F489646

General Info

Members Datasets Scaffolds Average Seq Length
1079 676 2158 289

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0036611|Ga0373927_0036611_1951_3030
Length 345
Sequence MRRLSWLVVLALVAMAPRAQADDRLNVVASFSILGDFVRNVGGDRVNVTTLVGPNSDAHVYEPTPADARKIADATRVIVNGLGLEGWLPRLVKAAGGKAIIITATSGIAPLKLGSGADPHAWQSVVNAKTYVTNIRDALIAADSAGAEAFRANAQNYLARLDALDREVHEAVGKIPAAHRKVISTHRAFGYFAAAYGIEFIAPLGVSTESEPSARDVAGIITQIRQAKIPAIFLENISDPRLIQRIAADTGARIGGTLYSDSLTAEKGEAPTYIDMVRHNIKALTSALAKQGPPCRVECLPSSARSCYARSFCLKNPRDRADGLSRRRQDHAAQPHPVGKPRQEQ

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
89 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
122 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
123 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
124 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
128 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
195 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
197 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
198 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
203 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
210 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
211 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
235 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
251 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
254 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
255 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
296 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
297 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
298 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
313 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
314 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
317 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
350 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
353 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
368 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
369 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
370 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
381 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
385 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
386 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
387 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
388 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
389 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
390 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
391 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
392 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
393 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
394 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
395 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
396 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
397 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
398 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
399 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
400 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
401 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
402 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
403 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
404 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
408 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
409 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
410 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
411 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
412 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
413 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
414 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
415 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
416 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
417 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
418 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
419 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
420 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
421 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
422 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
423 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
424 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
425 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
426 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
427 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
428 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
429 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
430 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
431 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
432 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
433 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
434 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
435 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
436 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
437 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
438 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
439 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
440 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
441 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
442 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
443 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
444 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
445 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
446 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
447 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
448 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
449 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
450 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
451 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
452 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
453 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
454 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
455 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
456 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
457 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
458 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
459 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
460 2643221651 Afipia sp. Root123D2 Isolate Unclassified
461 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
462 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
463 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
464 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
465 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
466 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
467 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
468 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
469 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
470 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
471 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
472 2791355199
473 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
474 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
475 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
476 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
477 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
478 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
479 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
480 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
481 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
482 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
483 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
484 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
485 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
486 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
487 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
488 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
489 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
490 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
491 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
492 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
493 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
494 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
495 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
496 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
497 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
498 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
499 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
500 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
501 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
502 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
503 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
504 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
505 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
506 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
507 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
508 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
509 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
510 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
511 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
512 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
513 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
514 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
515 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
516 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
517 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
518 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
519 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
520 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
521 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
522 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
523 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
524 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
525 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
526 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
527 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
528 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
529 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
530 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
531 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
532 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
533 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
534 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
535 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
536 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
537 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
538 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
539 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
540 2904456579 Variovorax sp. 2002 Isolate Unclassified
541 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
542 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
543 2904699407
544 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
545 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
546 2906610324
547 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
548 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
549 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
550 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
551 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
552 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
553 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
554 2922368715
555 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
556 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
557 2922425934
558 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
559 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
560 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
561 2929520902 Variovorax beijingensis 502 Isolate Unclassified
562 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
563 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
564 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
565 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
566 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
567 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
568 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
569 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
570 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
571 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
572 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
573 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
574 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
575 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
576 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
577 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
578 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
579 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
580 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
581 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
582 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
583 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
584 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
585 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
586 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
587 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
588 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
589 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
590 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
591 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
592 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
593 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
594 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
595 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
596 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
597 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
598 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
599 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
600 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
601 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
602 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
603 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
604 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
605 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
606 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
607 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
608 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
609 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
610 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
611 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
612 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
613 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
614 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
615 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
616 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
617 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
618 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
619 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
620 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
621 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
622 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
623 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
624 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
625 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
626 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
627 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
628 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
629 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
630 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
631 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
632 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
633 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
634 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
635 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
636 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
637 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
638 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
639 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
640 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
641 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
642 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
643 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
644 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
645 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
646 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
647 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
648 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
649 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
650 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
651 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
652 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
653 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
654 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
655 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
656 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
657 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
658 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
659 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
660 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
661 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
662 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
663 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
664 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
665 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
666 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
667 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
668 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
669 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
670 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
671 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
672 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
673 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
674 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
675 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
676 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.44
Metatranscriptomes 0.09
Isolates 23.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.42
Nodule 16.13
Rhizoplane 6.49
Rhizosphere 51.07
Stem 0
Stem Tuber 0.09
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0036611 3300035695 Bacteria 3191
2 JGI24741J21665_1005484 3300001915 Bacteria 2642
3 JGI24739J22299_10004386 3300001989 Bacteria 5402
4 JGI24737J22298_10026694 3300001990 Bacteria 1823
5 JGI24735J21928_10029987 3300002067 Bacteria 1617
6 JGI25154J39366_1004166 3300002738 Bacteria 2689
7 JGI25165J46597_1008266 3300003214 Bacteria 1646
8 JGI25165J46597_1009827 3300003214 Bacteria 1420
9 JGI25165J46597_1009894 3300003214 Bacteria 1411
10 JGI25153J46596_10009118 3300003215 Bacteria 4652
11 JGI25153J46596_10013220 3300003215 Bacteria 3505
12 JGI25153J46596_10029846 3300003215 Bacteria 1865
13 rootH2_10345235 3300003320 Bacteria 1331
14 rootL2_10124449 3300003322 Bacteria 1124
15 Ga0006562J51391_1119272 3300003578 Bacteria 1834
16 JGI25404J52841_10010825 3300003659 Bacteria 1962
17 Ga0055538_1000012 3300003751 Bacteria 353826
18 Ga0055539_1000017 3300003752 Bacteria 353873
19 Ga0055533_1000021 3300003756 Bacteria 353826
20 Ga0055532_1000020 3300003758 Bacteria 270853
21 Ga0055525_1000078 3300003759 Bacteria 165788
22 Ga0055540_1001304 3300003792 Bacteria 15079
23 Ga0055541_1000012 3300003841 Bacteria 353826
24 Ga0065165_1003123 3300005262 Bacteria 12280
25 Ga0065165_1007216 3300005262 Bacteria 5539
26 Ga0065165_1010731 3300005262 Bacteria 3914
27 Ga0065165_1033623 3300005262 Bacteria 1594
28 Ga0065714_10004573 3300005288 Bacteria 4748
29 Ga0065704_10088231 3300005289 Bacteria 2956
30 Ga0070658_10145326 3300005327 Bacteria 1983
31 Ga0070683_100058153 3300005329 Bacteria 3592
32 Ga0070670_100000141 3300005331 Bacteria 67499
33 Ga0070670_100223142 3300005331 Bacteria 1640
34 Ga0068869_100177413 3300005334 Bacteria 1668
35 Ga0070666_10116344 3300005335 Bacteria 1852
36 Ga0070680_100007323 3300005336 Bacteria 8416
37 Ga0070680_100251951 3300005336 Bacteria 1493
38 Ga0070682_100101303 3300005337 Bacteria 1902
39 Ga0068868_100219698 3300005338 Bacteria 1590
40 Ga0070660_100003353 3300005339 Bacteria 11009
41 Ga0070689_100017936 3300005340 Bacteria 5204
42 Ga0070689_100397977 3300005340 Bacteria 1163
43 Ga0070661_100029726 3300005344 Bacteria 3945
44 Ga0070668_100103430 3300005347 Bacteria 2259
45 Ga0070668_100116316 3300005347 Bacteria 2132
46 Ga0070668_100399295 3300005347 Bacteria 1173
47 Ga0070668_100448652 3300005347 Bacteria 1108
48 Ga0070669_100238436 3300005353 Bacteria 1444
49 Ga0070675_100309043 3300005354 Bacteria 1394
50 Ga0070671_100241802 3300005355 Bacteria 1532
51 Ga0070671_100387593 3300005355 Bacteria 1194
52 Ga0070688_100145669 3300005365 Bacteria 1613
53 Ga0070659_100043428 3300005366 Bacteria 3515
54 Ga0070659_100349769 3300005366 Bacteria 1240
55 Ga0070667_100163338 3300005367 Bacteria 1963
56 Ga0070709_10004499 3300005434 Bacteria 7521
57 Ga0070709_10016287 3300005434 Bacteria 4242
58 Ga0070714_100032403 3300005435 Bacteria 4361
59 Ga0070713_100024272 3300005436 Bacteria 4721
60 Ga0070713_100097488 3300005436 Bacteria 2540
61 Ga0070713_100228196 3300005436 Bacteria 1692
62 Ga0070710_10003046 3300005437 Bacteria 7964
63 Ga0070710_10039645 3300005437 Bacteria 2592
64 Ga0070711_100010406 3300005439 Bacteria 5756
65 Ga0070663_100007241 3300005455 Bacteria 6742
66 Ga0070663_100160637 3300005455 Bacteria 1729
67 Ga0070663_100166983 3300005455 Bacteria 1698
68 Ga0070663_100174728 3300005455 Bacteria 1662
69 Ga0070678_100202136 3300005456 Bacteria 1640
70 Ga0070678_100255989 3300005456 Bacteria 1470
71 Ga0070662_100026265 3300005457 Bacteria 4031
72 Ga0070662_100121049 3300005457 Bacteria 2006
73 Ga0070681_10033490 3300005458 Bacteria 5158
74 Ga0070685_10175818 3300005466 Bacteria 1375
75 Ga0070699_100382184 3300005518 Bacteria 1271
76 Ga0070679_100075614 3300005530 Bacteria 3357
77 Ga0070679_100377415 3300005530 Bacteria 1364
78 Ga0070679_100613690 3300005530 Bacteria 1031
79 Ga0070684_100006286 3300005535 Bacteria 9176
80 Ga0070684_100025288 3300005535 Bacteria 4989
81 Ga0068853_100001496 3300005539 Bacteria 16976
82 Ga0068853_100026288 3300005539 Bacteria 4887
83 Ga0068853_100269755 3300005539 Bacteria 1567
84 Ga0068853_100368008 3300005539 Bacteria 1340
85 Ga0070665_100105477 3300005548 Bacteria 2820
86 Ga0070665_100155549 3300005548 Bacteria 2288
87 Ga0070665_100367819 3300005548 Bacteria 1444
88 Ga0070665_100499631 3300005548 Bacteria 1227
89 Ga0070704_100192822 3300005549 Bacteria 1639
90 Ga0070704_100241846 3300005549 Bacteria 1477
91 Ga0068855_100031854 3300005563 Bacteria 6294
92 Ga0068855_100256651 3300005563 Bacteria 1949
93 Ga0068855_100300260 3300005563 Bacteria 1778
94 Ga0068855_100376434 3300005563 Bacteria 1560
95 Ga0070664_100503876 3300005564 Bacteria 1116
96 Ga0068857_100004210 3300005577 Bacteria 12119
97 Ga0068857_100056749 3300005577 Bacteria 3475
98 Ga0068857_100060787 3300005577 Bacteria 3356
99 Ga0068854_100008298 3300005578 Bacteria 6670
100 Ga0068854_100017829 3300005578 Bacteria 4758
101 Ga0068854_100061411 3300005578 Bacteria 2722
102 Ga0068856_100006410 3300005614 Bacteria 11545
103 Ga0068856_100019463 3300005614 Bacteria 6589
104 Ga0068856_100077437 3300005614 Bacteria 3295
105 Ga0068856_100547953 3300005614 Bacteria 1178
106 Ga0070702_100275930 3300005615 Bacteria 1152
107 Ga0068852_100016237 3300005616 Bacteria 5800
108 Ga0068852_100326120 3300005616 Bacteria 1492
109 Ga0068852_100448092 3300005616 Bacteria 1277
110 Ga0068859_100135138 3300005617 Bacteria 2539
111 Ga0068859_100164271 3300005617 Bacteria 2299
112 Ga0068859_100178873 3300005617 Bacteria 2203
113 Ga0068864_100133624 3300005618 Bacteria 2232
114 Ga0068864_100487779 3300005618 Bacteria 1184
115 Ga0068866_10093974 3300005718 Bacteria 1639
116 Ga0068861_100170496 3300005719 Bacteria 1803
117 Ga0068861_100489562 3300005719 Bacteria 1109
118 Ga0068851_10011168 3300005834 Bacteria 4206
119 Ga0068863_100406296 3300005841 Bacteria 1332
120 Ga0068858_100334100 3300005842 Bacteria 1449
121 Ga0068858_100400955 3300005842 Bacteria 1318
122 Ga0068858_100511700 3300005842 Bacteria 1160
123 Ga0068860_100003385 3300005843 Bacteria 16406
124 Ga0068862_100145350 3300005844 Bacteria 2107
125 Ga0081538_10036555 3300005981 Bacteria 3202
126 Ga0081540_1004705 3300005983 Bacteria 10327
127 Ga0081540_1005016 3300005983 Bacteria 9944
128 Ga0081540_1005578 3300005983 Bacteria 9373
129 Ga0081540_1005788 3300005983 Bacteria 9148
130 Ga0081540_1006936 3300005983 Bacteria 8165
131 Ga0081540_1010271 3300005983 Bacteria 6356
132 Ga0081540_1015887 3300005983 Bacteria 4745
133 Ga0081540_1031359 3300005983 Bacteria 2924
134 Ga0081540_1041746 3300005983 Bacteria 2375
135 Ga0081540_1066406 3300005983 Bacteria 1691
136 Ga0081539_10039667 3300005985 Bacteria 2775
137 Ga0070717_10023806 3300006028 Bacteria 4857
138 Ga0070717_10105321 3300006028 Bacteria 2401
139 Ga0070717_10119675 3300006028 Bacteria 2255
140 Ga0075365_10146416 3300006038 Bacteria 1641
141 Ga0075365_10151624 3300006038 Bacteria 1612
142 Ga0075365_10184513 3300006038 Bacteria 1459
143 Ga0075368_10012299 3300006042 Bacteria 3125
144 Ga0075368_10041629 3300006042 Bacteria 1805
145 Ga0075368_10068758 3300006042 Bacteria 1427
146 Ga0075363_100004089 3300006048 Bacteria 6322
147 Ga0075364_10253173 3300006051 Bacteria 1197
148 Ga0070716_100010967 3300006173 Bacteria 4559
149 Ga0070716_100079528 3300006173 Bacteria 1952
150 Ga0070716_100081468 3300006173 Bacteria 1933
151 Ga0070712_100028666 3300006175 Bacteria 3726
152 Ga0070712_100248704 3300006175 Bacteria 1419
153 Ga0070712_100405837 3300006175 Bacteria 1126
154 Ga0075367_10022959 3300006178 Bacteria 3505
155 Ga0075367_10051061 3300006178 Bacteria 2443
156 Ga0075367_10113608 3300006178 Bacteria 1664
157 Ga0075367_10131776 3300006178 Bacteria 1545
158 Ga0075367_10202456 3300006178 Bacteria 1240
159 Ga0075366_10112604 3300006195 Bacteria 1637
160 Ga0075434_100244652 3300006871 Bacteria 1814
161 Ga0068865_100057630 3300006881 Bacteria 2711
162 Ga0097620_100135137 3300006931 Bacteria 2539
163 Ga0097620_100164286 3300006931 Bacteria 2299
164 Ga0097620_100178880 3300006931 Bacteria 2203
165 Ga0099824_1008875 3300006942 Bacteria 12635
166 Ga0099824_1023890 3300006942 Bacteria 3695
167 Ga0099822_1017500 3300006943 Bacteria 7646
168 Ga0099794_10043155 3300007265 Bacteria 2152
169 Ga0105244_10003428 3300009036 Bacteria 11304
170 Ga0105240_10009125 3300009093 Bacteria 14079
171 Ga0105240_10014685 3300009093 Bacteria 10686
172 Ga0105240_10046064 3300009093 Bacteria 5528
173 Ga0105240_10095537 3300009093 Bacteria 3624
174 Ga0105240_10538244 3300009093 Bacteria 1294
175 Ga0105245_10071302 3300009098 Bacteria 3156
176 Ga0105245_10216132 3300009098 Bacteria 1847
177 Ga0105245_10260089 3300009098 Bacteria 1689
178 Ga0105247_10104696 3300009101 Bacteria 1813
179 Ga0105247_10173183 3300009101 Bacteria 1436
180 Ga0105247_10187173 3300009101 Bacteria 1384
181 Ga0114129_10004595 3300009147 Bacteria 19485
182 Ga0114129_10157307 3300009147 Bacteria 3107
183 Ga0105243_10075279 3300009148 Bacteria 2740
184 Ga0105243_10231134 3300009148 Bacteria 1641
185 Ga0105243_10485191 3300009148 Bacteria 1167
186 Ga0105241_10015112 3300009174 Bacteria 5655
187 Ga0105241_10111550 3300009174 Bacteria 2190
188 Ga0105241_10197931 3300009174 Bacteria 1676
189 Ga0105241_10240858 3300009174 Bacteria 1529
190 Ga0105241_10529071 3300009174 Bacteria 1055
191 Ga0105242_10184248 3300009176 Bacteria 1844
192 Ga0105242_10205972 3300009176 Bacteria 1749
193 Ga0105248_10080990 3300009177 Bacteria 3650
194 Ga0105248_10170279 3300009177 Bacteria 2454
195 Ga0105248_10496096 3300009177 Bacteria 1376
196 Ga0105248_10579251 3300009177 Bacteria 1266
197 Ga0105248_11011862 3300009177 Bacteria 939
198 Ga0105237_10008895 3300009545 Bacteria 10820
199 Ga0105237_10044886 3300009545 Bacteria 4450
200 Ga0105237_10069051 3300009545 Bacteria 3528
201 Ga0105237_10183321 3300009545 Bacteria 2093
202 Ga0105237_10356681 3300009545 Bacteria 1466
203 Ga0105237_10408045 3300009545 Bacteria 1363
204 Ga0105238_10025742 3300009551 Bacteria 5999
205 Ga0105238_10026375 3300009551 Bacteria 5924
206 Ga0105238_10028483 3300009551 Bacteria 5691
207 Ga0105238_10462551 3300009551 Bacteria 1266
208 Ga0105238_10572317 3300009551 Bacteria 1135
209 Ga0105249_10692538 3300009553 Bacteria 1079
210 Ga0099796_10016875 3300010159 Bacteria 2164
211 Ga0099796_10096508 3300010159 Bacteria 1106
212 Ga0105239_10008167 3300010375 Bacteria 11943
213 Ga0105239_10074854 3300010375 Bacteria 3723
214 Ga0105239_10084315 3300010375 Bacteria 3500
215 Ga0105239_10169114 3300010375 Bacteria 2444
216 Ga0105239_10271446 3300010375 Bacteria 1908
217 Ga0105239_10414628 3300010375 Bacteria 1525
218 Ga0105239_10694216 3300010375 Bacteria 1163
219 Ga0105246_10067767 3300011119 Bacteria 2501
220 Ga0157373_10011474 3300013100 Bacteria 6515
221 Ga0157373_10037722 3300013100 Bacteria 3463
222 Ga0157373_10047172 3300013100 Bacteria 3074
223 Ga0157373_10096002 3300013100 Bacteria 2087
224 Ga0157370_10054683 3300013104 Bacteria 3805
225 Ga0157369_10006096 3300013105 Bacteria 13996
226 Ga0157374_10199007 3300013296 Bacteria 1961
227 Ga0157374_10482983 3300013296 Bacteria 1242
228 Ga0157378_10222202 3300013297 Bacteria 1796
229 Ga0157378_10391905 3300013297 Bacteria 1366
230 Ga0157378_10543889 3300013297 Bacteria 1166
231 Ga0163162_10064929 3300013306 Bacteria 3696
232 Ga0163162_10586244 3300013306 Bacteria 1242
233 Ga0163162_10773871 3300013306 Bacteria 1078
234 Ga0157372_10149868 3300013307 Bacteria 2691
235 Ga0157375_10010583 3300013308 Bacteria 8121
236 Ga0163163_10513828 3300014325 Bacteria 1260
237 Ga0157380_10538360 3300014326 Bacteria 1143
238 Ga0157380_10835908 3300014326 Bacteria 941
239 Ga0182008_10000581 3300014497 Bacteria 26916
240 Ga0182008_10000904 3300014497 Bacteria 20630
241 Ga0157379_10107304 3300014968 Bacteria 2507
242 Ga0157376_10042518 3300014969 Bacteria 3724
243 Ga0157376_10436292 3300014969 Bacteria 1274
244 Ga0182006_1000467 3300015261 Bacteria 31644
245 Ga0182006_1092731 3300015261 Bacteria 1084
246 Ga0182007_10002786 3300015262 Bacteria 8522
247 Ga0214542_1000009 3300021321 Bacteria 262861
248 Ga0214542_1033238 3300021321 Bacteria 1754
249 Ga0214545_1000007 3300021324 Bacteria 262984
250 Ga0214545_1039271 3300021324 Bacteria 1337
251 Ga0214543_1000020 3300021327 Bacteria 262861
252 Ga0214543_1040577 3300021327 Bacteria 1235
253 Ga0213873_10002858 3300021358 Bacteria 3043
254 Ga0213872_10021501 3300021361 Bacteria 2971
255 Ga0213876_10001108 3300021384 Bacteria 17232
256 Ga0209435_100606 3300025206 Bacteria 6586
257 Ga0209784_100007 3300025224 Bacteria 747715
258 Ga0209566_100009 3300025225 Bacteria 554018
259 Ga0209674_100021 3300025226 Bacteria 629811
260 Ga0209147_100009 3300025229 Bacteria 747409
261 Ga0209563_100018 3300025230 Bacteria 747850
262 Ga0209563_101581 3300025230 Bacteria 5915
263 Ga0209258_100347 3300025242 Bacteria 66549
264 Ga0209646_1001318 3300025246 Bacteria 6908
265 Ga0209677_100012 3300025253 Bacteria 554018
266 Ga0209677_102936 3300025253 Bacteria 5960
267 Ga0209148_1000707 3300025254 Bacteria 26803
268 Ga0209233_1001624 3300025261 Bacteria 8741
269 Ga0209233_1010411 3300025261 Bacteria 2787
270 Ga0209455_1004030 3300025272 Bacteria 4969
271 Ga0209455_1005738 3300025272 Bacteria 3779
272 Ga0209455_1007958 3300025272 Bacteria 2934
273 Ga0209455_1012768 3300025272 Bacteria 1989
274 Ga0209564_1000503 3300025295 Bacteria 64437
275 Ga0209564_1009431 3300025295 Bacteria 4647
276 Ga0209758_1000106 3300025297 Bacteria 218450
277 Ga0209758_1002009 3300025297 Bacteria 21878
278 Ga0209758_1002765 3300025297 Bacteria 17179
279 Ga0209758_1003053 3300025297 Bacteria 15935
280 Ga0209758_1006390 3300025297 Bacteria 8493
281 Ga0209758_1011674 3300025297 Bacteria 5048
282 Ga0209758_1011887 3300025297 Bacteria 4961
283 Ga0209758_1069464 3300025297 Bacteria 1116
284 Ga0209256_1008328 3300025299 Bacteria 4835
285 Ga0207426_1000337 3300025302 Bacteria 88200
286 Ga0207426_1007201 3300025302 Bacteria 4691
287 Ga0207426_1009271 3300025302 Bacteria 3909
288 Ga0209051_1000298 3300025303 Bacteria 78777
289 Ga0209257_1000684 3300025304 Bacteria 52769
290 Ga0207656_10035984 3300025321 Bacteria 2076
291 Ga0207656_10046534 3300025321 Bacteria 1862
292 Ga0207655_1000534 3300025728 Bacteria 48119
293 Ga0207692_10001396 3300025898 Bacteria 9039
294 Ga0207692_10070024 3300025898 Bacteria 1845
295 Ga0207688_10048296 3300025901 Bacteria 2378
296 Ga0207688_10098160 3300025901 Bacteria 1688
297 Ga0207680_10165964 3300025903 Bacteria 1484
298 Ga0207680_10269037 3300025903 Bacteria 1181
299 Ga0207647_10009009 3300025904 Bacteria 7112
300 Ga0207647_10053238 3300025904 Bacteria 2495
301 Ga0207685_10004095 3300025905 Bacteria 3652
302 Ga0207699_10038984 3300025906 Bacteria 2727
303 Ga0207645_10133078 3300025907 Bacteria 1619
304 Ga0207645_10282096 3300025907 Bacteria 1103
305 Ga0207643_10027690 3300025908 Bacteria 3144
306 Ga0207705_10080452 3300025909 Bacteria 2374
307 Ga0207705_10418436 3300025909 Bacteria 1037
308 Ga0207707_10001933 3300025912 Bacteria 18846
309 Ga0207695_10000478 3300025913 Bacteria 86076
310 Ga0207695_10034396 3300025913 Bacteria 5512
311 Ga0207695_10142598 3300025913 Bacteria 2343
312 Ga0207671_10037028 3300025914 Bacteria 3618
313 Ga0207671_10047710 3300025914 Bacteria 3170
314 Ga0207671_10057143 3300025914 Bacteria 2892
315 Ga0207671_10063710 3300025914 Bacteria 2740
316 Ga0207671_10203488 3300025914 Bacteria 1547
317 Ga0207693_10020323 3300025915 Bacteria 5283
318 Ga0207693_10027576 3300025915 Bacteria 4489
319 Ga0207693_10293797 3300025915 Bacteria 1273
320 Ga0207663_10001112 3300025916 Bacteria 12359
321 Ga0207663_10023479 3300025916 Bacteria 3539
322 Ga0207663_10067343 3300025916 Bacteria 2296
323 Ga0207660_10009206 3300025917 Bacteria 6389
324 Ga0207660_10232901 3300025917 Bacteria 1449
325 Ga0207662_10078044 3300025918 Bacteria 2015
326 Ga0207657_10005821 3300025919 Bacteria 12839
327 Ga0207657_10113450 3300025919 Bacteria 2236
328 Ga0207657_10121119 3300025919 Bacteria 2152
329 Ga0207652_10070273 3300025921 Bacteria 3040
330 Ga0207652_10198291 3300025921 Bacteria 1806
331 Ga0207694_10001415 3300025924 Bacteria 20567
332 Ga0207694_10022943 3300025924 Bacteria 4735
333 Ga0207694_10177181 3300025924 Bacteria 1728
334 Ga0207694_10205787 3300025924 Bacteria 1602
335 Ga0207650_10000089 3300025925 Bacteria 120962
336 Ga0207687_10149563 3300025927 Bacteria 1780
337 Ga0207700_10064270 3300025928 Bacteria 2794
338 Ga0207700_10214960 3300025928 Bacteria 1627
339 Ga0207664_10313407 3300025929 Bacteria 1383
340 Ga0207690_10074010 3300025932 Bacteria 2358
341 Ga0207706_10154120 3300025933 Bacteria 2021
342 Ga0207706_10251531 3300025933 Bacteria 1543
343 Ga0207706_10262690 3300025933 Bacteria 1507
344 Ga0207686_10295937 3300025934 Bacteria 1200
345 Ga0207709_10042337 3300025935 Bacteria 2738
346 Ga0207709_10251506 3300025935 Bacteria 1291
347 Ga0207709_10256222 3300025935 Bacteria 1281
348 Ga0207669_10224931 3300025937 Bacteria 1380
349 Ga0207704_10244042 3300025938 Bacteria 1344
350 Ga0207665_10000703 3300025939 Bacteria 22673
351 Ga0207665_10091630 3300025939 Bacteria 2108
352 Ga0207665_10156926 3300025939 Bacteria 1634
353 Ga0207711_10108494 3300025941 Bacteria 2466
354 Ga0207711_10195442 3300025941 Bacteria 1845
355 Ga0207711_10644284 3300025941 Bacteria 988
356 Ga0207689_10038013 3300025942 Bacteria 3988
357 Ga0207689_10304900 3300025942 Bacteria 1320
358 Ga0207661_10000171 3300025944 Bacteria 41708
359 Ga0207661_10030341 3300025944 Bacteria 4164
360 Ga0207679_10384077 3300025945 Bacteria 1232
361 Ga0207667_10011741 3300025949 Bacteria 10158
362 Ga0207667_10013826 3300025949 Bacteria 9221
363 Ga0207667_10348678 3300025949 Bacteria 1510
364 Ga0207667_10387248 3300025949 Bacteria 1424
365 Ga0207668_10042480 3300025972 Bacteria 3079
366 Ga0207668_10129694 3300025972 Bacteria 1923
367 Ga0207640_10060359 3300025981 Bacteria 2506
368 Ga0207640_10368608 3300025981 Bacteria 1160
369 Ga0207677_10061516 3300026023 Bacteria 2601
370 Ga0207703_10345982 3300026035 Bacteria 1368
371 Ga0207703_10554506 3300026035 Bacteria 1084
372 Ga0207639_10008009 3300026041 Bacteria 7220
373 Ga0207678_10014592 3300026067 Bacteria 6914
374 Ga0207678_10027182 3300026067 Bacteria 4990
375 Ga0207678_10079253 3300026067 Bacteria 2813
376 Ga0207678_10125020 3300026067 Bacteria 2194
377 Ga0207678_10279947 3300026067 Bacteria 1431
378 Ga0207678_10329627 3300026067 Bacteria 1314
379 Ga0207702_10000003 3300026078 Bacteria 434196
380 Ga0207702_10000014 3300026078 Bacteria 253304
381 Ga0207702_10033457 3300026078 Bacteria 4294
382 Ga0207702_10106532 3300026078 Bacteria 2484
383 Ga0207702_10211921 3300026078 Bacteria 1802
384 Ga0207702_10319646 3300026078 Bacteria 1478
385 Ga0207702_10420068 3300026078 Bacteria 1293
386 Ga0207641_10249261 3300026088 Bacteria 1658
387 Ga0207676_10208596 3300026095 Bacteria 1732
388 Ga0207674_10004961 3300026116 Bacteria 15902
389 Ga0207674_10009035 3300026116 Bacteria 11446
390 Ga0207674_10044466 3300026116 Bacteria 4574
391 Ga0207674_10175694 3300026116 Bacteria 2094
392 Ga0207683_10018023 3300026121 Bacteria 6021
393 Ga0207683_10223320 3300026121 Bacteria 1717
394 Ga0207698_10088283 3300026142 Bacteria 2528
395 Ga0207698_10120408 3300026142 Bacteria 2220
396 Ga0207698_10268969 3300026142 Bacteria 1570
397 Ga0207698_10275638 3300026142 Bacteria 1553
398 Ga0207698_10406542 3300026142 Bacteria 1302
399 Ga0207698_10623316 3300026142 Bacteria 1066
400 Ga0209389_1000016 3300027296 Bacteria 184844
401 Ga0209389_1000027 3300027296 Bacteria 146917
402 Ga0209371_1001354 3300027312 Bacteria 16977
403 Ga0209589_1000005 3300027357 Bacteria 530958
404 Ga0209589_1000031 3300027357 Bacteria 147054
405 Ga0209489_100005 3300027361 Bacteria 530958
406 Ga0209489_100057 3300027361 Bacteria 147398
407 Ga0209489_100063 3300027361 Bacteria 144408
408 Ga0209700_100006 3300027363 Bacteria 530958
409 Ga0209700_100012 3300027363 Bacteria 357892
410 Ga0268266_10004322 3300028379 Bacteria 13666
411 Ga0268266_10006723 3300028379 Bacteria 10484
412 Ga0268266_10086610 3300028379 Bacteria 2739
413 Ga0268266_10359651 3300028379 Bacteria 1369
414 Ga0268266_10676159 3300028379 Bacteria 994
415 Ga0268265_10043874 3300028380 Bacteria 3326
416 Ga0268264_10000042 3300028381 Bacteria 372069
417 Ga0268264_10380313 3300028381 Bacteria 1352
418 Ga0265337_1009916 3300028556 Bacteria 3365
419 Ga0265319_1005843 3300028563 Bacteria 5806
420 Ga0265334_10011705 3300028573 Bacteria 3688
421 Ga0265323_10009578 3300028653 Bacteria 3950
422 Ga0265336_10000395 3300028666 Bacteria 27433
423 Ga0307517_10176129 3300028786 Bacteria 1392
424 Ga0265338_10000018 3300028800 Bacteria 338910
425 Ga0268256_1001153 3300030500 Bacteria 17056
426 Ga0316183_1201524 3300030742 Bacteria 3062
427 Ga0316181_1259633 3300030744 Bacteria 3339
428 Ga0265330_10056386 3300031235 Bacteria 1715
429 Ga0265339_10004193 3300031249 Bacteria 9881
430 Ga0265331_10092294 3300031250 Bacteria 1398
431 Ga0265327_10029833 3300031251 Bacteria 3095
432 Ga0307513_10072122 3300031456 Bacteria 3601
433 Ga0307509_10006260 3300031507 Bacteria 16085
434 Ga0307509_10070980 3300031507 Bacteria 3635
435 Ga0307509_10137057 3300031507 Bacteria 2391
436 Ga0307509_10337852 3300031507 Bacteria 1235
437 Ga0307408_100014308 3300031548 Bacteria 5271
438 Ga0307508_10000125 3300031616 Bacteria 91829
439 Ga0307508_10054061 3300031616 Bacteria 3561
440 Ga0307508_10221869 3300031616 Bacteria 1490
441 Ga0307508_10332828 3300031616 Bacteria 1110
442 Ga0307508_10343203 3300031616 Bacteria 1085
443 Ga0307514_10003203 3300031649 Bacteria 15988
444 Ga0265314_10022030 3300031711 Bacteria 4886
445 Ga0265314_10022428 3300031711 Bacteria 4836
446 Ga0265342_10013040 3300031712 Bacteria 5600
447 Ga0307516_10077415 3300031730 Bacteria 3175
448 Ga0307516_10113165 3300031730 Bacteria 2512
449 Ga0307516_10117287 3300031730 Bacteria 2456
450 Ga0307516_10199918 3300031730 Bacteria 1719
451 Ga0307405_10236767 3300031731 Bacteria 1349
452 Ga0307406_10000052 3300031901 Bacteria 64031
453 Ga0307406_10366718 3300031901 Bacteria 1131
454 Ga0307412_10349797 3300031911 Bacteria 1186
455 Ga0307414_10237263 3300032004 Bacteria 1507
456 Ga0307507_10062098 3300033179 Bacteria 3474
457 Ga0307510_10007708 3300033180 Bacteria 12837
458 Ga0307510_10015767 3300033180 Bacteria 8935
459 Ga0307510_10087981 3300033180 Bacteria 2969
460 Ga0307510_10204610 3300033180 Bacteria 1504
461 Ga0307510_10206472 3300033180 Bacteria 1492
462 Ga0315911_1000005 3300033442 Bacteria 426255
463 Ga0373934_0004936 3300035086 Bacteria 4940
464 Ga0373932_0016069 3300035112 Bacteria 1906
465 Ga0373954_0002374 3300035118 Bacteria 7874
466 Ga0373956_0038676 3300035119 Bacteria 2111
467 Ga0373957_0008219 3300035120 Bacteria 3371
468 Ga0373943_0018713 3300035170 Bacteria 3184
469 Ga0373946_0059032 3300035171 Bacteria 1627
470 Ga0373955_0000590 3300035172 Bacteria 15443
471 Ga0373961_0027281 3300035241 Bacteria 1567
472 Ga0373924_0042035 3300035410 Bacteria 1874
473 Ga0373931_0016534 3300035691 Bacteria 3633
474 Ga0373927_0014600 3300035695 Bacteria 5195
475 Ga0373933_0044344 3300035724 Bacteria 2634
476 Ga0373947_0083172 3300035725 Bacteria 1985
477 Ga0373947_0162647 3300035725 Bacteria 1444
478 Ga0373925_0284792 3300037068 Bacteria 1332
479 Ga0373925_0393303 3300037068 Bacteria 1130
480 Ga0395900_0000753 3300037418 Bacteria 43021
481 Ga0395900_0034589 3300037418 Bacteria 5205
482 Ga0395900_0570067 3300037418 Bacteria 1075
483 Ga0395898_0005579 3300037466 Bacteria 13568
484 Ga0395898_0029509 3300037466 Bacteria 5494
485 Ga0395905_0058930 3300037471 Bacteria 3590
486 Ga0395905_0095802 3300037471 Bacteria 2786
487 Ga0395901_0092860 3300038443 Bacteria 3159
488 Ga0395901_0290360 3300038443 Bacteria 1697
489 Ga0436365_0122301 3300039437 Bacteria 13111
490 Ga0436365_0816185 3300039437 Bacteria 1576
491 Ga0436360_0121399 3300039438 Bacteria 4193
492 Ga0436361_0897018 3300039447 Bacteria 3253
493 Ga0436361_1132428 3300039447 Bacteria 4403
494 Ga0436363_1250187 3300039450 Bacteria 2190
495 Ga0436362_0972873 3300039453 Bacteria 4993
496 Ga0436362_1029662 3300039453 Bacteria 2783
497 Ga0451791_0675706 3300041451 Bacteria 1153
498 Ga0451843_0000168 3300041509 Bacteria 1133
499 Ga0439432_000047 3300042006 Bacteria 37317
500 Ga0450891_000878 3300042129 Bacteria 3142
501 Ga0466969_0016241 3300044656 Bacteria 3899
502 Ga0466972_0000585 3300044658 Bacteria 17722
503 Ga0466966_0000720 3300044684 Bacteria 20983
504 Ga0466961_0000136 3300044693 Bacteria 49049
505 Ga0466963_0047541 3300044694 Bacteria 2832
506 Ga0466964_0018290 3300044706 Bacteria 2688
507 Ga0466970_0091748 3300044765 Bacteria 1649
508 Ga0466957_0070496 3300044842 Bacteria 2160
509 Ga0466957_0198439 3300044842 Bacteria 1317
510 Ga0466959_0030496 3300045049 Bacteria 3992
511 Ga0466959_0132374 3300045049 Bacteria 1767
512 Ga0466967_0049868 3300045976 Bacteria 3664
513 Ga0466967_0090376 3300045976 Bacteria 2781
514 Ga0466967_0118618 3300045976 Bacteria 2441
515 Ga0466967_0257117 3300045976 Bacteria 1670
516 Ga0495592_0007391 3300046454 Bacteria 8221
517 Ga0495603_0017965 3300046455 Bacteria 4280
518 Ga0495603_0036375 3300046455 Bacteria 2956
519 Ga0495603_0046931 3300046455 Bacteria 2573
520 Ga0495603_0060530 3300046455 Bacteria 2237
521 Ga0495603_0114087 3300046455 Bacteria 1576
522 Ga0495629_0021300 3300046459 Bacteria 4625
523 Ga0495638_0016562 3300046460 Bacteria 4934
524 Ga0495638_0025345 3300046460 Bacteria 3856
525 Ga0495641_0077094 3300046461 Bacteria 1494
526 Ga0495651_0009620 3300046462 Bacteria 7427
527 Ga0495651_0058439 3300046462 Bacteria 2959
528 Ga0495651_0065835 3300046462 Bacteria 2767
529 Ga0495651_0177628 3300046462 Bacteria 1510
530 Ga0495653_0017260 3300046463 Bacteria 5871
531 Ga0495605_0072285 3300046474 Bacteria 1627
532 Ga0495605_0145814 3300046474 Bacteria 1059
533 Ga0495639_0105919 3300046475 Bacteria 1331
534 Ga0495639_0179251 3300046475 Bacteria 1031
535 Ga0495664_0009047 3300046477 Bacteria 5568
536 Ga0495664_0011721 3300046477 Bacteria 4949
537 Ga0495664_0018996 3300046477 Bacteria 3947
538 Ga0495664_0271384 3300046477 Bacteria 1025
539 Ga0495585_0136242 3300046492 Bacteria 1289
540 Ga0495596_0104938 3300046500 Bacteria 1097
541 Ga0495583_0093806 3300046506 Bacteria 1289
542 Ga0495606_0012721 3300046507 Bacteria 6710
543 Ga0495606_0024749 3300046507 Bacteria 4318
544 Ga0495606_0181991 3300046507 Bacteria 1211
545 Ga0495606_0196889 3300046507 Bacteria 1151
546 Ga0495608_0019083 3300046511 Bacteria 4727
547 Ga0495608_0048870 3300046511 Bacteria 2810
548 Ga0495608_0068933 3300046511 Bacteria 2312
549 Ga0495610_0055778 3300046512 Bacteria 1903
550 Ga0495610_0144162 3300046512 Bacteria 1022
551 Ga0495616_0149186 3300046513 Bacteria 1059
552 Ga0495618_0035324 3300046514 Bacteria 3138
553 Ga0495620_0089680 3300046515 Bacteria 1235
554 Ga0495628_0011834 3300046516 Bacteria 7362
555 Ga0495631_0119821 3300046518 Bacteria 1132
556 Ga0495632_0178900 3300046519 Bacteria 972
557 Ga0495643_0021450 3300046522 Bacteria 3705
558 Ga0495648_0056224 3300046524 Bacteria 2368
559 Ga0495648_0118424 3300046524 Bacteria 1428
560 Ga0495652_0004325 3300046529 Bacteria 13603
561 Ga0495652_0033670 3300046529 Bacteria 4470
562 Ga0495640_0009547 3300046533 Bacteria 7547
563 Ga0495640_0028702 3300046533 Bacteria 4003
564 Ga0495587_0027506 3300046536 Bacteria 3462
565 Ga0495587_0058603 3300046536 Bacteria 2262
566 Ga0495598_0033166 3300046537 Bacteria 1464
567 Ga0495609_0094911 3300046538 Bacteria 1295
568 Ga0495609_0126024 3300046538 Bacteria 1099
569 Ga0495645_0007861 3300046543 Bacteria 7418
570 Ga0495645_0009133 3300046543 Bacteria 6926
571 Ga0495622_0006001 3300046557 Bacteria 5644
572 Ga0495622_0009820 3300046557 Bacteria 4425
573 Ga0495622_0061671 3300046557 Bacteria 1736
574 Ga0495622_0076200 3300046557 Bacteria 1545
575 Ga0495633_0052517 3300046558 Bacteria 1920
576 Ga0495667_0026445 3300046559 Bacteria 3911
577 Ga0495667_0035440 3300046559 Bacteria 3334
578 Ga0495656_0042832 3300046615 Bacteria 1897
579 Ga0495668_0024106 3300046616 Bacteria 3462
580 Ga0495668_0067864 3300046616 Bacteria 1962
581 Ga0495668_0098762 3300046616 Bacteria 1597
582 Ga0495634_0009379 3300046642 Bacteria 7219
583 Ga0495634_0034428 3300046642 Bacteria 3476
584 Ga0495625_0236326 3300046660 Bacteria 1191
585 Ga0495635_0007423 3300046663 Bacteria 7651
586 Ga0495635_0012284 3300046663 Bacteria 5998
587 Ga0495635_0093517 3300046663 Bacteria 2056
588 Ga0495659_0081824 3300046664 Bacteria 1226
589 Ga0495588_0004335 3300046674 Bacteria 6264
590 Ga0495657_0001308 3300046675 Bacteria 21681
591 Ga0495657_0007247 3300046675 Bacteria 8593
592 Ga0495657_0016949 3300046675 Bacteria 5295
593 Ga0495599_0019799 3300046678 Bacteria 4191
594 Ga0495599_0025698 3300046678 Bacteria 3688
595 Ga0495599_0051324 3300046678 Bacteria 2584
596 Ga0495623_0021928 3300046679 Bacteria 4125
597 Ga0495623_0120808 3300046679 Bacteria 1577
598 Ga0495646_0046922 3300046680 Bacteria 2631
599 Ga0495646_0081177 3300046680 Bacteria 1890
600 Ga0495669_0108507 3300046684 Bacteria 1294
601 Ga0495669_0139417 3300046684 Bacteria 1144
602 Ga0495613_0119691 3300046689 Bacteria 1891
603 Ga0495624_0074817 3300046690 Bacteria 2103
604 Ga0495671_0100551 3300046692 Bacteria 1414
605 Ga0495649_0119963 3300046694 Bacteria 1391
606 Ga0495589_0136929 3300046794 Bacteria 1174
607 Ga0495600_0007966 3300046809 Bacteria 6491
608 Ga0495600_0020140 3300046809 Bacteria 4267
609 Ga0495600_0031062 3300046809 Bacteria 3459
610 Ga0495581_0167462 3300047315 Bacteria 1285
611 Ga0495604_0006128 3300047317 Bacteria 9545
612 Ga0495604_0020133 3300047317 Bacteria 5331
613 Ga0495604_0244404 3300047317 Bacteria 1226
614 Ga0495674_0011175 3300047319 Bacteria 8479
615 Ga0495674_0044585 3300047319 Bacteria 3942
616 Ga0495674_0121079 3300047319 Bacteria 2210
617 Ga0495672_0005618 3300047320 Bacteria 9900
618 Ga0495676_0162888 3300047321 Bacteria 1576
619 Ga0495676_0224246 3300047321 Bacteria 1294
620 Ga0495680_0001053 3300047322 Bacteria 30524
621 Ga0495680_0014448 3300047322 Bacteria 6836
622 Ga0495687_016734 3300047443 Bacteria 3679
623 Ga0495679_007969 3300047446 Bacteria 4356
624 Ga0495684_0073127 3300047471 Bacteria 2604
625 Ga0495686_0213485 3300047472 Bacteria 1101
626 Ga0495602_0021411 3300048088 Bacteria 6366
627 Ga0495602_0074922 3300048088 Bacteria 2874
628 Ga0496100_0012991 3300048903 Bacteria 4792
629 Ga0496101_0003670 3300048904 Bacteria 9579
630 Ga0496101_0130902 3300048904 Bacteria 1905
631 Ga0496101_0203088 3300048904 Bacteria 1533
632 Ga0496101_0250297 3300048904 Bacteria 1380
633 Ga0496102_0001403 3300048905 Bacteria 21391
634 Ga0496102_0051154 3300048905 Bacteria 3764
635 Ga0496102_0067221 3300048905 Bacteria 3287
636 Ga0496102_0719152 3300048905 Bacteria 921
637 Ga0496103_0116426 3300048906 Bacteria 1700
638 Ga0496103_0276307 3300048906 Bacteria 1081
639 Ga0496104_0002112 3300048907 Bacteria 17255
640 Ga0496104_0014912 3300048907 Bacteria 7025
641 Ga0496104_0029597 3300048907 Bacteria 5080
642 Ga0496104_0108179 3300048907 Bacteria 2664
643 Ga0496104_0126288 3300048907 Bacteria 2456
644 Ga0496104_0301812 3300048907 Bacteria 1513
645 Ga0496105_0046798 3300048908 Bacteria 3570
646 Ga0496105_0076936 3300048908 Bacteria 2756
647 Ga0496105_0087969 3300048908 Bacteria 2566
648 Ga0496105_0123081 3300048908 Bacteria 2138
649 Ga0496106_0001280 3300048909 Bacteria 18862
650 Ga0496106_0011375 3300048909 Bacteria 6586
651 Ga0496106_0066732 3300048909 Bacteria 2741
652 Ga0496106_0234646 3300048909 Bacteria 1465
653 Ga0496107_0027212 3300048910 Bacteria 4060
654 Ga0496107_0202501 3300048910 Bacteria 1475
655 Ga0496107_0226803 3300048910 Bacteria 1390
656 Ga0496108_0031333 3300048911 Bacteria 4412
657 Ga0496108_0173496 3300048911 Bacteria 1866
658 Ga0496108_0399302 3300048911 Bacteria 1201
659 Ga0496109_0010437 3300048912 Bacteria 7934
660 Ga0496109_0240372 3300048912 Bacteria 1704
661 Ga0496109_0284205 3300048912 Bacteria 1559
662 Ga0496110_0056755 3300048913 Bacteria 3446
663 Ga0496110_0078391 3300048913 Bacteria 2941
664 Ga0496110_0133066 3300048913 Bacteria 2246
665 Ga0496110_0146918 3300048913 Bacteria 2133
666 Ga0496110_0186033 3300048913 Bacteria 1886
667 Ga0496110_0245272 3300048913 Bacteria 1630
668 Ga0496110_0611197 3300048913 Bacteria 988
669 Ga0496111_0004711 3300048914 Bacteria 8653
670 Ga0496111_0057198 3300048914 Bacteria 2823
671 Ga0496111_0208005 3300048914 Bacteria 1454
672 Ga0496111_0369052 3300048914 Bacteria 1062
673 Ga0496112_0027302 3300048915 Bacteria 5504
674 Ga0496112_0036649 3300048915 Bacteria 4785
675 Ga0496112_0144708 3300048915 Bacteria 2345
676 Ga0496112_0199695 3300048915 Bacteria 1959
677 Ga0496112_0503338 3300048915 Bacteria 1147
678 Ga0496113_0006206 3300048916 Bacteria 7551
679 Ga0496113_0035660 3300048916 Bacteria 3639
680 Ga0496113_0093556 3300048916 Bacteria 2320
681 Ga0496114_0069047 3300048917 Bacteria 2967
682 Ga0496114_0346237 3300048917 Bacteria 1314
683 Ga0496115_0004202 3300048918 Bacteria 10415
684 Ga0496115_0049654 3300048918 Bacteria 3359
685 Ga0496115_0263750 3300048918 Bacteria 1416
686 Ga0496116_0127078 3300048919 Bacteria 1462
687 Ga0496117_0028354 3300048920 Bacteria 4339
688 Ga0496117_0089657 3300048920 Bacteria 1985
689 Ga0496118_0001458 3300048921 Bacteria 35562
690 Ga0496118_0031386 3300048921 Bacteria 4405
691 Ga0496119_0003138 3300048922 Bacteria 17407
692 Ga0496119_0197794 3300048922 Bacteria 1042
693 Ga0496120_0015858 3300048923 Bacteria 4949
694 Ga0496120_0042462 3300048923 Bacteria 2655
695 Ga0496121_0000146 3300048924 Bacteria 154459
696 Ga0496121_0001525 3300048924 Bacteria 38839
697 Ga0496121_0039521 3300048924 Bacteria 4155
698 Ga0496121_0073560 3300048924 Bacteria 2738
699 Ga0496121_0079535 3300048924 Bacteria 2602
700 Ga0496121_0109129 3300048924 Bacteria 2115
701 Ga0496121_0141995 3300048924 Bacteria 1780
702 Ga0496121_0173220 3300048924 Bacteria 1565
703 Ga0496121_0221500 3300048924 Bacteria 1332
704 Ga0496121_0261049 3300048924 Bacteria 1196
705 Ga0496122_0013345 3300048925 Bacteria 8048
706 Ga0496122_0078087 3300048925 Bacteria 2321
707 Ga0496123_0115156 3300048926 Bacteria 1526
708 Ga0496124_0002217 3300048927 Bacteria 25870
709 Ga0496124_0012006 3300048927 Bacteria 8611
710 Ga0496124_0074509 3300048927 Bacteria 2805
711 Ga0496124_0330131 3300048927 Bacteria 1088
712 Ga0496125_0000099 3300048928 Bacteria 203333
713 Ga0496125_0003103 3300048928 Bacteria 20706
714 Ga0496125_0003676 3300048928 Bacteria 18328
715 Ga0496125_0056870 3300048928 Bacteria 3173
716 Ga0496125_0098349 3300048928 Bacteria 2165
717 Ga0496125_0101350 3300048928 Bacteria 2119
718 Ga0496125_0171374 3300048928 Bacteria 1458
719 Ga0496125_0255755 3300048928 Bacteria 1101
720 Ga0496126_0003212 3300048929 Bacteria 20945
721 Ga0496126_0004243 3300048929 Bacteria 17254
722 Ga0496126_0010429 3300048929 Bacteria 9736
723 Ga0496126_0016652 3300048929 Bacteria 7346
724 Ga0496126_0058992 3300048929 Bacteria 3457
725 Ga0496126_0124221 3300048929 Bacteria 2235
726 Ga0496126_0142660 3300048929 Bacteria 2060
727 Ga0496126_0236367 3300048929 Bacteria 1528
728 Ga0496126_0252657 3300048929 Bacteria 1468
729 Ga0496126_0316293 3300048929 Bacteria 1284
730 Ga0496126_0398518 3300048929 Bacteria 1117
731 Ga0501033_0020903 3300049570 Bacteria 4940
732 Ga0501034_0168820 3300049571 Bacteria 2156
733 Ga0501037_0087480 3300049573 Bacteria 2255
734 Ga0501038_0113748 3300049574 Bacteria 2239
735 Ga0501039_0187577 3300049575 Bacteria 1626
736 Ga0501047_0257069 3300049581 Bacteria 1594
737 Ga0501068_0139925 3300049584 Bacteria 1517
738 Ga0501073_0151635 3300049589 Bacteria 1607
739 Ga0501235_019739 3300049669 Bacteria 1496
740 Ga0501080_0097775 3300049742 Bacteria 2726
741 nmdc:mga03683_3300_c1 3300050489 Bacteria 4493
742 nmdc:mga03n38_1503_c1 3300050490 Bacteria 6729
743 nmdc:mga03n38_74501_c1 3300050490 Bacteria 1579
744 nmdc:mga00v17_270674_c1 3300050491 Bacteria 1102
745 nmdc:mga0yw44_186447_c1 3300050492 Bacteria 1367
746 nmdc:mga0yw44_238276_c1 3300050492 Bacteria 1209
747 nmdc:mga0yw44_88455_c1 3300050492 Bacteria 1953
748 nmdc:mga0k408_23297_c1 3300050493 Bacteria 3491
749 nmdc:mga06z11_172489_c1 3300050494 Bacteria 1243
750 nmdc:mga06z11_185854_c1 3300050494 Bacteria 1201
751 nmdc:mga06z11_64715_c1 3300050494 Bacteria 1917
752 nmdc:mga06z11_7051_c1 3300050494 Bacteria 4608
753 nmdc:mga04h51_45459_c1 3300050495 Bacteria 1452
754 nmdc:mga07m45_168319_c1 3300050496 Bacteria 1273
755 nmdc:mga07m45_180195_c1 3300050496 Bacteria 1229
756 nmdc:mga07m45_20736_c1 3300050496 Bacteria 3572
757 nmdc:mga05p37_15155_c1 3300050507 Bacteria 9257
758 nmdc:mga05p37_75724_c1 3300050507 Bacteria 4142
759 nmdc:mga0n895_236471_c1 3300050512 Bacteria 1854
760 nmdc:mga0sz30_43399_c1 3300050516 Bacteria 1893
761 nmdc:mga0sz30_93211_c1 3300050516 Bacteria 1312
762 nmdc:mga0sz30_93948_c1 3300050516 Bacteria 1307
763 Ga0495601_0032293 3300053077 Bacteria 3258
764 Ga0495601_0108477 3300053077 Bacteria 1796
765 Ga0495612_0097656 3300053078 Bacteria 1248
766 Ga0500635_0055288 3300053080 Bacteria 1370
767 Ga0495655_0007769 3300053083 Bacteria 2010
768 Ga0495595_0061912 3300053084 Bacteria 1753
769 Ga0495619_0077752 3300053085 Bacteria 2229
770 Ga0500643_000052 3300053087 Bacteria 144656
771 Ga0500643_023418 3300053087 Bacteria 1973
772 Ga0500647_0020775 3300053091 Bacteria 3059
773 Ga0500651_0018968 3300053093 Bacteria 4265
774 Ga0500566_0039993 3300053094 Bacteria 2710
775 Ga0500566_0077548 3300053094 Bacteria 1855
776 Ga0500554_028832 3300053102 Bacteria 1617
777 Ga0500554_067935 3300053102 Bacteria 1155
778 Ga0500555_001634 3300053103 Bacteria 6773
779 Ga0500556_0003305 3300053104 Bacteria 4778
780 Ga0500556_0094648 3300053104 Bacteria 1144
781 Ga0500557_000096 3300053105 Bacteria 28838
782 Ga0500569_001480 3300053109 Bacteria 4446
783 Ga0500572_000335 3300053111 Bacteria 16881
784 Ga0500572_012239 3300053111 Bacteria 2098
785 Ga0500594_0083366 3300053118 Bacteria 960
786 Ga0500595_000728 3300053119 Bacteria 19571
787 Ga0500595_012442 3300053119 Bacteria 3292
788 Ga0500595_021655 3300053119 Bacteria 2291
789 Ga0500595_059971 3300053119 Bacteria 1152
790 Ga0500642_0000083 3300053130 Bacteria 50718
791 Ga0500658_0026515 3300053134 Bacteria 2233
792 Ga0500658_0051892 3300053134 Bacteria 1678
793 Ga0500559_0003196 3300053136 Bacteria 8145
794 Ga0500559_0037151 3300053136 Bacteria 2110
795 Ga0500564_067301 3300053138 Bacteria 1619
796 Ga0500568_0027187 3300053139 Bacteria 2394
797 Ga0500573_0144985 3300053140 Bacteria 1304
798 Ga0500577_0050831 3300053142 Bacteria 1556
799 Ga0500590_075347 3300053148 Bacteria 1669
800 Ga0500603_003284 3300053150 Bacteria 3475
801 Ga0500616_0015671 3300053153 Bacteria 4327
802 Ga0500616_0060448 3300053153 Bacteria 1964
803 Ga0500622_0012122 3300053156 Bacteria 4678
804 Ga0500638_007140 3300053162 Bacteria 4643
805 Ga0500639_161605 3300053163 Bacteria 1018
806 Ga0500636_0000232 3300053177 Bacteria 30484
807 Ga0500636_0024967 3300053177 Bacteria 3532
808 Ga0500636_0035062 3300053177 Bacteria 2970
809 Ga0500636_0175110 3300053177 Bacteria 1157
810 Ga0500637_0000080 3300053178 Bacteria 34464
811 Ga0500637_0188357 3300053178 Bacteria 1179
812 Ga0500625_026577 3300053729 Bacteria 2742
813 Ga0500645_004073 3300053730 Bacteria 5727
814 Ga0500645_052144 3300053730 Bacteria 1192
815 Ga0500645_052415 3300053730 Bacteria 1189
816 Ga0500609_000805 3300053731 Bacteria 4710
817 Ga0500596_002066 3300053735 Bacteria 4000
818 Ga0500599_002446 3300053736 Bacteria 2228
819 Ga0500601_000108 3300053737 Bacteria 17177
820 Ga0501084_0016246 3300054114 Bacteria 6181
821 Ga0500661_011701 3300055283 Bacteria 1586
822 Ga0501082_0193577 3300060353 Bacteria 1769
823 2508545792 2508501009 Bacteria 7784016
824 2508694618 2508501042 Bacteria 8719808
825 2509146538 2508501128 Bacteria 8613869
826 2511398380 2511231028 Bacteria 8046582
827 2513624470 2513237092 Bacteria 8341956
828 2513638665 2513237094 Bacteria 8789602
829 2513649944 2513237095 Bacteria 8976980
830 2513655384 2513237096 Bacteria 8722461
831 2513672529 2513237098 Bacteria 9902361
832 2513702473 2513237102 Bacteria 7703324
833 2513716789 2513237104 Bacteria 10034502
834 2513860052 2513237137 Bacteria 9558895
835 2513874239 2513237139 Bacteria 8737671
836 2513892408 2513237141 Bacteria 8496279
837 2513916538 2513237145 Bacteria 8979722
838 2514009995 2513237161 Bacteria 8871253
839 2515624455 2515154112 Bacteria 8294334
840 2517104618 2517093001 Bacteria 9002274
841 2517889871 2517572143 Bacteria 9484767
842 2523467875 2523231067 Bacteria 5230452
843 2524438570 2524023205 Bacteria 8918781
844 2524466687 2524023210 Bacteria 9029266
845 2524532941 2524023228 Bacteria 10118060
846 2528850423 2528768022 Bacteria 10457665
847 2597866882 2597489888 Bacteria 6179543
848 2597872721 2597489889 Bacteria 6297495
849 2599503704 2599185188 Bacteria 6164180
850 2599505979 2599185189 Bacteria 5862825
851 2599942115 2599185302 Bacteria 5954930
852 2599955096 2599185304 Bacteria 5951361
853 2599984511 2599185309 Bacteria 5969593
854 2599990793 2599185310 Bacteria 6014457
855 2600000715 2599185312 Bacteria 5912071
856 2600049690 2599185320 Bacteria 5963263
857 2601693227 2600255296 Bacteria 5784754
858 2603860653 2602042107 Bacteria 6226103
859 2617353864 2617270735 Bacteria 9163226
860 2617374641 2617270741 Bacteria 8201522
861 2621296615 2619619299 Bacteria 6649820
862 2643873445 2643221571 Bacteria 6228673
863 2644290240 2643221651 Bacteria 4798932
864 2644624540 2643221713 Bacteria 6554480
865 2671121105 2667528175 Bacteria 7532676
866 2723251594 2721755607 Bacteria 5841722
867 2728751734 2728368998 Bacteria 8720350
868 2738673548 2738541265 Bacteria 6594665
869 2738751941 2738541282 Bacteria 6593925
870 2738860982 2738541303 Bacteria 6591772
871 2739349328 2738543031 Bacteria 5769731
872 2745077204 2744054633 Bacteria 8678936
873 2793059373 2791355196 Bacteria 7323613
874 2793073399 2791355197 Bacteria 8420563
875 2793078591
876 2805922129 2802429603 Bacteria 8777136
877 2808976386 2808606385 Bacteria 6711065
878 2808994154 2808606388 Bacteria 6706662
879 2812370627 2811994881 Bacteria 6298475
880 2817494274 2816332298 Bacteria 6852809
881 2818240944 2816332527 Bacteria 8933356
882 2824604622 2824600985 Bacteria 8488197
883 2824616170 2824609381 Bacteria 8672835
884 2824658371 2824653114 Bacteria 8493680
885 2824667379 2824661429 Bacteria 9877870
886 2824675542 2824671348 Bacteria 8369588
887 2824686559 2824679649 Bacteria 8248951
888 2824691764 2824687955 Bacteria 8360029
889 2824698993 2824696289 Bacteria 8335049
890 2824711685 2824704595 Bacteria 9667483
891 2824739303 2824732956 Bacteria 7810675
892 2824750387 2824746037 Bacteria 7911610
893 2824761083 2824753945 Bacteria 9787441
894 2824771800 2824763712 Bacteria 9792355
895 2824779758 2824773399 Bacteria 8360218
896 2834031180 2834028612 Bacteria 6354979
897 2838126100 2838122688 Bacteria 8803140
898 2841942507 2841941048 Bacteria 8688029
899 2841953143 2841949485 Bacteria 8680857
900 2841960651 2841957949 Bacteria 8652217
901 2841970833 2841966195 Bacteria 8673214
902 2841977908 2841974524 Bacteria 8931498
903 2841984527 2841983080 Bacteria 8395090
904 2842041752 2842038055 Bacteria 8002051
905 2842049794 2842045827 Bacteria 8006841
906 2842828518 2842826826 Bacteria 5974129
907 2842838129 2842837860 Bacteria 6066181
908 2844321366 2844315083 Bacteria 8138177
909 2847932047 2847930680 Bacteria 9342022
910 2847943284 2847939898 Bacteria 8606328
911 2852616581 2852612431 Bacteria 6885235
912 2852671549 2852667396 Bacteria 6885555
913 2857514715 2857509624 Bacteria 7472071
914 2857525612 2857524615 Bacteria 6615449
915 2860873252 2860867994 Bacteria 5645326
916 2871286099 2871282230 Bacteria 4917173
917 2874595687 2874590934 Bacteria 8299676
918 2874620313 2874612657 Bacteria 8252029
919 2874624251 2874620515 Bacteria 8290088
920 2874630276 2874628541 Bacteria 8630250
921 2874651681 2874645413 Bacteria 8214782
922 2876767692 2876761206 Bacteria 10111113
923 2876775882 2876771140 Bacteria 8287509
924 2876821576 2876818435 Bacteria 8274608
925 2879079973 2879074833 Bacteria 8279565
926 2879085723 2879083081 Bacteria 8587928
927 2879100892 2879099564 Bacteria 10442239
928 2879134056 2879127579 Bacteria 8294491
929 2879148541 2879142872 Bacteria 8267021
930 2881669343 2881665667 Bacteria 8175609
931 2885193860 2885192300 Bacteria 5882526
932 2885374456 2885366525 Bacteria 8326213
933 2885376198 2885374607 Bacteria 8927485
934 2885385887 2885383462 Bacteria 9473874
935 2888387662 2888378607 Bacteria 9652610
936 2888391501 2888388044 Bacteria 7304136
937 2888426879 2888419890 Bacteria 7857137
938 2893070664 2893066018 Bacteria 6158120
939 2903731444 2903727486 Bacteria 8281579
940 2903749013 2903748898 Bacteria 9972761
941 2903775929 2903768456 Bacteria 9749579
942 2904454323 2904449895 Bacteria 6927402
943 2904462681 2904456579 Bacteria 6819253
944 2904670962 2904666416 Bacteria 8226587
945 2904692692 2904690495 Bacteria 9412302
946 2904711208
947 2904713583 2904711408 Bacteria 9771557
948 2906607980 2906602504 Bacteria 8295279
949 2906612392
950 2906633050 2906626472 Bacteria 8826946
951 2906637844 2906635258 Bacteria 8601019
952 2906663433 2906660503 Bacteria 8595048
953 2908739734 2908739725 Bacteria 8628932
954 2908757668 2908756301 Bacteria 8864324
955 2908777122 2908775508 Bacteria 8092255
956 2919074580 2919073203 Bacteria 6531949
957 2922376649
958 2922391544 2922386360 Bacteria 7017218
959 2922398596 2922393267 Bacteria 8285685
960 2922426901
961 2923524727 2923519811 Bacteria 6298479
962 2928118629 2928115317 Bacteria 6477646
963 2929195381 2929189879 Bacteria 5930554
964 2929527132 2929520902 Bacteria 6765052
965 2929619848 2929615660 Bacteria 9193770
966 2929629159 2929624759 Bacteria 9339455
967 2932789709 2932784394 Bacteria 9704911
968 2932796625 2932794094 Bacteria 7915132
969 2932802593 2932801729 Bacteria 7987968
970 2932817779 2932809354 Bacteria 9135765
971 2932827110 2932818245 Bacteria 9955613
972 2932835634 2932828146 Bacteria 9745859
973 2933581766 2933577622 Bacteria 9116884
974 2935613228 2935608549 Bacteria 8203142
975 2935624592 2935616580 Bacteria 9032984
976 2935633062 2935630451 Bacteria 8169952
977 2935647181 2935638405 Bacteria 10015038
978 2935655598 2935648319 Bacteria 8801166
979 2935664498 2935656913 Bacteria 8965014
980 2935674356 2935665750 Bacteria 9571747
981 2935684237 2935675223 Bacteria 9928132
982 2935689108 2935684952 Bacteria 9590419
983 2935697631 2935694250 Bacteria 9291695
984 2935711345 2935703347 Bacteria 10242284
985 2935720054 2935713505 Bacteria 9608509
986 2935728329 2935722832 Bacteria 9608746
987 2935737074 2935732158 Bacteria 9706831
988 2935746865 2935741537 Bacteria 9707219
989 2935757832 2935750917 Bacteria 9590372
990 2935764210 2935760218 Bacteria 9817913
991 2935775167 2935769743 Bacteria 7878163
992 2935780069 2935777560 Bacteria 8077691
993 2935790191 2935785616 Bacteria 7962367
994 2935798767 2935793552 Bacteria 8012592
995 2935809869 2935801545 Bacteria 9301974
996 2935819350 2935810662 Bacteria 9401221
997 2935824918 2935819856 Bacteria 8261050
998 2935836605 2935827899 Bacteria 10038562
999 2935846815 2935837841 Bacteria 9454360
1000 2935852138 2935847175 Bacteria 8228321
1001 2935863198 2935855204 Bacteria 9035059
1002 2935868667 2935864058 Bacteria 9784707
1003 2935879441 2935873716 Bacteria 9632195
1004 2935883596 2935883170 Bacteria 7964738
1005 2935911485 2935908558 Bacteria 8568796
1006 2935925402 2935916978 Bacteria 9113783
1007 2935928514 2935926038 Bacteria 8601059
1008 2935938159 2935934488 Bacteria 8602579
1009 2935945441 2935942939 Bacteria 8599779
1010 2935954053 2935951376 Bacteria 8602333
1011 2935965432 2935959822 Bacteria 7869783
1012 2935971679 2935967501 Bacteria 8603075
1013 2935980083 2935975950 Bacteria 8347125
1014 2935984244 2935984226 Bacteria 8302647
1015 2936000235 2935992306 Bacteria 9802711
1016 2936010277 2936002035 Bacteria 9362176
1017 2936018548 2936011229 Bacteria 8801034
1018 2936027066 2936019824 Bacteria 8804134
1019 2936035967 2936028420 Bacteria 8965941
1020 2936045973 2936037263 Bacteria 9446081
1021 2936054046 2936046547 Bacteria 8903709
1022 2936055324 2936055302 Bacteria 8785755
1023 2940563346 2940556831 Bacteria 9590747
1024 2941509636 2941507105 Bacteria 8166816
1025 2941517465 2941515067 Bacteria 8166720
1026 2941526582 2941523033 Bacteria 8169134
1027 2941531936 2941531003 Bacteria 7653939
1028 2941547259 2941538514 Bacteria 9402094
1029 2945977277 2945972063 Bacteria 6086495
1030 2946028131 2946027586 Bacteria 6049274
1031 2947234664 2947233263 Bacteria 6439278
1032 3005476087 3005474847 Bacteria 9259049
1033 3005485978 3005483717 Bacteria 7877331
1034 3005506642 3005506211 Bacteria 6943378
1035 3005591800 3005587118 Bacteria 7794411
1036 3005601718 3005594810 Bacteria 8716512
1037 3005717458 3005710791 Bacteria 7622528
1038 3005724399 3005718088 Bacteria 8283608
1039 3007419521 3007419365 Bacteria 7026924
1040 8006927298 8006926726 Bacteria 6749210
1041 8006937400 8006933436 Bacteria 10410654
1042 8006977429 8006973647 Bacteria 10679141
1043 8006986159 8006984368 Bacteria 9651211
1044 8016519182 8016511872 Bacteria 9921665
1045 8016538711 8016530956 Bacteria 8155261
1046 8016542999 8016539877 Bacteria 8155419
1047 8016550291 8016548790 Bacteria 8155074
1048 8016558700 8016557553 Bacteria 8154380
1049 8016581056 8016575299 Bacteria 8154085
1050 8016587660 8016583857 Bacteria 10421953
1051 8016596677 8016595262 Bacteria 8149947
1052 8016607552 8016603502 Bacteria 8731218
1053 8016619342 8016613128 Bacteria 8794220
1054 8016636903 8016630954 Bacteria 9217207
1055 8017066322 8017057580 Bacteria 10023680
1056 8019538384 8019530166 Bacteria 8155624
1057 8019541438 8019538911 Bacteria 7872763
1058 8019549187 8019547302 Bacteria 7996444
1059 8019561226 8019555841 Bacteria 9642137
1060 8019571316 8019565922 Bacteria 9639779
1061 8019578296 8019576017 Bacteria 10049540
1062 8019605368 8019597564 Bacteria 10041141
1063 8019613175 8019608314 Bacteria 10042931
1064 8019623865 8019619141 Bacteria 9218857
1065 8019638179 8019629233 Bacteria 8687553
1066 8019651584 8019648815 Bacteria 10014479
1067 8019666096 8019659431 Bacteria 8577854
1068 8019675607 8019668869 Bacteria 8791617
1069 8019680492 8019678201 Bacteria 8863603
1070 8019695266 8019687851 Bacteria 8712826
1071 8054290203 8054285046 Bacteria 6919322
1072 8054349356 8054347763 Bacteria 5901107
1073 8055750400 8055742211 Bacteria 9226248
1074 8055824139 8055817908 Bacteria 6609162
1075 8056151265 8056148874 Bacteria 6479865
1076 8056678901 8056673599 Bacteria 7871253
1077 8056685483 8056681323 Bacteria 8472857
1078 8056692021 8056689827 Bacteria 6712655
1079 8056971819 8056967851 Bacteria 9038162
1080 Ga0373927_0036611
1081 JGI24741J21665_1005484
1082 JGI24739J22299_10004386
1083 JGI24737J22298_10026694
1084 JGI24735J21928_10029987
1085 JGI25154J39366_1004166
1086 JGI25165J46597_1008266
1087 JGI25165J46597_1009827
1088 JGI25165J46597_1009894
1089 JGI25153J46596_10009118
1090 JGI25153J46596_10013220
1091 JGI25153J46596_10029846
1092 rootH2_10345235
1093 rootL2_10124449
1094 Ga0006562J51391_1119272
1095 JGI25404J52841_10010825
1096 Ga0055538_1000012
1097 Ga0055539_1000017
1098 Ga0055533_1000021
1099 Ga0055532_1000020
1100 Ga0055525_1000078
1101 Ga0055540_1001304
1102 Ga0055541_1000012
1103 Ga0065165_1003123
1104 Ga0065165_1007216
1105 Ga0065165_1010731
1106 Ga0065165_1033623
1107 Ga0065714_10004573
1108 Ga0065704_10088231
1109 Ga0070658_10145326
1110 Ga0070683_100058153
1111 Ga0070670_100000141
1112 Ga0070670_100223142
1113 Ga0068869_100177413
1114 Ga0070666_10116344
1115 Ga0070680_100007323
1116 Ga0070680_100251951
1117 Ga0070682_100101303
1118 Ga0068868_100219698
1119 Ga0070660_100003353
1120 Ga0070689_100017936
1121 Ga0070689_100397977
1122 Ga0070661_100029726
1123 Ga0070668_100103430
1124 Ga0070668_100116316
1125 Ga0070668_100399295
1126 Ga0070668_100448652
1127 Ga0070669_100238436
1128 Ga0070675_100309043
1129 Ga0070671_100241802
1130 Ga0070671_100387593
1131 Ga0070688_100145669
1132 Ga0070659_100043428
1133 Ga0070659_100349769
1134 Ga0070667_100163338
1135 Ga0070709_10004499
1136 Ga0070709_10016287
1137 Ga0070714_100032403
1138 Ga0070713_100024272
1139 Ga0070713_100097488
1140 Ga0070713_100228196
1141 Ga0070710_10003046
1142 Ga0070710_10039645
1143 Ga0070711_100010406
1144 Ga0070663_100007241
1145 Ga0070663_100160637
1146 Ga0070663_100166983
1147 Ga0070663_100174728
1148 Ga0070678_100202136
1149 Ga0070678_100255989
1150 Ga0070662_100026265
1151 Ga0070662_100121049
1152 Ga0070681_10033490
1153 Ga0070685_10175818
1154 Ga0070699_100382184
1155 Ga0070679_100075614
1156 Ga0070679_100377415
1157 Ga0070679_100613690
1158 Ga0070684_100006286
1159 Ga0070684_100025288
1160 Ga0068853_100001496
1161 Ga0068853_100026288
1162 Ga0068853_100269755
1163 Ga0068853_100368008
1164 Ga0070665_100105477
1165 Ga0070665_100155549
1166 Ga0070665_100367819
1167 Ga0070665_100499631
1168 Ga0070704_100192822
1169 Ga0070704_100241846
1170 Ga0068855_100031854
1171 Ga0068855_100256651
1172 Ga0068855_100300260
1173 Ga0068855_100376434
1174 Ga0070664_100503876
1175 Ga0068857_100004210
1176 Ga0068857_100056749
1177 Ga0068857_100060787
1178 Ga0068854_100008298
1179 Ga0068854_100017829
1180 Ga0068854_100061411
1181 Ga0068856_100006410
1182 Ga0068856_100019463
1183 Ga0068856_100077437
1184 Ga0068856_100547953
1185 Ga0070702_100275930
1186 Ga0068852_100016237
1187 Ga0068852_100326120
1188 Ga0068852_100448092
1189 Ga0068859_100135138
1190 Ga0068859_100164271
1191 Ga0068859_100178873
1192 Ga0068864_100133624
1193 Ga0068864_100487779
1194 Ga0068866_10093974
1195 Ga0068861_100170496
1196 Ga0068861_100489562
1197 Ga0068851_10011168
1198 Ga0068863_100406296
1199 Ga0068858_100334100
1200 Ga0068858_100400955
1201 Ga0068858_100511700
1202 Ga0068860_100003385
1203 Ga0068862_100145350
1204 Ga0081538_10036555
1205 Ga0081540_1004705
1206 Ga0081540_1005016
1207 Ga0081540_1005578
1208 Ga0081540_1005788
1209 Ga0081540_1006936
1210 Ga0081540_1010271
1211 Ga0081540_1015887
1212 Ga0081540_1031359
1213 Ga0081540_1041746
1214 Ga0081540_1066406
1215 Ga0081539_10039667
1216 Ga0070717_10023806
1217 Ga0070717_10105321
1218 Ga0070717_10119675
1219 Ga0075365_10146416
1220 Ga0075365_10151624
1221 Ga0075365_10184513
1222 Ga0075368_10012299
1223 Ga0075368_10041629
1224 Ga0075368_10068758
1225 Ga0075363_100004089
1226 Ga0075364_10253173
1227 Ga0070716_100010967
1228 Ga0070716_100079528
1229 Ga0070716_100081468
1230 Ga0070712_100028666
1231 Ga0070712_100248704
1232 Ga0070712_100405837
1233 Ga0075367_10022959
1234 Ga0075367_10051061
1235 Ga0075367_10113608
1236 Ga0075367_10131776
1237 Ga0075367_10202456
1238 Ga0075366_10112604
1239 Ga0075434_100244652
1240 Ga0068865_100057630
1241 Ga0097620_100135137
1242 Ga0097620_100164286
1243 Ga0097620_100178880
1244 Ga0099824_1008875
1245 Ga0099824_1023890
1246 Ga0099822_1017500
1247 Ga0099794_10043155
1248 Ga0105244_10003428
1249 Ga0105240_10009125
1250 Ga0105240_10014685
1251 Ga0105240_10046064
1252 Ga0105240_10095537
1253 Ga0105240_10538244
1254 Ga0105245_10071302
1255 Ga0105245_10216132
1256 Ga0105245_10260089
1257 Ga0105247_10104696
1258 Ga0105247_10173183
1259 Ga0105247_10187173
1260 Ga0114129_10004595
1261 Ga0114129_10157307
1262 Ga0105243_10075279
1263 Ga0105243_10231134
1264 Ga0105243_10485191
1265 Ga0105241_10015112
1266 Ga0105241_10111550
1267 Ga0105241_10197931
1268 Ga0105241_10240858
1269 Ga0105241_10529071
1270 Ga0105242_10184248
1271 Ga0105242_10205972
1272 Ga0105248_10080990
1273 Ga0105248_10170279
1274 Ga0105248_10496096
1275 Ga0105248_10579251
1276 Ga0105248_11011862
1277 Ga0105237_10008895
1278 Ga0105237_10044886
1279 Ga0105237_10069051
1280 Ga0105237_10183321
1281 Ga0105237_10356681
1282 Ga0105237_10408045
1283 Ga0105238_10025742
1284 Ga0105238_10026375
1285 Ga0105238_10028483
1286 Ga0105238_10462551
1287 Ga0105238_10572317
1288 Ga0105249_10692538
1289 Ga0099796_10016875
1290 Ga0099796_10096508
1291 Ga0105239_10008167
1292 Ga0105239_10074854
1293 Ga0105239_10084315
1294 Ga0105239_10169114
1295 Ga0105239_10271446
1296 Ga0105239_10414628
1297 Ga0105239_10694216
1298 Ga0105246_10067767
1299 Ga0157373_10011474
1300 Ga0157373_10037722
1301 Ga0157373_10047172
1302 Ga0157373_10096002
1303 Ga0157370_10054683
1304 Ga0157369_10006096
1305 Ga0157374_10199007
1306 Ga0157374_10482983
1307 Ga0157378_10222202
1308 Ga0157378_10391905
1309 Ga0157378_10543889
1310 Ga0163162_10064929
1311 Ga0163162_10586244
1312 Ga0163162_10773871
1313 Ga0157372_10149868
1314 Ga0157375_10010583
1315 Ga0163163_10513828
1316 Ga0157380_10538360
1317 Ga0157380_10835908
1318 Ga0182008_10000581
1319 Ga0182008_10000904
1320 Ga0157379_10107304
1321 Ga0157376_10042518
1322 Ga0157376_10436292
1323 Ga0182006_1000467
1324 Ga0182006_1092731
1325 Ga0182007_10002786
1326 Ga0214542_1000009
1327 Ga0214542_1033238
1328 Ga0214545_1000007
1329 Ga0214545_1039271
1330 Ga0214543_1000020
1331 Ga0214543_1040577
1332 Ga0213873_10002858
1333 Ga0213872_10021501
1334 Ga0213876_10001108
1335 Ga0209435_100606
1336 Ga0209784_100007
1337 Ga0209566_100009
1338 Ga0209674_100021
1339 Ga0209147_100009
1340 Ga0209563_100018
1341 Ga0209563_101581
1342 Ga0209258_100347
1343 Ga0209646_1001318
1344 Ga0209677_100012
1345 Ga0209677_102936
1346 Ga0209148_1000707
1347 Ga0209233_1001624
1348 Ga0209233_1010411
1349 Ga0209455_1004030
1350 Ga0209455_1005738
1351 Ga0209455_1007958
1352 Ga0209455_1012768
1353 Ga0209564_1000503
1354 Ga0209564_1009431
1355 Ga0209758_1000106
1356 Ga0209758_1002009
1357 Ga0209758_1002765
1358 Ga0209758_1003053
1359 Ga0209758_1006390
1360 Ga0209758_1011674
1361 Ga0209758_1011887
1362 Ga0209758_1069464
1363 Ga0209256_1008328
1364 Ga0207426_1000337
1365 Ga0207426_1007201
1366 Ga0207426_1009271
1367 Ga0209051_1000298
1368 Ga0209257_1000684
1369 Ga0207656_10035984
1370 Ga0207656_10046534
1371 Ga0207655_1000534
1372 Ga0207692_10001396
1373 Ga0207692_10070024
1374 Ga0207688_10048296
1375 Ga0207688_10098160
1376 Ga0207680_10165964
1377 Ga0207680_10269037
1378 Ga0207647_10009009
1379 Ga0207647_10053238
1380 Ga0207685_10004095
1381 Ga0207699_10038984
1382 Ga0207645_10133078
1383 Ga0207645_10282096
1384 Ga0207643_10027690
1385 Ga0207705_10080452
1386 Ga0207705_10418436
1387 Ga0207707_10001933
1388 Ga0207695_10000478
1389 Ga0207695_10034396
1390 Ga0207695_10142598
1391 Ga0207671_10037028
1392 Ga0207671_10047710
1393 Ga0207671_10057143
1394 Ga0207671_10063710
1395 Ga0207671_10203488
1396 Ga0207693_10020323
1397 Ga0207693_10027576
1398 Ga0207693_10293797
1399 Ga0207663_10001112
1400 Ga0207663_10023479
1401 Ga0207663_10067343
1402 Ga0207660_10009206
1403 Ga0207660_10232901
1404 Ga0207662_10078044
1405 Ga0207657_10005821
1406 Ga0207657_10113450
1407 Ga0207657_10121119
1408 Ga0207652_10070273
1409 Ga0207652_10198291
1410 Ga0207694_10001415
1411 Ga0207694_10022943
1412 Ga0207694_10177181
1413 Ga0207694_10205787
1414 Ga0207650_10000089
1415 Ga0207687_10149563
1416 Ga0207700_10064270
1417 Ga0207700_10214960
1418 Ga0207664_10313407
1419 Ga0207690_10074010
1420 Ga0207706_10154120
1421 Ga0207706_10251531
1422 Ga0207706_10262690
1423 Ga0207686_10295937
1424 Ga0207709_10042337
1425 Ga0207709_10251506
1426 Ga0207709_10256222
1427 Ga0207669_10224931
1428 Ga0207704_10244042
1429 Ga0207665_10000703
1430 Ga0207665_10091630
1431 Ga0207665_10156926
1432 Ga0207711_10108494
1433 Ga0207711_10195442
1434 Ga0207711_10644284
1435 Ga0207689_10038013
1436 Ga0207689_10304900
1437 Ga0207661_10000171
1438 Ga0207661_10030341
1439 Ga0207679_10384077
1440 Ga0207667_10011741
1441 Ga0207667_10013826
1442 Ga0207667_10348678
1443 Ga0207667_10387248
1444 Ga0207668_10042480
1445 Ga0207668_10129694
1446 Ga0207640_10060359
1447 Ga0207640_10368608
1448 Ga0207677_10061516
1449 Ga0207703_10345982
1450 Ga0207703_10554506
1451 Ga0207639_10008009
1452 Ga0207678_10014592
1453 Ga0207678_10027182
1454 Ga0207678_10079253
1455 Ga0207678_10125020
1456 Ga0207678_10279947
1457 Ga0207678_10329627
1458 Ga0207702_10000003
1459 Ga0207702_10000014
1460 Ga0207702_10033457
1461 Ga0207702_10106532
1462 Ga0207702_10211921
1463 Ga0207702_10319646
1464 Ga0207702_10420068
1465 Ga0207641_10249261
1466 Ga0207676_10208596
1467 Ga0207674_10004961
1468 Ga0207674_10009035
1469 Ga0207674_10044466
1470 Ga0207674_10175694
1471 Ga0207683_10018023
1472 Ga0207683_10223320
1473 Ga0207698_10088283
1474 Ga0207698_10120408
1475 Ga0207698_10268969
1476 Ga0207698_10275638
1477 Ga0207698_10406542
1478 Ga0207698_10623316
1479 Ga0209389_1000016
1480 Ga0209389_1000027
1481 Ga0209371_1001354
1482 Ga0209589_1000005
1483 Ga0209589_1000031
1484 Ga0209489_100005
1485 Ga0209489_100057
1486 Ga0209489_100063
1487 Ga0209700_100006
1488 Ga0209700_100012
1489 Ga0268266_10004322
1490 Ga0268266_10006723
1491 Ga0268266_10086610
1492 Ga0268266_10359651
1493 Ga0268266_10676159
1494 Ga0268265_10043874
1495 Ga0268264_10000042
1496 Ga0268264_10380313
1497 Ga0265337_1009916
1498 Ga0265319_1005843
1499 Ga0265334_10011705
1500 Ga0265323_10009578
1501 Ga0265336_10000395
1502 Ga0307517_10176129
1503 Ga0265338_10000018
1504 Ga0268256_1001153
1505 Ga0316183_1201524
1506 Ga0316181_1259633
1507 Ga0265330_10056386
1508 Ga0265339_10004193
1509 Ga0265331_10092294
1510 Ga0265327_10029833
1511 Ga0307513_10072122
1512 Ga0307509_10006260
1513 Ga0307509_10070980
1514 Ga0307509_10137057
1515 Ga0307509_10337852
1516 Ga0307408_100014308
1517 Ga0307508_10000125
1518 Ga0307508_10054061
1519 Ga0307508_10221869
1520 Ga0307508_10332828
1521 Ga0307508_10343203
1522 Ga0307514_10003203
1523 Ga0265314_10022030
1524 Ga0265314_10022428
1525 Ga0265342_10013040
1526 Ga0307516_10077415
1527 Ga0307516_10113165
1528 Ga0307516_10117287
1529 Ga0307516_10199918
1530 Ga0307405_10236767
1531 Ga0307406_10000052
1532 Ga0307406_10366718
1533 Ga0307412_10349797
1534 Ga0307414_10237263
1535 Ga0307507_10062098
1536 Ga0307510_10007708
1537 Ga0307510_10015767
1538 Ga0307510_10087981
1539 Ga0307510_10204610
1540 Ga0307510_10206472
1541 Ga0315911_1000005
1542 Ga0373934_0004936
1543 Ga0373932_0016069
1544 Ga0373954_0002374
1545 Ga0373956_0038676
1546 Ga0373957_0008219
1547 Ga0373943_0018713
1548 Ga0373946_0059032
1549 Ga0373955_0000590
1550 Ga0373961_0027281
1551 Ga0373924_0042035
1552 Ga0373931_0016534
1553 Ga0373927_0014600
1554 Ga0373933_0044344
1555 Ga0373947_0083172
1556 Ga0373947_0162647
1557 Ga0373925_0284792
1558 Ga0373925_0393303
1559 Ga0395900_0000753
1560 Ga0395900_0034589
1561 Ga0395900_0570067
1562 Ga0395898_0005579
1563 Ga0395898_0029509
1564 Ga0395905_0058930
1565 Ga0395905_0095802
1566 Ga0395901_0092860
1567 Ga0395901_0290360
1568 Ga0436365_0122301
1569 Ga0436365_0816185
1570 Ga0436360_0121399
1571 Ga0436361_0897018
1572 Ga0436361_1132428
1573 Ga0436363_1250187
1574 Ga0436362_0972873
1575 Ga0436362_1029662
1576 Ga0451791_0675706
1577 Ga0451843_0000168
1578 Ga0439432_000047
1579 Ga0450891_000878
1580 Ga0466969_0016241
1581 Ga0466972_0000585
1582 Ga0466966_0000720
1583 Ga0466961_0000136
1584 Ga0466963_0047541
1585 Ga0466964_0018290
1586 Ga0466970_0091748
1587 Ga0466957_0070496
1588 Ga0466957_0198439
1589 Ga0466959_0030496
1590 Ga0466959_0132374
1591 Ga0466967_0049868
1592 Ga0466967_0090376
1593 Ga0466967_0118618
1594 Ga0466967_0257117
1595 Ga0495592_0007391
1596 Ga0495603_0017965
1597 Ga0495603_0036375
1598 Ga0495603_0046931
1599 Ga0495603_0060530
1600 Ga0495603_0114087
1601 Ga0495629_0021300
1602 Ga0495638_0016562
1603 Ga0495638_0025345
1604 Ga0495641_0077094
1605 Ga0495651_0009620
1606 Ga0495651_0058439
1607 Ga0495651_0065835
1608 Ga0495651_0177628
1609 Ga0495653_0017260
1610 Ga0495605_0072285
1611 Ga0495605_0145814
1612 Ga0495639_0105919
1613 Ga0495639_0179251
1614 Ga0495664_0009047
1615 Ga0495664_0011721
1616 Ga0495664_0018996
1617 Ga0495664_0271384
1618 Ga0495585_0136242
1619 Ga0495596_0104938
1620 Ga0495583_0093806
1621 Ga0495606_0012721
1622 Ga0495606_0024749
1623 Ga0495606_0181991
1624 Ga0495606_0196889
1625 Ga0495608_0019083
1626 Ga0495608_0048870
1627 Ga0495608_0068933
1628 Ga0495610_0055778
1629 Ga0495610_0144162
1630 Ga0495616_0149186
1631 Ga0495618_0035324
1632 Ga0495620_0089680
1633 Ga0495628_0011834
1634 Ga0495631_0119821
1635 Ga0495632_0178900
1636 Ga0495643_0021450
1637 Ga0495648_0056224
1638 Ga0495648_0118424
1639 Ga0495652_0004325
1640 Ga0495652_0033670
1641 Ga0495640_0009547
1642 Ga0495640_0028702
1643 Ga0495587_0027506
1644 Ga0495587_0058603
1645 Ga0495598_0033166
1646 Ga0495609_0094911
1647 Ga0495609_0126024
1648 Ga0495645_0007861
1649 Ga0495645_0009133
1650 Ga0495622_0006001
1651 Ga0495622_0009820
1652 Ga0495622_0061671
1653 Ga0495622_0076200
1654 Ga0495633_0052517
1655 Ga0495667_0026445
1656 Ga0495667_0035440
1657 Ga0495656_0042832
1658 Ga0495668_0024106
1659 Ga0495668_0067864
1660 Ga0495668_0098762
1661 Ga0495634_0009379
1662 Ga0495634_0034428
1663 Ga0495625_0236326
1664 Ga0495635_0007423
1665 Ga0495635_0012284
1666 Ga0495635_0093517
1667 Ga0495659_0081824
1668 Ga0495588_0004335
1669 Ga0495657_0001308
1670 Ga0495657_0007247
1671 Ga0495657_0016949
1672 Ga0495599_0019799
1673 Ga0495599_0025698
1674 Ga0495599_0051324
1675 Ga0495623_0021928
1676 Ga0495623_0120808
1677 Ga0495646_0046922
1678 Ga0495646_0081177
1679 Ga0495669_0108507
1680 Ga0495669_0139417
1681 Ga0495613_0119691
1682 Ga0495624_0074817
1683 Ga0495671_0100551
1684 Ga0495649_0119963
1685 Ga0495589_0136929
1686 Ga0495600_0007966
1687 Ga0495600_0020140
1688 Ga0495600_0031062
1689 Ga0495581_0167462
1690 Ga0495604_0006128
1691 Ga0495604_0020133
1692 Ga0495604_0244404
1693 Ga0495674_0011175
1694 Ga0495674_0044585
1695 Ga0495674_0121079
1696 Ga0495672_0005618
1697 Ga0495676_0162888
1698 Ga0495676_0224246
1699 Ga0495680_0001053
1700 Ga0495680_0014448
1701 Ga0495687_016734
1702 Ga0495679_007969
1703 Ga0495684_0073127
1704 Ga0495686_0213485
1705 Ga0495602_0021411
1706 Ga0495602_0074922
1707 Ga0496100_0012991
1708 Ga0496101_0003670
1709 Ga0496101_0130902
1710 Ga0496101_0203088
1711 Ga0496101_0250297
1712 Ga0496102_0001403
1713 Ga0496102_0051154
1714 Ga0496102_0067221
1715 Ga0496102_0719152
1716 Ga0496103_0116426
1717 Ga0496103_0276307
1718 Ga0496104_0002112
1719 Ga0496104_0014912
1720 Ga0496104_0029597
1721 Ga0496104_0108179
1722 Ga0496104_0126288
1723 Ga0496104_0301812
1724 Ga0496105_0046798
1725 Ga0496105_0076936
1726 Ga0496105_0087969
1727 Ga0496105_0123081
1728 Ga0496106_0001280
1729 Ga0496106_0011375
1730 Ga0496106_0066732
1731 Ga0496106_0234646
1732 Ga0496107_0027212
1733 Ga0496107_0202501
1734 Ga0496107_0226803
1735 Ga0496108_0031333
1736 Ga0496108_0173496
1737 Ga0496108_0399302
1738 Ga0496109_0010437
1739 Ga0496109_0240372
1740 Ga0496109_0284205
1741 Ga0496110_0056755
1742 Ga0496110_0078391
1743 Ga0496110_0133066
1744 Ga0496110_0146918
1745 Ga0496110_0186033
1746 Ga0496110_0245272
1747 Ga0496110_0611197
1748 Ga0496111_0004711
1749 Ga0496111_0057198
1750 Ga0496111_0208005
1751 Ga0496111_0369052
1752 Ga0496112_0027302
1753 Ga0496112_0036649
1754 Ga0496112_0144708
1755 Ga0496112_0199695
1756 Ga0496112_0503338
1757 Ga0496113_0006206
1758 Ga0496113_0035660
1759 Ga0496113_0093556
1760 Ga0496114_0069047
1761 Ga0496114_0346237
1762 Ga0496115_0004202
1763 Ga0496115_0049654
1764 Ga0496115_0263750
1765 Ga0496116_0127078
1766 Ga0496117_0028354
1767 Ga0496117_0089657
1768 Ga0496118_0001458
1769 Ga0496118_0031386
1770 Ga0496119_0003138
1771 Ga0496119_0197794
1772 Ga0496120_0015858
1773 Ga0496120_0042462
1774 Ga0496121_0000146
1775 Ga0496121_0001525
1776 Ga0496121_0039521
1777 Ga0496121_0073560
1778 Ga0496121_0079535
1779 Ga0496121_0109129
1780 Ga0496121_0141995
1781 Ga0496121_0173220
1782 Ga0496121_0221500
1783 Ga0496121_0261049
1784 Ga0496122_0013345
1785 Ga0496122_0078087
1786 Ga0496123_0115156
1787 Ga0496124_0002217
1788 Ga0496124_0012006
1789 Ga0496124_0074509
1790 Ga0496124_0330131
1791 Ga0496125_0000099
1792 Ga0496125_0003103
1793 Ga0496125_0003676
1794 Ga0496125_0056870
1795 Ga0496125_0098349
1796 Ga0496125_0101350
1797 Ga0496125_0171374
1798 Ga0496125_0255755
1799 Ga0496126_0003212
1800 Ga0496126_0004243
1801 Ga0496126_0010429
1802 Ga0496126_0016652
1803 Ga0496126_0058992
1804 Ga0496126_0124221
1805 Ga0496126_0142660
1806 Ga0496126_0236367
1807 Ga0496126_0252657
1808 Ga0496126_0316293
1809 Ga0496126_0398518
1810 Ga0501033_0020903
1811 Ga0501034_0168820
1812 Ga0501037_0087480
1813 Ga0501038_0113748
1814 Ga0501039_0187577
1815 Ga0501047_0257069
1816 Ga0501068_0139925
1817 Ga0501073_0151635
1818 Ga0501235_019739
1819 Ga0501080_0097775
1820 nmdc:mga03683_3300_c1
1821 nmdc:mga03n38_1503_c1
1822 nmdc:mga03n38_74501_c1
1823 nmdc:mga00v17_270674_c1
1824 nmdc:mga0yw44_186447_c1
1825 nmdc:mga0yw44_238276_c1
1826 nmdc:mga0yw44_88455_c1
1827 nmdc:mga0k408_23297_c1
1828 nmdc:mga06z11_172489_c1
1829 nmdc:mga06z11_185854_c1
1830 nmdc:mga06z11_64715_c1
1831 nmdc:mga06z11_7051_c1
1832 nmdc:mga04h51_45459_c1
1833 nmdc:mga07m45_168319_c1
1834 nmdc:mga07m45_180195_c1
1835 nmdc:mga07m45_20736_c1
1836 nmdc:mga05p37_15155_c1
1837 nmdc:mga05p37_75724_c1
1838 nmdc:mga0n895_236471_c1
1839 nmdc:mga0sz30_43399_c1
1840 nmdc:mga0sz30_93211_c1
1841 nmdc:mga0sz30_93948_c1
1842 Ga0495601_0032293
1843 Ga0495601_0108477
1844 Ga0495612_0097656
1845 Ga0500635_0055288
1846 Ga0495655_0007769
1847 Ga0495595_0061912
1848 Ga0495619_0077752
1849 Ga0500643_000052
1850 Ga0500643_023418
1851 Ga0500647_0020775
1852 Ga0500651_0018968
1853 Ga0500566_0039993
1854 Ga0500566_0077548
1855 Ga0500554_028832
1856 Ga0500554_067935
1857 Ga0500555_001634
1858 Ga0500556_0003305
1859 Ga0500556_0094648
1860 Ga0500557_000096
1861 Ga0500569_001480
1862 Ga0500572_000335
1863 Ga0500572_012239
1864 Ga0500594_0083366
1865 Ga0500595_000728
1866 Ga0500595_012442
1867 Ga0500595_021655
1868 Ga0500595_059971
1869 Ga0500642_0000083
1870 Ga0500658_0026515
1871 Ga0500658_0051892
1872 Ga0500559_0003196
1873 Ga0500559_0037151
1874 Ga0500564_067301
1875 Ga0500568_0027187
1876 Ga0500573_0144985
1877 Ga0500577_0050831
1878 Ga0500590_075347
1879 Ga0500603_003284
1880 Ga0500616_0015671
1881 Ga0500616_0060448
1882 Ga0500622_0012122
1883 Ga0500638_007140
1884 Ga0500639_161605
1885 Ga0500636_0000232
1886 Ga0500636_0024967
1887 Ga0500636_0035062
1888 Ga0500636_0175110
1889 Ga0500637_0000080
1890 Ga0500637_0188357
1891 Ga0500625_026577
1892 Ga0500645_004073
1893 Ga0500645_052144
1894 Ga0500645_052415
1895 Ga0500609_000805
1896 Ga0500596_002066
1897 Ga0500599_002446
1898 Ga0500601_000108
1899 Ga0501084_0016246
1900 Ga0500661_011701
1901 Ga0501082_0193577
1902 2508545792
1903 2508694618
1904 2509146538
1905 2511398380
1906 2513624470
1907 2513638665
1908 2513649944
1909 2513655384
1910 2513672529
1911 2513702473
1912 2513716789
1913 2513860052
1914 2513874239
1915 2513892408
1916 2513916538
1917 2514009995
1918 2515624455
1919 2517104618
1920 2517889871
1921 2523467875
1922 2524438570
1923 2524466687
1924 2524532941
1925 2528850423
1926 2597866882
1927 2597872721
1928 2599503704
1929 2599505979
1930 2599942115
1931 2599955096
1932 2599984511
1933 2599990793
1934 2600000715
1935 2600049690
1936 2601693227
1937 2603860653
1938 2617353864
1939 2617374641
1940 2621296615
1941 2643873445
1942 2644290240
1943 2644624540
1944 2671121105
1945 2723251594
1946 2728751734
1947 2738673548
1948 2738751941
1949 2738860982
1950 2739349328
1951 2745077204
1952 2793059373
1953 2793073399
1954 2793078591
1955 2805922129
1956 2808976386
1957 2808994154
1958 2812370627
1959 2817494274
1960 2818240944
1961 2824604622
1962 2824616170
1963 2824658371
1964 2824667379
1965 2824675542
1966 2824686559
1967 2824691764
1968 2824698993
1969 2824711685
1970 2824739303
1971 2824750387
1972 2824761083
1973 2824771800
1974 2824779758
1975 2834031180
1976 2838126100
1977 2841942507
1978 2841953143
1979 2841960651
1980 2841970833
1981 2841977908
1982 2841984527
1983 2842041752
1984 2842049794
1985 2842828518
1986 2842838129
1987 2844321366
1988 2847932047
1989 2847943284
1990 2852616581
1991 2852671549
1992 2857514715
1993 2857525612
1994 2860873252
1995 2871286099
1996 2874595687
1997 2874620313
1998 2874624251
1999 2874630276
2000 2874651681
2001 2876767692
2002 2876775882
2003 2876821576
2004 2879079973
2005 2879085723
2006 2879100892
2007 2879134056
2008 2879148541
2009 2881669343
2010 2885193860
2011 2885374456
2012 2885376198
2013 2885385887
2014 2888387662
2015 2888391501
2016 2888426879
2017 2893070664
2018 2903731444
2019 2903749013
2020 2903775929
2021 2904454323
2022 2904462681
2023 2904670962
2024 2904692692
2025 2904711208
2026 2904713583
2027 2906607980
2028 2906612392
2029 2906633050
2030 2906637844
2031 2906663433
2032 2908739734
2033 2908757668
2034 2908777122
2035 2919074580
2036 2922376649
2037 2922391544
2038 2922398596
2039 2922426901
2040 2923524727
2041 2928118629
2042 2929195381
2043 2929527132
2044 2929619848
2045 2929629159
2046 2932789709
2047 2932796625
2048 2932802593
2049 2932817779
2050 2932827110
2051 2932835634
2052 2933581766
2053 2935613228
2054 2935624592
2055 2935633062
2056 2935647181
2057 2935655598
2058 2935664498
2059 2935674356
2060 2935684237
2061 2935689108
2062 2935697631
2063 2935711345
2064 2935720054
2065 2935728329
2066 2935737074
2067 2935746865
2068 2935757832
2069 2935764210
2070 2935775167
2071 2935780069
2072 2935790191
2073 2935798767
2074 2935809869
2075 2935819350
2076 2935824918
2077 2935836605
2078 2935846815
2079 2935852138
2080 2935863198
2081 2935868667
2082 2935879441
2083 2935883596
2084 2935911485
2085 2935925402
2086 2935928514
2087 2935938159
2088 2935945441
2089 2935954053
2090 2935965432
2091 2935971679
2092 2935980083
2093 2935984244
2094 2936000235
2095 2936010277
2096 2936018548
2097 2936027066
2098 2936035967
2099 2936045973
2100 2936054046
2101 2936055324
2102 2940563346
2103 2941509636
2104 2941517465
2105 2941526582
2106 2941531936
2107 2941547259
2108 2945977277
2109 2946028131
2110 2947234664
2111 3005476087
2112 3005485978
2113 3005506642
2114 3005591800
2115 3005601718
2116 3005717458
2117 3005724399
2118 3007419521
2119 8006927298
2120 8006937400
2121 8006977429
2122 8006986159
2123 8016519182
2124 8016538711
2125 8016542999
2126 8016550291
2127 8016558700
2128 8016581056
2129 8016587660
2130 8016596677
2131 8016607552
2132 8016619342
2133 8016636903
2134 8017066322
2135 8019538384
2136 8019541438
2137 8019549187
2138 8019561226
2139 8019571316
2140 8019578296
2141 8019605368
2142 8019613175
2143 8019623865
2144 8019638179
2145 8019651584
2146 8019666096
2147 8019675607
2148 8019680492
2149 8019695266
2150 8054290203
2151 8054349356
2152 8055750400
2153 8055824139
2154 8056151265
2155 8056678901
2156 8056685483
2157 8056692021
2158 8056971819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01297

ZnuA

Zinc-uptake complex component A periplasmic

27

287

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hx7-assembly1.cif.gz_A metal abc transporter from listeria monocytogenes 0.9012 27 296
6xpn-assembly2.cif.gz_A z-loop deletion mutant of aztc from paracoccus denitrificans 0.8983 28 295
3zk9-assembly2.cif.gz_B crystal structure of pneumococcal surface antigen psaa d280n in the metal-free, open state 0.8943 27 296
6q1c-assembly1.cif.gz_A apo yfea extracted from the e. coli periplasm 0.8893 26 296
3zk8-assembly2.cif.gz_B crystal structure of pneumococcal surface antigen psaa e205q in the metal-free, open state 0.8873 27 296
ID Description Score Start End Superfamily
4irmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9561 30 177 3.40.50.1980
4udnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9333 30 178 3.40.50.1980
4oxrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9322 27 165 3.40.50.1980
1pq4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9205 26 174 3.40.50.1980
4irmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9187 30 177 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A2A2Q068-F1-model_v4 Metal ABC transporter substrate-binding protein 0.9537 27 162 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A3S5ES28-F1-model_v4 Periplasmic iron-binding protein 0.9512 23 169 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A369FT21-F1-model_v4 Metal ABC transporter substrate-binding protein 0.9453 22 158 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A7W1NBS9-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9441 25 171 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A524KIM7-F1-model_v4 Metal ABC transporter substrate-binding protein 0.9392 86 296 GO:0007155
GO:0030001
GO:0030313
GO:0046872

Map