteria 1399
916 Ga0496124_0248647 3300048927 Bacteria 1317
917 Ga0496125_0043665 3300048928 Bacteria 3800
918 Ga0496125_0085847 3300048928 Bacteria 2383
919 Ga0496126_0351118 3300048929 Bacteria 1206
920 Ga0496126_0413818 3300048929 Bacteria 1091
921 Ga0501031_0000355 3300049568 Bacteria 26681
922 Ga0501031_0239627 3300049568 Bacteria 1179
923 Ga0501032_0000734 3300049569 Bacteria 26634
924 Ga0501033_0000927 3300049570 Bacteria 26794
925 Ga0501033_0117850 3300049570 Bacteria 1929
926 Ga0501034_0008505 3300049571 Bacteria 10837
927 Ga0501034_0219806 3300049571 Bacteria 1853
928 Ga0501036_0000548 3300049572 Bacteria 26923
929 Ga0501036_0147752 3300049572 Bacteria 1983
930 Ga0501036_0267066 3300049572 Bacteria 1433
931 Ga0501037_0000599 3300049573 Bacteria 28109
932 Ga0501038_0000788 3300049574 Bacteria 28056
933 Ga0501039_0004109 3300049575 Bacteria 10959
934 Ga0501039_0036116 3300049575 Bacteria 3813
935 Ga0501039_0241299 3300049575 Bacteria 1421
936 Ga0501039_0435772 3300049575 Bacteria 1029
937 Ga0501040_0033872 3300049576 Bacteria 3462
938 Ga0501040_0077311 3300049576 Bacteria 2302
939 Ga0501042_0016286 3300049578 Bacteria 5102
940 Ga0501042_0183274 3300049578 Bacteria 1510
941 Ga0501043_0000871 3300049579 Bacteria 26758
942 Ga0501046_0000669 3300049580 Bacteria 33196
943 Ga0501047_0001012 3300049581 Bacteria 28368
944 Ga0501047_0107547 3300049581 Bacteria 2670
945 Ga0501047_0320663 3300049581 Bacteria 1389
946 Ga0501048_0001025 3300049582 Bacteria 20894
947 Ga0501048_0130961 3300049582 Bacteria 1773
948 Ga0501048_0241023 3300049582 Bacteria 1283
949 Ga0501067_0054852 3300049583 Bacteria 2208
950 Ga0501068_0196300 3300049584 Bacteria 1279
951 Ga0501069_0011011 3300049585 Bacteria 4796
952 Ga0501069_0014111 3300049585 Bacteria 4265
953 Ga0501069_0031666 3300049585 Bacteria 2910
954 Ga0501069_0099379 3300049585 Bacteria 1651
955 Ga0501070_0000466 3300049586 Bacteria 36819
956 Ga0501070_0264256 3300049586 Bacteria 1406
957 Ga0501070_0278122 3300049586 Bacteria 1366
958 Ga0501070_0327455 3300049586 Bacteria 1245
959 Ga0501071_0177865 3300049587 Bacteria 1594
960 Ga0501072_0011877 3300049588 Bacteria 6653
961 Ga0501072_0030202 3300049588 Bacteria 4237
962 Ga0501072_0032899 3300049588 Bacteria 4061
963 Ga0501073_0000981 3300049589 Bacteria 20567
964 Ga0501073_0002848 3300049589 Bacteria 12954
965 Ga0501073_0132569 3300049589 Bacteria 1727
966 Ga0501074_0008085 3300049590 Bacteria 7621
967 Ga0501074_0044917 3300049590 Bacteria 3197
968 Ga0501074_0054881 3300049590 Bacteria 2873
969 Ga0501075_0001027 3300049591 Bacteria 17897
970 Ga0501075_0216565 3300049591 Bacteria 1461
971 Ga0501076_0004141 3300049592 Bacteria 10260
972 Ga0501076_0013004 3300049592 Bacteria 6231
973 Ga0501076_0163720 3300049592 Bacteria 1813
974 Ga0501079_0009854 3300049741 Bacteria 7249
975 Ga0501079_0077178 3300049741 Bacteria 2577
976 Ga0501079_0146648 3300049741 Bacteria 1839
977 Ga0501079_0384020 3300049741 Bacteria 1101
978 Ga0501080_0002687 3300049742 Bacteria 15577
979 Ga0501080_0006435 3300049742 Bacteria 10543
980 Ga0501081_0059551 3300049743 Bacteria 2644
981 Ga0501081_0204670 3300049743 Bacteria 1432
982 Ga0501081_0237177 3300049743 Bacteria 1329
983 Ga0501083_0000531 3300049744 Bacteria 24333
984 Ga0501083_0000666 3300049744 Bacteria 22284
985 Ga0501083_0010094 3300049744 Bacteria 6655
986 Ga0501083_0027051 3300049744 Bacteria 3960
987 Ga0501083_0228949 3300049744 Bacteria 1211
988 Ga0501035_0001127 3300049822 Bacteria 27921
989 Ga0501035_0090471 3300049822 Bacteria 2694
990 Ga0501044_0001423 3300049823 Bacteria 28065
991 Ga0501044_0081576 3300049823 Bacteria 3273
992 Ga0501045_0006965 3300049824 Bacteria 7837
993 Ga0501045_0008962 3300049824 Bacteria 6987
994 Ga0501045_0127864 3300049824 Bacteria 1888
995 Ga0501045_0267418 3300049824 Bacteria 1273
996 nmdc:mga00v17_87294_c1 3300050491 Bacteria 1955
997 nmdc:mga00v17_94822_c1 3300050491 Bacteria 1878
998 nmdc:mga0yw44_165520_c1 3300050492 Bacteria 1449
999 nmdc:mga0yw44_253506_c1 3300050492 Bacteria 1172
1000 nmdc:mga0yw44_4753_c1 3300050492 Bacteria 6293
1001 nmdc:mga0yw44_54693_c1 3300050492 Bacteria 2427
1002 nmdc:mga06z11_50203_c1 3300050494 Bacteria 2131
1003 nmdc:mga05p37_138550_c1 3300050507 Bacteria 2982
1004 nmdc:mga05p37_160696_c1 3300050507 Bacteria 2744
1005 nmdc:mga05p37_180960_c1 3300050507 Bacteria 2564
1006 nmdc:mga05p37_208895_c1 3300050507 Bacteria 2361
1007 nmdc:mga05p37_216918_c1 3300050507 Bacteria 2310
1008 nmdc:mga05p37_284307_c1 3300050507 Bacteria 1667
1009 nmdc:mga05p37_350029_c1 3300050507 Bacteria 1740
1010 nmdc:mga05p37_39716_c1 3300050507 Bacteria 2635
1011 nmdc:mga05p37_4288_c1 3300050507 Bacteria 16659
1012 nmdc:mga05p37_640695_c1 3300050507 Bacteria 1192
1013 nmdc:mga09592_26468_c1 3300050508 Bacteria 4806
1014 nmdc:mga09592_48745_c1 3300050508 Bacteria 3571
1015 nmdc:mga0qj67_7661_c1 3300050509 Bacteria 7978
1016 nmdc:mga0qj67_86767_c1 3300050509 Bacteria 2511
1017 nmdc:mga06r32_110560_c1 3300050510 Bacteria 2703
1018 nmdc:mga06r32_135857_c1 3300050510 Bacteria 2434
1019 nmdc:mga06r32_4342_c1 3300050510 Bacteria 12687
1020 nmdc:mga06r32_49434_c1 3300050510 Bacteria 4021
1021 nmdc:mga06r32_55917_c1 3300050510 Bacteria 3786
1022 nmdc:mga08y16_10720_c1 3300050511 Bacteria 9618
1023 nmdc:mga08y16_32841_c1 3300050511 Bacteria 5456
1024 nmdc:mga08y16_426965_c1 3300050511 Bacteria 1354
1025 nmdc:mga08y16_729063_c1 3300050511 Bacteria 989
1026 nmdc:mga0n895_1290_c1 3300050512 Bacteria 18537
1027 nmdc:mga0n895_173515_c1 3300050512 Bacteria 2188
1028 nmdc:mga0n895_18266_c1 3300050512 Bacteria 6485
1029 nmdc:mga0n895_85269_c1 3300050512 Bacteria 3153
1030 nmdc:mga0n895_91074_c1 3300050512 Bacteria 3051
1031 nmdc:mga0rr50_181999_c1 3300050513 Bacteria 1718
1032 nmdc:mga0rr50_74488_c1 3300050513 Bacteria 2599
1033 nmdc:mga08x19_323939_c1 3300050514 Bacteria 1073
1034 nmdc:mga08x19_49438_c1 3300050514 Bacteria 2696
1035 nmdc:mga0a205_12181_c1 3300050515 Bacteria 7952
1036 nmdc:mga0a205_169690_c1 3300050515 Bacteria 2078
1037 nmdc:mga0a205_40657_c1 3300050515 Bacteria 4476
1038 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
1039 Ga0495601_0000027 3300053077 Bacteria 116790
1040 Ga0495601_0000617 3300053077 Bacteria 18929
1041 Ga0495601_0001946 3300053077 Bacteria 11558
1042 Ga0495601_0008060 3300053077 Bacteria 6210
1043 Ga0495601_0045549 3300053077 Bacteria 2759
1044 Ga0495601_0078051 3300053077 Bacteria 2121
1045 Ga0495612_0000022 3300053078 Bacteria 119126
1046 Ga0495612_0000072 3300053078 Bacteria 45740
1047 Ga0495612_0001004 3300053078 Bacteria 11610
1048 Ga0495612_0007683 3300053078 Bacteria 4404
1049 Ga0495655_0000001 3300053083 Bacteria 419518
1050 Ga0495655_0004484 3300053083 Bacteria 2389
1051 Ga0495595_0000022 3300053084 Bacteria 110598
1052 Ga0495595_0000140 3300053084 Bacteria 29997
1053 Ga0495619_0000010 3300053085 Bacteria 302390
1054 Ga0495619_0000070 3300053085 Bacteria 80588
1055 Ga0495619_0000077 3300053085 Bacteria 73017
1056 Ga0495619_0002106 3300053085 Bacteria 13197
1057 Ga0495619_0004729 3300053085 Bacteria 8662
1058 Ga0495619_0004935 3300053085 Bacteria 8473
1059 Ga0495619_0019032 3300053085 Bacteria 4362
1060 Ga0500566_0001344 3300053094 Bacteria 14356
1061 Ga0500641_0006890 3300053096 Bacteria 4040
1062 Ga0500556_0000780 3300053104 Bacteria 18803
1063 Ga0500614_003327 3300053123 Bacteria 3467
1064 Ga0500628_000073 3300053129 Bacteria 26096
1065 Ga0500628_003565 3300053129 Unclassified 2573
1066 Ga0500616_0009899 3300053153 Bacteria 5741
1067 Ga0500637_0001373 3300053178 Bacteria 10330
1068 Ga0500599_003742 3300053736 Bacteria 1865
1069 Ga0501084_0045098 3300054114 Bacteria 3692
1070 Ga0501082_0014568 3300060353 Bacteria 6772
1071 Ga0501082_0173646 3300060353 Bacteria 1874
1072 Ga0501082_0206784 3300060353 Bacteria 1708
1073 Ga0501082_0367066 3300060353 Bacteria 1256
1074 Ga0466962_0004305 3300061719 Bacteria 6825
1075 Ga0466962_0064790 3300061719 Bacteria 1745
1076 Ga0466962_0088312 3300061719 Bacteria 1485
1077 Ga0530510_0009028 3300061734 Bacteria 6988
1078 Ga0530510_0048891 3300061734 Bacteria 3056
1079 Ga0530510_0304370 3300061734 Bacteria 1193

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_0275176 Ga0496113_0275176_512_1306 263
2 3300046531 Ga0495665_0208760 Ga0495665_0208760_161_976 270
3 3300048908 Ga0496105_0003630 Ga0496105_0003630_5092_6084 287
4 3300048915 Ga0496112_0174855 Ga0496112_0174855_705_1697 287
5 3300014325 Ga0163163_10168575 Ga0163163_101685752 288
6 3300048915 Ga0496112_0209116 Ga0496112_0209116_711_1706 288
7 3300049741 Ga0501079_0384020 Ga0501079_0384020_201_1076 291
8 3300049589 Ga0501073_0132569 Ga0501073_0132569_10_951 294
9 3300046809 Ga0495600_0047292 Ga0495600_0047292_769_1770 298
10 3300053178 Ga0500637_0001373 Ga0500637_0001373_155_1168 298
11 3300050491 nmdc:mga00v17_87294_c1 nmdc:mga00v17_87294_c1_496_1488 300
12 3300032002 Ga0307416_100451090 Ga0307416_1004510902 304
13 3300048912 Ga0496109_0007678 Ga0496109_0007678_2579_3568 307
14 3300006847 Ga0075431_100233256 Ga0075431_1002332562 308
15 3300048913 Ga0496110_0123883 Ga0496110_0123883_1025_2029 308
16 3300048914 Ga0496111_0035980 Ga0496111_0035980_1445_2449 308
17 3300050510 nmdc:mga06r32_55917_c1 nmdc:mga06r32_55917_c1_2568_3572 308
18 3300050511 nmdc:mga08y16_729063_c1 nmdc:mga08y16_729063_c1_20_946 308
19 3300005518 Ga0070699_100079328 Ga0070699_1000793284 309
20 3300046536 Ga0495587_0005182 Ga0495587_0005182_2805_3803 312
21 3300047472 Ga0495686_0002378 Ga0495686_0002378_14926_15876 312
22 3300049585 Ga0501069_0099379 Ga0501069_0099379_354_1313 312
23 3300048927 Ga0496124_0248647 Ga0496124_0248647_256_1257 313
24 3300005435 Ga0070714_100164642 Ga0070714_1001646422 314
25 3300025929 Ga0207664_10071622 Ga0207664_100716223 314
26 3300049744 Ga0501083_0000666 Ga0501083_0000666_429_1436 314
27 3300049589 Ga0501073_0002848 Ga0501073_0002848_5905_6927 315
28 3300053085 Ga0495619_0000077 Ga0495619_0000077_43812_44798 317
29 3300005341 Ga0070691_10000001 Ga0070691_1000000136 319
30 3300009148 Ga0105243_10440617 Ga0105243_104406171 320
31 3300046463 Ga0495653_0150783 Ga0495653_0150783_128_1096 320
32 3300049570 Ga0501033_0117850 Ga0501033_0117850_511_1503 320
33 3300006028 Ga0070717_10153196 Ga0070717_101531962 321
34 3300025928 Ga0207700_10038669 Ga0207700_100386694 321
35 3300045976 Ga0466967_0155266 Ga0466967_0155266_1077_2069 321
36 3300009177 Ga0105248_10128056 Ga0105248_101280562 323
37 3300048903 Ga0496100_0013715 Ga0496100_0013715_1810_2844 323
38 3300005467 Ga0070706_100010715 Ga0070706_1000107156 324
39 3300005468 Ga0070707_100217407 Ga0070707_1002174072 324
40 3300005937 Ga0081455_10007837 Ga0081455_100078375 324
41 3300010375 Ga0105239_10172957 Ga0105239_101729573 324
42 3300013306 Ga0163162_10459077 Ga0163162_104590772 324
43 3300025910 Ga0207684_10001611 Ga0207684_100016113 324
44 3300025922 Ga0207646_10057050 Ga0207646_100570502 324
45 3300025927 Ga0207687_10022929 Ga0207687_100229292 324
46 3300028800 Ga0265338_10012258 Ga0265338_100122588 324
47 3300031251 Ga0265327_10001436 Ga0265327_1000143620 324
48 3300037312 Ga0395899_0020250 Ga0395899_0020250_1953_2936 324
49 3300037418 Ga0395900_0166368 Ga0395900_0166368_1114_2094 324
50 3300037466 Ga0395898_0003141 Ga0395898_0003141_1712_2695 324
51 3300037466 Ga0395898_0067934 Ga0395898_0067934_167_1147 324
52 3300037466 Ga0395898_0293825 Ga0395898_0293825_450_1430 324
53 3300037471 Ga0395905_0021115 Ga0395905_0021115_760_1743 324
54 3300038443 Ga0395901_0023382 Ga0395901_0023382_1634_2617 324
55 3300048905 Ga0496102_0324241 Ga0496102_0324241_210_1193 324
56 3300048915 Ga0496112_0166847 Ga0496112_0166847_876_1859 324
57 3300005439 Ga0070711_100001716 Ga0070711_1000017167 325
58 3300005937 Ga0081455_10085414 Ga0081455_100854142 325
59 3300005985 Ga0081539_10003820 Ga0081539_100038205 325
60 3300013308 Ga0157375_10520165 Ga0157375_105201652 325
61 3300017792 Ga0163161_10336924 Ga0163161_103369242 325
62 3300025912 Ga0207707_10229762 Ga0207707_102297622 325
63 3300025916 Ga0207663_10012244 Ga0207663_100122442 325
64 3300025928 Ga0207700_10234380 Ga0207700_102343802 325
65 3300025929 Ga0207664_10090856 Ga0207664_100908562 325
66 3300026067 Ga0207678_10196534 Ga0207678_101965342 325
67 3300044694 Ga0466963_0003594 Ga0466963_0003594_1887_2921 325
68 3300044694 Ga0466963_0011029 Ga0466963_0011029_1055_2038 325
69 3300044842 Ga0466957_0032032 Ga0466957_0032032_1528_2562 325
70 3300044842 Ga0466957_0122175 Ga0466957_0122175_473_1456 325
71 3300044901 Ga0466960_0019437 Ga0466960_0019437_1433_2416 325
72 3300045976 Ga0466967_0005609 Ga0466967_0005609_3882_4916 325
73 3300045976 Ga0466967_0079502 Ga0466967_0079502_1951_2934 325
74 3300048913 Ga0496110_0153398 Ga0496110_0153398_719_1699 325
75 3300048918 Ga0496115_0191782 Ga0496115_0191782_318_1301 325
76 3300050507 nmdc:mga05p37_138550_c1 nmdc:mga05p37_138550_c1_957_1937 325
77 3300005329 Ga0070683_100062589 Ga0070683_1000625893 326
78 3300005530 Ga0070679_100219759 Ga0070679_1002197592 326
79 3300005539 Ga0068853_100159773 Ga0068853_1001597731 326
80 3300005578 Ga0068854_100207256 Ga0068854_1002072562 326
81 3300005937 Ga0081455_10114109 Ga0081455_101141093 326
82 3300006871 Ga0075434_100008022 Ga0075434_1000080228 326
83 3300006871 Ga0075434_100245894 Ga0075434_1002458942 326
84 3300006914 Ga0075436_100097051 Ga0075436_1000970512 326
85 3300009093 Ga0105240_10036442 Ga0105240_100364424 326
86 3300009147 Ga0114129_10000229 Ga0114129_1000022972 326
87 3300013104 Ga0157370_10077456 Ga0157370_100774563 326
88 3300014969 Ga0157376_10054029 Ga0157376_100540294 326
89 3300025913 Ga0207695_10006218 Ga0207695_100062187 326
90 3300026041 Ga0207639_10197162 Ga0207639_101971622 326
91 3300026041 Ga0207639_10302852 Ga0207639_103028521 326
92 3300026121 Ga0207683_10369127 Ga0207683_103691271 326
93 3300028556 Ga0265337_1020390 Ga0265337_10203903 326
94 3300031251 Ga0265327_10002767 Ga0265327_100027678 326
95 3300031901 Ga0307406_10029141 Ga0307406_100291412 326
96 3300031901 Ga0307406_10346300 Ga0307406_103463001 326
97 3300031903 Ga0307407_10070539 Ga0307407_100705392 326
98 3300032002 Ga0307416_100402665 Ga0307416_1004026652 326
99 3300032005 Ga0307411_10019425 Ga0307411_100194253 326
100 3300037312 Ga0395899_0058634 Ga0395899_0058634_1430_2422 326
101 3300037418 Ga0395900_0077025 Ga0395900_0077025_2029_3021 326
102 3300037471 Ga0395905_0019433 Ga0395905_0019433_5029_6021 326
103 3300038443 Ga0395901_0023591 Ga0395901_0023591_421_1413 326
104 3300044693 Ga0466961_0011845 Ga0466961_0011845_2092_3087 326
105 3300044694 Ga0466963_0027393 Ga0466963_0027393_2584_3570 326
106 3300044901 Ga0466960_0035547 Ga0466960_0035547_317_1303 326
107 3300045049 Ga0466959_0041894 Ga0466959_0041894_1620_2615 326
108 3300045976 Ga0466967_0078341 Ga0466967_0078341_741_1730 326
109 3300046454 Ga0495592_0015168 Ga0495592_0015168_1532_2530 326
110 3300046559 Ga0495667_0089911 Ga0495667_0089911_370_1356 326
111 3300046559 Ga0495667_0120399 Ga0495667_0120399_377_1363 326
112 3300046663 Ga0495635_0118943 Ga0495635_0118943_788_1774 326
113 3300046683 Ga0495658_0125692 Ga0495658_0125692_509_1495 326
114 3300048904 Ga0496101_0224926 Ga0496101_0224926_190_1230 326
115 3300048905 Ga0496102_0202423 Ga0496102_0202423_723_1763 326
116 3300048908 Ga0496105_0076169 Ga0496105_0076169_691_1731 326
117 3300048910 Ga0496107_0150115 Ga0496107_0150115_309_1298 326
118 3300048911 Ga0496108_0046651 Ga0496108_0046651_471_1460 326
119 3300048912 Ga0496109_0064127 Ga0496109_0064127_2037_3026 326
120 3300048917 Ga0496114_0007038 Ga0496114_0007038_1778_2818 326
121 3300048918 Ga0496115_0033220 Ga0496115_0033220_1571_2611 326
122 3300048924 Ga0496121_0002111 Ga0496121_0002111_741_1754 326
123 3300049568 Ga0501031_0239627 Ga0501031_0239627_40_1029 326
124 3300049582 Ga0501048_0241023 Ga0501048_0241023_189_1178 326
125 3300049583 Ga0501067_0054852 Ga0501067_0054852_777_1760 326
126 3300049585 Ga0501069_0031666 Ga0501069_0031666_14_1054 326
127 3300049586 Ga0501070_0278122 Ga0501070_0278122_14_1003 326
128 3300049590 Ga0501074_0044917 Ga0501074_0044917_2131_3120 326
129 3300049744 Ga0501083_0228949 Ga0501083_0228949_202_1191 326
130 3300049824 Ga0501045_0267418 Ga0501045_0267418_210_1199 326
131 3300050507 nmdc:mga05p37_4288_c1 nmdc:mga05p37_4288_c1_9363_10352 326
132 3300050512 nmdc:mga0n895_1290_c1 nmdc:mga0n895_1290_c1_3187_4227 326
133 3300050512 nmdc:mga0n895_85269_c1 nmdc:mga0n895_85269_c1_622_1659 326
134 3300050513 nmdc:mga0rr50_74488_c1 nmdc:mga0rr50_74488_c1_1534_2574 326
135 3300053104 Ga0500556_0000780 Ga0500556_0000780_653_1645 326
136 3300053153 Ga0500616_0009899 Ga0500616_0009899_570_1562 326
137 3300053736 Ga0500599_003742 Ga0500599_003742_268_1260 326
138 3300061719 Ga0466962_0064790 Ga0466962_0064790_634_1620 326
139 3300061734 Ga0530510_0009028 Ga0530510_0009028_1702_2742 326
140 3300061734 Ga0530510_0304370 Ga0530510_0304370_33_1022 326
141 3300003203 JGI25406J46586_10003262 JGI25406J46586_100032628 327
142 3300005339 Ga0070660_100013156 Ga0070660_1000131562 327
143 3300005345 Ga0070692_10012752 Ga0070692_100127522 327
144 3300005366 Ga0070659_100346998 Ga0070659_1003469982 327
145 3300005435 Ga0070714_100000137 Ga0070714_10000013728 327
146 3300005441 Ga0070700_100161929 Ga0070700_1001619292 327
147 3300005981 Ga0081538_10000909 Ga0081538_100009095 327
148 3300005983 Ga0081540_1000265 Ga0081540_10002659 327
149 3300005985 Ga0081539_10016831 Ga0081539_100168315 327
150 3300005985 Ga0081539_10035589 Ga0081539_100355892 327
151 3300006048 Ga0075363_100084439 Ga0075363_1000844392 327
152 3300006051 Ga0075364_10035244 Ga0075364_100352442 327
153 3300006175 Ga0070712_100000002 Ga0070712_100000002172 327
154 3300006844 Ga0075428_100156573 Ga0075428_1001565732 327
155 3300006871 Ga0075434_100446095 Ga0075434_1004460952 327
156 3300006880 Ga0075429_100023593 Ga0075429_1000235933 327
157 3300006881 Ga0068865_100047443 Ga0068865_1000474434 327
158 3300009098 Ga0105245_10024710 Ga0105245_100247106 327
159 3300014325 Ga0163163_10066087 Ga0163163_100660874 327
160 3300021384 Ga0213876_10039275 Ga0213876_100392752 327
161 3300025915 Ga0207693_10000014 Ga0207693_1000001425 327
162 3300025929 Ga0207664_10000006 Ga0207664_10000006117 327
163 3300028563 Ga0265319_1000323 Ga0265319_10003232 327
164 3300028577 Ga0265318_10015071 Ga0265318_100150712 327
165 3300028800 Ga0265338_10086363 Ga0265338_100863632 327
166 3300031240 Ga0265320_10018765 Ga0265320_100187652 327
167 3300031240 Ga0265320_10103011 Ga0265320_101030112 327
168 3300037418 Ga0395900_0435928 Ga0395900_0435928_187_1173 327
169 3300037466 Ga0395898_0063887 Ga0395898_0063887_2094_3080 327
170 3300037466 Ga0395898_0288586 Ga0395898_0288586_35_1024 327
171 3300038443 Ga0395901_0005774 Ga0395901_0005774_11153_12142 327
172 3300038443 Ga0395901_0064733 Ga0395901_0064733_1511_2497 327
173 3300039437 Ga0436365_0378539 Ga0436365_0378539_6052_7038 327
174 3300039453 Ga0436362_0570716 Ga0436362_0570716_480_1472 327
175 3300039453 Ga0436362_1091830 Ga0436362_1091830_659_1645 327
176 3300044719 Ga0466971_0007205 Ga0466971_0007205_159_1145 327
177 3300044842 Ga0466957_0045274 Ga0466957_0045274_231_1217 327
178 3300045049 Ga0466959_0047397 Ga0466959_0047397_799_1785 327
179 3300046476 Ga0495662_0065988 Ga0495662_0065988_347_1339 327
180 3300046499 Ga0495594_0000010 Ga0495594_0000010_57354_58343 327
181 3300046517 Ga0495630_0029400 Ga0495630_0029400_2747_3760 327
182 3300046523 Ga0495644_0000902 Ga0495644_0000902_8383_9375 327
183 3300046615 Ga0495656_0034837 Ga0495656_0034837_865_1857 327
184 3300046683 Ga0495658_0014050 Ga0495658_0014050_2691_3683 327
185 3300047469 Ga0495673_0007713 Ga0495673_0007713_4101_5093 327
186 3300047472 Ga0495686_0047528 Ga0495686_0047528_1324_2316 327
187 3300048904 Ga0496101_0257672 Ga0496101_0257672_145_1131 327
188 3300048904 Ga0496101_0268843 Ga0496101_0268843_118_1113 327
189 3300048907 Ga0496104_0192049 Ga0496104_0192049_88_1074 327
190 3300048910 Ga0496107_0279007 Ga0496107_0279007_209_1195 327
191 3300048912 Ga0496109_0077913 Ga0496109_0077913_814_1800 327
192 3300048915 Ga0496112_0001374 Ga0496112_0001374_779_1765 327
193 3300048916 Ga0496113_0088987 Ga0496113_0088987_532_1518 327
194 3300050507 nmdc:mga05p37_216918_c1 nmdc:mga05p37_216918_c1_69_1073 327
195 3300050507 nmdc:mga05p37_350029_c1 nmdc:mga05p37_350029_c1_215_1201 327
196 3300050508 nmdc:mga09592_26468_c1 nmdc:mga09592_26468_c1_2726_3712 327
197 3300053129 Ga0500628_003565 Ga0500628_003565_678_1670 327
198 3300061719 Ga0466962_0004305 Ga0466962_0004305_193_1179 327
199 3300003659 JGI25404J52841_10002501 JGI25404J52841_100025012 328
200 3300005329 Ga0070683_100073405 Ga0070683_1000734053 328
201 3300005334 Ga0068869_100104385 Ga0068869_1001043853 328
202 3300005337 Ga0070682_100006477 Ga0070682_1000064772 328
203 3300005338 Ga0068868_100006160 Ga0068868_1000061607 328
204 3300005340 Ga0070689_100062567 Ga0070689_1000625673 328
205 3300005341 Ga0070691_10032476 Ga0070691_100324762 328
206 3300005344 Ga0070661_100173092 Ga0070661_1001730922 328
207 3300005347 Ga0070668_100037834 Ga0070668_1000378342 328
208 3300005353 Ga0070669_100369034 Ga0070669_1003690341 328
209 3300005354 Ga0070675_100108017 Ga0070675_1001080172 328
210 3300005356 Ga0070674_100135857 Ga0070674_1001358572 328
211 3300005366 Ga0070659_100011575 Ga0070659_1000115757 328
212 3300005435 Ga0070714_100030023 Ga0070714_1000300233 328
213 3300005435 Ga0070714_100068311 Ga0070714_1000683113 328
214 3300005436 Ga0070713_100330713 Ga0070713_1003307131 328
215 3300005438 Ga0070701_10030805 Ga0070701_100308052 328
216 3300005439 Ga0070711_100006351 Ga0070711_1000063513 328
217 3300005439 Ga0070711_100146244 Ga0070711_1001462441 328
218 3300005440 Ga0070705_100306933 Ga0070705_1003069331 328
219 3300005441 Ga0070700_100006904 Ga0070700_1000069045 328
220 3300005456 Ga0070678_100006059 Ga0070678_1000060599 328
221 3300005457 Ga0070662_100146963 Ga0070662_1001469632 328
222 3300005545 Ga0070695_100042564 Ga0070695_1000425643 328
223 3300005549 Ga0070704_100106342 Ga0070704_1001063421 328
224 3300005564 Ga0070664_100007855 Ga0070664_1000078554 328
225 3300005578 Ga0068854_100165665 Ga0068854_1001656652 328
226 3300005614 Ga0068856_100056321 Ga0068856_1000563215 328
227 3300005614 Ga0068856_100219927 Ga0068856_1002199271 328
228 3300005615 Ga0070702_100159897 Ga0070702_1001598972 328
229 3300005618 Ga0068864_100311207 Ga0068864_1003112072 328
230 3300005719 Ga0068861_100002823 Ga0068861_1000028232 328
231 3300005981 Ga0081538_10000386 Ga0081538_1000038640 328
232 3300005981 Ga0081538_10001446 Ga0081538_1000144615 328
233 3300005981 Ga0081538_10005326 Ga0081538_100053264 328
234 3300005981 Ga0081538_10008613 Ga0081538_100086133 328
235 3300005983 Ga0081540_1000554 Ga0081540_100055422 328
236 3300005983 Ga0081540_1000650 Ga0081540_100065022 328
237 3300006028 Ga0070717_10002035 Ga0070717_100020355 328
238 3300006028 Ga0070717_10067208 Ga0070717_100672082 328
239 3300006038 Ga0075365_10017279 Ga0075365_100172793 328
240 3300006038 Ga0075365_10058623 Ga0075365_100586232 328
241 3300006048 Ga0075363_100081554 Ga0075363_1000815542 328
242 3300006173 Ga0070716_100039133 Ga0070716_1000391332 328
243 3300006175 Ga0070712_100002700 Ga0070712_1000027008 328
244 3300006844 Ga0075428_100008397 Ga0075428_10000839711 328
245 3300006844 Ga0075428_100015609 Ga0075428_1000156094 328
246 3300006844 Ga0075428_100053326 Ga0075428_1000533262 328
247 3300006844 Ga0075428_100093527 Ga0075428_1000935272 328
248 3300006846 Ga0075430_100002217 Ga0075430_10000221710 328
249 3300006847 Ga0075431_100037352 Ga0075431_1000373527 328
250 3300006847 Ga0075431_100076092 Ga0075431_1000760923 328
251 3300006852 Ga0075433_10031897 Ga0075433_100318972 328
252 3300006880 Ga0075429_100227752 Ga0075429_1002277523 328
253 3300006914 Ga0075436_100140264 Ga0075436_1001402641 328
254 3300007076 Ga0075435_100029836 Ga0075435_1000298363 328
255 3300009093 Ga0105240_10003665 Ga0105240_100036656 328
256 3300009094 Ga0111539_10052407 Ga0111539_100524075 328
257 3300009094 Ga0111539_10479514 Ga0111539_104795142 328
258 3300009098 Ga0105245_10011852 Ga0105245_100118522 328
259 3300009098 Ga0105245_10320307 Ga0105245_103203072 328
260 3300009147 Ga0114129_10488803 Ga0114129_104888032 328
261 3300009177 Ga0105248_10073668 Ga0105248_100736682 328
262 3300009545 Ga0105237_10001714 Ga0105237_100017144 328
263 3300009553 Ga0105249_10004662 Ga0105249_100046627 328
264 3300009553 Ga0105249_10315720 Ga0105249_103157202 328
265 3300010375 Ga0105239_10004095 Ga0105239_1000409510 328
266 3300010375 Ga0105239_10072024 Ga0105239_100720243 328
267 3300011119 Ga0105246_10148592 Ga0105246_101485922 328
268 3300013296 Ga0157374_10010688 Ga0157374_1001068811 328
269 3300013307 Ga0157372_10186378 Ga0157372_101863784 328
270 3300013308 Ga0157375_10157415 Ga0157375_101574152 328
271 3300014325 Ga0163163_10096176 Ga0163163_100961763 328
272 3300014745 Ga0157377_10001774 Ga0157377_1000177412 328
273 3300021384 Ga0213876_10016626 Ga0213876_100166263 328
274 3300021384 Ga0213876_10049019 Ga0213876_100490192 328
275 3300021384 Ga0213876_10099757 Ga0213876_100997572 328
276 3300025898 Ga0207692_10048285 Ga0207692_100482851 328
277 3300025898 Ga0207692_10115645 Ga0207692_101156452 328
278 3300025901 Ga0207688_10003516 Ga0207688_1000351611 328
279 3300025901 Ga0207688_10012330 Ga0207688_100123306 328
280 3300025901 Ga0207688_10131569 Ga0207688_101315692 328
281 3300025915 Ga0207693_10014178 Ga0207693_100141785 328
282 3300025915 Ga0207693_10142350 Ga0207693_101423502 328
283 3300025916 Ga0207663_10004337 Ga0207663_100043372 328
284 3300025916 Ga0207663_10115862 Ga0207663_101158622 328
285 3300025926 Ga0207659_10151820 Ga0207659_101518202 328
286 3300025929 Ga0207664_10030907 Ga0207664_100309073 328
287 3300025929 Ga0207664_10359207 Ga0207664_103592071 328
288 3300025932 Ga0207690_10053536 Ga0207690_100535362 328
289 3300025933 Ga0207706_10001715 Ga0207706_1000171521 328
290 3300025933 Ga0207706_10165567 Ga0207706_101655672 328
291 3300025937 Ga0207669_10158095 Ga0207669_101580952 328
292 3300025938 Ga0207704_10032887 Ga0207704_100328873 328
293 3300025941 Ga0207711_10057858 Ga0207711_100578581 328
294 3300025942 Ga0207689_10113518 Ga0207689_101135182 328
295 3300025945 Ga0207679_10007996 Ga0207679_100079962 328
296 3300025945 Ga0207679_10061831 Ga0207679_100618314 328
297 3300025949 Ga0207667_10452247 Ga0207667_104522472 328
298 3300025961 Ga0207712_10366304 Ga0207712_103663042 328
299 3300025972 Ga0207668_10011009 Ga0207668_100110098 328
300 3300025972 Ga0207668_10188129 Ga0207668_101881292 328
301 3300026023 Ga0207677_10028342 Ga0207677_100283422 328
302 3300026075 Ga0207708_10001166 Ga0207708_100011667 328
303 3300026075 Ga0207708_10001883 Ga0207708_100018833 328
304 3300026078 Ga0207702_10140831 Ga0207702_101408312 328
305 3300026095 Ga0207676_10217897 Ga0207676_102178972 328
306 3300026116 Ga0207674_10051341 Ga0207674_100513415 328
307 3300026118 Ga0207675_100000091 Ga0207675_10000009118 328
308 3300026121 Ga0207683_10039055 Ga0207683_100390553 328
309 3300028556 Ga0265337_1003682 Ga0265337_10036822 328
310 3300028558 Ga0265326_10004289 Ga0265326_100042894 328
311 3300028563 Ga0265319_1001236 Ga0265319_10012367 328
312 3300028577 Ga0265318_10000650 Ga0265318_1000065014 328
313 3300028654 Ga0265322_10004940 Ga0265322_100049404 328
314 3300028666 Ga0265336_10000002 Ga0265336_1000000296 328
315 3300028800 Ga0265338_10000001 Ga0265338_10000001718 328
316 3300028800 Ga0265338_10005918 Ga0265338_1000591815 328
317 3300029957 Ga0265324_10001753 Ga0265324_100017537 328
318 3300031247 Ga0265340_10000001 Ga0265340_10000001717 328
319 3300031249 Ga0265339_10019994 Ga0265339_100199943 328
320 3300031344 Ga0265316_10014142 Ga0265316_100141423 328
321 3300031731 Ga0307405_10035033 Ga0307405_100350332 328
322 3300031824 Ga0307413_10036602 Ga0307413_100366023 328
323 3300031824 Ga0307413_10102556 Ga0307413_101025562 328
324 3300031824 Ga0307413_10229887 Ga0307413_102298871 328
325 3300031852 Ga0307410_10015552 Ga0307410_100155522 328
326 3300031901 Ga0307406_10009961 Ga0307406_100099612 328
327 3300031901 Ga0307406_10024976 Ga0307406_100249765 328
328 3300031901 Ga0307406_10301037 Ga0307406_103010372 328
329 3300031901 Ga0307406_10337463 Ga0307406_103374631 328
330 3300031903 Ga0307407_10030563 Ga0307407_100305632 328
331 3300031995 Ga0307409_100045253 Ga0307409_1000452533 328
332 3300031995 Ga0307409_100047478 Ga0307409_1000474783 328
333 3300031995 Ga0307409_100089555 Ga0307409_1000895554 328
334 3300031995 Ga0307409_100099139 Ga0307409_1000991392 328
335 3300032002 Ga0307416_100052310 Ga0307416_1000523103 328
336 3300032002 Ga0307416_100089091 Ga0307416_1000890911 328
337 3300032002 Ga0307416_100423565 Ga0307416_1004235651 328
338 3300032126 Ga0307415_100027638 Ga0307415_1000276383 328
339 3300032126 Ga0307415_100038515 Ga0307415_1000385154 328
340 3300032126 Ga0307415_100219967 Ga0307415_1002199672 328
341 3300032126 Ga0307415_100242214 Ga0307415_1002422141 328
342 3300032126 Ga0307415_100383258 Ga0307415_1003832581 328
343 3300035121 Ga0373960_0002815 Ga0373960_0002815_159_1148 328
344 3300035691 Ga0373931_0028618 Ga0373931_0028618_803_1792 328
345 3300037418 Ga0395900_0205142 Ga0395900_0205142_582_1577 328
346 3300037466 Ga0395898_0402724 Ga0395898_0402724_299_1288 328
347 3300037853 Ga0436364_0240449 Ga0436364_0240449_192_1187 328
348 3300037853 Ga0436364_0815220 Ga0436364_0815220_318_1313 328
349 3300037853 Ga0436364_1477052 Ga0436364_1477052_12497_13492 328
350 3300038443 Ga0395901_0100570 Ga0395901_0100570_66_1055 328
351 3300039437 Ga0436365_0000795 Ga0436365_0000795_2750_3745 328
352 3300039437 Ga0436365_0807310 Ga0436365_0807310_3640_4641 328
353 3300039437 Ga0436365_1395668 Ga0436365_1395668_1763_2767 328
354 3300039437 Ga0436365_1487643 Ga0436365_1487643_6373_7368 328
355 3300039437 Ga0436365_1549123 Ga0436365_1549123_4498_5493 328
356 3300039450 Ga0436363_0805533 Ga0436363_0805533_36426_37427 328
357 3300039453 Ga0436362_0170227 Ga0436362_0170227_161_1156 328
358 3300039453 Ga0436362_0857091 Ga0436362_0857091_1836_2831 328
359 3300039453 Ga0436362_1078989 Ga0436362_1078989_755_1759 328
360 3300039453 Ga0436362_1156991 Ga0436362_1156991_15_1004 328
361 3300042993 Ga0439440_0002839 Ga0439440_0002839_1803_2792 328
362 3300044684 Ga0466966_0141494 Ga0466966_0141494_161_1156 328
363 3300044693 Ga0466961_0008158 Ga0466961_0008158_5198_6193 328
364 3300044693 Ga0466961_0065974 Ga0466961_0065974_1292_2287 328
365 3300044693 Ga0466961_0224164 Ga0466961_0224164_106_1122 328
366 3300044694 Ga0466963_0007404 Ga0466963_0007404_66_1082 328
367 3300044694 Ga0466963_0014580 Ga0466963_0014580_220_1215 328
368 3300044694 Ga0466963_0077408 Ga0466963_0077408_641_1636 328
369 3300044735 Ga0466968_0030758 Ga0466968_0030758_25_1020 328
370 3300044735 Ga0466968_0086922 Ga0466968_0086922_221_1237 328
371 3300044765 Ga0466970_0035935 Ga0466970_0035935_97_1113 328
372 3300044765 Ga0466970_0104245 Ga0466970_0104245_273_1289 328
373 3300044842 Ga0466957_0014919 Ga0466957_0014919_3171_4187 328
374 3300044901 Ga0466960_0049897 Ga0466960_0049897_577_1578 328
375 3300045049 Ga0466959_0000352 Ga0466959_0000352_12636_13631 328
376 3300045049 Ga0466959_0039628 Ga0466959_0039628_1306_2301 328
377 3300045049 Ga0466959_0042350 Ga0466959_0042350_1281_2276 328
378 3300045049 Ga0466959_0110195 Ga0466959_0110195_245_1240 328
379 3300045049 Ga0466959_0176315 Ga0466959_0176315_99_1094 328
380 3300045836 Ga0466958_0000550 Ga0466958_0000550_61_1056 328
381 3300045836 Ga0466958_0003128 Ga0466958_0003128_171_1187 328
382 3300045836 Ga0466958_0005509 Ga0466958_0005509_303_1298 328
383 3300045976 Ga0466967_0000217 Ga0466967_0000217_14787_15782 328
384 3300046462 Ga0495651_0110277 Ga0495651_0110277_817_1830 328
385 3300046463 Ga0495653_0000982 Ga0495653_0000982_16099_17112 328
386 3300046475 Ga0495639_0073494 Ga0495639_0073494_527_1537 328
387 3300046477 Ga0495664_0000032 Ga0495664_0000032_12496_13512 328
388 3300046514 Ga0495618_0000113 Ga0495618_0000113_346_1359 328
389 3300046516 Ga0495628_0116689 Ga0495628_0116689_975_1961 328
390 3300046517 Ga0495630_0000145 Ga0495630_0000145_11740_12726 328
391 3300046517 Ga0495630_0009696 Ga0495630_0009696_3496_4509 328
392 3300046517 Ga0495630_0041247 Ga0495630_0041247_2368_3354 328
393 3300046529 Ga0495652_0152823 Ga0495652_0152823_675_1670 328
394 3300046543 Ga0495645_0000021 Ga0495645_0000021_4644_5648 328
395 3300046557 Ga0495622_0000104 Ga0495622_0000104_8954_9946 328
396 3300046675 Ga0495657_0000013 Ga0495657_0000013_913_1926 328
397 3300046675 Ga0495657_0049342 Ga0495657_0049342_820_1806 328
398 3300046680 Ga0495646_0025126 Ga0495646_0025126_730_1737 328
399 3300047317 Ga0495604_0000158 Ga0495604_0000158_4541_5548 328
400 3300047471 Ga0495684_0006606 Ga0495684_0006606_7200_8213 328
401 3300048903 Ga0496100_0000156 Ga0496100_0000156_15683_16675 328
402 3300048903 Ga0496100_0036184 Ga0496100_0036184_483_1478 328
403 3300048903 Ga0496100_0119669 Ga0496100_0119669_430_1419 328
404 3300048904 Ga0496101_0016622 Ga0496101_0016622_2874_3869 328
405 3300048904 Ga0496101_0117600 Ga0496101_0117600_350_1339 328
406 3300048905 Ga0496102_0000002 Ga0496102_0000002_144181_145182 328
407 3300048905 Ga0496102_0014625 Ga0496102_0014625_174_1169 328
408 3300048905 Ga0496102_0029110 Ga0496102_0029110_2295_3284 328
409 3300048906 Ga0496103_0000047 Ga0496103_0000047_4820_5821 328
410 3300048906 Ga0496103_0085303 Ga0496103_0085303_49_1062 328
411 3300048906 Ga0496103_0238934 Ga0496103_0238934_46_1047 328
412 3300048907 Ga0496104_0000037 Ga0496104_0000037_27026_28066 328
413 3300048908 Ga0496105_0213738 Ga0496105_0213738_390_1391 328
414 3300048909 Ga0496106_0001753 Ga0496106_0001753_4759_5754 328
415 3300048909 Ga0496106_0036182 Ga0496106_0036182_379_1368 328
416 3300048910 Ga0496107_0248832 Ga0496107_0248832_238_1233 328
417 3300048911 Ga0496108_0018657 Ga0496108_0018657_4669_5658 328
418 3300048911 Ga0496108_0099888 Ga0496108_0099888_407_1408 328
419 3300048912 Ga0496109_0003171 Ga0496109_0003171_3349_4416 328
420 3300048912 Ga0496109_0011008 Ga0496109_0011008_4373_5365 328
421 3300048912 Ga0496109_0030491 Ga0496109_0030491_1901_2890 328
422 3300048912 Ga0496109_0322736 Ga0496109_0322736_253_1248 328
423 3300048912 Ga0496109_0357593 Ga0496109_0357593_172_1173 328
424 3300048913 Ga0496110_0000694 Ga0496110_0000694_10663_11703 328
425 3300048913 Ga0496110_0004405 Ga0496110_0004405_697_1686 328
426 3300048913 Ga0496110_0153595 Ga0496110_0153595_136_1131 328
427 3300048915 Ga0496112_0032839 Ga0496112_0032839_3570_4565 328
428 3300048915 Ga0496112_0064087 Ga0496112_0064087_1760_2761 328
429 3300048916 Ga0496113_0004202 Ga0496113_0004202_4488_5477 328
430 3300048917 Ga0496114_0128601 Ga0496114_0128601_899_1891 328
431 3300048918 Ga0496115_0000012 Ga0496115_0000012_155865_156878 328
432 3300048918 Ga0496115_0000017 Ga0496115_0000017_65570_66583 328
433 3300048918 Ga0496115_0004810 Ga0496115_0004810_24_1019 328
434 3300048924 Ga0496121_0205619 Ga0496121_0205619_334_1335 328
435 3300049571 Ga0501034_0219806 Ga0501034_0219806_32_1033 328
436 3300049572 Ga0501036_0147752 Ga0501036_0147752_170_1159 328
437 3300049572 Ga0501036_0267066 Ga0501036_0267066_398_1387 328
438 3300049575 Ga0501039_0435772 Ga0501039_0435772_16_1005 328
439 3300049576 Ga0501040_0033872 Ga0501040_0033872_1204_2193 328
440 3300049576 Ga0501040_0077311 Ga0501040_0077311_535_1524 328
441 3300049578 Ga0501042_0183274 Ga0501042_0183274_312_1301 328
442 3300049582 Ga0501048_0130961 Ga0501048_0130961_728_1717 328
443 3300049587 Ga0501071_0177865 Ga0501071_0177865_289_1287 328
444 3300049590 Ga0501074_0054881 Ga0501074_0054881_848_1855 328
445 3300049592 Ga0501076_0013004 Ga0501076_0013004_2389_3378 328
446 3300049592 Ga0501076_0163720 Ga0501076_0163720_619_1614 328
447 3300049741 Ga0501079_0077178 Ga0501079_0077178_379_1386 328
448 3300049741 Ga0501079_0146648 Ga0501079_0146648_576_1565 328
449 3300049742 Ga0501080_0006435 Ga0501080_0006435_660_1667 328
450 3300049743 Ga0501081_0237177 Ga0501081_0237177_257_1246 328
451 3300049824 Ga0501045_0008962 Ga0501045_0008962_148_1137 328
452 3300049824 Ga0501045_0127864 Ga0501045_0127864_462_1451 328
453 3300050492 nmdc:mga0yw44_165520_c1 nmdc:mga0yw44_165520_c1_65_1063 328
454 3300050492 nmdc:mga0yw44_253506_c1 nmdc:mga0yw44_253506_c1_13_1005 328
455 3300050507 nmdc:mga05p37_180960_c1 nmdc:mga05p37_180960_c1_770_1759 328
456 3300050507 nmdc:mga05p37_208895_c1 nmdc:mga05p37_208895_c1_835_1824 328
457 3300050507 nmdc:mga05p37_640695_c1 nmdc:mga05p37_640695_c1_103_1092 328
458 3300050508 nmdc:mga09592_48745_c1 nmdc:mga09592_48745_c1_1515_2504 328
459 3300050510 nmdc:mga06r32_110560_c1 nmdc:mga06r32_110560_c1_1002_2000 328
460 3300050510 nmdc:mga06r32_135857_c1 nmdc:mga06r32_135857_c1_530_1519 328
461 3300050510 nmdc:mga06r32_4342_c1 nmdc:mga06r32_4342_c1_2200_3189 328
462 3300050511 nmdc:mga08y16_426965_c1 nmdc:mga08y16_426965_c1_133_1122 328
463 3300050512 nmdc:mga0n895_173515_c1 nmdc:mga0n895_173515_c1_77_1066 328
464 3300050513 nmdc:mga0rr50_181999_c1 nmdc:mga0rr50_181999_c1_649_1662 328
465 3300050515 nmdc:mga0a205_169690_c1 nmdc:mga0a205_169690_c1_183_1172 328
466 3300053077 Ga0495601_0001946 Ga0495601_0001946_4552_5565 328
467 3300053077 Ga0495601_0008060 Ga0495601_0008060_4297_5304 328
468 3300053077 Ga0495601_0078051 Ga0495601_0078051_480_1466 328
469 3300053078 Ga0495612_0000072 Ga0495612_0000072_10220_11233 328
470 3300053096 Ga0500641_0006890 Ga0500641_0006890_2395_3381 328
471 3300054114 Ga0501084_0045098 Ga0501084_0045098_1828_2817 328
472 3300060353 Ga0501082_0173646 Ga0501082_0173646_549_1538 328
473 3300060353 Ga0501082_0206784 Ga0501082_0206784_279_1271 328
474 3300061719 Ga0466962_0088312 Ga0466962_0088312_305_1300 328
475 3300061734 Ga0530510_0048891 Ga0530510_0048891_541_1530 328
476 3300003203 JGI25406J46586_10035344 JGI25406J46586_100353442 329
477 3300005327 Ga0070658_10073527 Ga0070658_100735273 329
478 3300005329 Ga0070683_100042159 Ga0070683_1000421595 329
479 3300005329 Ga0070683_100075467 Ga0070683_1000754671 329
480 3300005329 Ga0070683_100376039 Ga0070683_1003760392 329
481 3300005330 Ga0070690_100062046 Ga0070690_1000620462 329
482 3300005334 Ga0068869_100139148 Ga0068869_1001391482 329
483 3300005335 Ga0070666_10012316 Ga0070666_100123166 329
484 3300005336 Ga0070680_100166436 Ga0070680_1001664361 329
485 3300005339 Ga0070660_100024817 Ga0070660_1000248175 329
486 3300005366 Ga0070659_100068926 Ga0070659_1000689262 329
487 3300005367 Ga0070667_100004009 Ga0070667_1000040093 329
488 3300005439 Ga0070711_100097109 Ga0070711_1000971092 329
489 3300005455 Ga0070663_100078773 Ga0070663_1000787732 329
490 3300005466 Ga0070685_10045276 Ga0070685_100452762 329
491 3300005530 Ga0070679_100030794 Ga0070679_1000307944 329
492 3300005530 Ga0070679_100083807 Ga0070679_1000838072 329
493 3300005535 Ga0070684_100323033 Ga0070684_1003230332 329
494 3300005548 Ga0070665_100009749 Ga0070665_10000974911 329
495 3300005563 Ga0068855_100590323 Ga0068855_1005903232 329
496 3300005564 Ga0070664_100154111 Ga0070664_1001541112 329
497 3300005614 Ga0068856_100025704 Ga0068856_1000257044 329
498 3300005615 Ga0070702_100071332 Ga0070702_1000713322 329
499 3300005616 Ga0068852_100046949 Ga0068852_1000469493 329
500 3300005617 Ga0068859_100205860 Ga0068859_1002058601 329
501 3300005937 Ga0081455_10025676 Ga0081455_100256765 329
502 3300005981 Ga0081538_10000035 Ga0081538_1000003572 329
503 3300005981 Ga0081538_10002436 Ga0081538_100024364 329
504 3300005981 Ga0081538_10012736 Ga0081538_100127362 329
505 3300005981 Ga0081538_10042930 Ga0081538_100429304 329
506 3300005981 Ga0081538_10081679 Ga0081538_100816792 329
507 3300005985 Ga0081539_10057279 Ga0081539_100572792 329
508 3300006038 Ga0075365_10018927 Ga0075365_100189274 329
509 3300006237 Ga0097621_100045919 Ga0097621_1000459192 329
510 3300006846 Ga0075430_100004849 Ga0075430_10000484911 329
511 3300006852 Ga0075433_10107486 Ga0075433_101074863 329
512 3300006871 Ga0075434_100092872 Ga0075434_1000928722 329
513 3300006931 Ga0097620_100205850 Ga0097620_1002058501 329
514 3300007076 Ga0075435_100037672 Ga0075435_1000376724 329
515 3300009098 Ga0105245_10065785 Ga0105245_100657852 329
516 3300009148 Ga0105243_10312181 Ga0105243_103121811 329
517 3300009176 Ga0105242_10137492 Ga0105242_101374922 329
518 3300009551 Ga0105238_10231600 Ga0105238_102316002 329
519 3300009553 Ga0105249_10089249 Ga0105249_100892492 329
520 3300013307 Ga0157372_10235069 Ga0157372_102350692 329
521 3300025899 Ga0207642_10101382 Ga0207642_101013821 329
522 3300025908 Ga0207643_10077699 Ga0207643_100776992 329
523 3300025914 Ga0207671_10123230 Ga0207671_101232301 329
524 3300025916 Ga0207663_10084925 Ga0207663_100849252 329
525 3300025919 Ga0207657_10124941 Ga0207657_101249412 329
526 3300025919 Ga0207657_10254047 Ga0207657_102540471 329
527 3300025921 Ga0207652_10023036 Ga0207652_100230364 329
528 3300025927 Ga0207687_10116589 Ga0207687_101165892 329
529 3300025932 Ga0207690_10092269 Ga0207690_100922692 329
530 3300025932 Ga0207690_10104340 Ga0207690_101043402 329
531 3300025944 Ga0207661_10109553 Ga0207661_101095533 329
532 3300025944 Ga0207661_10254744 Ga0207661_102547441 329
533 3300025944 Ga0207661_10391491 Ga0207661_103914911 329
534 3300025945 Ga0207679_10009512 Ga0207679_100095122 329
535 3300026023 Ga0207677_10317993 Ga0207677_103179932 329
536 3300026067 Ga0207678_10024623 Ga0207678_100246231 329
537 3300026075 Ga0207708_10099467 Ga0207708_100994672 329
538 3300026116 Ga0207674_10021899 Ga0207674_100218997 329
539 3300028379 Ga0268266_10001143 Ga0268266_1000114310 329
540 3300031852 Ga0307410_10153873 Ga0307410_101538732 329
541 3300031852 Ga0307410_10218850 Ga0307410_102188502 329
542 3300031901 Ga0307406_10230666 Ga0307406_102306662 329
543 3300031903 Ga0307407_10014776 Ga0307407_100147762 329
544 3300031995 Ga0307409_100147053 Ga0307409_1001470532 329
545 3300031995 Ga0307409_100181402 Ga0307409_1001814022 329
546 3300032002 Ga0307416_100092075 Ga0307416_1000920752 329
547 3300032005 Ga0307411_10143917 Ga0307411_101439172 329
548 3300037312 Ga0395899_0020569 Ga0395899_0020569_552_1547 329
549 3300037418 Ga0395900_0019376 Ga0395900_0019376_4244_5239 329
550 3300037418 Ga0395900_0382200 Ga0395900_0382200_75_1085 329
551 3300037466 Ga0395898_0006287 Ga0395898_0006287_9510_10505 329
552 3300037466 Ga0395898_0122780 Ga0395898_0122780_777_1787 329
553 3300037466 Ga0395898_0201989 Ga0395898_0201989_591_1586 329
554 3300037471 Ga0395905_0170345 Ga0395905_0170345_987_1982 329
555 3300038443 Ga0395901_0278375 Ga0395901_0278375_332_1342 329
556 3300038443 Ga0395901_0369543 Ga0395901_0369543_260_1255 329
557 3300042008 Ga0439450_021683 Ga0439450_021683_56_1066 329
558 3300044719 Ga0466971_0062070 Ga0466971_0062070_424_1422 329
559 3300045976 Ga0466967_0092564 Ga0466967_0092564_1504_2517 329
560 3300045976 Ga0466967_0102252 Ga0466967_0102252_954_1958 329
561 3300046474 Ga0495605_0075081 Ga0495605_0075081_296_1294 329
562 3300046491 Ga0495584_0020785 Ga0495584_0020785_1775_2773 329
563 3300046543 Ga0495645_0001238 Ga0495645_0001238_867_1967 329
564 3300046558 Ga0495633_0118090 Ga0495633_0118090_48_1058 329
565 3300046642 Ga0495634_0005924 Ga0495634_0005924_4959_5948 329
566 3300047321 Ga0495676_0057767 Ga0495676_0057767_277_1356 329
567 3300047472 Ga0495686_0198100 Ga0495686_0198100_42_1046 329
568 3300048904 Ga0496101_0301027 Ga0496101_0301027_60_1055 329
569 3300048905 Ga0496102_0033594 Ga0496102_0033594_1618_2616 329
570 3300048905 Ga0496102_0163015 Ga0496102_0163015_522_1517 329
571 3300048906 Ga0496103_0144315 Ga0496103_0144315_429_1424 329
572 3300048906 Ga0496103_0199585 Ga0496103_0199585_25_1023 329
573 3300048907 Ga0496104_0004472 Ga0496104_0004472_5263_6261 329
574 3300048907 Ga0496104_0058518 Ga0496104_0058518_501_1496 329
575 3300048909 Ga0496106_0077535 Ga0496106_0077535_374_1372 329
576 3300048910 Ga0496107_0247112 Ga0496107_0247112_98_1108 329
577 3300048911 Ga0496108_0001085 Ga0496108_0001085_19063_20061 329
578 3300048912 Ga0496109_0000881 Ga0496109_0000881_3291_4289 329
579 3300048912 Ga0496109_0060520 Ga0496109_0060520_1269_2267 329
580 3300048913 Ga0496110_0006226 Ga0496110_0006226_2965_3963 329
581 3300048913 Ga0496110_0072112 Ga0496110_0072112_1775_2773 329
582 3300048913 Ga0496110_0138520 Ga0496110_0138520_352_1347 329
583 3300048914 Ga0496111_0008983 Ga0496111_0008983_3349_4347 329
584 3300048914 Ga0496111_0171777 Ga0496111_0171777_328_1317 329
585 3300048915 Ga0496112_0035847 Ga0496112_0035847_1519_2517 329
586 3300048915 Ga0496112_0071816 Ga0496112_0071816_1156_2154 329
587 3300048915 Ga0496112_0211771 Ga0496112_0211771_258_1247 329
588 3300048916 Ga0496113_0056576 Ga0496113_0056576_1687_2676 329
589 3300048916 Ga0496113_0366270 Ga0496113_0366270_32_1030 329
590 3300048919 Ga0496116_0000360 Ga0496116_0000360_48056_49051 329
591 3300048920 Ga0496117_0006636 Ga0496117_0006636_61_1056 329
592 3300048921 Ga0496118_0001416 Ga0496118_0001416_27076_28071 329
593 3300048921 Ga0496118_0057207 Ga0496118_0057207_1340_2335 329
594 3300048922 Ga0496119_0002006 Ga0496119_0002006_8256_9251 329
595 3300048922 Ga0496119_0002714 Ga0496119_0002714_15686_16681 329
596 3300048922 Ga0496119_0016372 Ga0496119_0016372_1923_2918 329
597 3300048923 Ga0496120_0005529 Ga0496120_0005529_5591_6586 329
598 3300048924 Ga0496121_0016970 Ga0496121_0016970_1061_2056 329
599 3300048924 Ga0496121_0045460 Ga0496121_0045460_1368_2363 329
600 3300048928 Ga0496125_0043665 Ga0496125_0043665_347_1342 329
601 3300048928 Ga0496125_0085847 Ga0496125_0085847_51_1046 329
602 3300048929 Ga0496126_0351118 Ga0496126_0351118_136_1131 329
603 3300048929 Ga0496126_0413818 Ga0496126_0413818_39_1034 329
604 3300049568 Ga0501031_0000355 Ga0501031_0000355_4026_5021 329
605 3300049569 Ga0501032_0000734 Ga0501032_0000734_3978_4973 329
606 3300049570 Ga0501033_0000927 Ga0501033_0000927_4139_5134 329
607 3300049571 Ga0501034_0008505 Ga0501034_0008505_4433_5428 329
608 3300049572 Ga0501036_0000548 Ga0501036_0000548_21662_22657 329
609 3300049573 Ga0501037_0000599 Ga0501037_0000599_5454_6449 329
610 3300049574 Ga0501038_0000788 Ga0501038_0000788_21645_22640 329
611 3300049575 Ga0501039_0004109 Ga0501039_0004109_387_1382 329
612 3300049579 Ga0501043_0000871 Ga0501043_0000871_21661_22656 329
613 3300049580 Ga0501046_0000669 Ga0501046_0000669_21619_22614 329
614 3300049581 Ga0501047_0001012 Ga0501047_0001012_21661_22656 329
615 3300049581 Ga0501047_0107547 Ga0501047_0107547_1482_2477 329
616 3300049581 Ga0501047_0320663 Ga0501047_0320663_63_1061 329
617 3300049582 Ga0501048_0001025 Ga0501048_0001025_14446_15441 329
618 3300049584 Ga0501068_0196300 Ga0501068_0196300_10_1005 329
619 3300049585 Ga0501069_0014111 Ga0501069_0014111_1219_2214 329
620 3300049586 Ga0501070_0000466 Ga0501070_0000466_21661_22656 329
621 3300049589 Ga0501073_0000981 Ga0501073_0000981_16084_17079 329
622 3300049590 Ga0501074_0008085 Ga0501074_0008085_4128_5123 329
623 3300049741 Ga0501079_0009854 Ga0501079_0009854_3136_4131 329
624 3300049742 Ga0501080_0002687 Ga0501080_0002687_13038_14033 329
625 3300049744 Ga0501083_0000531 Ga0501083_0000531_19416_20411 329
626 3300049744 Ga0501083_0010094 Ga0501083_0010094_2993_3991 329
627 3300049744 Ga0501083_0027051 Ga0501083_0027051_2010_3005 329
628 3300049822 Ga0501035_0001127 Ga0501035_0001127_5266_6261 329
629 3300049822 Ga0501035_0090471 Ga0501035_0090471_513_1508 329
630 3300049823 Ga0501044_0001423 Ga0501044_0001423_21661_22656 329
631 3300049823 Ga0501044_0081576 Ga0501044_0081576_277_1272 329
632 3300049824 Ga0501045_0006965 Ga0501045_0006965_4043_5038 329
633 3300050491 nmdc:mga00v17_94822_c1 nmdc:mga00v17_94822_c1_594_1586 329
634 3300050509 nmdc:mga0qj67_7661_c1 nmdc:mga0qj67_7661_c1_5592_6590 329
635 3300050511 nmdc:mga08y16_32841_c1 nmdc:mga08y16_32841_c1_3576_4586 329
636 3300050512 nmdc:mga0n895_91074_c1 nmdc:mga0n895_91074_c1_62_1060 329
637 3300050514 nmdc:mga08x19_323939_c1 nmdc:mga08x19_323939_c1_63_1058 329
638 3300053078 Ga0495612_0000022 Ga0495612_0000022_85456_86445 329
639 3300053085 Ga0495619_0019032 Ga0495619_0019032_2585_3628 329
640 3300060353 Ga0501082_0014568 Ga0501082_0014568_2152_3147 329
641 3300005328 Ga0070676_10115690 Ga0070676_101156902 330
642 3300005337 Ga0070682_100000017 Ga0070682_10000001786 330
643 3300005338 Ga0068868_100116141 Ga0068868_1001161412 330
644 3300005344 Ga0070661_100087761 Ga0070661_1000877612 330
645 3300005345 Ga0070692_10029433 Ga0070692_100294332 330
646 3300005355 Ga0070671_100306354 Ga0070671_1003063541 330
647 3300005356 Ga0070674_100117209 Ga0070674_1001172092 330
648 3300005364 Ga0070673_100047121 Ga0070673_1000471215 330
649 3300005439 Ga0070711_100244943 Ga0070711_1002449432 330
650 3300005441 Ga0070700_100021303 Ga0070700_1000213035 330
651 3300005445 Ga0070708_100340298 Ga0070708_1003402981 330
652 3300005455 Ga0070663_100152699 Ga0070663_1001526992 330
653 3300005456 Ga0070678_100015270 Ga0070678_1000152702 330
654 3300005458 Ga0070681_10056027 Ga0070681_100560274 330
655 3300005459 Ga0068867_100045794 Ga0068867_1000457942 330
656 3300005466 Ga0070685_10042553 Ga0070685_100425532 330
657 3300005530 Ga0070679_100000245 Ga0070679_1000002459 330
658 3300005539 Ga0068853_100240043 Ga0068853_1002400432 330
659 3300005544 Ga0070686_100107402 Ga0070686_1001074022 330
660 3300005548 Ga0070665_100000040 Ga0070665_100000040287 330
661 3300005549 Ga0070704_100028722 Ga0070704_1000287224 330
662 3300005614 Ga0068856_100003952 Ga0068856_10000395214 330
663 3300005614 Ga0068856_100273226 Ga0068856_1002732262 330
664 3300005616 Ga0068852_100569808 Ga0068852_1005698081 330
665 3300005719 Ga0068861_100089830 Ga0068861_1000898302 330
666 3300005841 Ga0068863_100000170 Ga0068863_10000017028 330
667 3300005842 Ga0068858_100001457 Ga0068858_10000145710 330
668 3300005842 Ga0068858_100108226 Ga0068858_1001082263 330
669 3300005937 Ga0081455_10034998 Ga0081455_100349984 330
670 3300006038 Ga0075365_10042336 Ga0075365_100423364 330
671 3300006038 Ga0075365_10157485 Ga0075365_101574851 330
672 3300006038 Ga0075365_10273791 Ga0075365_102737911 330
673 3300006048 Ga0075363_100066793 Ga0075363_1000667932 330
674 3300006173 Ga0070716_100084330 Ga0070716_1000843303 330
675 3300006175 Ga0070712_100005751 Ga0070712_1000057512 330
676 3300006847 Ga0075431_100031776 Ga0075431_1000317766 330
677 3300006852 Ga0075433_10000556 Ga0075433_1000055617 330
678 3300006871 Ga0075434_100020344 Ga0075434_1000203446 330
679 3300006881 Ga0068865_100120979 Ga0068865_1001209792 330
680 3300009094 Ga0111539_10050403 Ga0111539_100504034 330
681 3300009098 Ga0105245_10002293 Ga0105245_100022937 330
682 3300009147 Ga0114129_10023002 Ga0114129_100230023 330
683 3300009147 Ga0114129_10036577 Ga0114129_100365777 330
684 3300009147 Ga0114129_10769486 Ga0114129_107694862 330
685 3300009148 Ga0105243_10040129 Ga0105243_100401291 330
686 3300009176 Ga0105242_10059700 Ga0105242_100597002 330
687 3300009177 Ga0105248_10372090 Ga0105248_103720902 330
688 3300011119 Ga0105246_10179186 Ga0105246_101791862 330
689 3300013296 Ga0157374_10015151 Ga0157374_100151511 330
690 3300013306 Ga0163162_10072950 Ga0163162_100729503 330
691 3300013306 Ga0163162_10334238 Ga0163162_103342382 330
692 3300014968 Ga0157379_10225573 Ga0157379_102255731 330
693 3300025901 Ga0207688_10137918 Ga0207688_101379182 330
694 3300025907 Ga0207645_10163847 Ga0207645_101638472 330
695 3300025912 Ga0207707_10041141 Ga0207707_100411415 330
696 3300025915 Ga0207693_10008348 Ga0207693_100083489 330
697 3300025916 Ga0207663_10243367 Ga0207663_102433672 330
698 3300025921 Ga0207652_10001906 Ga0207652_100019069 330
699 3300025932 Ga0207690_10112246 Ga0207690_101122462 330
700 3300025937 Ga0207669_10163373 Ga0207669_101633732 330
701 3300025938 Ga0207704_10031608 Ga0207704_100316083 330
702 3300025939 Ga0207665_10056858 Ga0207665_100568583 330
703 3300025942 Ga0207689_10208465 Ga0207689_102084652 330
704 3300025944 Ga0207661_10255974 Ga0207661_102559742 330
705 3300025961 Ga0207712_10061889 Ga0207712_100618893 330
706 3300025961 Ga0207712_10063009 Ga0207712_100630093 330
707 3300025981 Ga0207640_10043408 Ga0207640_100434082 330
708 3300026023 Ga0207677_10024474 Ga0207677_100244743 330
709 3300026035 Ga0207703_10000078 Ga0207703_1000007811 330
710 3300026041 Ga0207639_10000747 Ga0207639_100007479 330
711 3300026067 Ga0207678_10239182 Ga0207678_102391822 330
712 3300026075 Ga0207708_10019391 Ga0207708_100193916 330
713 3300026078 Ga0207702_10003603 Ga0207702_1000360314 330
714 3300026088 Ga0207641_10000301 Ga0207641_1000030131 330
715 3300026118 Ga0207675_100038624 Ga0207675_1000386245 330
716 3300026121 Ga0207683_10027531 Ga0207683_100275312 330
717 3300026142 Ga0207698_10589241 Ga0207698_105892411 330
718 3300027907 Ga0207428_10020740 Ga0207428_100207407 330
719 3300028379 Ga0268266_10000045 Ga0268266_10000045288 330
720 3300028381 Ga0268264_10376295 Ga0268264_103762952 330
721 3300031731 Ga0307405_10150056 Ga0307405_101500562 330
722 3300031901 Ga0307406_10136958 Ga0307406_101369582 330
723 3300032002 Ga0307416_100056695 Ga0307416_1000566952 330
724 3300032126 Ga0307415_100199266 Ga0307415_1001992662 330
725 3300034816 Ga0373930_0023452 Ga0373930_0023452_161_1165 330
726 3300035120 Ga0373957_0070803 Ga0373957_0070803_280_1272 330
727 3300036401 Ga0373937_0039385 Ga0373937_0039385_1540_2532 330
728 3300037312 Ga0395899_0026257 Ga0395899_0026257_146_1144 330
729 3300037418 Ga0395900_0046056 Ga0395900_0046056_3466_4464 330
730 3300037466 Ga0395898_0002543 Ga0395898_0002543_5526_6524 330
731 3300037471 Ga0395905_0006210 Ga0395905_0006210_1593_2591 330
732 3300045976 Ga0466967_0240892 Ga0466967_0240892_167_1174 330
733 3300046459 Ga0495629_0029468 Ga0495629_0029468_469_1461 330
734 3300046461 Ga0495641_0000050 Ga0495641_0000050_69642_70634 330
735 3300046473 Ga0495582_0071872 Ga0495582_0071872_51_1052 330
736 3300046511 Ga0495608_0010082 Ga0495608_0010082_4021_5013 330
737 3300046535 Ga0495586_0008489 Ga0495586_0008489_1347_2339 330
738 3300046663 Ga0495635_0071907 Ga0495635_0071907_880_1872 330
739 3300046681 Ga0495647_0001315 Ga0495647_0001315_5243_6235 330
740 3300046690 Ga0495624_0052824 Ga0495624_0052824_81_1073 330
741 3300047317 Ga0495604_0037209 Ga0495604_0037209_221_1213 330
742 3300047321 Ga0495676_0001265 Ga0495676_0001265_14932_15924 330
743 3300047322 Ga0495680_0002644 Ga0495680_0002644_11195_12187 330
744 3300048903 Ga0496100_0343536 Ga0496100_0343536_98_1105 330
745 3300048904 Ga0496101_0047037 Ga0496101_0047037_1867_2868 330
746 3300048905 Ga0496102_0010557 Ga0496102_0010557_5545_6546 330
747 3300048906 Ga0496103_0001442 Ga0496103_0001442_9539_10540 330
748 3300048907 Ga0496104_0042574 Ga0496104_0042574_2448_3449 330
749 3300048908 Ga0496105_0019110 Ga0496105_0019110_1695_2696 330
750 3300048909 Ga0496106_0006922 Ga0496106_0006922_470_1471 330
751 3300048911 Ga0496108_0070701 Ga0496108_0070701_400_1401 330
752 3300048912 Ga0496109_0067792 Ga0496109_0067792_466_1467 330
753 3300048913 Ga0496110_0009280 Ga0496110_0009280_1197_2189 330
754 3300048913 Ga0496110_0125716 Ga0496110_0125716_574_1575 330
755 3300048916 Ga0496113_0054110 Ga0496113_0054110_1887_2888 330
756 3300048917 Ga0496114_0027378 Ga0496114_0027378_2080_3072 330
757 3300048917 Ga0496114_0041570 Ga0496114_0041570_957_1958 330
758 3300048918 Ga0496115_0015221 Ga0496115_0015221_3881_4882 330
759 3300049575 Ga0501039_0036116 Ga0501039_0036116_1647_2645 330
760 3300049588 Ga0501072_0030202 Ga0501072_0030202_1978_2976 330
761 3300049588 Ga0501072_0032899 Ga0501072_0032899_123_1133 330
762 3300049591 Ga0501075_0216565 Ga0501075_0216565_394_1392 330
763 3300049592 Ga0501076_0004141 Ga0501076_0004141_356_1354 330
764 3300049743 Ga0501081_0059551 Ga0501081_0059551_1290_2288 330
765 3300050492 nmdc:mga0yw44_4753_c1 nmdc:mga0yw44_4753_c1_3625_4626 330
766 3300050492 nmdc:mga0yw44_54693_c1 nmdc:mga0yw44_54693_c1_684_1685 330
767 3300050494 nmdc:mga06z11_50203_c1 nmdc:mga06z11_50203_c1_32_1069 330
768 3300050507 nmdc:mga05p37_160696_c1 nmdc:mga05p37_160696_c1_328_1329 330
769 3300050507 nmdc:mga05p37_284307_c1 nmdc:mga05p37_284307_c1_136_1137 330
770 3300050507 nmdc:mga05p37_39716_c1 nmdc:mga05p37_39716_c1_793_1794 330
771 3300050510 nmdc:mga06r32_49434_c1 nmdc:mga06r32_49434_c1_1222_2223 330
772 3300050511 nmdc:mga08y16_10720_c1 nmdc:mga08y16_10720_c1_5425_6426 330
773 3300050512 nmdc:mga0n895_18266_c1 nmdc:mga0n895_18266_c1_4200_5201 330
774 3300050515 nmdc:mga0a205_40657_c1 nmdc:mga0a205_40657_c1_762_1763 330
775 3300050515 nmdc:mga0a205_6_c1 nmdc:mga0a205_6_c1_34656_35651 330
776 3300053077 Ga0495601_0000617 Ga0495601_0000617_14101_15093 330
777 3300053123 Ga0500614_003327 Ga0500614_003327_1312_2304 330
778 3300001979 JGI24740J21852_10008667 JGI24740J21852_100086672 331
779 3300005333 Ga0070677_10000190 Ga0070677_1000019011 331
780 3300005344 Ga0070661_100000492 Ga0070661_10000049214 331
781 3300005356 Ga0070674_100000005 Ga0070674_100000005171 331
782 3300005356 Ga0070674_100000009 Ga0070674_100000009130 331
783 3300005364 Ga0070673_100022147 Ga0070673_1000221474 331
784 3300005365 Ga0070688_100000069 Ga0070688_10000006911 331
785 3300005436 Ga0070713_100000079 Ga0070713_10000007945 331
786 3300005456 Ga0070678_100288326 Ga0070678_1002883261 331
787 3300005459 Ga0068867_100002520 Ga0068867_10000252012 331
788 3300005466 Ga0070685_10000024 Ga0070685_1000002462 331
789 3300005548 Ga0070665_100004387 Ga0070665_1000043872 331
790 3300005563 Ga0068855_100112334 Ga0068855_1001123343 331
791 3300005577 Ga0068857_100226217 Ga0068857_1002262172 331
792 3300005578 Ga0068854_100098115 Ga0068854_1000981152 331
793 3300005614 Ga0068856_100000635 Ga0068856_10000063540 331
794 3300005718 Ga0068866_10000003 Ga0068866_1000000313 331
795 3300005718 Ga0068866_10000389 Ga0068866_100003898 331
796 3300005834 Ga0068851_10000339 Ga0068851_1000033917 331
797 3300005841 Ga0068863_100075609 Ga0068863_1000756092 331
798 3300005937 Ga0081455_10089357 Ga0081455_100893574 331
799 3300005981 Ga0081538_10050023 Ga0081538_100500233 331
800 3300005983 Ga0081540_1073886 Ga0081540_10738861 331
801 3300006163 Ga0070715_10000001 Ga0070715_10000001534 331
802 3300006175 Ga0070712_100012205 Ga0070712_1000122056 331
803 3300009098 Ga0105245_10015606 Ga0105245_100156062 331
804 3300009101 Ga0105247_10000892 Ga0105247_1000089215 331
805 3300009551 Ga0105238_10000009 Ga0105238_1000000933 331
806 3300009553 Ga0105249_10000050 Ga0105249_10000050142 331
807 3300013102 Ga0157371_10002052 Ga0157371_1000205218 331
808 3300013104 Ga0157370_10036245 Ga0157370_100362456 331
809 3300014326 Ga0157380_10000167 Ga0157380_1000016727 331
810 3300014326 Ga0157380_10000179 Ga0157380_1000017921 331
811 3300014968 Ga0157379_10015709 Ga0157379_100157091 331
812 3300025321 Ga0207656_10000124 Ga0207656_1000012417 331
813 3300025885 Ga0207653_10074537 Ga0207653_100745371 331
814 3300025893 Ga0207682_10000045 Ga0207682_1000004542 331
815 3300025899 Ga0207642_10000002 Ga0207642_10000002264 331
816 3300025899 Ga0207642_10000238 Ga0207642_1000023811 331
817 3300025900 Ga0207710_10000548 Ga0207710_100005489 331
818 3300025900 Ga0207710_10048481 Ga0207710_100484812 331
819 3300025905 Ga0207685_10000005 Ga0207685_10000005198 331
820 3300025913 Ga0207695_10005035 Ga0207695_100050352 331
821 3300025914 Ga0207671_10001437 Ga0207671_1000143722 331
822 3300025915 Ga0207693_10016044 Ga0207693_100160442 331
823 3300025918 Ga0207662_10072934 Ga0207662_100729342 331
824 3300025920 Ga0207649_10000009 Ga0207649_1000000945 331
825 3300025924 Ga0207694_10000004 Ga0207694_10000004262 331
826 3300025927 Ga0207687_10000013 Ga0207687_10000013236 331
827 3300025927 Ga0207687_10015729 Ga0207687_100157294 331
828 3300025928 Ga0207700_10000007 Ga0207700_1000000776 331
829 3300025937 Ga0207669_10000001 Ga0207669_10000001278 331
830 3300025937 Ga0207669_10000006 Ga0207669_1000000622 331
831 3300025944 Ga0207661_10000707 Ga0207661_100007072 331
832 3300025949 Ga0207667_10043085 Ga0207667_100430853 331
833 3300025960 Ga0207651_10014173 Ga0207651_100141734 331
834 3300025961 Ga0207712_10000019 Ga0207712_1000001926 331
835 3300025981 Ga0207640_10005821 Ga0207640_100058217 331
836 3300025986 Ga0207658_10139099 Ga0207658_101390992 331
837 3300026078 Ga0207702_10000360 Ga0207702_1000036044 331
838 3300026088 Ga0207641_10035210 Ga0207641_100352103 331
839 3300026089 Ga0207648_10017132 Ga0207648_100171326 331
840 3300026121 Ga0207683_10093205 Ga0207683_100932053 331
841 3300041491 Ga0451833_0087528 Ga0451833_0087528_560_1558 331
842 3300044694 Ga0466963_0000075 Ga0466963_0000075_21919_22914 331
843 3300044842 Ga0466957_0003008 Ga0466957_0003008_793_1788 331
844 3300045976 Ga0466967_0000019 Ga0466967_0000019_10082_11077 331
845 3300045976 Ga0466967_0129745 Ga0466967_0129745_1117_2124 331
846 3300046455 Ga0495603_0006166 Ga0495603_0006166_2454_3449 331
847 3300046459 Ga0495629_0001110 Ga0495629_0001110_18011_19006 331
848 3300046461 Ga0495641_0136187 Ga0495641_0136187_40_1035 331
849 3300046473 Ga0495582_0000004 Ga0495582_0000004_83130_84125 331
850 3300046507 Ga0495606_0000072 Ga0495606_0000072_159832_160827 331
851 3300046514 Ga0495618_0000008 Ga0495618_0000008_191934_192929 331
852 3300046515 Ga0495620_0000247 Ga0495620_0000247_31040_32035 331
853 3300046516 Ga0495628_0065563 Ga0495628_0065563_1395_2390 331
854 3300046517 Ga0495630_0000012 Ga0495630_0000012_60011_61006 331
855 3300046517 Ga0495630_0233502 Ga0495630_0233502_374_1369 331
856 3300046523 Ga0495644_0001127 Ga0495644_0001127_157_1152 331
857 3300046559 Ga0495667_0119247 Ga0495667_0119247_321_1316 331
858 3300046678 Ga0495599_0038243 Ga0495599_0038243_1855_2850 331
859 3300046681 Ga0495647_0018848 Ga0495647_0018848_1392_2387 331
860 3300046683 Ga0495658_0000004 Ga0495658_0000004_55431_56426 331
861 3300046684 Ga0495669_0000030 Ga0495669_0000030_23149_24144 331
862 3300046689 Ga0495613_0000850 Ga0495613_0000850_20946_21941 331
863 3300046690 Ga0495624_0007692 Ga0495624_0007692_62_1057 331
864 3300046809 Ga0495600_0014884 Ga0495600_0014884_2538_3533 331
865 3300047317 Ga0495604_0000071 Ga0495604_0000071_18053_19048 331
866 3300047317 Ga0495604_0000106 Ga0495604_0000106_57396_58391 331
867 3300047317 Ga0495604_0011719 Ga0495604_0011719_4538_5533 331
868 3300047319 Ga0495674_0000019 Ga0495674_0000019_8345_9340 331
869 3300047320 Ga0495672_0005626 Ga0495672_0005626_8293_9348 331
870 3300047322 Ga0495680_0000569 Ga0495680_0000569_37173_38171 331
871 3300047471 Ga0495684_0119730 Ga0495684_0119730_632_1630 331
872 3300048088 Ga0495602_0000142 Ga0495602_0000142_43991_44986 331
873 3300048088 Ga0495602_0102358 Ga0495602_0102358_1218_2213 331
874 3300048903 Ga0496100_0000010 Ga0496100_0000010_117211_118206 331
875 3300048904 Ga0496101_0000025 Ga0496101_0000025_117211_118206 331
876 3300048907 Ga0496104_0000004 Ga0496104_0000004_504996_505991 331
877 3300048907 Ga0496104_0000009 Ga0496104_0000009_415048_416043 331
878 3300048908 Ga0496105_0000001 Ga0496105_0000001_135840_136835 331
879 3300048908 Ga0496105_0000007 Ga0496105_0000007_72013_73008 331
880 3300048909 Ga0496106_0000012 Ga0496106_0000012_86971_87966 331
881 3300048909 Ga0496106_0000041 Ga0496106_0000041_95296_96291 331
882 3300048910 Ga0496107_0000010 Ga0496107_0000010_86983_87978 331
883 3300048911 Ga0496108_0000001 Ga0496108_0000001_853500_854495 331
884 3300048912 Ga0496109_0000004 Ga0496109_0000004_107311_108306 331
885 3300048912 Ga0496109_0000075 Ga0496109_0000075_2821_3816 331
886 3300048914 Ga0496111_0032669 Ga0496111_0032669_1970_3043 331
887 3300048915 Ga0496112_0045466 Ga0496112_0045466_1852_2847 331
888 3300048916 Ga0496113_0000052 Ga0496113_0000052_38511_39506 331
889 3300048916 Ga0496113_0239549 Ga0496113_0239549_43_1038 331
890 3300048917 Ga0496114_0000074 Ga0496114_0000074_58367_59362 331
891 3300048918 Ga0496115_0000010 Ga0496115_0000010_9814_10809 331
892 3300048918 Ga0496115_0002588 Ga0496115_0002588_34_1029 331
893 3300048922 Ga0496119_0036375 Ga0496119_0036375_840_1835 331
894 3300049575 Ga0501039_0241299 Ga0501039_0241299_74_1072 331
895 3300049586 Ga0501070_0264256 Ga0501070_0264256_256_1251 331
896 3300049588 Ga0501072_0011877 Ga0501072_0011877_3253_4251 331
897 3300049743 Ga0501081_0204670 Ga0501081_0204670_57_1052 331
898 3300053077 Ga0495601_0000027 Ga0495601_0000027_62430_63425 331
899 3300053078 Ga0495612_0001004 Ga0495612_0001004_9192_10187 331
900 3300053078 Ga0495612_0007683 Ga0495612_0007683_1451_2446 331
901 3300053085 Ga0495619_0000010 Ga0495619_0000010_182318_183313 331
902 3300053094 Ga0500566_0001344 Ga0500566_0001344_1467_2462 331
903 3300060353 Ga0501082_0367066 Ga0501082_0367066_192_1187 331
904 3300002074 JGI24748J21848_1001192 JGI24748J21848_10011922 332
905 3300002239 JGI24034J26672_10002685 JGI24034J26672_100026852 332
906 3300002244 JGI24742J22300_10005449 JGI24742J22300_100054492 332
907 3300005329 Ga0070683_100025124 Ga0070683_1000251242 332
908 3300005337 Ga0070682_100000049 Ga0070682_10000004922 332
909 3300005338 Ga0068868_100000026 Ga0068868_10000002655 332
910 3300005340 Ga0070689_100137471 Ga0070689_1001374712 332
911 3300005341 Ga0070691_10011263 Ga0070691_100112633 332
912 3300005435 Ga0070714_100075381 Ga0070714_1000753812 332
913 3300005457 Ga0070662_100000009 Ga0070662_10000000924 332
914 3300005535 Ga0070684_100057855 Ga0070684_1000578552 332
915 3300005543 Ga0070672_100000283 Ga0070672_10000028315 332
916 3300005618 Ga0068864_100000031 Ga0068864_100000031166 332
917 3300005981 Ga0081538_10000103 Ga0081538_1000010324 332
918 3300005985 Ga0081539_10010669 Ga0081539_100106698 332
919 3300005985 Ga0081539_10116686 Ga0081539_101166862 332
920 3300006914 Ga0075436_100057057 Ga0075436_1000570572 332
921 3300009176 Ga0105242_10000473 Ga0105242_1000047313 332
922 3300013307 Ga0157372_10000610 Ga0157372_1000061010 332
923 3300017792 Ga0163161_10000021 Ga0163161_1000002191 332
924 3300025929 Ga0207664_10012727 Ga0207664_100127273 332
925 3300025932 Ga0207690_10072124 Ga0207690_100721242 332
926 3300025932 Ga0207690_10226983 Ga0207690_102269832 332
927 3300025933 Ga0207706_10000001 Ga0207706_10000001129 332
928 3300025934 Ga0207686_10000644 Ga0207686_1000064413 332
929 3300025936 Ga0207670_10021953 Ga0207670_100219532 332
930 3300025937 Ga0207669_10059794 Ga0207669_100597942 332
931 3300025940 Ga0207691_10000934 Ga0207691_1000093415 332
932 3300025944 Ga0207661_10012761 Ga0207661_100127612 332
933 3300026023 Ga0207677_10000106 Ga0207677_1000010642 332
934 3300026095 Ga0207676_10000031 Ga0207676_10000031165 332
935 3300028556 Ga0265337_1000006 Ga0265337_100000686 332
936 3300028558 Ga0265326_10000066 Ga0265326_1000006646 332
937 3300028654 Ga0265322_10000001 Ga0265322_10000001504 332
938 3300028666 Ga0265336_10002244 Ga0265336_100022448 332
939 3300029957 Ga0265324_10000563 Ga0265324_1000056313 332
940 3300031240 Ga0265320_10000002 Ga0265320_10000002503 332
941 3300031242 Ga0265329_10003034 Ga0265329_100030345 332
942 3300031249 Ga0265339_10011892 Ga0265339_100118922 332
943 3300031250 Ga0265331_10003440 Ga0265331_100034408 332
944 3300031251 Ga0265327_10000011 Ga0265327_10000011503 332
945 3300031344 Ga0265316_10008459 Ga0265316_100084599 332
946 3300031711 Ga0265314_10000726 Ga0265314_100007268 332
947 3300032126 Ga0307415_100029921 Ga0307415_1000299215 332
948 3300041512 Ga0451853_1497798 Ga0451853_1497798_52_1050 332
949 3300046455 Ga0495603_0000828 Ga0495603_0000828_5206_6204 332
950 3300046459 Ga0495629_0000145 Ga0495629_0000145_16565_17563 332
951 3300046462 Ga0495651_0110944 Ga0495651_0110944_187_1185 332
952 3300046463 Ga0495653_0050898 Ga0495653_0050898_899_1897 332
953 3300046463 Ga0495653_0252695 Ga0495653_0252695_138_1136 332
954 3300046476 Ga0495662_0012304 Ga0495662_0012304_1755_2753 332
955 3300046511 Ga0495608_0000023 Ga0495608_0000023_45961_46977 332
956 3300046511 Ga0495608_0000891 Ga0495608_0000891_10520_11518 332
957 3300046516 Ga0495628_0000165 Ga0495628_0000165_52992_53990 332
958 3300046516 Ga0495628_0001530 Ga0495628_0001530_18266_19264 332
959 3300046529 Ga0495652_0000346 Ga0495652_0000346_19577_20575 332
960 3300046529 Ga0495652_0013007 Ga0495652_0013007_2090_3088 332
961 3300046543 Ga0495645_0040166 Ga0495645_0040166_1337_2335 332
962 3300046559 Ga0495667_0000047 Ga0495667_0000047_63442_64440 332
963 3300046615 Ga0495656_0001137 Ga0495656_0001137_77_1075 332
964 3300046642 Ga0495634_0005892 Ga0495634_0005892_4893_5912 332
965 3300046642 Ga0495634_0048539 Ga0495634_0048539_252_1250 332
966 3300046663 Ga0495635_0000034 Ga0495635_0000034_50077_51075 332
967 3300046674 Ga0495588_0000422 Ga0495588_0000422_21657_22655 332
968 3300046675 Ga0495657_0000020 Ga0495657_0000020_45961_46977 332
969 3300046675 Ga0495657_0026853 Ga0495657_0026853_1478_2476 332
970 3300046678 Ga0495599_0149180 Ga0495599_0149180_28_1026 332
971 3300046689 Ga0495613_0000251 Ga0495613_0000251_1448_2452 332
972 3300046690 Ga0495624_0060732 Ga0495624_0060732_21_1019 332
973 3300047321 Ga0495676_0010945 Ga0495676_0010945_55_1053 332
974 3300047322 Ga0495680_0003506 Ga0495680_0003506_10117_11115 332
975 3300047444 Ga0495675_0000561 Ga0495675_0000561_2246_3262 332
976 3300047447 Ga0495685_015775 Ga0495685_015775_1410_2408 332
977 3300048088 Ga0495602_0013667 Ga0495602_0013667_1397_2395 332
978 3300048907 Ga0496104_0001329 Ga0496104_0001329_12463_13464 332
979 3300048908 Ga0496105_0000407 Ga0496105_0000407_8597_9598 332
980 3300048913 Ga0496110_0000200 Ga0496110_0000200_7600_8598 332
981 3300048914 Ga0496111_0000153 Ga0496111_0000153_15589_16587 332
982 3300048915 Ga0496112_0000013 Ga0496112_0000013_226178_227176 332
983 3300048916 Ga0496113_0030475 Ga0496113_0030475_1112_2110 332
984 3300049578 Ga0501042_0016286 Ga0501042_0016286_2986_3987 332
985 3300049591 Ga0501075_0001027 Ga0501075_0001027_8380_9378 332
986 3300050514 nmdc:mga08x19_49438_c1 nmdc:mga08x19_49438_c1_162_1160 332
987 3300053077 Ga0495601_0045549 Ga0495601_0045549_421_1419 332
988 3300053084 Ga0495595_0000022 Ga0495595_0000022_63622_64638 332
989 3300053084 Ga0495595_0000140 Ga0495595_0000140_27207_28205 332
990 3300053085 Ga0495619_0000070 Ga0495619_0000070_63561_64577 332
991 3300053085 Ga0495619_0002106 Ga0495619_0002106_10103_11101 332
992 3300053085 Ga0495619_0004729 Ga0495619_0004729_2969_3967 332
993 3300053085 Ga0495619_0004935 Ga0495619_0004935_5220_6218 332
994 3300001977 JGI24746J21847_1000008 JGI24746J21847_10000084 333
995 3300005338 Ga0068868_100056518 Ga0068868_1000565182 333
996 3300005347 Ga0070668_100003085 Ga0070668_10000308510 333
997 3300005354 Ga0070675_100000025 Ga0070675_10000002539 333
998 3300005365 Ga0070688_100000099 Ga0070688_10000009933 333
999 3300005366 Ga0070659_100010269 Ga0070659_1000102696 333
1000 3300005367 Ga0070667_100000625 Ga0070667_10000062515 333
1001 3300005466 Ga0070685_10000025 Ga0070685_1000002515 333
1002 3300005547 Ga0070693_100022499 Ga0070693_1000224992 333
1003 3300005549 Ga0070704_100252601 Ga0070704_1002526011 333
1004 3300005578 Ga0068854_100000065 Ga0068854_10000006524 333
1005 3300005614 Ga0068856_100024767 Ga0068856_1000247676 333
1006 3300005616 Ga0068852_100000094 Ga0068852_1000000949 333
1007 3300005616 Ga0068852_100383203 Ga0068852_1003832032 333
1008 3300005617 Ga0068859_100563043 Ga0068859_1005630432 333
1009 3300005718 Ga0068866_10094595 Ga0068866_100945952 333
1010 3300005834 Ga0068851_10010203 Ga0068851_100102037 333
1011 3300005841 Ga0068863_100007521 Ga0068863_1000075217 333
1012 3300005842 Ga0068858_100000069 Ga0068858_10000006988 333
1013 3300005843 Ga0068860_100174128 Ga0068860_1001741282 333
1014 3300005844 Ga0068862_100001642 Ga0068862_10000164210 333
1015 3300005937 Ga0081455_10012576 Ga0081455_100125767 333
1016 3300006846 Ga0075430_100103456 Ga0075430_1001034562 333
1017 3300006881 Ga0068865_100000034 Ga0068865_1000000342 333
1018 3300006931 Ga0097620_100563100 Ga0097620_1005631002 333
1019 3300009098 Ga0105245_10000135 Ga0105245_1000013515 333
1020 3300009176 Ga0105242_10005668 Ga0105242_100056682 333
1021 3300009177 Ga0105248_10000008 Ga0105248_10000008148 333
1022 3300009553 Ga0105249_10052691 Ga0105249_100526913 333
1023 3300013104 Ga0157370_10008177 Ga0157370_1000817712 333
1024 3300013105 Ga0157369_10000020 Ga0157369_100000205 333
1025 3300013308 Ga0157375_10000236 Ga0157375_1000023622 333
1026 3300013308 Ga0157375_10002341 Ga0157375_1000234111 333
1027 3300014969 Ga0157376_10041111 Ga0157376_100411112 333
1028 3300020070 Ga0206356_10475672 Ga0206356_104756722 333
1029 3300025321 Ga0207656_10039829 Ga0207656_100398292 333
1030 3300025916 Ga0207663_10028817 Ga0207663_100288172 333
1031 3300025926 Ga0207659_10000033 Ga0207659_1000003331 333
1032 3300025927 Ga0207687_10000007 Ga0207687_10000007594 333
1033 3300025932 Ga0207690_10012005 Ga0207690_100120054 333
1034 3300025934 Ga0207686_10000300 Ga0207686_1000030031 333
1035 3300025938 Ga0207704_10000059 Ga0207704_100000592 333
1036 3300025941 Ga0207711_10000006 Ga0207711_10000006544 333
1037 3300025972 Ga0207668_10002210 Ga0207668_100022105 333
1038 3300025981 Ga0207640_10000151 Ga0207640_1000015122 333
1039 3300025986 Ga0207658_10000506 Ga0207658_1000050624 333
1040 3300026023 Ga0207677_10001102 Ga0207677_100011029 333
1041 3300026035 Ga0207703_10000257 Ga0207703_1000025734 333
1042 3300026078 Ga0207702_10019703 Ga0207702_100197032 333
1043 3300026088 Ga0207641_10010509 Ga0207641_100105097 333
1044 3300026142 Ga0207698_10000013 Ga0207698_10000013195 333
1045 3300026142 Ga0207698_10052769 Ga0207698_100527694 333
1046 3300028379 Ga0268266_10120741 Ga0268266_101207412 333
1047 3300028380 Ga0268265_10005906 Ga0268265_100059066 333
1048 3300028381 Ga0268264_10255537 Ga0268264_102555372 333
1049 3300028563 Ga0265319_1000073 Ga0265319_100007320 333
1050 3300028800 Ga0265338_10002303 Ga0265338_100023034 333
1051 3300031241 Ga0265325_10006312 Ga0265325_100063122 333
1052 3300045836 Ga0466958_0100493 Ga0466958_0100493_746_1753 333
1053 3300046459 Ga0495629_0001588 Ga0495629_0001588_3209_4210 333
1054 3300046511 Ga0495608_0015492 Ga0495608_0015492_71_1075 333
1055 3300046512 Ga0495610_0085075 Ga0495610_0085075_50_1054 333
1056 3300046642 Ga0495634_0000034 Ga0495634_0000034_61951_62955 333
1057 3300046660 Ga0495625_0001243 Ga0495625_0001243_11316_12323 333
1058 3300046683 Ga0495658_0030299 Ga0495658_0030299_546_1550 333
1059 3300047320 Ga0495672_0029855 Ga0495672_0029855_1362_2381 333
1060 3300047321 Ga0495676_0010845 Ga0495676_0010845_1883_2884 333
1061 3300048903 Ga0496100_0000005 Ga0496100_0000005_158545_159546 333
1062 3300048904 Ga0496101_0000022 Ga0496101_0000022_82140_83141 333
1063 3300048905 Ga0496102_0000572 Ga0496102_0000572_9679_10680 333
1064 3300048906 Ga0496103_0000031 Ga0496103_0000031_181742_182743 333
1065 3300048909 Ga0496106_0000108 Ga0496106_0000108_42457_43458 333
1066 3300048910 Ga0496107_0000011 Ga0496107_0000011_152337_153338 333
1067 3300048911 Ga0496108_0000026 Ga0496108_0000026_80602_81612 333
1068 3300048911 Ga0496108_0000341 Ga0496108_0000341_27674_28675 333
1069 3300048911 Ga0496108_0009847 Ga0496108_0009847_4711_5715 333
1070 3300048912 Ga0496109_0000060 Ga0496109_0000060_6794_7804 333
1071 3300048912 Ga0496109_0000172 Ga0496109_0000172_35529_36530 333
1072 3300048912 Ga0496109_0256610 Ga0496109_0256610_55_1059 333
1073 3300049585 Ga0501069_0011011 Ga0501069_0011011_170_1183 333
1074 3300049586 Ga0501070_0327455 Ga0501070_0327455_63_1076 333
1075 3300050509 nmdc:mga0qj67_86767_c1 nmdc:mga0qj67_86767_c1_1485_2489 333
1076 3300050515 nmdc:mga0a205_12181_c1 nmdc:mga0a205_12181_c1_6257_7261 333
1077 3300053083 Ga0495655_0000001 Ga0495655_0000001_417134_418138 333
1078 3300053083 Ga0495655_0004484 Ga0495655_0004484_1334_2335 333
1079 3300053129 Ga0500628_000073 Ga0500628_000073_23743_24747 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

44

328

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7elt-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase complexed with trp-amp 0.9706 6 330
5ekd-assembly1.cif.gz_B human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp. 0.9673 1 327
7ev2-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase complexed with y-11 and atp 0.9661 2 330
7el8-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis tryptophanyl-trna synthetase 0.9658 3 330
5ekd-assembly1.cif.gz_A human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp. 0.9638 4 327
ID Description Score Start End Superfamily
3fhjF02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9748 187 292 1.10.240.10
af_Q86A90_233_346_1.10.240.10 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9669 187 288 1.10.240.10
3fi0I02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9669 188 292 1.10.240.10
5ekdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9667 1 182 3.40.50.620
3n9iB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9652 187 296 1.10.240.10
ID Description Score Start End GO Terms
AF-A0A7W1N483-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9813 76 330 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A5S9M6P4-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9783 38 196 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A821SYS9-F1-model_v4 tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) 0.9761 4 329 GO:0004830
GO:0005524
GO:0005759
GO:0070183
AF-A0A2H0W900-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9756 4 330 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A2K5RVG5-F1-model_v4 tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) 0.9753 2 329 GO:0001570
GO:0004830
GO:0005524
GO:0005654
GO:0005759
GO:0005886
GO:0070183

Feature Viewer

pLDDT pTM Quality
93.62 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map