F489652

General Info

Members Datasets Scaffolds Average Seq Length
1079 630 2158 244

Family's Representative Sequence

Representative Sequence 3300049758|Ga0501241_001086|Ga0501241_001086_522_1358
Length 278
Sequence LRLRRDASGRLQKCADRHLFHQGNFMSRLRVLDDPTILPALDPAYALQRPAIGLGADEPAPRILLLYGSLRARSFSRLAVEEAARLLQFFGAETRIFDPSDLPLPDQIAGDDHPAVHELRELSMWSEGQVWCSPERHGQISGIMKAQIDHLPLEMGGMRPTQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMVTIPNQSSVAMAYKEFDEAGRMKPSSYYDRIVDVMEELVRFTVLLRPHAGQLVDRYSERKAAGLRVDPAAELAARALASSTVRSG

Samples

Sample ID Description Type Environment
1 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
91 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
94 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
95 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
154 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
155 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
177 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
191 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
254 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
293 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
294 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
295 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
300 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
314 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
318 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
322 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
323 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
324 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
325 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
326 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
327 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
328 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
329 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
330 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
331 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
332 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
333 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
336 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
337 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
338 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
341 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
342 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
346 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
347 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
352 2509276019 Ensifer aridi TW10 Isolate Nodule
353 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
354 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
355 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
356 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
357 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
358 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
359 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
360 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
361 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
362 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
363 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
364 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
365 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
366 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
367 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
368 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
369 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
370 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
371 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
372 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
373 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
374 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
375 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
376 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
377 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
378 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
379 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
380 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
381 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
382 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
383 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
384 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
385 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
386 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
387 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
388 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
389 2643221583 Caulobacter sp. Root655 Isolate Unclassified
390 2643221584 Caulobacter sp. Root656 Isolate Unclassified
391 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
392 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
393 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
394 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
395 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
396 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
397 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
398 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
399 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
400 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
401 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
402 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
403 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
404 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
405 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
406 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
407 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
408 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
409 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
410 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
411 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
412 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
413 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
414 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
415 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
416 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
417 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
418 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
419 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
420 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
421 2849560528 Caulobacter zeae 410 Isolate Unclassified
422 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
423 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
424 2851153111 Caulobacter radicis 736 Isolate Unclassified
425 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
426 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
427 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
428 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
429 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
430 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
431 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
432 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
433 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
434 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
435 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
436 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
437 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
438 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
439 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
440 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
441 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
442 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
443 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
444 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
445 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
446 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
447 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
448 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
449 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
450 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
451 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
452 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
453 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
454 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
455 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
456 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
457 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
458 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
459 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
460 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
461 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
462 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
463 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
464 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
465 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
466 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
467 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
468 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
469 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
470 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
471 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
472 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
473 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
474 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
475 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
476 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
477 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
478 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
479 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
480 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
481 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
482 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
483 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
484 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
485 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
486 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
487 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
488 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
489 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
490 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
491 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
492 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
493 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
494 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
495 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
496 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
497 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
498 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
499 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
500 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
501 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
502 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
503 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
504 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
505 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
506 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
507 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
508 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
509 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
510 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
511 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
512 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
513 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
514 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
515 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
516 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
517 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
518 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
519 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
520 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
521 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
522 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
523 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
524 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
525 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
526 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
527 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
528 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
529 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
530 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
531 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
532 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
533 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
534 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
535 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
536 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
537 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
538 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
539 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
540 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
541 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
542 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
543 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
544 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
545 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
546 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
547 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
548 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
549 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
550 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
551 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
552 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
553 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
554 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
555 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
556 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
557 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
558 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
559 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
560 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
561 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
562 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
563 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
564 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
565 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
566 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
567 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
568 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
569 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
570 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
571 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
572 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
573 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
574 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
575 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
576 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
577 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
578 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
579 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
580 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
581 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
582 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
583 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
584 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
585 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
586 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
587 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
588 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
589 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
590 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
591 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
592 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
593 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
594 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
595 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
596 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
597 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
598 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
599 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
600 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
601 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
602 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
603 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
604 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
605 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
606 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
607 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
608 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
609 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
610 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
611 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
612 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
613 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
614 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
615 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
616 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
617 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
618 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
619 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
620 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
621 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
622 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
623 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
624 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
625 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
626 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
627 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
628 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
629 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
630 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.66
Metatranscriptomes 0
Isolates 27.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 20.48
Nodule 21.5
Rhizoplane 2.87
Rhizosphere 42.82
Stem 0
Stem Tuber 0.09
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501241_001086 3300049758 Bacteria 5722
2 SwRhRL2b_contig_1483352 2162886007 Bacteria 1660
3 SwRhRL2b_contig_1901739 2162886007 Bacteria 28384
4 JGI24740J21852_10009449 3300001979 Bacteria 3817
5 JGI24740J21852_10024760 3300001979 Bacteria 2032
6 JGI24739J22299_10005502 3300001989 Bacteria 4805
7 JGI24739J22299_10013439 3300001989 Bacteria 2990
8 JGI24737J22298_10004941 3300001990 Bacteria 4619
9 JGI24737J22298_10006147 3300001990 Bacteria 4114
10 JGI24737J22298_10008641 3300001990 Bacteria 3406
11 JGI24737J22298_10036595 3300001990 Bacteria 1515
12 JGI24735J21928_10000694 3300002067 Bacteria 11946
13 JGI24735J21928_10006314 3300002067 Bacteria 3911
14 JGI24735J21928_10037938 3300002067 Bacteria 1411
15 JGI24738J21930_10002762 3300002075 Bacteria 4512
16 JGI24738J21930_10004350 3300002075 Bacteria 3482
17 JGI24738J21930_10023083 3300002075 Bacteria 1284
18 JGI25150J39212_1000369 3300002774 Bacteria 21665
19 JGI25151J46595_10000639 3300003187 Bacteria 30118
20 JGI25153J46596_10000124 3300003215 Bacteria 86430
21 rootH1_10030986 3300003316 Bacteria 1859
22 rootL2_10275712 3300003322 Bacteria 2488
23 rootH1_10005886 3300003323 Bacteria 9819
24 rootH1_10160732 3300003323 Bacteria 6407
25 Ga0055532_1003824 3300003758 Bacteria 2434
26 Ga0055532_1004520 3300003758 Bacteria 2083
27 Ga0055525_1000104 3300003759 Bacteria 134560
28 Ga0055542_1000037 3300003762 Bacteria 225640
29 Ga0055529_1000042 3300003763 Bacteria 225663
30 Ga0055526_1003257 3300003771 Bacteria 10432
31 Ga0055537_1002473 3300003773 Bacteria 6179
32 Ga0055524_1000470 3300003775 Bacteria 32352
33 Ga0055524_1002798 3300003775 Bacteria 8760
34 Ga0055524_1014354 3300003775 Bacteria 2939
35 Ga0055536_1000121 3300003781 Bacteria 68027
36 Ga0055536_1000288 3300003781 Bacteria 38152
37 Ga0055536_1000616 3300003781 Bacteria 24156
38 Ga0055536_1001415 3300003781 Bacteria 14501
39 Ga0055536_1002431 3300003781 Bacteria 10470
40 Ga0055536_1004304 3300003781 Bacteria 7328
41 Ga0055536_1046923 3300003781 Bacteria 978
42 Ga0055534_1007990 3300003784 Bacteria 2449
43 Ga0055528_1006831 3300003790 Bacteria 5125
44 Ga0055530_10000897 3300003791 Bacteria 24503
45 Ga0055530_10001863 3300003791 Bacteria 14501
46 Ga0055530_10002377 3300003791 Bacteria 12196
47 Ga0055530_10004849 3300003791 Bacteria 6723
48 Ga0055530_10005341 3300003791 Bacteria 6147
49 Ga0055530_10014423 3300003791 Bacteria 2632
50 Ga0055530_10018168 3300003791 Bacteria 2178
51 Ga0055540_1001358 3300003792 Bacteria 14676
52 Ga0055540_1029201 3300003792 Bacteria 1293
53 Ga0055540_1046215 3300003792 Bacteria 916
54 Ga0055531_10000096 3300003794 Bacteria 95992
55 Ga0055531_10002825 3300003794 Bacteria 11373
56 Ga0055531_10004227 3300003794 Bacteria 8835
57 Ga0055531_10022413 3300003794 Bacteria 2407
58 Ga0055531_10022508 3300003794 Bacteria 2398
59 Ga0058692_1002907 3300003856 Bacteria 5538
60 Ga0058692_1030815 3300003856 Bacteria 1016
61 Ga0065165_1008723 3300005262 Bacteria 4683
62 Ga0065704_10000204 3300005289 Bacteria 211587
63 Ga0065704_10099817 3300005289 Bacteria 2296
64 Ga0065704_10123610 3300005289 Bacteria 1721
65 Ga0065704_10211406 3300005289 Bacteria 1107
66 Ga0070658_10012637 3300005327 Bacteria 6772
67 Ga0070658_10019655 3300005327 Bacteria 5408
68 Ga0070670_100152681 3300005331 Bacteria 1999
69 Ga0070666_10032969 3300005335 Bacteria 3425
70 Ga0070660_100327848 3300005339 Bacteria 1258
71 Ga0070661_100005592 3300005344 Bacteria 8662
72 Ga0070661_100136756 3300005344 Bacteria 1844
73 Ga0070668_100034378 3300005347 Bacteria 3862
74 Ga0070668_100037160 3300005347 Bacteria 3718
75 Ga0070671_100219745 3300005355 Bacteria 1612
76 Ga0070674_100012527 3300005356 Bacteria 5209
77 Ga0070659_100017489 3300005366 Bacteria 5399
78 Ga0070667_100000429 3300005367 Bacteria 44271
79 Ga0070667_100002234 3300005367 Bacteria 17045
80 Ga0070667_100072346 3300005367 Bacteria 2938
81 Ga0070662_100015566 3300005457 Bacteria 5097
82 Ga0070662_100040479 3300005457 Bacteria 3318
83 Ga0070685_10077215 3300005466 Bacteria 1988
84 Ga0070707_100069477 3300005468 Bacteria 3391
85 Ga0068853_100005287 3300005539 Bacteria 10106
86 Ga0068853_100096300 3300005539 Bacteria 2611
87 Ga0070665_100000884 3300005548 Bacteria 38426
88 Ga0070665_100071210 3300005548 Bacteria 3483
89 Ga0068855_100073172 3300005563 Bacteria 3982
90 Ga0068855_100338275 3300005563 Bacteria 1660
91 Ga0070664_100021924 3300005564 Bacteria 5266
92 Ga0070664_100115685 3300005564 Bacteria 2344
93 Ga0068857_100029220 3300005577 Bacteria 4864
94 Ga0068857_101049809 3300005577 Bacteria 785
95 Ga0068854_100014957 3300005578 Bacteria 5126
96 Ga0068854_100037728 3300005578 Bacteria 3393
97 Ga0068856_100479732 3300005614 Bacteria 1264
98 Ga0068859_100001448 3300005617 Bacteria 24068
99 Ga0068864_100017949 3300005618 Bacteria 5904
100 Ga0068861_100001768 3300005719 Bacteria 13896
101 Ga0068861_100145803 3300005719 Bacteria 1937
102 Ga0068861_100201101 3300005719 Bacteria 1672
103 Ga0068863_100043382 3300005841 Bacteria 4270
104 Ga0068860_100000573 3300005843 Bacteria 44277
105 Ga0068860_100833691 3300005843 Bacteria 936
106 Ga0068862_100008954 3300005844 Bacteria 8285
107 Ga0068862_100009968 3300005844 Bacteria 7850
108 Ga0070717_10307434 3300006028 Bacteria 1410
109 Ga0075365_10002570 3300006038 Bacteria 8963
110 Ga0075365_10012014 3300006038 Bacteria 5120
111 Ga0075365_10455720 3300006038 Bacteria 903
112 Ga0075368_10000158 3300006042 Bacteria 18321
113 Ga0075368_10000190 3300006042 Bacteria 16846
114 Ga0075368_10000214 3300006042 Bacteria 16126
115 Ga0075368_10000330 3300006042 Bacteria 13869
116 Ga0075363_100000005 3300006048 Bacteria 56964
117 Ga0075363_100017140 3300006048 Bacteria 3587
118 Ga0075363_100036200 3300006048 Bacteria 2588
119 Ga0075363_100083720 3300006048 Bacteria 1748
120 Ga0075364_10000003 3300006051 Bacteria 111353
121 Ga0075364_10000022 3300006051 Bacteria 53466
122 Ga0075432_10003631 3300006058 Bacteria 5248
123 Ga0075362_10000118 3300006177 Bacteria 22058
124 Ga0075367_10001760 3300006178 Bacteria 9506
125 Ga0075367_10002007 3300006178 Bacteria 9075
126 Ga0075367_10003779 3300006178 Bacteria 7295
127 Ga0075367_10014566 3300006178 Bacteria 4258
128 Ga0075367_10061128 3300006178 Bacteria 2248
129 Ga0075369_10000533 3300006186 Bacteria 12019
130 Ga0075369_10001184 3300006186 Bacteria 8825
131 Ga0075369_10002521 3300006186 Bacteria 6549
132 Ga0075369_10010635 3300006186 Bacteria 3604
133 Ga0075366_10025738 3300006195 Bacteria 3441
134 Ga0075366_10113625 3300006195 Bacteria 1630
135 Ga0075366_10177627 3300006195 Bacteria 1293
136 Ga0075366_10200046 3300006195 Bacteria 1215
137 Ga0075370_10000006 3300006353 Bacteria 110712
138 Ga0075370_10003734 3300006353 Bacteria 7287
139 Ga0075370_10004824 3300006353 Bacteria 6607
140 Ga0075370_10027468 3300006353 Bacteria 3158
141 Ga0075370_10027640 3300006353 Bacteria 3149
142 Ga0075370_10118177 3300006353 Bacteria 1542
143 Ga0075429_100208924 3300006880 Bacteria 1710
144 Ga0097620_100001448 3300006931 Bacteria 24068
145 Ga0079104_1004220 3300006946 Bacteria 6253
146 Ga0079104_1045489 3300006946 Bacteria 1001
147 Ga0105251_10018057 3300009011 Bacteria 3763
148 Ga0105251_10069781 3300009011 Bacteria 1637
149 Ga0105240_10030854 3300009093 Bacteria 6962
150 Ga0105240_10342380 3300009093 Bacteria 1698
151 Ga0105240_10414549 3300009093 Bacteria 1514
152 Ga0105241_10012879 3300009174 Bacteria 6137
153 Ga0105241_10173195 3300009174 Bacteria 1784
154 Ga0105248_10022524 3300009177 Bacteria 6988
155 Ga0105248_10059186 3300009177 Bacteria 4303
156 Ga0105248_10092062 3300009177 Bacteria 3414
157 Ga0105248_10103815 3300009177 Bacteria 3204
158 Ga0105248_10299391 3300009177 Bacteria 1811
159 Ga0105237_10004065 3300009545 Bacteria 17062
160 Ga0105237_10065031 3300009545 Bacteria 3643
161 Ga0105237_10339863 3300009545 Bacteria 1506
162 Ga0105238_10211033 3300009551 Bacteria 1917
163 Ga0105249_10003624 3300009553 Bacteria 13354
164 Ga0105249_10068891 3300009553 Bacteria 3264
165 Ga0105239_10000385 3300010375 Bacteria 64470
166 Ga0105239_10584241 3300010375 Bacteria 1274
167 Ga0157373_10038189 3300013100 Bacteria 3442
168 Ga0157373_10085510 3300013100 Bacteria 2223
169 Ga0157373_10530797 3300013100 Bacteria 852
170 Ga0157371_10000183 3300013102 Bacteria 92426
171 Ga0157371_10006898 3300013102 Bacteria 9273
172 Ga0157370_10017512 3300013104 Bacteria 7229
173 Ga0157369_10029788 3300013105 Bacteria 6028
174 Ga0157369_10063890 3300013105 Bacteria 3965
175 Ga0157369_10285001 3300013105 Bacteria 1720
176 Ga0157369_10440589 3300013105 Bacteria 1349
177 Ga0157369_10488566 3300013105 Bacteria 1274
178 Ga0157374_10432129 3300013296 Bacteria 1316
179 Ga0163162_10003415 3300013306 Bacteria 15154
180 Ga0163162_10053910 3300013306 Bacteria 4043
181 Ga0163162_10077504 3300013306 Bacteria 3388
182 Ga0163162_10655526 3300013306 Bacteria 1173
183 Ga0157375_10002079 3300013308 Bacteria 17318
184 Ga0157380_10230418 3300014326 Bacteria 1663
185 Ga0182008_10037660 3300014497 Bacteria 2420
186 Ga0157379_10305126 3300014968 Bacteria 1451
187 Ga0182006_1027560 3300015261 Bacteria 2317
188 Ga0182007_10012367 3300015262 Bacteria 3284
189 Ga0182007_10088705 3300015262 Bacteria 1018
190 Ga0183369_1007 3300015685 Bacteria 414878
191 Ga0183363_1009 3300015690 Bacteria 127797
192 Ga0163161_10001715 3300017792 Bacteria 16062
193 Ga0163161_10016323 3300017792 Bacteria 5184
194 Ga0163161_10029808 3300017792 Bacteria 3878
195 Ga0163161_10101478 3300017792 Bacteria 2142
196 Ga0163161_10447814 3300017792 Bacteria 1043
197 Ga0214543_1000003 3300021327 Bacteria 692327
198 Ga0228711_1020746 3300022739 Bacteria 5606
199 Ga0228710_1022297 3300022740 Bacteria 4899
200 Ga0209672_101064 3300025228 Bacteria 11746
201 Ga0209147_100205 3300025229 Bacteria 64474
202 Ga0209147_100558 3300025229 Bacteria 20955
203 Ga0209147_100607 3300025229 Bacteria 19587
204 Ga0209147_108381 3300025229 Bacteria 1285
205 Ga0209563_100116 3300025230 Bacteria 134661
206 Ga0207425_1000022 3300025245 Bacteria 355305
207 Ga0209677_110133 3300025253 Bacteria 1602
208 Ga0209148_1000026 3300025254 Bacteria 629213
209 Ga0209759_1008921 3300025256 Bacteria 3082
210 Ga0209129_1001190 3300025258 Bacteria 14977
211 Ga0209233_1000455 3300025261 Bacteria 26723
212 Ga0209233_1045290 3300025261 Bacteria 926
213 Ga0209565_1000065 3300025263 Bacteria 178266
214 Ga0209455_1000005 3300025272 Bacteria 1416756
215 Ga0209673_1000818 3300025273 Bacteria 41077
216 Ga0209675_1000724 3300025291 Bacteria 22437
217 Ga0209676_1000060 3300025292 Bacteria 338238
218 Ga0209676_1000072 3300025292 Bacteria 307347
219 Ga0209676_1000184 3300025292 Bacteria 143543
220 Ga0209676_1000247 3300025292 Bacteria 115814
221 Ga0209676_1000297 3300025292 Bacteria 100558
222 Ga0209676_1001039 3300025292 Bacteria 32114
223 Ga0209676_1019584 3300025292 Bacteria 2325
224 Ga0209676_1024680 3300025292 Bacteria 1941
225 Ga0209025_1000018 3300025294 Bacteria 686898
226 Ga0209025_1000326 3300025294 Bacteria 106087
227 Ga0209025_1000371 3300025294 Bacteria 94612
228 Ga0209025_1033530 3300025294 Bacteria 2370
229 Ga0209564_1004449 3300025295 Bacteria 8568
230 Ga0209564_1025384 3300025295 Bacteria 1994
231 Ga0209564_1027816 3300025295 Bacteria 1826
232 Ga0209758_1000004 3300025297 Bacteria 1375322
233 Ga0209758_1001185 3300025297 Bacteria 32966
234 Ga0209758_1026850 3300025297 Bacteria 2479
235 Ga0209050_1000001 3300025298 Bacteria 3563507
236 Ga0209050_1000057 3300025298 Bacteria 326289
237 Ga0209050_1000077 3300025298 Bacteria 278985
238 Ga0209050_1000402 3300025298 Bacteria 80873
239 Ga0209050_1000548 3300025298 Bacteria 62143
240 Ga0209050_1000622 3300025298 Bacteria 55613
241 Ga0209050_1016408 3300025298 Bacteria 3031
242 Ga0209256_1003381 3300025299 Bacteria 11271
243 Ga0209051_1000303 3300025303 Bacteria 77630
244 Ga0209051_1003506 3300025303 Bacteria 10256
245 Ga0209051_1034867 3300025303 Bacteria 1880
246 Ga0209257_1000088 3300025304 Bacteria 279014
247 Ga0209257_1001450 3300025304 Bacteria 28046
248 Ga0209257_1001686 3300025304 Bacteria 24844
249 Ga0209257_1002690 3300025304 Bacteria 16999
250 Ga0209257_1016515 3300025304 Bacteria 2980
251 Ga0209257_1020328 3300025304 Bacteria 2459
252 Ga0207688_10059879 3300025901 Bacteria 2144
253 Ga0207680_10011950 3300025903 Bacteria 4408
254 Ga0207647_10027364 3300025904 Bacteria 3717
255 Ga0207647_10052205 3300025904 Bacteria 2524
256 Ga0207705_10000397 3300025909 Bacteria 38200
257 Ga0207654_10024820 3300025911 Bacteria 3227
258 Ga0207695_10008826 3300025913 Bacteria 12551
259 Ga0207695_10164752 3300025913 Bacteria 2146
260 Ga0207695_10442779 3300025913 Bacteria 1183
261 Ga0207671_10001440 3300025914 Bacteria 27565
262 Ga0207671_10016082 3300025914 Bacteria 5829
263 Ga0207671_10167441 3300025914 Bacteria 1705
264 Ga0207657_10065059 3300025919 Bacteria 3109
265 Ga0207657_10412079 3300025919 Bacteria 1062
266 Ga0207649_10003218 3300025920 Bacteria 8945
267 Ga0207649_10236072 3300025920 Bacteria 1310
268 Ga0207694_10005402 3300025924 Bacteria 9833
269 Ga0207694_10036765 3300025924 Bacteria 3758
270 Ga0207694_10060062 3300025924 Bacteria 2958
271 Ga0207644_10169376 3300025931 Bacteria 1704
272 Ga0207644_10585917 3300025931 Bacteria 925
273 Ga0207690_10001443 3300025932 Bacteria 14876
274 Ga0207706_10007581 3300025933 Bacteria 10038
275 Ga0207706_10069138 3300025933 Bacteria 3106
276 Ga0207669_10039679 3300025937 Bacteria 2723
277 Ga0207711_10015556 3300025941 Bacteria 6314
278 Ga0207711_10034224 3300025941 Bacteria 4303
279 Ga0207711_10035470 3300025941 Bacteria 4227
280 Ga0207711_10075038 3300025941 Bacteria 2942
281 Ga0207711_10165342 3300025941 Bacteria 2005
282 Ga0207667_10000107 3300025949 Bacteria 133066
283 Ga0207667_10011452 3300025949 Bacteria 10307
284 Ga0207667_10490866 3300025949 Bacteria 1246
285 Ga0207712_10004353 3300025961 Bacteria 8943
286 Ga0207712_10038029 3300025961 Bacteria 3288
287 Ga0207712_10246841 3300025961 Bacteria 1441
288 Ga0207668_10003517 3300025972 Bacteria 9202
289 Ga0207668_10003735 3300025972 Bacteria 8957
290 Ga0207640_10007563 3300025981 Bacteria 6000
291 Ga0207640_10013814 3300025981 Bacteria 4636
292 Ga0207640_10200657 3300025981 Bacteria 1511
293 Ga0207658_10000368 3300025986 Bacteria 44362
294 Ga0207658_10009771 3300025986 Bacteria 6515
295 Ga0207658_10062027 3300025986 Bacteria 2796
296 Ga0207658_10631176 3300025986 Bacteria 964
297 Ga0207639_10002138 3300026041 Bacteria 13301
298 Ga0207639_10009537 3300026041 Bacteria 6699
299 Ga0207639_10020899 3300026041 Bacteria 4695
300 Ga0207678_10002748 3300026067 Bacteria 15930
301 Ga0207678_10030255 3300026067 Bacteria 4727
302 Ga0207702_10005233 3300026078 Bacteria 11389
303 Ga0207702_10007230 3300026078 Bacteria 9496
304 Ga0207702_10007530 3300026078 Bacteria 9283
305 Ga0207641_10027348 3300026088 Bacteria 4710
306 Ga0207676_10009756 3300026095 Bacteria 6828
307 Ga0207674_10002464 3300026116 Bacteria 23363
308 Ga0207674_10087483 3300026116 Bacteria 3109
309 Ga0207675_100000016 3300026118 Bacteria 126353
310 Ga0207675_100216677 3300026118 Bacteria 1843
311 Ga0207675_100455070 3300026118 Bacteria 1269
312 Ga0207683_10074155 3300026121 Bacteria 3010
313 Ga0207698_10018963 3300026142 Bacteria 4697
314 Ga0209281_1000332 3300027111 Bacteria 81534
315 Ga0209281_1000360 3300027111 Bacteria 74340
316 Ga0209281_1033727 3300027111 Bacteria 898
317 Ga0209282_1000060 3300027666 Bacteria 97673
318 Ga0209813_10000022 3300027866 Bacteria 72813
319 Ga0209813_10000038 3300027866 Bacteria 56808
320 Ga0209813_10000092 3300027866 Bacteria 33357
321 Ga0209813_10000105 3300027866 Bacteria 31318
322 Ga0207428_10013576 3300027907 Bacteria 7109
323 Ga0268266_10001163 3300028379 Bacteria 32562
324 Ga0268266_10253345 3300028379 Bacteria 1629
325 Ga0268265_10012328 3300028380 Bacteria 5792
326 Ga0268265_10015937 3300028380 Bacteria 5156
327 Ga0268265_10151002 3300028380 Bacteria 1959
328 Ga0268265_10727088 3300028380 Bacteria 961
329 Ga0268264_10000582 3300028381 Bacteria 44285
330 Ga0268264_10800901 3300028381 Bacteria 941
331 Ga0265318_10009370 3300028577 Bacteria 4309
332 Ga0265322_10029347 3300028654 Bacteria 1572
333 Ga0265336_10000859 3300028666 Bacteria 15784
334 Ga0307517_10021522 3300028786 Bacteria 8140
335 Ga0307517_10052593 3300028786 Bacteria 4078
336 Ga0307515_10026858 3300028794 Bacteria 9877
337 Ga0265338_10000013 3300028800 Bacteria 379065
338 Ga0265324_10021279 3300029957 Bacteria 2326
339 Ga0265327_10138513 3300031251 Bacteria 1139
340 Ga0307513_10003740 3300031456 Bacteria 20550
341 Ga0307513_10004795 3300031456 Bacteria 17963
342 Ga0307509_10002287 3300031507 Bacteria 31311
343 Ga0307408_100010494 3300031548 Bacteria 6109
344 Ga0307408_100036834 3300031548 Bacteria 3441
345 Ga0307408_100174792 3300031548 Bacteria 1717
346 Ga0307408_100223793 3300031548 Bacteria 1537
347 Ga0307516_10086960 3300031730 Bacteria 2961
348 Ga0307516_10175613 3300031730 Bacteria 1879
349 Ga0307405_10279380 3300031731 Bacteria 1256
350 Ga0307413_10017189 3300031824 Bacteria 3761
351 Ga0307413_10077624 3300031824 Bacteria 2116
352 Ga0307410_10131729 3300031852 Bacteria 1837
353 Ga0307406_10205477 3300031901 Bacteria 1453
354 Ga0307412_10000003 3300031911 Bacteria 659081
355 Ga0307412_10019961 3300031911 Bacteria 4069
356 Ga0307412_10061744 3300031911 Bacteria 2520
357 Ga0307412_10380078 3300031911 Bacteria 1143
358 Ga0315914_1000121 3300031967 Bacteria 70704
359 Ga0307409_100176956 3300031995 Bacteria 1884
360 Ga0307416_100153428 3300032002 Bacteria 2116
361 Ga0307416_100697871 3300032002 Bacteria 1104
362 Ga0307414_10000536 3300032004 Bacteria 19786
363 Ga0307414_10001051 3300032004 Bacteria 14107
364 Ga0307414_10021372 3300032004 Bacteria 4059
365 Ga0307414_10022530 3300032004 Bacteria 3976
366 Ga0307414_10104516 3300032004 Bacteria 2139
367 Ga0307414_10200207 3300032004 Bacteria 1623
368 Ga0307414_10249936 3300032004 Bacteria 1473
369 Ga0307414_10361613 3300032004 Bacteria 1249
370 Ga0307411_10466043 3300032005 Bacteria 1060
371 Ga0307415_100902000 3300032126 Bacteria 815
372 Ga0315913_1000046 3300033430 Bacteria 62008
373 Ga0315915_1000004 3300033464 Bacteria 403083
374 Ga0373937_0277486 3300036401 Bacteria 1582
375 Ga0395898_0036347 3300037466 Bacteria 4890
376 Ga0436365_0654829 3300039437 Bacteria 5264
377 Ga0436365_1097678 3300039437 Bacteria 902
378 Ga0439439_0002567 3300041406 Bacteria 3879
379 Ga0439465_0006311 3300041413 Bacteria 3764
380 Ga0439465_0141468 3300041413 Bacteria 855
381 Ga0451791_0474554 3300041451 Bacteria 1252
382 Ga0451795_1076342 3300041456 Bacteria 818
383 Ga0451802_1573622 3300041460 Bacteria 1841
384 Ga0451807_2178245 3300041486 Bacteria 1737
385 Ga0451837_1810866 3300041494 Bacteria 920
386 Ga0451843_0184918 3300041509 Bacteria 1438
387 Ga0451843_0511461 3300041509 Bacteria 1217
388 Ga0451853_0332407 3300041512 Bacteria 1297
389 Ga0439431_0007141 3300041997 Bacteria 2487
390 Ga0439445_0033116 3300042004 Bacteria 1349
391 Ga0439449_0008122 3300042007 Bacteria 3989
392 Ga0450911_001396 3300042115 Bacteria 5603
393 Ga0439434_0102338 3300042435 Bacteria 923
394 Ga0451576_0000053 3300045051 Bacteria 308708
395 Ga0495627_000103 3300046453 Bacteria 104335
396 Ga0495627_000105 3300046453 Bacteria 103413
397 Ga0495627_000185 3300046453 Bacteria 69533
398 Ga0495592_0063903 3300046454 Bacteria 2698
399 Ga0495638_0000021 3300046460 Bacteria 365602
400 Ga0495638_0002128 3300046460 Bacteria 16657
401 Ga0495638_0002254 3300046460 Bacteria 15983
402 Ga0495638_0004335 3300046460 Bacteria 10752
403 Ga0495638_0006082 3300046460 Bacteria 8833
404 Ga0495638_0086206 3300046460 Bacteria 1898
405 Ga0495651_0437393 3300046462 Bacteria 847
406 Ga0495653_0162114 3300046463 Bacteria 1551
407 Ga0495650_0000045 3300046471 Bacteria 346204
408 Ga0495650_0000862 3300046471 Bacteria 36369
409 Ga0495650_0001034 3300046471 Bacteria 31214
410 Ga0495650_0005530 3300046471 Bacteria 8166
411 Ga0495580_0000047 3300046472 Bacteria 68842
412 Ga0495580_0053620 3300046472 Bacteria 2845
413 Ga0495605_0003880 3300046474 Bacteria 8861
414 Ga0495605_0005837 3300046474 Bacteria 7119
415 Ga0495664_0012632 3300046477 Bacteria 4785
416 Ga0495584_0172349 3300046491 Bacteria 1100
417 Ga0495585_0001506 3300046492 Bacteria 18152
418 Ga0495596_0000171 3300046500 Bacteria 45024
419 Ga0495596_0001194 3300046500 Bacteria 15178
420 Ga0495596_0005301 3300046500 Bacteria 6111
421 Ga0495607_0006779 3300046501 Bacteria 8001
422 Ga0495583_0000069 3300046506 Bacteria 186863
423 Ga0495583_0000184 3300046506 Bacteria 105978
424 Ga0495583_0000401 3300046506 Bacteria 65722
425 Ga0495583_0034485 3300046506 Bacteria 2423
426 Ga0495583_0043219 3300046506 Bacteria 2099
427 Ga0495606_0008550 3300046507 Bacteria 8864
428 Ga0495606_0089105 3300046507 Bacteria 1901
429 Ga0495606_0255917 3300046507 Bacteria 969
430 Ga0495610_0000013 3300046512 Bacteria 465872
431 Ga0495610_0000018 3300046512 Bacteria 355044
432 Ga0495610_0000101 3300046512 Bacteria 99012
433 Ga0495610_0002633 3300046512 Bacteria 14848
434 Ga0495610_0002639 3300046512 Bacteria 14830
435 Ga0495610_0142206 3300046512 Bacteria 1031
436 Ga0495616_0000270 3300046513 Bacteria 42085
437 Ga0495616_0176222 3300046513 Bacteria 953
438 Ga0495620_0033849 3300046515 Bacteria 2315
439 Ga0495620_0039025 3300046515 Bacteria 2103
440 Ga0495620_0045054 3300046515 Bacteria 1913
441 Ga0495628_0062359 3300046516 Bacteria 2922
442 Ga0495628_0345569 3300046516 Bacteria 1094
443 Ga0495630_0172398 3300046517 Bacteria 1648
444 Ga0495631_0052696 3300046518 Bacteria 1777
445 Ga0495631_0099404 3300046518 Bacteria 1252
446 Ga0495632_0001639 3300046519 Bacteria 18335
447 Ga0495632_0001694 3300046519 Bacteria 18032
448 Ga0495643_0000336 3300046522 Bacteria 64049
449 Ga0495643_0027804 3300046522 Bacteria 3174
450 Ga0495643_0030778 3300046522 Bacteria 2993
451 Ga0495643_0034028 3300046522 Bacteria 2814
452 Ga0495643_0044552 3300046522 Bacteria 2411
453 Ga0495643_0114051 3300046522 Bacteria 1371
454 Ga0495648_0000026 3300046524 Bacteria 232162
455 Ga0495648_0000111 3300046524 Bacteria 100648
456 Ga0495648_0048047 3300046524 Bacteria 2631
457 Ga0495648_0049703 3300046524 Bacteria 2568
458 Ga0495648_0067184 3300046524 Bacteria 2098
459 Ga0495663_0000757 3300046525 Bacteria 11087
460 Ga0495663_0052964 3300046525 Bacteria 1261
461 Ga0495666_0004701 3300046526 Bacteria 6904
462 Ga0495642_0007084 3300046528 Bacteria 4302
463 Ga0495642_0106553 3300046528 Bacteria 1196
464 Ga0495652_0051478 3300046529 Bacteria 3517
465 Ga0495652_0156210 3300046529 Bacteria 1776
466 Ga0495654_0000018 3300046530 Bacteria 293124
467 Ga0495640_0066032 3300046533 Bacteria 2441
468 Ga0495609_0074614 3300046538 Bacteria 1487
469 Ga0495597_0002618 3300046542 Bacteria 11199
470 Ga0495597_0024054 3300046542 Bacteria 2813
471 Ga0495597_0105938 3300046542 Bacteria 1182
472 Ga0495645_0378934 3300046543 Bacteria 905
473 Ga0495622_0003300 3300046557 Bacteria 7628
474 Ga0495622_0047054 3300046557 Bacteria 2005
475 Ga0495622_0097704 3300046557 Bacteria 1347
476 Ga0495633_0003416 3300046558 Bacteria 10577
477 Ga0495633_0004092 3300046558 Bacteria 9409
478 Ga0495668_0000002 3300046616 Bacteria 763179
479 Ga0495668_0000325 3300046616 Bacteria 65404
480 Ga0495668_0031231 3300046616 Bacteria 3003
481 Ga0495668_0117517 3300046616 Bacteria 1454
482 Ga0495668_0143886 3300046616 Bacteria 1305
483 Ga0495668_0167114 3300046616 Bacteria 1205
484 Ga0495611_0020290 3300046648 Bacteria 2860
485 Ga0495611_0104509 3300046648 Bacteria 1317
486 Ga0495625_0000011 3300046660 Bacteria 377120
487 Ga0495625_0002609 3300046660 Bacteria 19289
488 Ga0495625_0002714 3300046660 Bacteria 18781
489 Ga0495625_0004251 3300046660 Bacteria 13639
490 Ga0495625_0018596 3300046660 Bacteria 5417
491 Ga0495625_0038770 3300046660 Bacteria 3484
492 Ga0495625_0038875 3300046660 Bacteria 3478
493 Ga0495625_0043927 3300046660 Bacteria 3238
494 Ga0495625_0055530 3300046660 Bacteria 2824
495 Ga0495661_0007978 3300046665 Bacteria 7351
496 Ga0495661_0012689 3300046665 Bacteria 5688
497 Ga0495661_0066993 3300046665 Bacteria 2111
498 Ga0495661_0119451 3300046665 Bacteria 1458
499 Ga0495599_0013711 3300046678 Bacteria 5011
500 Ga0495599_0040463 3300046678 Bacteria 2927
501 Ga0495646_0055361 3300046680 Bacteria 2382
502 Ga0495669_0001020 3300046684 Bacteria 11676
503 Ga0495669_0002307 3300046684 Bacteria 7813
504 Ga0495613_0004913 3300046689 Bacteria 10050
505 Ga0495671_0000050 3300046692 Bacteria 141936
506 Ga0495671_0021372 3300046692 Bacteria 3401
507 Ga0495649_0026157 3300046694 Bacteria 3248
508 Ga0495589_0008502 3300046794 Bacteria 5354
509 Ga0495604_0020344 3300047317 Bacteria 5302
510 Ga0495674_0034286 3300047319 Bacteria 4591
511 Ga0495672_0004230 3300047320 Bacteria 11857
512 Ga0495672_0004815 3300047320 Bacteria 10884
513 Ga0495683_0012468 3300047323 Bacteria 4459
514 Ga0495683_0016369 3300047323 Bacteria 3853
515 Ga0495683_0030145 3300047323 Bacteria 2768
516 Ga0495687_001092 3300047443 Bacteria 26544
517 Ga0495687_001844 3300047443 Bacteria 18546
518 Ga0495687_007250 3300047443 Bacteria 6582
519 Ga0495687_018058 3300047443 Bacteria 3498
520 Ga0495675_0189287 3300047444 Bacteria 1257
521 Ga0495677_0053767 3300047445 Bacteria 1485
522 Ga0495673_0000056 3300047469 Bacteria 245918
523 Ga0495673_0000125 3300047469 Bacteria 141937
524 Ga0495673_0020024 3300047469 Bacteria 3339
525 Ga0495681_0000036 3300047470 Bacteria 124207
526 Ga0495681_0000174 3300047470 Bacteria 53932
527 Ga0495681_0005853 3300047470 Bacteria 8166
528 Ga0495681_0006465 3300047470 Bacteria 7698
529 Ga0495686_0000057 3300047472 Bacteria 250088
530 Ga0495686_0000808 3300047472 Bacteria 40566
531 Ga0495686_0000944 3300047472 Bacteria 36054
532 Ga0495686_0002660 3300047472 Bacteria 16456
533 Ga0495686_0003856 3300047472 Bacteria 12676
534 Ga0495686_0016945 3300047472 Bacteria 4922
535 Ga0495686_0027554 3300047472 Bacteria 3708
536 Ga0495686_0028511 3300047472 Bacteria 3636
537 Ga0495686_0036965 3300047472 Bacteria 3131
538 Ga0495602_0025013 3300048088 Bacteria 5785
539 Ga0495602_0392296 3300048088 Bacteria 992
540 Ga0495615_0000006 3300048090 Bacteria 96050
541 Ga0495615_0000009 3300048090 Bacteria 76727
542 Ga0495615_0000022 3300048090 Bacteria 51294
543 Ga0495615_0000056 3300048090 Bacteria 35338
544 Ga0495626_0034390 3300048091 Bacteria 2424
545 Ga0495626_0092043 3300048091 Bacteria 1332
546 Ga0496100_0004363 3300048903 Bacteria 7490
547 Ga0496100_0580091 3300048903 Bacteria 869
548 Ga0496101_0000647 3300048904 Bacteria 21009
549 Ga0496101_0414580 3300048904 Bacteria 1061
550 Ga0496102_0000067 3300048905 Bacteria 156790
551 Ga0496102_0008560 3300048905 Bacteria 8774
552 Ga0496102_0052303 3300048905 Bacteria 3721
553 Ga0496102_0568457 3300048905 Bacteria 1057
554 Ga0496103_0002600 3300048906 Bacteria 11306
555 Ga0496103_0276162 3300048906 Bacteria 1081
556 Ga0496104_0016161 3300048907 Bacteria 6773
557 Ga0496104_0561403 3300048907 Bacteria 1052
558 Ga0496105_0000662 3300048908 Bacteria 23132
559 Ga0496106_0059203 3300048909 Bacteria 2901
560 Ga0496106_0068882 3300048909 Bacteria 2700
561 Ga0496106_0084941 3300048909 Bacteria 2436
562 Ga0496107_0000136 3300048910 Bacteria 36033
563 Ga0496107_0000515 3300048910 Bacteria 21514
564 Ga0496107_0018371 3300048910 Bacteria 4924
565 Ga0496110_0058225 3300048913 Bacteria 3403
566 Ga0496111_0002307 3300048914 Bacteria 11473
567 Ga0496112_0697702 3300048915 Bacteria 943
568 Ga0496113_0064418 3300048916 Bacteria 2771
569 Ga0496113_0492592 3300048916 Bacteria 984
570 Ga0496114_0040025 3300048917 Bacteria 3879
571 Ga0496115_0000056 3300048918 Bacteria 104434
572 Ga0496116_0000545 3300048919 Bacteria 50407
573 Ga0496116_0006376 3300048919 Bacteria 10721
574 Ga0496116_0036283 3300048919 Bacteria 3452
575 Ga0496117_0000114 3300048920 Bacteria 180658
576 Ga0496117_0012932 3300048920 Bacteria 7314
577 Ga0496117_0013436 3300048920 Bacteria 7145
578 Ga0496117_0026934 3300048920 Bacteria 4489
579 Ga0496117_0062312 3300048920 Bacteria 2556
580 Ga0496118_0000082 3300048921 Bacteria 185820
581 Ga0496118_0000439 3300048921 Bacteria 68828
582 Ga0496118_0001437 3300048921 Bacteria 35866
583 Ga0496118_0004598 3300048921 Bacteria 16223
584 Ga0496118_0014789 3300048921 Bacteria 7279
585 Ga0496118_0061924 3300048921 Bacteria 2766
586 Ga0496119_0002162 3300048922 Bacteria 22091
587 Ga0496119_0019495 3300048922 Bacteria 4993
588 Ga0496120_0006533 3300048923 Bacteria 8927
589 Ga0496120_0048673 3300048923 Bacteria 2438
590 Ga0496121_0000021 3300048924 Bacteria 478544
591 Ga0496121_0000190 3300048924 Bacteria 136607
592 Ga0496121_0000344 3300048924 Bacteria 96865
593 Ga0496121_0000721 3300048924 Bacteria 61207
594 Ga0496121_0002392 3300048924 Bacteria 28763
595 Ga0496121_0009736 3300048924 Bacteria 10996
596 Ga0496121_0028182 3300048924 Bacteria 5234
597 Ga0496121_0032836 3300048924 Bacteria 4709
598 Ga0496121_0034383 3300048924 Bacteria 4562
599 Ga0496121_0230957 3300048924 Bacteria 1296
600 Ga0496122_0000462 3300048925 Bacteria 84546
601 Ga0496122_0001343 3300048925 Bacteria 40125
602 Ga0496122_0004042 3300048925 Bacteria 18642
603 Ga0496122_0004742 3300048925 Bacteria 16663
604 Ga0496122_0008010 3300048925 Bacteria 11540
605 Ga0496122_0010005 3300048925 Bacteria 9870
606 Ga0496122_0021500 3300048925 Bacteria 5774
607 Ga0496122_0031248 3300048925 Bacteria 4437
608 Ga0496122_0078878 3300048925 Bacteria 2304
609 Ga0496123_0000048 3300048926 Bacteria 244152
610 Ga0496123_0000300 3300048926 Bacteria 96475
611 Ga0496123_0000643 3300048926 Bacteria 58206
612 Ga0496123_0002078 3300048926 Bacteria 25781
613 Ga0496123_0013351 3300048926 Bacteria 6905
614 Ga0496123_0017198 3300048926 Bacteria 5833
615 Ga0496123_0025200 3300048926 Bacteria 4491
616 Ga0496123_0065530 3300048926 Bacteria 2308
617 Ga0496123_0143732 3300048926 Bacteria 1299
618 Ga0496124_0000068 3300048927 Bacteria 221819
619 Ga0496124_0003193 3300048927 Bacteria 20246
620 Ga0496124_0006400 3300048927 Bacteria 12839
621 Ga0496124_0019388 3300048927 Bacteria 6332
622 Ga0496124_0056514 3300048927 Bacteria 3309
623 Ga0496124_0061695 3300048927 Bacteria 3141
624 Ga0496124_0119858 3300048927 Bacteria 2104
625 Ga0496124_0175482 3300048927 Bacteria 1655
626 Ga0496125_0000488 3300048928 Bacteria 69299
627 Ga0496125_0002303 3300048928 Bacteria 25208
628 Ga0496125_0004268 3300048928 Bacteria 16627
629 Ga0496125_0012254 3300048928 Bacteria 8525
630 Ga0496125_0035284 3300048928 Bacteria 4391
631 Ga0496125_0070822 3300048928 Bacteria 2727
632 Ga0496125_0102467 3300048928 Bacteria 2103
633 Ga0496125_0159962 3300048928 Bacteria 1531
634 Ga0496125_0230986 3300048928 Bacteria 1183
635 Ga0496126_0000157 3300048929 Bacteria 156203
636 Ga0496126_0000503 3300048929 Bacteria 76786
637 Ga0496126_0011995 3300048929 Bacteria 8906
638 Ga0496126_0018537 3300048929 Bacteria 6891
639 Ga0496126_0027270 3300048929 Bacteria 5458
640 Ga0496126_0265064 3300048929 Bacteria 1427
641 Ga0495682_0028086 3300049460 Bacteria 2086
642 Ga0501292_000003 3300049515 Bacteria 161908
643 Ga0501031_0011456 3300049568 Bacteria 5777
644 Ga0501032_0010834 3300049569 Bacteria 6562
645 Ga0501032_0027261 3300049569 Bacteria 3926
646 Ga0501033_0005862 3300049570 Bacteria 9657
647 Ga0501033_0029586 3300049570 Bacteria 4116
648 Ga0501033_0064704 3300049570 Bacteria 2691
649 Ga0501033_0131204 3300049570 Bacteria 1815
650 Ga0501034_0000215 3300049571 Bacteria 110067
651 Ga0501034_0028660 3300049571 Bacteria 5665
652 Ga0501034_0092516 3300049571 Bacteria 3021
653 Ga0501034_0186316 3300049571 Bacteria 2039
654 Ga0501034_0473074 3300049571 Bacteria 1169
655 Ga0501038_0122898 3300049574 Bacteria 2139
656 Ga0501039_0266539 3300049575 Bacteria 1346
657 Ga0501043_0210689 3300049579 Bacteria 1506
658 Ga0501043_0309235 3300049579 Bacteria 1206
659 Ga0501047_0000307 3300049581 Bacteria 56284
660 Ga0501047_0001806 3300049581 Bacteria 20665
661 Ga0501047_0010908 3300049581 Bacteria 8593
662 Ga0501047_0274153 3300049581 Bacteria 1533
663 Ga0501048_0063616 3300049582 Bacteria 2609
664 Ga0501048_0239907 3300049582 Bacteria 1286
665 Ga0501073_0000140 3300049589 Bacteria 47436
666 Ga0501223_000007 3300049663 Bacteria 132601
667 Ga0501238_000513 3300049671 Bacteria 4442
668 Ga0501246_000376 3300049676 Bacteria 3180
669 Ga0501249_000267 3300049679 Bacteria 14967
670 Ga0501249_000588 3300049679 Bacteria 8509
671 Ga0501225_0000010 3300049705 Bacteria 82395
672 Ga0501080_0018648 3300049742 Bacteria 6421
673 Ga0501083_0079772 3300049744 Bacteria 2170
674 Ga0501262_002548 3300049759 Bacteria 2059
675 Ga0501279_000009 3300049775 Bacteria 117146
676 Ga0501035_0004268 3300049822 Bacteria 13569
677 Ga0501035_0092439 3300049822 Bacteria 2662
678 Ga0501035_0102217 3300049822 Bacteria 2514
679 Ga0501044_0000109 3300049823 Bacteria 100674
680 Ga0501044_0000453 3300049823 Bacteria 49990
681 Ga0501044_0043037 3300049823 Bacteria 4693
682 Ga0501044_0105330 3300049823 Bacteria 2833
683 Ga0501044_0672560 3300049823 Bacteria 923
684 nmdc:mga03n38_68_c1 3300050490 Bacteria 21917
685 nmdc:mga03n38_71089_c1 3300050490 Bacteria 1611
686 nmdc:mga00v17_91_c1 3300050491 Bacteria 53223
687 nmdc:mga00v17_9_c1 3300050491 Bacteria 138453
688 nmdc:mga0yw44_452865_c1 3300050492 Bacteria 870
689 nmdc:mga0yw44_567_c1 3300050492 Bacteria 13324
690 nmdc:mga0yw44_727_c2 3300050492 Bacteria 11571
691 nmdc:mga0k408_156526_c1 3300050493 Bacteria 1041
692 nmdc:mga0k408_28620_c1 3300050493 Bacteria 3168
693 nmdc:mga0k408_415_c1 3300050493 Bacteria 23295
694 nmdc:mga0k408_59038_c1 3300050493 Bacteria 2228
695 nmdc:mga0k408_80036_c1 3300050493 Bacteria 1912
696 nmdc:mga06z11_121710_c1 3300050494 Bacteria 1456
697 nmdc:mga06z11_3_c1 3300050494 Bacteria 138457
698 nmdc:mga06z11_41_c1 3300050494 Bacteria 53112
699 nmdc:mga06z11_48_c1 3300050494 Bacteria 51095
700 nmdc:mga06z11_60931_c1 3300050494 Bacteria 1966
701 nmdc:mga06z11_71_c1 3300050494 Bacteria 42338
702 nmdc:mga04h51_27_c1 3300050495 Bacteria 53116
703 nmdc:mga04h51_43_c1 3300050495 Bacteria 42355
704 nmdc:mga04h51_57_c1 3300050495 Bacteria 35214
705 nmdc:mga04h51_5_c1 3300050495 Bacteria 138278
706 nmdc:mga07m45_18_c1 3300050496 Bacteria 138462
707 nmdc:mga07m45_22856_c1 3300050496 Bacteria 3415
708 nmdc:mga07m45_26825_c1 3300050496 Bacteria 3168
709 nmdc:mga07m45_2787_c1 3300050496 Bacteria 8259
710 nmdc:mga09592_163515_c1 3300050508 Bacteria 1923
711 nmdc:mga0sz30_271_c1 3300050516 Bacteria 19815
712 nmdc:mga0sz30_3064_c1 3300050516 Bacteria 5987
713 nmdc:mga0sz30_34_c1 3300050516 Bacteria 53573
714 nmdc:mga0sz30_397_c1 3300050516 Bacteria 16569
715 Ga0495601_0046860 3300053077 Bacteria 2721
716 Ga0500610_0000206 3300053079 Bacteria 18104
717 Ga0500635_0000154 3300053080 Bacteria 38155
718 Ga0495619_0066359 3300053085 Bacteria 2408
719 Ga0500643_000203 3300053087 Bacteria 56433
720 Ga0500643_030347 3300053087 Bacteria 1656
721 Ga0500646_0007574 3300053090 Bacteria 2775
722 Ga0500647_0014019 3300053091 Bacteria 3636
723 Ga0500651_0000062 3300053093 Bacteria 71042
724 Ga0500651_0004291 3300053093 Bacteria 7964
725 Ga0500566_0000824 3300053094 Bacteria 17698
726 Ga0500566_0022100 3300053094 Bacteria 3739
727 Ga0500566_0076541 3300053094 Bacteria 1870
728 Ga0500566_0082680 3300053094 Bacteria 1784
729 Ga0500641_0001855 3300053096 Bacteria 7498
730 Ga0500650_0170650 3300053098 Bacteria 1000
731 Ga0500654_078918 3300053099 Bacteria 1549
732 Ga0500555_000448 3300053103 Bacteria 17084
733 Ga0500592_016490 3300053116 Bacteria 1185
734 Ga0500592_019210 3300053116 Bacteria 1097
735 Ga0500595_002134 3300053119 Bacteria 10068
736 Ga0500595_002188 3300053119 Bacteria 9926
737 Ga0500595_004324 3300053119 Bacteria 6398
738 Ga0500595_021474 3300053119 Bacteria 2303
739 Ga0500607_000293 3300053121 Bacteria 47399
740 Ga0500608_000135 3300053122 Bacteria 30072
741 Ga0500608_000353 3300053122 Bacteria 17755
742 Ga0500608_002030 3300053122 Bacteria 7258
743 Ga0500614_000155 3300053123 Bacteria 17375
744 Ga0500614_004939 3300053123 Bacteria 2804
745 Ga0500614_023077 3300053123 Bacteria 1459
746 Ga0500618_000178 3300053125 Bacteria 52653
747 Ga0500618_000606 3300053125 Bacteria 21912
748 Ga0500618_000707 3300053125 Bacteria 19471
749 Ga0500618_006287 3300053125 Bacteria 3506
750 Ga0500642_0000471 3300053130 Bacteria 12520
751 Ga0500642_0031645 3300053130 Bacteria 2212
752 Ga0500655_000055 3300053133 Bacteria 30746
753 Ga0500655_017095 3300053133 Bacteria 1339
754 Ga0500559_0000031 3300053136 Bacteria 114782
755 Ga0500559_0000879 3300053136 Bacteria 19217
756 Ga0500559_0000984 3300053136 Bacteria 17768
757 Ga0500559_0003462 3300053136 Bacteria 7753
758 Ga0500559_0008942 3300053136 Bacteria 4359
759 Ga0500559_0021988 3300053136 Bacteria 2705
760 Ga0500559_0220483 3300053136 Bacteria 894
761 Ga0500568_0069966 3300053139 Bacteria 1345
762 Ga0500573_0047098 3300053140 Bacteria 2484
763 Ga0500590_000433 3300053148 Bacteria 14077
764 Ga0500603_000737 3300053150 Bacteria 7972
765 Ga0500604_0000520 3300053151 Bacteria 10639
766 Ga0500622_0003059 3300053156 Bacteria 11547
767 Ga0500622_0005037 3300053156 Bacteria 8048
768 Ga0500622_0005173 3300053156 Bacteria 7907
769 Ga0500622_0005293 3300053156 Bacteria 7784
770 Ga0500624_000002 3300053157 Bacteria 257900
771 Ga0500627_0000020 3300053158 Bacteria 109977
772 Ga0500639_101614 3300053163 Bacteria 1414
773 Ga0500636_0001943 3300053177 Bacteria 11357
774 Ga0500637_0004224 3300053178 Bacteria 6780
775 Ga0500570_006654 3300053724 Bacteria 6292
776 Ga0500625_000007 3300053729 Bacteria 177638
777 Ga0500645_000585 3300053730 Bacteria 23518
778 Ga0500645_001694 3300053730 Bacteria 10762
779 Ga0500645_002181 3300053730 Bacteria 8957
780 Ga0500645_014440 3300053730 Bacteria 2515
781 Ga0501084_0021531 3300054114 Bacteria 5374
782 Ga0500661_000033 3300055283 Bacteria 20509
783 Ga0501082_0043906 3300060353 Bacteria 3856
784 Ga0530510_0211114 3300061734 Bacteria 1442
785 2509374508 2509276019 Bacteria 6802256
786 2510306598 2510065057 Bacteria 6649661
787 2510842739 2510461069 Bacteria 5505000
788 2511124402 2510917020 Bacteria 5657507
789 2511500961 2511231052 Bacteria 6974333
790 2512532376 2512047086 Bacteria 6850303
791 2512974772 2512875026 Bacteria 6861065
792 2513583501 2513237086 Bacteria 7265287
793 2513603894 2513237089 Bacteria 6553624
794 2513617650 2513237091 Bacteria 6900273
795 2513882714 2513237140 Bacteria 7076289
796 2513905259 2513237143 Bacteria 6664116
797 2513914506 2513237144 Bacteria 7530820
798 2513928245 2513237146 Bacteria 7166346
799 2513957704 2513237150 Bacteria 6553639
800 2513984799 2513237156 Bacteria 6402557
801 2513999503 2513237159 Bacteria 6810126
802 2514004151 2513237160 Bacteria 6650282
803 2514045559 2513237165 Bacteria 6771773
804 2515610215 2515154107 Bacteria 6795637
805 2516892242 2516653046 Bacteria 6989037
806 2517567419 2517487022 Bacteria 7227575
807 2524454505 2524023207 Bacteria 6813453
808 2524614013 2524023250 Bacteria 5457705
809 2551676421 2551306084 Bacteria 8942552
810 2551687222 2551306085 Bacteria 7347181
811 2551694402 2551306086 Bacteria 6843938
812 2551703175 2551306087 Bacteria 7351905
813 2551740391 2551306093 Bacteria 7064773
814 2558863535 2558860100 Bacteria 8458965
815 2585259935 2582581305 Bacteria 4895574
816 2585266237 2582581306 Bacteria 6450535
817 2585387239 2582581865 Bacteria 6644329
818 2599416862 2599185170 Bacteria 7295545
819 2600200418 2599185354 Bacteria 4398675
820 2643729558 2643221541 Bacteria 5498788
821 2643832609 2643221563 Bacteria 4726935
822 2643834711 2643221563 Bacteria 4726935
823 2643926097 2643221583 Bacteria 5218014
824 2643928721 2643221584 Bacteria 5511711
825 2644001519 2643221598 Bacteria 4578346
826 2644040957 2643221605 Bacteria 4772303
827 2644043915 2643221606 Bacteria 5588032
828 2644053596 2643221608 Bacteria 4724829
829 2644055638 2643221608 Bacteria 4724829
830 2644087198 2643221614 Bacteria 4260023
831 2644342151 2643221661 Bacteria 4267604
832 2644368437 2643221666 Bacteria 4265935
833 2644392386 2643221671 Bacteria 5496681
834 2687583756 2687453130 Bacteria 4227172
835 2739649610 2739367664 Bacteria 4114334
836 2739652359 2739367664 Bacteria 4114334
837 2740028083 2739367865 Bacteria 4114482
838 2740030833 2739367865 Bacteria 4114482
839 2753767250 2751185897 Bacteria 5322941
840 2778126862 2775507255 Bacteria 3945731
841 2792458920 2791355048 Bacteria 5832535
842 2792462237 2791355048 Bacteria 5832535
843 2792462246 2791355048 Bacteria 5832535
844 2802725820 2802428859 Bacteria 6667919
845 2802731472 2802428860 Bacteria 6525526
846 2802736337 2802428861 Bacteria 6534206
847 2802750099 2802428863 Bacteria 6410669
848 2809064532 2808606401 Bacteria 4586670
849 2809080557 2808606404 Bacteria 4652788
850 2809084921 2808606405 Bacteria 4586632
851 2819713795 2818991466 Bacteria 4748179
852 2830078833 2830075706 Bacteria 3855215
853 2838041808 2838035591 Bacteria 7166484
854 2838661187 2838661181 Bacteria 7385261
855 2841915630 2841911363 Bacteria 6173697
856 2841920832 2841917233 Bacteria 6173500
857 2842525297 2842521101 Bacteria 6569494
858 2843749076 2843744320 Bacteria 5659202
859 2848298222 2848297114 Bacteria 3608511
860 2849563761 2849560528 Bacteria 5393480
861 2849576443 2849573788 Bacteria 5421256
862 2850080426 2850079185 Bacteria 6848280
863 2851154939 2851153111 Bacteria 5542585
864 2852656984 2852653556 Bacteria 4050083
865 2852681249 2852680915 Bacteria 4100189
866 2855831312 2855825444 Bacteria 6785811
867 2855840437 2855839649 Bacteria 7135830
868 2857507213 2857504554 Bacteria 5369913
869 2858800965 2858800743 Bacteria 6603254
870 2874220725 2874220319 Bacteria 4594709
871 2876808932 2876808645 Bacteria 8824342
872 2879110278 2879110137 Bacteria 8907982
873 2880523668 2880518877 Bacteria 5012590
874 2884961984 2884960567 Bacteria 5437054
875 2885429103 2885427238 Bacteria 2291351
876 2885433150 2885429604 Bacteria 3642894
877 2894417496 2894414249 Bacteria 4405451
878 2898331475 2898329390 Bacteria 5168154
879 2915980963 2915980308 Bacteria 6624279
880 2915990905 2915986958 Bacteria 6739310
881 2915996271 2915993759 Bacteria 7016183
882 2916005749 2916000859 Bacteria 6865702
883 2916010916 2916007675 Bacteria 6898660
884 2916016553 2916014648 Bacteria 6946486
885 2916024752 2916021584 Bacteria 6854472
886 2916032191 2916028427 Bacteria 6748433
887 2916038154 2916035215 Bacteria 6755766
888 2916047918 2916041962 Bacteria 6820487
889 2916054361 2916048683 Bacteria 6543552
890 2916055368 2916055098 Bacteria 6758838
891 2916064490 2916061851 Bacteria 6737736
892 2916073448 2916068649 Bacteria 6943657
893 2916078178 2916076590 Bacteria 6596108
894 2917705606 2917699015 Bacteria 7043791
895 2919090755 2919089067 Bacteria 4560942
896 2919140636 2919138771 Bacteria 5281312
897 2919682705 2919679072 Bacteria 4629602
898 2919708895 2919704043 Bacteria 5560311
899 2919709460 2919709256 Bacteria 4318106
900 2921204930 2921201388 Bacteria 6926299
901 2921213520 2921208531 Bacteria 6745326
902 2921241612 2921237296 Bacteria 6876710
903 2921247526 2921244191 Bacteria 6568419
904 2921251303 2921250672 Bacteria 6677771
905 2921261599 2921257292 Bacteria 6808382
906 2921264245 2921263974 Bacteria 6864552
907 2921282758 2921282425 Bacteria 6826397
908 2921290140 2921289301 Bacteria 7316391
909 2921303397 2921296804 Bacteria 7176999
910 2924145610 2924144063 Bacteria 6883928
911 2924157260 2924150972 Bacteria 7169444
912 2924160563 2924158325 Bacteria 7188855
913 2924168161 2924165586 Bacteria 7260590
914 2924173408 2924172951 Bacteria 6749356
915 2924186324 2924179722 Bacteria 6843264
916 2924189502 2924186466 Bacteria 6876637
917 2924198238 2924193448 Bacteria 6955718
918 2924204069 2924200457 Bacteria 6757188
919 2924209899 2924207177 Bacteria 6917007
920 2924215186 2924214083 Bacteria 7080103
921 2924226239 2924221636 Bacteria 7113495
922 2924234924 2924228884 Bacteria 6633132
923 2928496739 2928496128 Bacteria 4631123
924 2928534089 2928531327 Bacteria 5101314
925 2928969803 2928968154 Bacteria 4633371
926 2931381641 2931380184 Bacteria 4455911
927 2933019853 2933016740 Bacteria 6355406
928 2937000765 2936996657 Bacteria 6298727
929 2937009524 2937002841 Bacteria 6934057
930 2937010876 2937009748 Bacteria 6746052
931 2937018995 2937016420 Bacteria 6782579
932 2937027935 2937023124 Bacteria 6815156
933 2937035893 2937029754 Bacteria 6424026
934 2937036359 2937036028 Bacteria 6846469
935 2937048979 2937042894 Bacteria 6741576
936 2937056294 2937049772 Bacteria 6757901
937 2937063363 2937056579 Bacteria 7107896
938 2937070635 2937063883 Bacteria 7199456
939 2937072169 2937071275 Bacteria 6984483
940 2937084741 2937078374 Bacteria 6610289
941 2937086888 2937084907 Bacteria 6618516
942 2937095579 2937091812 Bacteria 6979387
943 2937103645 2937098957 Bacteria 7249374
944 2937112552 2937106411 Bacteria 6947143
945 2937118184 2937113482 Bacteria 6505872
946 2937121175 2937119839 Bacteria 6597547
947 2937129809 2937126314 Bacteria 6771275
948 2939627491 2939626828 Bacteria 4695272
949 2941486494 2941485952 Bacteria 3591484
950 2941506422 2941499720 Bacteria 7599444
951 2946790953 2946787523 Bacteria 4366789
952 2957375998 2957375807 Bacteria 6425588
953 2957385079 2957382221 Bacteria 6737050
954 2957389142 2957388812 Bacteria 6778072
955 2957396396 2957395598 Bacteria 6822399
956 2957405458 2957402308 Bacteria 6741770
957 2957413261 2957408893 Bacteria 6558585
958 2957419188 2957415311 Bacteria 6991633
959 2957419369 2957415311 Bacteria 6991633
960 2957421810 2957415311 Bacteria 6991633
961 2957427723 2957422303 Bacteria 7172205
962 2957431101 2957430029 Bacteria 7022557
963 2957439587 2957437181 Bacteria 6568994
964 2957446664 2957443900 Bacteria 6869977
965 2957450504 2957443900 Bacteria 6869977
966 2957454180 2957450854 Bacteria 6765715
967 2957457613 2957457609 Bacteria 6967680
968 2957463576 2957457609 Bacteria 6967680
969 2957467758 2957464669 Bacteria 6568877
970 2957477800 2957471148 Bacteria 6797643
971 2957480638 2957478035 Bacteria 6756658
972 2957485800 2957484790 Bacteria 6703082
973 2957495984 2957491536 Bacteria 6695180
974 2957501026 2957498199 Bacteria 7126688
975 2957509582 2957505466 Bacteria 7253085
976 2960586634 2960584000 Bacteria 6864594
977 2960592469 2960591022 Bacteria 6622873
978 2960600585 2960597568 Bacteria 6550735
979 2960609485 2960603979 Bacteria 6898737
980 2960616721 2960610863 Bacteria 6691244
981 2960617693 2960617483 Bacteria 6727748
982 2960622637 2960617483 Bacteria 6727748
983 2960629778 2960624210 Bacteria 6875384
984 2960636146 2960631154 Bacteria 6732508
985 2960640197 2960637947 Bacteria 7296468
986 2960648738 2960645483 Bacteria 7211087
987 2960659496 2960652885 Bacteria 7083688
988 2960666394 2960660292 Bacteria 7041660
989 2960666751 2960660292 Bacteria 7041660
990 2960673915 2960667422 Bacteria 6763020
991 2960678822 2960674078 Bacteria 6609048
992 2960681106 2960680706 Bacteria 6624464
993 2960692069 2960687367 Bacteria 6535474
994 2960694106 2960693952 Bacteria 6749742
995 2961047490 2961047084 Bacteria 4594415
996 2964609722 2964607997 Bacteria 7101408
997 2964620711 2964615318 Bacteria 6809089
998 2964627797 2964621998 Bacteria 6834995
999 2964633127 2964628898 Bacteria 7083044
1000 2964637207 2964636051 Bacteria 7091832
1001 2964646037 2964643177 Bacteria 6820887
1002 2964646151 2964643177 Bacteria 6820887
1003 2964653093 2964649959 Bacteria 6675118
1004 2964661894 2964656573 Bacteria 7100150
1005 2964671696 2964670856 Bacteria 6851364
1006 2964678977 2964678106 Bacteria 6792020
1007 2964688098 2964685014 Bacteria 6839111
1008 2964695831 2964691889 Bacteria 6802758
1009 2964703605 2964698721 Bacteria 6765331
1010 2964706166 2964705432 Bacteria 7114648
1011 2964716289 2964712639 Bacteria 6695970
1012 2964726467 2964719344 Bacteria 7286602
1013 2967667361 2967664464 Bacteria 6948836
1014 2967672154 2967671571 Bacteria 7021409
1015 2967678915 2967678726 Bacteria 7264382
1016 2967692032 2967686174 Bacteria 6678622
1017 2967693235 2967693043 Bacteria 6804451
1018 2967704250 2967699805 Bacteria 6854538
1019 2967712938 2967706974 Bacteria 7186053
1020 2967716539 2967714385 Bacteria 7000047
1021 2967724576 2967721400 Bacteria 7073753
1022 2967731364 2967728569 Bacteria 6641507
1023 2967737590 2967735183 Bacteria 6827012
1024 2967740159 2967735183 Bacteria 6827012
1025 2967742200 2967742019 Bacteria 6794534
1026 2967747863 2967742019 Bacteria 6794534
1027 2967752115 2967748971 Bacteria 6733771
1028 2967757724 2967755722 Bacteria 6814706
1029 2967763809 2967762386 Bacteria 6923502
1030 2967770782 2967769361 Bacteria 6587838
1031 2967782167 2967775926 Bacteria 6738189
1032 2970026061 2970019648 Bacteria 7072033
1033 2970029635 2970026789 Bacteria 6785236
1034 2970037792 2970033650 Bacteria 7118744
1035 2970043295 2970040964 Bacteria 6731123
1036 2970049930 2970047711 Bacteria 7088379
1037 2970059618 2970054988 Bacteria 6611507
1038 2970065304 2970061556 Bacteria 7099761
1039 2970075673 2970068827 Bacteria 7123112
1040 2970076979 2970076120 Bacteria 6697332
1041 2970085658 2970082768 Bacteria 6183754
1042 2970093298 2970088815 Bacteria 6933825
1043 2970096805 2970095765 Bacteria 6936963
1044 2970108554 2970102677 Bacteria 6812532
1045 2970109829 2970109326 Bacteria 6863976
1046 2970117978 2970116247 Bacteria 6501857
1047 2970124152 2970122695 Bacteria 6625855
1048 2970129508 2970129317 Bacteria 6806560
1049 2970143160 2970136068 Bacteria 7207982
1050 2970144954 2970143518 Bacteria 6446480
1051 2970153824 2970149975 Bacteria 6779706
1052 2970162816 2970156795 Bacteria 7168044
1053 2970167494 2970164137 Bacteria 6861252
1054 2970171784 2970170962 Bacteria 6876229
1055 2970184114 2970177841 Bacteria 6768001
1056 2970185134 2970184632 Bacteria 7054431
1057 2970198334 2970191845 Bacteria 7032787
1058 2977523657 2977516862 Bacteria 6940108
1059 2977527645 2977523885 Bacteria 6960446
1060 2977528876 2977523885 Bacteria 6960446
1061 2977537306 2977530762 Bacteria 6951399
1062 2977537979 2977537788 Bacteria 6929320
1063 2977550078 2977544691 Bacteria 6875412
1064 2977551977 2977551784 Bacteria 7125765
1065 2977561682 2977558990 Bacteria 6863948
1066 2977568972 2977565890 Bacteria 6901543
1067 2977578971 2977572785 Bacteria 6763888
1068 2977581504 2977579622 Bacteria 6772100
1069 2979103089 2979100975 Bacteria 5423623
1070 2984606509 2984601300 Bacteria 5455244
1071 2990269394 2990265787 Bacteria 3943888
1072 2993697504 2993693658 Bacteria 4040749
1073 644750038 644736347 Bacteria 6476522
1074 648736356 648276728 Bacteria 6968865
1075 8003992934 8003992118 Bacteria 7266902
1076 8004006137 8003999396 Bacteria 7063185
1077 8054305125 8054302542 Bacteria 5698134
1078 8055272054 8055266321 Bacteria 7999742
1079 8056679075 8056673599 Bacteria 7871253
1080 Ga0501241_001086
1081 SwRhRL2b_contig_1483352
1082 SwRhRL2b_contig_1901739
1083 JGI24740J21852_10009449
1084 JGI24740J21852_10024760
1085 JGI24739J22299_10005502
1086 JGI24739J22299_10013439
1087 JGI24737J22298_10004941
1088 JGI24737J22298_10006147
1089 JGI24737J22298_10008641
1090 JGI24737J22298_10036595
1091 JGI24735J21928_10000694
1092 JGI24735J21928_10006314
1093 JGI24735J21928_10037938
1094 JGI24738J21930_10002762
1095 JGI24738J21930_10004350
1096 JGI24738J21930_10023083
1097 JGI25150J39212_1000369
1098 JGI25151J46595_10000639
1099 JGI25153J46596_10000124
1100 rootH1_10030986
1101 rootL2_10275712
1102 rootH1_10005886
1103 rootH1_10160732
1104 Ga0055532_1003824
1105 Ga0055532_1004520
1106 Ga0055525_1000104
1107 Ga0055542_1000037
1108 Ga0055529_1000042
1109 Ga0055526_1003257
1110 Ga0055537_1002473
1111 Ga0055524_1000470
1112 Ga0055524_1002798
1113 Ga0055524_1014354
1114 Ga0055536_1000121
1115 Ga0055536_1000288
1116 Ga0055536_1000616
1117 Ga0055536_1001415
1118 Ga0055536_1002431
1119 Ga0055536_1004304
1120 Ga0055536_1046923
1121 Ga0055534_1007990
1122 Ga0055528_1006831
1123 Ga0055530_10000897
1124 Ga0055530_10001863
1125 Ga0055530_10002377
1126 Ga0055530_10004849
1127 Ga0055530_10005341
1128 Ga0055530_10014423
1129 Ga0055530_10018168
1130 Ga0055540_1001358
1131 Ga0055540_1029201
1132 Ga0055540_1046215
1133 Ga0055531_10000096
1134 Ga0055531_10002825
1135 Ga0055531_10004227
1136 Ga0055531_10022413
1137 Ga0055531_10022508
1138 Ga0058692_1002907
1139 Ga0058692_1030815
1140 Ga0065165_1008723
1141 Ga0065704_10000204
1142 Ga0065704_10099817
1143 Ga0065704_10123610
1144 Ga0065704_10211406
1145 Ga0070658_10012637
1146 Ga0070658_10019655
1147 Ga0070670_100152681
1148 Ga0070666_10032969
1149 Ga0070660_100327848
1150 Ga0070661_100005592
1151 Ga0070661_100136756
1152 Ga0070668_100034378
1153 Ga0070668_100037160
1154 Ga0070671_100219745
1155 Ga0070674_100012527
1156 Ga0070659_100017489
1157 Ga0070667_100000429
1158 Ga0070667_100002234
1159 Ga0070667_100072346
1160 Ga0070662_100015566
1161 Ga0070662_100040479
1162 Ga0070685_10077215
1163 Ga0070707_100069477
1164 Ga0068853_100005287
1165 Ga0068853_100096300
1166 Ga0070665_100000884
1167 Ga0070665_100071210
1168 Ga0068855_100073172
1169 Ga0068855_100338275
1170 Ga0070664_100021924
1171 Ga0070664_100115685
1172 Ga0068857_100029220
1173 Ga0068857_101049809
1174 Ga0068854_100014957
1175 Ga0068854_100037728
1176 Ga0068856_100479732
1177 Ga0068859_100001448
1178 Ga0068864_100017949
1179 Ga0068861_100001768
1180 Ga0068861_100145803
1181 Ga0068861_100201101
1182 Ga0068863_100043382
1183 Ga0068860_100000573
1184 Ga0068860_100833691
1185 Ga0068862_100008954
1186 Ga0068862_100009968
1187 Ga0070717_10307434
1188 Ga0075365_10002570
1189 Ga0075365_10012014
1190 Ga0075365_10455720
1191 Ga0075368_10000158
1192 Ga0075368_10000190
1193 Ga0075368_10000214
1194 Ga0075368_10000330
1195 Ga0075363_100000005
1196 Ga0075363_100017140
1197 Ga0075363_100036200
1198 Ga0075363_100083720
1199 Ga0075364_10000003
1200 Ga0075364_10000022
1201 Ga0075432_10003631
1202 Ga0075362_10000118
1203 Ga0075367_10001760
1204 Ga0075367_10002007
1205 Ga0075367_10003779
1206 Ga0075367_10014566
1207 Ga0075367_10061128
1208 Ga0075369_10000533
1209 Ga0075369_10001184
1210 Ga0075369_10002521
1211 Ga0075369_10010635
1212 Ga0075366_10025738
1213 Ga0075366_10113625
1214 Ga0075366_10177627
1215 Ga0075366_10200046
1216 Ga0075370_10000006
1217 Ga0075370_10003734
1218 Ga0075370_10004824
1219 Ga0075370_10027468
1220 Ga0075370_10027640
1221 Ga0075370_10118177
1222 Ga0075429_100208924
1223 Ga0097620_100001448
1224 Ga0079104_1004220
1225 Ga0079104_1045489
1226 Ga0105251_10018057
1227 Ga0105251_10069781
1228 Ga0105240_10030854
1229 Ga0105240_10342380
1230 Ga0105240_10414549
1231 Ga0105241_10012879
1232 Ga0105241_10173195
1233 Ga0105248_10022524
1234 Ga0105248_10059186
1235 Ga0105248_10092062
1236 Ga0105248_10103815
1237 Ga0105248_10299391
1238 Ga0105237_10004065
1239 Ga0105237_10065031
1240 Ga0105237_10339863
1241 Ga0105238_10211033
1242 Ga0105249_10003624
1243 Ga0105249_10068891
1244 Ga0105239_10000385
1245 Ga0105239_10584241
1246 Ga0157373_10038189
1247 Ga0157373_10085510
1248 Ga0157373_10530797
1249 Ga0157371_10000183
1250 Ga0157371_10006898
1251 Ga0157370_10017512
1252 Ga0157369_10029788
1253 Ga0157369_10063890
1254 Ga0157369_10285001
1255 Ga0157369_10440589
1256 Ga0157369_10488566
1257 Ga0157374_10432129
1258 Ga0163162_10003415
1259 Ga0163162_10053910
1260 Ga0163162_10077504
1261 Ga0163162_10655526
1262 Ga0157375_10002079
1263 Ga0157380_10230418
1264 Ga0182008_10037660
1265 Ga0157379_10305126
1266 Ga0182006_1027560
1267 Ga0182007_10012367
1268 Ga0182007_10088705
1269 Ga0183369_1007
1270 Ga0183363_1009
1271 Ga0163161_10001715
1272 Ga0163161_10016323
1273 Ga0163161_10029808
1274 Ga0163161_10101478
1275 Ga0163161_10447814
1276 Ga0214543_1000003
1277 Ga0228711_1020746
1278 Ga0228710_1022297
1279 Ga0209672_101064
1280 Ga0209147_100205
1281 Ga0209147_100558
1282 Ga0209147_100607
1283 Ga0209147_108381
1284 Ga0209563_100116
1285 Ga0207425_1000022
1286 Ga0209677_110133
1287 Ga0209148_1000026
1288 Ga0209759_1008921
1289 Ga0209129_1001190
1290 Ga0209233_1000455
1291 Ga0209233_1045290
1292 Ga0209565_1000065
1293 Ga0209455_1000005
1294 Ga0209673_1000818
1295 Ga0209675_1000724
1296 Ga0209676_1000060
1297 Ga0209676_1000072
1298 Ga0209676_1000184
1299 Ga0209676_1000247
1300 Ga0209676_1000297
1301 Ga0209676_1001039
1302 Ga0209676_1019584
1303 Ga0209676_1024680
1304 Ga0209025_1000018
1305 Ga0209025_1000326
1306 Ga0209025_1000371
1307 Ga0209025_1033530
1308 Ga0209564_1004449
1309 Ga0209564_1025384
1310 Ga0209564_1027816
1311 Ga0209758_1000004
1312 Ga0209758_1001185
1313 Ga0209758_1026850
1314 Ga0209050_1000001
1315 Ga0209050_1000057
1316 Ga0209050_1000077
1317 Ga0209050_1000402
1318 Ga0209050_1000548
1319 Ga0209050_1000622
1320 Ga0209050_1016408
1321 Ga0209256_1003381
1322 Ga0209051_1000303
1323 Ga0209051_1003506
1324 Ga0209051_1034867
1325 Ga0209257_1000088
1326 Ga0209257_1001450
1327 Ga0209257_1001686
1328 Ga0209257_1002690
1329 Ga0209257_1016515
1330 Ga0209257_1020328
1331 Ga0207688_10059879
1332 Ga0207680_10011950
1333 Ga0207647_10027364
1334 Ga0207647_10052205
1335 Ga0207705_10000397
1336 Ga0207654_10024820
1337 Ga0207695_10008826
1338 Ga0207695_10164752
1339 Ga0207695_10442779
1340 Ga0207671_10001440
1341 Ga0207671_10016082
1342 Ga0207671_10167441
1343 Ga0207657_10065059
1344 Ga0207657_10412079
1345 Ga0207649_10003218
1346 Ga0207649_10236072
1347 Ga0207694_10005402
1348 Ga0207694_10036765
1349 Ga0207694_10060062
1350 Ga0207644_10169376
1351 Ga0207644_10585917
1352 Ga0207690_10001443
1353 Ga0207706_10007581
1354 Ga0207706_10069138
1355 Ga0207669_10039679
1356 Ga0207711_10015556
1357 Ga0207711_10034224
1358 Ga0207711_10035470
1359 Ga0207711_10075038
1360 Ga0207711_10165342
1361 Ga0207667_10000107
1362 Ga0207667_10011452
1363 Ga0207667_10490866
1364 Ga0207712_10004353
1365 Ga0207712_10038029
1366 Ga0207712_10246841
1367 Ga0207668_10003517
1368 Ga0207668_10003735
1369 Ga0207640_10007563
1370 Ga0207640_10013814
1371 Ga0207640_10200657
1372 Ga0207658_10000368
1373 Ga0207658_10009771
1374 Ga0207658_10062027
1375 Ga0207658_10631176
1376 Ga0207639_10002138
1377 Ga0207639_10009537
1378 Ga0207639_10020899
1379 Ga0207678_10002748
1380 Ga0207678_10030255
1381 Ga0207702_10005233
1382 Ga0207702_10007230
1383 Ga0207702_10007530
1384 Ga0207641_10027348
1385 Ga0207676_10009756
1386 Ga0207674_10002464
1387 Ga0207674_10087483
1388 Ga0207675_100000016
1389 Ga0207675_100216677
1390 Ga0207675_100455070
1391 Ga0207683_10074155
1392 Ga0207698_10018963
1393 Ga0209281_1000332
1394 Ga0209281_1000360
1395 Ga0209281_1033727
1396 Ga0209282_1000060
1397 Ga0209813_10000022
1398 Ga0209813_10000038
1399 Ga0209813_10000092
1400 Ga0209813_10000105
1401 Ga0207428_10013576
1402 Ga0268266_10001163
1403 Ga0268266_10253345
1404 Ga0268265_10012328
1405 Ga0268265_10015937
1406 Ga0268265_10151002
1407 Ga0268265_10727088
1408 Ga0268264_10000582
1409 Ga0268264_10800901
1410 Ga0265318_10009370
1411 Ga0265322_10029347
1412 Ga0265336_10000859
1413 Ga0307517_10021522
1414 Ga0307517_10052593
1415 Ga0307515_10026858
1416 Ga0265338_10000013
1417 Ga0265324_10021279
1418 Ga0265327_10138513
1419 Ga0307513_10003740
1420 Ga0307513_10004795
1421 Ga0307509_10002287
1422 Ga0307408_100010494
1423 Ga0307408_100036834
1424 Ga0307408_100174792
1425 Ga0307408_100223793
1426 Ga0307516_10086960
1427 Ga0307516_10175613
1428 Ga0307405_10279380
1429 Ga0307413_10017189
1430 Ga0307413_10077624
1431 Ga0307410_10131729
1432 Ga0307406_10205477
1433 Ga0307412_10000003
1434 Ga0307412_10019961
1435 Ga0307412_10061744
1436 Ga0307412_10380078
1437 Ga0315914_1000121
1438 Ga0307409_100176956
1439 Ga0307416_100153428
1440 Ga0307416_100697871
1441 Ga0307414_10000536
1442 Ga0307414_10001051
1443 Ga0307414_10021372
1444 Ga0307414_10022530
1445 Ga0307414_10104516
1446 Ga0307414_10200207
1447 Ga0307414_10249936
1448 Ga0307414_10361613
1449 Ga0307411_10466043
1450 Ga0307415_100902000
1451 Ga0315913_1000046
1452 Ga0315915_1000004
1453 Ga0373937_0277486
1454 Ga0395898_0036347
1455 Ga0436365_0654829
1456 Ga0436365_1097678
1457 Ga0439439_0002567
1458 Ga0439465_0006311
1459 Ga0439465_0141468
1460 Ga0451791_0474554
1461 Ga0451795_1076342
1462 Ga0451802_1573622
1463 Ga0451807_2178245
1464 Ga0451837_1810866
1465 Ga0451843_0184918
1466 Ga0451843_0511461
1467 Ga0451853_0332407
1468 Ga0439431_0007141
1469 Ga0439445_0033116
1470 Ga0439449_0008122
1471 Ga0450911_001396
1472 Ga0439434_0102338
1473 Ga0451576_0000053
1474 Ga0495627_000103
1475 Ga0495627_000105
1476 Ga0495627_000185
1477 Ga0495592_0063903
1478 Ga0495638_0000021
1479 Ga0495638_0002128
1480 Ga0495638_0002254
1481 Ga0495638_0004335
1482 Ga0495638_0006082
1483 Ga0495638_0086206
1484 Ga0495651_0437393
1485 Ga0495653_0162114
1486 Ga0495650_0000045
1487 Ga0495650_0000862
1488 Ga0495650_0001034
1489 Ga0495650_0005530
1490 Ga0495580_0000047
1491 Ga0495580_0053620
1492 Ga0495605_0003880
1493 Ga0495605_0005837
1494 Ga0495664_0012632
1495 Ga0495584_0172349
1496 Ga0495585_0001506
1497 Ga0495596_0000171
1498 Ga0495596_0001194
1499 Ga0495596_0005301
1500 Ga0495607_0006779
1501 Ga0495583_0000069
1502 Ga0495583_0000184
1503 Ga0495583_0000401
1504 Ga0495583_0034485
1505 Ga0495583_0043219
1506 Ga0495606_0008550
1507 Ga0495606_0089105
1508 Ga0495606_0255917
1509 Ga0495610_0000013
1510 Ga0495610_0000018
1511 Ga0495610_0000101
1512 Ga0495610_0002633
1513 Ga0495610_0002639
1514 Ga0495610_0142206
1515 Ga0495616_0000270
1516 Ga0495616_0176222
1517 Ga0495620_0033849
1518 Ga0495620_0039025
1519 Ga0495620_0045054
1520 Ga0495628_0062359
1521 Ga0495628_0345569
1522 Ga0495630_0172398
1523 Ga0495631_0052696
1524 Ga0495631_0099404
1525 Ga0495632_0001639
1526 Ga0495632_0001694
1527 Ga0495643_0000336
1528 Ga0495643_0027804
1529 Ga0495643_0030778
1530 Ga0495643_0034028
1531 Ga0495643_0044552
1532 Ga0495643_0114051
1533 Ga0495648_0000026
1534 Ga0495648_0000111
1535 Ga0495648_0048047
1536 Ga0495648_0049703
1537 Ga0495648_0067184
1538 Ga0495663_0000757
1539 Ga0495663_0052964
1540 Ga0495666_0004701
1541 Ga0495642_0007084
1542 Ga0495642_0106553
1543 Ga0495652_0051478
1544 Ga0495652_0156210
1545 Ga0495654_0000018
1546 Ga0495640_0066032
1547 Ga0495609_0074614
1548 Ga0495597_0002618
1549 Ga0495597_0024054
1550 Ga0495597_0105938
1551 Ga0495645_0378934
1552 Ga0495622_0003300
1553 Ga0495622_0047054
1554 Ga0495622_0097704
1555 Ga0495633_0003416
1556 Ga0495633_0004092
1557 Ga0495668_0000002
1558 Ga0495668_0000325
1559 Ga0495668_0031231
1560 Ga0495668_0117517
1561 Ga0495668_0143886
1562 Ga0495668_0167114
1563 Ga0495611_0020290
1564 Ga0495611_0104509
1565 Ga0495625_0000011
1566 Ga0495625_0002609
1567 Ga0495625_0002714
1568 Ga0495625_0004251
1569 Ga0495625_0018596
1570 Ga0495625_0038770
1571 Ga0495625_0038875
1572 Ga0495625_0043927
1573 Ga0495625_0055530
1574 Ga0495661_0007978
1575 Ga0495661_0012689
1576 Ga0495661_0066993
1577 Ga0495661_0119451
1578 Ga0495599_0013711
1579 Ga0495599_0040463
1580 Ga0495646_0055361
1581 Ga0495669_0001020
1582 Ga0495669_0002307
1583 Ga0495613_0004913
1584 Ga0495671_0000050
1585 Ga0495671_0021372
1586 Ga0495649_0026157
1587 Ga0495589_0008502
1588 Ga0495604_0020344
1589 Ga0495674_0034286
1590 Ga0495672_0004230
1591 Ga0495672_0004815
1592 Ga0495683_0012468
1593 Ga0495683_0016369
1594 Ga0495683_0030145
1595 Ga0495687_001092
1596 Ga0495687_001844
1597 Ga0495687_007250
1598 Ga0495687_018058
1599 Ga0495675_0189287
1600 Ga0495677_0053767
1601 Ga0495673_0000056
1602 Ga0495673_0000125
1603 Ga0495673_0020024
1604 Ga0495681_0000036
1605 Ga0495681_0000174
1606 Ga0495681_0005853
1607 Ga0495681_0006465
1608 Ga0495686_0000057
1609 Ga0495686_0000808
1610 Ga0495686_0000944
1611 Ga0495686_0002660
1612 Ga0495686_0003856
1613 Ga0495686_0016945
1614 Ga0495686_0027554
1615 Ga0495686_0028511
1616 Ga0495686_0036965
1617 Ga0495602_0025013
1618 Ga0495602_0392296
1619 Ga0495615_0000006
1620 Ga0495615_0000009
1621 Ga0495615_0000022
1622 Ga0495615_0000056
1623 Ga0495626_0034390
1624 Ga0495626_0092043
1625 Ga0496100_0004363
1626 Ga0496100_0580091
1627 Ga0496101_0000647
1628 Ga0496101_0414580
1629 Ga0496102_0000067
1630 Ga0496102_0008560
1631 Ga0496102_0052303
1632 Ga0496102_0568457
1633 Ga0496103_0002600
1634 Ga0496103_0276162
1635 Ga0496104_0016161
1636 Ga0496104_0561403
1637 Ga0496105_0000662
1638 Ga0496106_0059203
1639 Ga0496106_0068882
1640 Ga0496106_0084941
1641 Ga0496107_0000136
1642 Ga0496107_0000515
1643 Ga0496107_0018371
1644 Ga0496110_0058225
1645 Ga0496111_0002307
1646 Ga0496112_0697702
1647 Ga0496113_0064418
1648 Ga0496113_0492592
1649 Ga0496114_0040025
1650 Ga0496115_0000056
1651 Ga0496116_0000545
1652 Ga0496116_0006376
1653 Ga0496116_0036283
1654 Ga0496117_0000114
1655 Ga0496117_0012932
1656 Ga0496117_0013436
1657 Ga0496117_0026934
1658 Ga0496117_0062312
1659 Ga0496118_0000082
1660 Ga0496118_0000439
1661 Ga0496118_0001437
1662 Ga0496118_0004598
1663 Ga0496118_0014789
1664 Ga0496118_0061924
1665 Ga0496119_0002162
1666 Ga0496119_0019495
1667 Ga0496120_0006533
1668 Ga0496120_0048673
1669 Ga0496121_0000021
1670 Ga0496121_0000190
1671 Ga0496121_0000344
1672 Ga0496121_0000721
1673 Ga0496121_0002392
1674 Ga0496121_0009736
1675 Ga0496121_0028182
1676 Ga0496121_0032836
1677 Ga0496121_0034383
1678 Ga0496121_0230957
1679 Ga0496122_0000462
1680 Ga0496122_0001343
1681 Ga0496122_0004042
1682 Ga0496122_0004742
1683 Ga0496122_0008010
1684 Ga0496122_0010005
1685 Ga0496122_0021500
1686 Ga0496122_0031248
1687 Ga0496122_0078878
1688 Ga0496123_0000048
1689 Ga0496123_0000300
1690 Ga0496123_0000643
1691 Ga0496123_0002078
1692 Ga0496123_0013351
1693 Ga0496123_0017198
1694 Ga0496123_0025200
1695 Ga0496123_0065530
1696 Ga0496123_0143732
1697 Ga0496124_0000068
1698 Ga0496124_0003193
1699 Ga0496124_0006400
1700 Ga0496124_0019388
1701 Ga0496124_0056514
1702 Ga0496124_0061695
1703 Ga0496124_0119858
1704 Ga0496124_0175482
1705 Ga0496125_0000488
1706 Ga0496125_0002303
1707 Ga0496125_0004268
1708 Ga0496125_0012254
1709 Ga0496125_0035284
1710 Ga0496125_0070822
1711 Ga0496125_0102467
1712 Ga0496125_0159962
1713 Ga0496125_0230986
1714 Ga0496126_0000157
1715 Ga0496126_0000503
1716 Ga0496126_0011995
1717 Ga0496126_0018537
1718 Ga0496126_0027270
1719 Ga0496126_0265064
1720 Ga0495682_0028086
1721 Ga0501292_000003
1722 Ga0501031_0011456
1723 Ga0501032_0010834
1724 Ga0501032_0027261
1725 Ga0501033_0005862
1726 Ga0501033_0029586
1727 Ga0501033_0064704
1728 Ga0501033_0131204
1729 Ga0501034_0000215
1730 Ga0501034_0028660
1731 Ga0501034_0092516
1732 Ga0501034_0186316
1733 Ga0501034_0473074
1734 Ga0501038_0122898
1735 Ga0501039_0266539
1736 Ga0501043_0210689
1737 Ga0501043_0309235
1738 Ga0501047_0000307
1739 Ga0501047_0001806
1740 Ga0501047_0010908
1741 Ga0501047_0274153
1742 Ga0501048_0063616
1743 Ga0501048_0239907
1744 Ga0501073_0000140
1745 Ga0501223_000007
1746 Ga0501238_000513
1747 Ga0501246_000376
1748 Ga0501249_000267
1749 Ga0501249_000588
1750 Ga0501225_0000010
1751 Ga0501080_0018648
1752 Ga0501083_0079772
1753 Ga0501262_002548
1754 Ga0501279_000009
1755 Ga0501035_0004268
1756 Ga0501035_0092439
1757 Ga0501035_0102217
1758 Ga0501044_0000109
1759 Ga0501044_0000453
1760 Ga0501044_0043037
1761 Ga0501044_0105330
1762 Ga0501044_0672560
1763 nmdc:mga03n38_68_c1
1764 nmdc:mga03n38_71089_c1
1765 nmdc:mga00v17_91_c1
1766 nmdc:mga00v17_9_c1
1767 nmdc:mga0yw44_452865_c1
1768 nmdc:mga0yw44_567_c1
1769 nmdc:mga0yw44_727_c2
1770 nmdc:mga0k408_156526_c1
1771 nmdc:mga0k408_28620_c1
1772 nmdc:mga0k408_415_c1
1773 nmdc:mga0k408_59038_c1
1774 nmdc:mga0k408_80036_c1
1775 nmdc:mga06z11_121710_c1
1776 nmdc:mga06z11_3_c1
1777 nmdc:mga06z11_41_c1
1778 nmdc:mga06z11_48_c1
1779 nmdc:mga06z11_60931_c1
1780 nmdc:mga06z11_71_c1
1781 nmdc:mga04h51_27_c1
1782 nmdc:mga04h51_43_c1
1783 nmdc:mga04h51_57_c1
1784 nmdc:mga04h51_5_c1
1785 nmdc:mga07m45_18_c1
1786 nmdc:mga07m45_22856_c1
1787 nmdc:mga07m45_26825_c1
1788 nmdc:mga07m45_2787_c1
1789 nmdc:mga09592_163515_c1
1790 nmdc:mga0sz30_271_c1
1791 nmdc:mga0sz30_3064_c1
1792 nmdc:mga0sz30_34_c1
1793 nmdc:mga0sz30_397_c1
1794 Ga0495601_0046860
1795 Ga0500610_0000206
1796 Ga0500635_0000154
1797 Ga0495619_0066359
1798 Ga0500643_000203
1799 Ga0500643_030347
1800 Ga0500646_0007574
1801 Ga0500647_0014019
1802 Ga0500651_0000062
1803 Ga0500651_0004291
1804 Ga0500566_0000824
1805 Ga0500566_0022100
1806 Ga0500566_0076541
1807 Ga0500566_0082680
1808 Ga0500641_0001855
1809 Ga0500650_0170650
1810 Ga0500654_078918
1811 Ga0500555_000448
1812 Ga0500592_016490
1813 Ga0500592_019210
1814 Ga0500595_002134
1815 Ga0500595_002188
1816 Ga0500595_004324
1817 Ga0500595_021474
1818 Ga0500607_000293
1819 Ga0500608_000135
1820 Ga0500608_000353
1821 Ga0500608_002030
1822 Ga0500614_000155
1823 Ga0500614_004939
1824 Ga0500614_023077
1825 Ga0500618_000178
1826 Ga0500618_000606
1827 Ga0500618_000707
1828 Ga0500618_006287
1829 Ga0500642_0000471
1830 Ga0500642_0031645
1831 Ga0500655_000055
1832 Ga0500655_017095
1833 Ga0500559_0000031
1834 Ga0500559_0000879
1835 Ga0500559_0000984
1836 Ga0500559_0003462
1837 Ga0500559_0008942
1838 Ga0500559_0021988
1839 Ga0500559_0220483
1840 Ga0500568_0069966
1841 Ga0500573_0047098
1842 Ga0500590_000433
1843 Ga0500603_000737
1844 Ga0500604_0000520
1845 Ga0500622_0003059
1846 Ga0500622_0005037
1847 Ga0500622_0005173
1848 Ga0500622_0005293
1849 Ga0500624_000002
1850 Ga0500627_0000020
1851 Ga0500639_101614
1852 Ga0500636_0001943
1853 Ga0500637_0004224
1854 Ga0500570_006654
1855 Ga0500625_000007
1856 Ga0500645_000585
1857 Ga0500645_001694
1858 Ga0500645_002181
1859 Ga0500645_014440
1860 Ga0501084_0021531
1861 Ga0500661_000033
1862 Ga0501082_0043906
1863 Ga0530510_0211114
1864 2509374508
1865 2510306598
1866 2510842739
1867 2511124402
1868 2511500961
1869 2512532376
1870 2512974772
1871 2513583501
1872 2513603894
1873 2513617650
1874 2513882714
1875 2513905259
1876 2513914506
1877 2513928245
1878 2513957704
1879 2513984799
1880 2513999503
1881 2514004151
1882 2514045559
1883 2515610215
1884 2516892242
1885 2517567419
1886 2524454505
1887 2524614013
1888 2551676421
1889 2551687222
1890 2551694402
1891 2551703175
1892 2551740391
1893 2558863535
1894 2585259935
1895 2585266237
1896 2585387239
1897 2599416862
1898 2600200418
1899 2643729558
1900 2643832609
1901 2643834711
1902 2643926097
1903 2643928721
1904 2644001519
1905 2644040957
1906 2644043915
1907 2644053596
1908 2644055638
1909 2644087198
1910 2644342151
1911 2644368437
1912 2644392386
1913 2687583756
1914 2739649610
1915 2739652359
1916 2740028083
1917 2740030833
1918 2753767250
1919 2778126862
1920 2792458920
1921 2792462237
1922 2792462246
1923 2802725820
1924 2802731472
1925 2802736337
1926 2802750099
1927 2809064532
1928 2809080557
1929 2809084921
1930 2819713795
1931 2830078833
1932 2838041808
1933 2838661187
1934 2841915630
1935 2841920832
1936 2842525297
1937 2843749076
1938 2848298222
1939 2849563761
1940 2849576443
1941 2850080426
1942 2851154939
1943 2852656984
1944 2852681249
1945 2855831312
1946 2855840437
1947 2857507213
1948 2858800965
1949 2874220725
1950 2876808932
1951 2879110278
1952 2880523668
1953 2884961984
1954 2885429103
1955 2885433150
1956 2894417496
1957 2898331475
1958 2915980963
1959 2915990905
1960 2915996271
1961 2916005749
1962 2916010916
1963 2916016553
1964 2916024752
1965 2916032191
1966 2916038154
1967 2916047918
1968 2916054361
1969 2916055368
1970 2916064490
1971 2916073448
1972 2916078178
1973 2917705606
1974 2919090755
1975 2919140636
1976 2919682705
1977 2919708895
1978 2919709460
1979 2921204930
1980 2921213520
1981 2921241612
1982 2921247526
1983 2921251303
1984 2921261599
1985 2921264245
1986 2921282758
1987 2921290140
1988 2921303397
1989 2924145610
1990 2924157260
1991 2924160563
1992 2924168161
1993 2924173408
1994 2924186324
1995 2924189502
1996 2924198238
1997 2924204069
1998 2924209899
1999 2924215186
2000 2924226239
2001 2924234924
2002 2928496739
2003 2928534089
2004 2928969803
2005 2931381641
2006 2933019853
2007 2937000765
2008 2937009524
2009 2937010876
2010 2937018995
2011 2937027935
2012 2937035893
2013 2937036359
2014 2937048979
2015 2937056294
2016 2937063363
2017 2937070635
2018 2937072169
2019 2937084741
2020 2937086888
2021 2937095579
2022 2937103645
2023 2937112552
2024 2937118184
2025 2937121175
2026 2937129809
2027 2939627491
2028 2941486494
2029 2941506422
2030 2946790953
2031 2957375998
2032 2957385079
2033 2957389142
2034 2957396396
2035 2957405458
2036 2957413261
2037 2957419188
2038 2957419369
2039 2957421810
2040 2957427723
2041 2957431101
2042 2957439587
2043 2957446664
2044 2957450504
2045 2957454180
2046 2957457613
2047 2957463576
2048 2957467758
2049 2957477800
2050 2957480638
2051 2957485800
2052 2957495984
2053 2957501026
2054 2957509582
2055 2960586634
2056 2960592469
2057 2960600585
2058 2960609485
2059 2960616721
2060 2960617693
2061 2960622637
2062 2960629778
2063 2960636146
2064 2960640197
2065 2960648738
2066 2960659496
2067 2960666394
2068 2960666751
2069 2960673915
2070 2960678822
2071 2960681106
2072 2960692069
2073 2960694106
2074 2961047490
2075 2964609722
2076 2964620711
2077 2964627797
2078 2964633127
2079 2964637207
2080 2964646037
2081 2964646151
2082 2964653093
2083 2964661894
2084 2964671696
2085 2964678977
2086 2964688098
2087 2964695831
2088 2964703605
2089 2964706166
2090 2964716289
2091 2964726467
2092 2967667361
2093 2967672154
2094 2967678915
2095 2967692032
2096 2967693235
2097 2967704250
2098 2967712938
2099 2967716539
2100 2967724576
2101 2967731364
2102 2967737590
2103 2967740159
2104 2967742200
2105 2967747863
2106 2967752115
2107 2967757724
2108 2967763809
2109 2967770782
2110 2967782167
2111 2970026061
2112 2970029635
2113 2970037792
2114 2970043295
2115 2970049930
2116 2970059618
2117 2970065304
2118 2970075673
2119 2970076979
2120 2970085658
2121 2970093298
2122 2970096805
2123 2970108554
2124 2970109829
2125 2970117978
2126 2970124152
2127 2970129508
2128 2970143160
2129 2970144954
2130 2970153824
2131 2970162816
2132 2970167494
2133 2970171784
2134 2970184114
2135 2970185134
2136 2970198334
2137 2977523657
2138 2977527645
2139 2977528876
2140 2977537306
2141 2977537979
2142 2977550078
2143 2977551977
2144 2977561682
2145 2977568972
2146 2977578971
2147 2977581504
2148 2979103089
2149 2984606509
2150 2990269394
2151 2993697504
2152 644750038
2153 648736356
2154 8003992934
2155 8004006137
2156 8054305125
2157 8055272054
2158 8056679075

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

61

207

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fzv-assembly1.cif.gz_B crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9351 1 231
2fzv-assembly1.cif.gz_A crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9338 3 233
2fzv-assembly1.cif.gz_D crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9272 2 231
2fzv-assembly1.cif.gz_C crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9237 1 231
2fzv-assembly1.cif.gz_A crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.9147 3 233
ID Description Score Start End Superfamily
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9237 1 231 3.40.50.360
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9214 34 228 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8863 1 231 3.40.50.360
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8658 34 228 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8514 37 206 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A4Q3A6A9-F1-model_v4 Arsenical resistance protein ArsH 0.9912 1 98 GO:0016655
AF-A0A6S4VTP6-F1-model_v4 deleted 0.9901 2 106
AF-A0A2D8TFP3-F1-model_v4 deleted 0.9881 1 82
AF-A0A6I1JFG8-F1-model_v4 NADPH-dependent FMN reductase 0.9788 1 72 GO:0016655
AF-A0A2D8TFP3-F1-model_v4 deleted 0.9763 1 82

Map