F489652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1079 | 630 | 2158 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300049758|Ga0501241_001086|Ga0501241_001086_522_1358 |
| Length | 278 |
| Sequence | LRLRRDASGRLQKCADRHLFHQGNFMSRLRVLDDPTILPALDPAYALQRPAIGLGADEPAPRILLLYGSLRARSFSRLAVEEAARLLQFFGAETRIFDPSDLPLPDQIAGDDHPAVHELRELSMWSEGQVWCSPERHGQISGIMKAQIDHLPLEMGGMRPTQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMVTIPNQSSVAMAYKEFDEAGRMKPSSYYDRIVDVMEELVRFTVLLRPHAGQLVDRYSERKAAGLRVDPAAELAARALASSTVRSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 70 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 91 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 94 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 95 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 96 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 148 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 177 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 182 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 183 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 188 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 191 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 194 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 282 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 294 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 295 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 300 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 307 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 317 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 318 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 319 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 320 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 322 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 323 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 325 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 327 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 328 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 329 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 330 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 333 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 334 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 336 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 337 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 341 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 343 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 345 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 346 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 347 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 348 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 350 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 352 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 353 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 354 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 355 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 356 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 357 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 358 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 359 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 360 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 361 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 362 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 363 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 364 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 365 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 366 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 367 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 368 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 369 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 370 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 371 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 372 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 373 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 374 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 375 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 376 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 377 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 378 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 379 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 380 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 381 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 382 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 383 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 384 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 385 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 386 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 387 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 388 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 389 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 390 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 391 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 392 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 393 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 394 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 395 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 396 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 397 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 398 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 399 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 400 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 401 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 402 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 403 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 404 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 405 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 406 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 407 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 408 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 409 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 410 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 411 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 412 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 413 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 414 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 415 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 416 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 417 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 418 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 419 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 420 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 421 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 422 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 423 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 424 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 425 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 426 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 427 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 428 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 429 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 430 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 431 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 432 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 433 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 434 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 435 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 436 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 437 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 438 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 439 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 440 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 441 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 442 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 443 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 444 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 445 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 446 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 447 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 448 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 449 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 450 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 451 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 452 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 453 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 454 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 455 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 456 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 457 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 458 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 459 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 460 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 461 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 462 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 463 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 464 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 465 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 466 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 467 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 468 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 469 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 470 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 471 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 472 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 473 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 474 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 475 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 476 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 477 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 478 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 479 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 480 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 481 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 482 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 483 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 484 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 485 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 486 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 487 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 488 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 489 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 490 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 491 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 492 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 493 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 494 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 495 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 496 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 497 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 498 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 499 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 500 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 501 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 502 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 503 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 504 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 505 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 506 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 507 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 508 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 509 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 510 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 511 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 512 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 513 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 514 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 515 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 516 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 517 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 518 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 519 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 520 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 521 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 522 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 523 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 524 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 525 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 526 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 527 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 528 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 529 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 530 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 531 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 532 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 533 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 534 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 535 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 536 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 537 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 538 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 539 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 540 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 541 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 542 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 543 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 544 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 545 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 546 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 547 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 548 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 549 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 550 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 551 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 552 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 553 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 554 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 555 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 556 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 557 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 558 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 559 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 560 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 561 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 562 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 563 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 564 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 565 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 566 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 567 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 568 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 569 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 570 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 571 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 572 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 573 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 574 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 575 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 576 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 577 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 578 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 579 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 580 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 581 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 582 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 583 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 584 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 585 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 586 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 587 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 588 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 589 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 590 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 591 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 592 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 593 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 594 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 595 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 596 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 597 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 598 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 599 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 600 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 601 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 602 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 603 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 604 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 605 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 606 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 607 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 608 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 609 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 610 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 611 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 612 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 613 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 614 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 615 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 616 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 617 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 618 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 619 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 620 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 621 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 622 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 623 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 624 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 625 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 626 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 627 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 628 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 629 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 630 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.66 |
| Metatranscriptomes | 0 |
| Isolates | 27.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 20.48 |
| Nodule | 21.5 |
| Rhizoplane | 2.87 |
| Rhizosphere | 42.82 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501241_001086 | 3300049758 | Bacteria | 5722 |
| 2 | SwRhRL2b_contig_1483352 | 2162886007 | Bacteria | 1660 |
| 3 | SwRhRL2b_contig_1901739 | 2162886007 | Bacteria | 28384 |
| 4 | JGI24740J21852_10009449 | 3300001979 | Bacteria | 3817 |
| 5 | JGI24740J21852_10024760 | 3300001979 | Bacteria | 2032 |
| 6 | JGI24739J22299_10005502 | 3300001989 | Bacteria | 4805 |
| 7 | JGI24739J22299_10013439 | 3300001989 | Bacteria | 2990 |
| 8 | JGI24737J22298_10004941 | 3300001990 | Bacteria | 4619 |
| 9 | JGI24737J22298_10006147 | 3300001990 | Bacteria | 4114 |
| 10 | JGI24737J22298_10008641 | 3300001990 | Bacteria | 3406 |
| 11 | JGI24737J22298_10036595 | 3300001990 | Bacteria | 1515 |
| 12 | JGI24735J21928_10000694 | 3300002067 | Bacteria | 11946 |
| 13 | JGI24735J21928_10006314 | 3300002067 | Bacteria | 3911 |
| 14 | JGI24735J21928_10037938 | 3300002067 | Bacteria | 1411 |
| 15 | JGI24738J21930_10002762 | 3300002075 | Bacteria | 4512 |
| 16 | JGI24738J21930_10004350 | 3300002075 | Bacteria | 3482 |
| 17 | JGI24738J21930_10023083 | 3300002075 | Bacteria | 1284 |
| 18 | JGI25150J39212_1000369 | 3300002774 | Bacteria | 21665 |
| 19 | JGI25151J46595_10000639 | 3300003187 | Bacteria | 30118 |
| 20 | JGI25153J46596_10000124 | 3300003215 | Bacteria | 86430 |
| 21 | rootH1_10030986 | 3300003316 | Bacteria | 1859 |
| 22 | rootL2_10275712 | 3300003322 | Bacteria | 2488 |
| 23 | rootH1_10005886 | 3300003323 | Bacteria | 9819 |
| 24 | rootH1_10160732 | 3300003323 | Bacteria | 6407 |
| 25 | Ga0055532_1003824 | 3300003758 | Bacteria | 2434 |
| 26 | Ga0055532_1004520 | 3300003758 | Bacteria | 2083 |
| 27 | Ga0055525_1000104 | 3300003759 | Bacteria | 134560 |
| 28 | Ga0055542_1000037 | 3300003762 | Bacteria | 225640 |
| 29 | Ga0055529_1000042 | 3300003763 | Bacteria | 225663 |
| 30 | Ga0055526_1003257 | 3300003771 | Bacteria | 10432 |
| 31 | Ga0055537_1002473 | 3300003773 | Bacteria | 6179 |
| 32 | Ga0055524_1000470 | 3300003775 | Bacteria | 32352 |
| 33 | Ga0055524_1002798 | 3300003775 | Bacteria | 8760 |
| 34 | Ga0055524_1014354 | 3300003775 | Bacteria | 2939 |
| 35 | Ga0055536_1000121 | 3300003781 | Bacteria | 68027 |
| 36 | Ga0055536_1000288 | 3300003781 | Bacteria | 38152 |
| 37 | Ga0055536_1000616 | 3300003781 | Bacteria | 24156 |
| 38 | Ga0055536_1001415 | 3300003781 | Bacteria | 14501 |
| 39 | Ga0055536_1002431 | 3300003781 | Bacteria | 10470 |
| 40 | Ga0055536_1004304 | 3300003781 | Bacteria | 7328 |
| 41 | Ga0055536_1046923 | 3300003781 | Bacteria | 978 |
| 42 | Ga0055534_1007990 | 3300003784 | Bacteria | 2449 |
| 43 | Ga0055528_1006831 | 3300003790 | Bacteria | 5125 |
| 44 | Ga0055530_10000897 | 3300003791 | Bacteria | 24503 |
| 45 | Ga0055530_10001863 | 3300003791 | Bacteria | 14501 |
| 46 | Ga0055530_10002377 | 3300003791 | Bacteria | 12196 |
| 47 | Ga0055530_10004849 | 3300003791 | Bacteria | 6723 |
| 48 | Ga0055530_10005341 | 3300003791 | Bacteria | 6147 |
| 49 | Ga0055530_10014423 | 3300003791 | Bacteria | 2632 |
| 50 | Ga0055530_10018168 | 3300003791 | Bacteria | 2178 |
| 51 | Ga0055540_1001358 | 3300003792 | Bacteria | 14676 |
| 52 | Ga0055540_1029201 | 3300003792 | Bacteria | 1293 |
| 53 | Ga0055540_1046215 | 3300003792 | Bacteria | 916 |
| 54 | Ga0055531_10000096 | 3300003794 | Bacteria | 95992 |
| 55 | Ga0055531_10002825 | 3300003794 | Bacteria | 11373 |
| 56 | Ga0055531_10004227 | 3300003794 | Bacteria | 8835 |
| 57 | Ga0055531_10022413 | 3300003794 | Bacteria | 2407 |
| 58 | Ga0055531_10022508 | 3300003794 | Bacteria | 2398 |
| 59 | Ga0058692_1002907 | 3300003856 | Bacteria | 5538 |
| 60 | Ga0058692_1030815 | 3300003856 | Bacteria | 1016 |
| 61 | Ga0065165_1008723 | 3300005262 | Bacteria | 4683 |
| 62 | Ga0065704_10000204 | 3300005289 | Bacteria | 211587 |
| 63 | Ga0065704_10099817 | 3300005289 | Bacteria | 2296 |
| 64 | Ga0065704_10123610 | 3300005289 | Bacteria | 1721 |
| 65 | Ga0065704_10211406 | 3300005289 | Bacteria | 1107 |
| 66 | Ga0070658_10012637 | 3300005327 | Bacteria | 6772 |
| 67 | Ga0070658_10019655 | 3300005327 | Bacteria | 5408 |
| 68 | Ga0070670_100152681 | 3300005331 | Bacteria | 1999 |
| 69 | Ga0070666_10032969 | 3300005335 | Bacteria | 3425 |
| 70 | Ga0070660_100327848 | 3300005339 | Bacteria | 1258 |
| 71 | Ga0070661_100005592 | 3300005344 | Bacteria | 8662 |
| 72 | Ga0070661_100136756 | 3300005344 | Bacteria | 1844 |
| 73 | Ga0070668_100034378 | 3300005347 | Bacteria | 3862 |
| 74 | Ga0070668_100037160 | 3300005347 | Bacteria | 3718 |
| 75 | Ga0070671_100219745 | 3300005355 | Bacteria | 1612 |
| 76 | Ga0070674_100012527 | 3300005356 | Bacteria | 5209 |
| 77 | Ga0070659_100017489 | 3300005366 | Bacteria | 5399 |
| 78 | Ga0070667_100000429 | 3300005367 | Bacteria | 44271 |
| 79 | Ga0070667_100002234 | 3300005367 | Bacteria | 17045 |
| 80 | Ga0070667_100072346 | 3300005367 | Bacteria | 2938 |
| 81 | Ga0070662_100015566 | 3300005457 | Bacteria | 5097 |
| 82 | Ga0070662_100040479 | 3300005457 | Bacteria | 3318 |
| 83 | Ga0070685_10077215 | 3300005466 | Bacteria | 1988 |
| 84 | Ga0070707_100069477 | 3300005468 | Bacteria | 3391 |
| 85 | Ga0068853_100005287 | 3300005539 | Bacteria | 10106 |
| 86 | Ga0068853_100096300 | 3300005539 | Bacteria | 2611 |
| 87 | Ga0070665_100000884 | 3300005548 | Bacteria | 38426 |
| 88 | Ga0070665_100071210 | 3300005548 | Bacteria | 3483 |
| 89 | Ga0068855_100073172 | 3300005563 | Bacteria | 3982 |
| 90 | Ga0068855_100338275 | 3300005563 | Bacteria | 1660 |
| 91 | Ga0070664_100021924 | 3300005564 | Bacteria | 5266 |
| 92 | Ga0070664_100115685 | 3300005564 | Bacteria | 2344 |
| 93 | Ga0068857_100029220 | 3300005577 | Bacteria | 4864 |
| 94 | Ga0068857_101049809 | 3300005577 | Bacteria | 785 |
| 95 | Ga0068854_100014957 | 3300005578 | Bacteria | 5126 |
| 96 | Ga0068854_100037728 | 3300005578 | Bacteria | 3393 |
| 97 | Ga0068856_100479732 | 3300005614 | Bacteria | 1264 |
| 98 | Ga0068859_100001448 | 3300005617 | Bacteria | 24068 |
| 99 | Ga0068864_100017949 | 3300005618 | Bacteria | 5904 |
| 100 | Ga0068861_100001768 | 3300005719 | Bacteria | 13896 |
| 101 | Ga0068861_100145803 | 3300005719 | Bacteria | 1937 |
| 102 | Ga0068861_100201101 | 3300005719 | Bacteria | 1672 |
| 103 | Ga0068863_100043382 | 3300005841 | Bacteria | 4270 |
| 104 | Ga0068860_100000573 | 3300005843 | Bacteria | 44277 |
| 105 | Ga0068860_100833691 | 3300005843 | Bacteria | 936 |
| 106 | Ga0068862_100008954 | 3300005844 | Bacteria | 8285 |
| 107 | Ga0068862_100009968 | 3300005844 | Bacteria | 7850 |
| 108 | Ga0070717_10307434 | 3300006028 | Bacteria | 1410 |
| 109 | Ga0075365_10002570 | 3300006038 | Bacteria | 8963 |
| 110 | Ga0075365_10012014 | 3300006038 | Bacteria | 5120 |
| 111 | Ga0075365_10455720 | 3300006038 | Bacteria | 903 |
| 112 | Ga0075368_10000158 | 3300006042 | Bacteria | 18321 |
| 113 | Ga0075368_10000190 | 3300006042 | Bacteria | 16846 |
| 114 | Ga0075368_10000214 | 3300006042 | Bacteria | 16126 |
| 115 | Ga0075368_10000330 | 3300006042 | Bacteria | 13869 |
| 116 | Ga0075363_100000005 | 3300006048 | Bacteria | 56964 |
| 117 | Ga0075363_100017140 | 3300006048 | Bacteria | 3587 |
| 118 | Ga0075363_100036200 | 3300006048 | Bacteria | 2588 |
| 119 | Ga0075363_100083720 | 3300006048 | Bacteria | 1748 |
| 120 | Ga0075364_10000003 | 3300006051 | Bacteria | 111353 |
| 121 | Ga0075364_10000022 | 3300006051 | Bacteria | 53466 |
| 122 | Ga0075432_10003631 | 3300006058 | Bacteria | 5248 |
| 123 | Ga0075362_10000118 | 3300006177 | Bacteria | 22058 |
| 124 | Ga0075367_10001760 | 3300006178 | Bacteria | 9506 |
| 125 | Ga0075367_10002007 | 3300006178 | Bacteria | 9075 |
| 126 | Ga0075367_10003779 | 3300006178 | Bacteria | 7295 |
| 127 | Ga0075367_10014566 | 3300006178 | Bacteria | 4258 |
| 128 | Ga0075367_10061128 | 3300006178 | Bacteria | 2248 |
| 129 | Ga0075369_10000533 | 3300006186 | Bacteria | 12019 |
| 130 | Ga0075369_10001184 | 3300006186 | Bacteria | 8825 |
| 131 | Ga0075369_10002521 | 3300006186 | Bacteria | 6549 |
| 132 | Ga0075369_10010635 | 3300006186 | Bacteria | 3604 |
| 133 | Ga0075366_10025738 | 3300006195 | Bacteria | 3441 |
| 134 | Ga0075366_10113625 | 3300006195 | Bacteria | 1630 |
| 135 | Ga0075366_10177627 | 3300006195 | Bacteria | 1293 |
| 136 | Ga0075366_10200046 | 3300006195 | Bacteria | 1215 |
| 137 | Ga0075370_10000006 | 3300006353 | Bacteria | 110712 |
| 138 | Ga0075370_10003734 | 3300006353 | Bacteria | 7287 |
| 139 | Ga0075370_10004824 | 3300006353 | Bacteria | 6607 |
| 140 | Ga0075370_10027468 | 3300006353 | Bacteria | 3158 |
| 141 | Ga0075370_10027640 | 3300006353 | Bacteria | 3149 |
| 142 | Ga0075370_10118177 | 3300006353 | Bacteria | 1542 |
| 143 | Ga0075429_100208924 | 3300006880 | Bacteria | 1710 |
| 144 | Ga0097620_100001448 | 3300006931 | Bacteria | 24068 |
| 145 | Ga0079104_1004220 | 3300006946 | Bacteria | 6253 |
| 146 | Ga0079104_1045489 | 3300006946 | Bacteria | 1001 |
| 147 | Ga0105251_10018057 | 3300009011 | Bacteria | 3763 |
| 148 | Ga0105251_10069781 | 3300009011 | Bacteria | 1637 |
| 149 | Ga0105240_10030854 | 3300009093 | Bacteria | 6962 |
| 150 | Ga0105240_10342380 | 3300009093 | Bacteria | 1698 |
| 151 | Ga0105240_10414549 | 3300009093 | Bacteria | 1514 |
| 152 | Ga0105241_10012879 | 3300009174 | Bacteria | 6137 |
| 153 | Ga0105241_10173195 | 3300009174 | Bacteria | 1784 |
| 154 | Ga0105248_10022524 | 3300009177 | Bacteria | 6988 |
| 155 | Ga0105248_10059186 | 3300009177 | Bacteria | 4303 |
| 156 | Ga0105248_10092062 | 3300009177 | Bacteria | 3414 |
| 157 | Ga0105248_10103815 | 3300009177 | Bacteria | 3204 |
| 158 | Ga0105248_10299391 | 3300009177 | Bacteria | 1811 |
| 159 | Ga0105237_10004065 | 3300009545 | Bacteria | 17062 |
| 160 | Ga0105237_10065031 | 3300009545 | Bacteria | 3643 |
| 161 | Ga0105237_10339863 | 3300009545 | Bacteria | 1506 |
| 162 | Ga0105238_10211033 | 3300009551 | Bacteria | 1917 |
| 163 | Ga0105249_10003624 | 3300009553 | Bacteria | 13354 |
| 164 | Ga0105249_10068891 | 3300009553 | Bacteria | 3264 |
| 165 | Ga0105239_10000385 | 3300010375 | Bacteria | 64470 |
| 166 | Ga0105239_10584241 | 3300010375 | Bacteria | 1274 |
| 167 | Ga0157373_10038189 | 3300013100 | Bacteria | 3442 |
| 168 | Ga0157373_10085510 | 3300013100 | Bacteria | 2223 |
| 169 | Ga0157373_10530797 | 3300013100 | Bacteria | 852 |
| 170 | Ga0157371_10000183 | 3300013102 | Bacteria | 92426 |
| 171 | Ga0157371_10006898 | 3300013102 | Bacteria | 9273 |
| 172 | Ga0157370_10017512 | 3300013104 | Bacteria | 7229 |
| 173 | Ga0157369_10029788 | 3300013105 | Bacteria | 6028 |
| 174 | Ga0157369_10063890 | 3300013105 | Bacteria | 3965 |
| 175 | Ga0157369_10285001 | 3300013105 | Bacteria | 1720 |
| 176 | Ga0157369_10440589 | 3300013105 | Bacteria | 1349 |
| 177 | Ga0157369_10488566 | 3300013105 | Bacteria | 1274 |
| 178 | Ga0157374_10432129 | 3300013296 | Bacteria | 1316 |
| 179 | Ga0163162_10003415 | 3300013306 | Bacteria | 15154 |
| 180 | Ga0163162_10053910 | 3300013306 | Bacteria | 4043 |
| 181 | Ga0163162_10077504 | 3300013306 | Bacteria | 3388 |
| 182 | Ga0163162_10655526 | 3300013306 | Bacteria | 1173 |
| 183 | Ga0157375_10002079 | 3300013308 | Bacteria | 17318 |
| 184 | Ga0157380_10230418 | 3300014326 | Bacteria | 1663 |
| 185 | Ga0182008_10037660 | 3300014497 | Bacteria | 2420 |
| 186 | Ga0157379_10305126 | 3300014968 | Bacteria | 1451 |
| 187 | Ga0182006_1027560 | 3300015261 | Bacteria | 2317 |
| 188 | Ga0182007_10012367 | 3300015262 | Bacteria | 3284 |
| 189 | Ga0182007_10088705 | 3300015262 | Bacteria | 1018 |
| 190 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 191 | Ga0183363_1009 | 3300015690 | Bacteria | 127797 |
| 192 | Ga0163161_10001715 | 3300017792 | Bacteria | 16062 |
| 193 | Ga0163161_10016323 | 3300017792 | Bacteria | 5184 |
| 194 | Ga0163161_10029808 | 3300017792 | Bacteria | 3878 |
| 195 | Ga0163161_10101478 | 3300017792 | Bacteria | 2142 |
| 196 | Ga0163161_10447814 | 3300017792 | Bacteria | 1043 |
| 197 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 198 | Ga0228711_1020746 | 3300022739 | Bacteria | 5606 |
| 199 | Ga0228710_1022297 | 3300022740 | Bacteria | 4899 |
| 200 | Ga0209672_101064 | 3300025228 | Bacteria | 11746 |
| 201 | Ga0209147_100205 | 3300025229 | Bacteria | 64474 |
| 202 | Ga0209147_100558 | 3300025229 | Bacteria | 20955 |
| 203 | Ga0209147_100607 | 3300025229 | Bacteria | 19587 |
| 204 | Ga0209147_108381 | 3300025229 | Bacteria | 1285 |
| 205 | Ga0209563_100116 | 3300025230 | Bacteria | 134661 |
| 206 | Ga0207425_1000022 | 3300025245 | Bacteria | 355305 |
| 207 | Ga0209677_110133 | 3300025253 | Bacteria | 1602 |
| 208 | Ga0209148_1000026 | 3300025254 | Bacteria | 629213 |
| 209 | Ga0209759_1008921 | 3300025256 | Bacteria | 3082 |
| 210 | Ga0209129_1001190 | 3300025258 | Bacteria | 14977 |
| 211 | Ga0209233_1000455 | 3300025261 | Bacteria | 26723 |
| 212 | Ga0209233_1045290 | 3300025261 | Bacteria | 926 |
| 213 | Ga0209565_1000065 | 3300025263 | Bacteria | 178266 |
| 214 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 215 | Ga0209673_1000818 | 3300025273 | Bacteria | 41077 |
| 216 | Ga0209675_1000724 | 3300025291 | Bacteria | 22437 |
| 217 | Ga0209676_1000060 | 3300025292 | Bacteria | 338238 |
| 218 | Ga0209676_1000072 | 3300025292 | Bacteria | 307347 |
| 219 | Ga0209676_1000184 | 3300025292 | Bacteria | 143543 |
| 220 | Ga0209676_1000247 | 3300025292 | Bacteria | 115814 |
| 221 | Ga0209676_1000297 | 3300025292 | Bacteria | 100558 |
| 222 | Ga0209676_1001039 | 3300025292 | Bacteria | 32114 |
| 223 | Ga0209676_1019584 | 3300025292 | Bacteria | 2325 |
| 224 | Ga0209676_1024680 | 3300025292 | Bacteria | 1941 |
| 225 | Ga0209025_1000018 | 3300025294 | Bacteria | 686898 |
| 226 | Ga0209025_1000326 | 3300025294 | Bacteria | 106087 |
| 227 | Ga0209025_1000371 | 3300025294 | Bacteria | 94612 |
| 228 | Ga0209025_1033530 | 3300025294 | Bacteria | 2370 |
| 229 | Ga0209564_1004449 | 3300025295 | Bacteria | 8568 |
| 230 | Ga0209564_1025384 | 3300025295 | Bacteria | 1994 |
| 231 | Ga0209564_1027816 | 3300025295 | Bacteria | 1826 |
| 232 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 233 | Ga0209758_1001185 | 3300025297 | Bacteria | 32966 |
| 234 | Ga0209758_1026850 | 3300025297 | Bacteria | 2479 |
| 235 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 236 | Ga0209050_1000057 | 3300025298 | Bacteria | 326289 |
| 237 | Ga0209050_1000077 | 3300025298 | Bacteria | 278985 |
| 238 | Ga0209050_1000402 | 3300025298 | Bacteria | 80873 |
| 239 | Ga0209050_1000548 | 3300025298 | Bacteria | 62143 |
| 240 | Ga0209050_1000622 | 3300025298 | Bacteria | 55613 |
| 241 | Ga0209050_1016408 | 3300025298 | Bacteria | 3031 |
| 242 | Ga0209256_1003381 | 3300025299 | Bacteria | 11271 |
| 243 | Ga0209051_1000303 | 3300025303 | Bacteria | 77630 |
| 244 | Ga0209051_1003506 | 3300025303 | Bacteria | 10256 |
| 245 | Ga0209051_1034867 | 3300025303 | Bacteria | 1880 |
| 246 | Ga0209257_1000088 | 3300025304 | Bacteria | 279014 |
| 247 | Ga0209257_1001450 | 3300025304 | Bacteria | 28046 |
| 248 | Ga0209257_1001686 | 3300025304 | Bacteria | 24844 |
| 249 | Ga0209257_1002690 | 3300025304 | Bacteria | 16999 |
| 250 | Ga0209257_1016515 | 3300025304 | Bacteria | 2980 |
| 251 | Ga0209257_1020328 | 3300025304 | Bacteria | 2459 |
| 252 | Ga0207688_10059879 | 3300025901 | Bacteria | 2144 |
| 253 | Ga0207680_10011950 | 3300025903 | Bacteria | 4408 |
| 254 | Ga0207647_10027364 | 3300025904 | Bacteria | 3717 |
| 255 | Ga0207647_10052205 | 3300025904 | Bacteria | 2524 |
| 256 | Ga0207705_10000397 | 3300025909 | Bacteria | 38200 |
| 257 | Ga0207654_10024820 | 3300025911 | Bacteria | 3227 |
| 258 | Ga0207695_10008826 | 3300025913 | Bacteria | 12551 |
| 259 | Ga0207695_10164752 | 3300025913 | Bacteria | 2146 |
| 260 | Ga0207695_10442779 | 3300025913 | Bacteria | 1183 |
| 261 | Ga0207671_10001440 | 3300025914 | Bacteria | 27565 |
| 262 | Ga0207671_10016082 | 3300025914 | Bacteria | 5829 |
| 263 | Ga0207671_10167441 | 3300025914 | Bacteria | 1705 |
| 264 | Ga0207657_10065059 | 3300025919 | Bacteria | 3109 |
| 265 | Ga0207657_10412079 | 3300025919 | Bacteria | 1062 |
| 266 | Ga0207649_10003218 | 3300025920 | Bacteria | 8945 |
| 267 | Ga0207649_10236072 | 3300025920 | Bacteria | 1310 |
| 268 | Ga0207694_10005402 | 3300025924 | Bacteria | 9833 |
| 269 | Ga0207694_10036765 | 3300025924 | Bacteria | 3758 |
| 270 | Ga0207694_10060062 | 3300025924 | Bacteria | 2958 |
| 271 | Ga0207644_10169376 | 3300025931 | Bacteria | 1704 |
| 272 | Ga0207644_10585917 | 3300025931 | Bacteria | 925 |
| 273 | Ga0207690_10001443 | 3300025932 | Bacteria | 14876 |
| 274 | Ga0207706_10007581 | 3300025933 | Bacteria | 10038 |
| 275 | Ga0207706_10069138 | 3300025933 | Bacteria | 3106 |
| 276 | Ga0207669_10039679 | 3300025937 | Bacteria | 2723 |
| 277 | Ga0207711_10015556 | 3300025941 | Bacteria | 6314 |
| 278 | Ga0207711_10034224 | 3300025941 | Bacteria | 4303 |
| 279 | Ga0207711_10035470 | 3300025941 | Bacteria | 4227 |
| 280 | Ga0207711_10075038 | 3300025941 | Bacteria | 2942 |
| 281 | Ga0207711_10165342 | 3300025941 | Bacteria | 2005 |
| 282 | Ga0207667_10000107 | 3300025949 | Bacteria | 133066 |
| 283 | Ga0207667_10011452 | 3300025949 | Bacteria | 10307 |
| 284 | Ga0207667_10490866 | 3300025949 | Bacteria | 1246 |
| 285 | Ga0207712_10004353 | 3300025961 | Bacteria | 8943 |
| 286 | Ga0207712_10038029 | 3300025961 | Bacteria | 3288 |
| 287 | Ga0207712_10246841 | 3300025961 | Bacteria | 1441 |
| 288 | Ga0207668_10003517 | 3300025972 | Bacteria | 9202 |
| 289 | Ga0207668_10003735 | 3300025972 | Bacteria | 8957 |
| 290 | Ga0207640_10007563 | 3300025981 | Bacteria | 6000 |
| 291 | Ga0207640_10013814 | 3300025981 | Bacteria | 4636 |
| 292 | Ga0207640_10200657 | 3300025981 | Bacteria | 1511 |
| 293 | Ga0207658_10000368 | 3300025986 | Bacteria | 44362 |
| 294 | Ga0207658_10009771 | 3300025986 | Bacteria | 6515 |
| 295 | Ga0207658_10062027 | 3300025986 | Bacteria | 2796 |
| 296 | Ga0207658_10631176 | 3300025986 | Bacteria | 964 |
| 297 | Ga0207639_10002138 | 3300026041 | Bacteria | 13301 |
| 298 | Ga0207639_10009537 | 3300026041 | Bacteria | 6699 |
| 299 | Ga0207639_10020899 | 3300026041 | Bacteria | 4695 |
| 300 | Ga0207678_10002748 | 3300026067 | Bacteria | 15930 |
| 301 | Ga0207678_10030255 | 3300026067 | Bacteria | 4727 |
| 302 | Ga0207702_10005233 | 3300026078 | Bacteria | 11389 |
| 303 | Ga0207702_10007230 | 3300026078 | Bacteria | 9496 |
| 304 | Ga0207702_10007530 | 3300026078 | Bacteria | 9283 |
| 305 | Ga0207641_10027348 | 3300026088 | Bacteria | 4710 |
| 306 | Ga0207676_10009756 | 3300026095 | Bacteria | 6828 |
| 307 | Ga0207674_10002464 | 3300026116 | Bacteria | 23363 |
| 308 | Ga0207674_10087483 | 3300026116 | Bacteria | 3109 |
| 309 | Ga0207675_100000016 | 3300026118 | Bacteria | 126353 |
| 310 | Ga0207675_100216677 | 3300026118 | Bacteria | 1843 |
| 311 | Ga0207675_100455070 | 3300026118 | Bacteria | 1269 |
| 312 | Ga0207683_10074155 | 3300026121 | Bacteria | 3010 |
| 313 | Ga0207698_10018963 | 3300026142 | Bacteria | 4697 |
| 314 | Ga0209281_1000332 | 3300027111 | Bacteria | 81534 |
| 315 | Ga0209281_1000360 | 3300027111 | Bacteria | 74340 |
| 316 | Ga0209281_1033727 | 3300027111 | Bacteria | 898 |
| 317 | Ga0209282_1000060 | 3300027666 | Bacteria | 97673 |
| 318 | Ga0209813_10000022 | 3300027866 | Bacteria | 72813 |
| 319 | Ga0209813_10000038 | 3300027866 | Bacteria | 56808 |
| 320 | Ga0209813_10000092 | 3300027866 | Bacteria | 33357 |
| 321 | Ga0209813_10000105 | 3300027866 | Bacteria | 31318 |
| 322 | Ga0207428_10013576 | 3300027907 | Bacteria | 7109 |
| 323 | Ga0268266_10001163 | 3300028379 | Bacteria | 32562 |
| 324 | Ga0268266_10253345 | 3300028379 | Bacteria | 1629 |
| 325 | Ga0268265_10012328 | 3300028380 | Bacteria | 5792 |
| 326 | Ga0268265_10015937 | 3300028380 | Bacteria | 5156 |
| 327 | Ga0268265_10151002 | 3300028380 | Bacteria | 1959 |
| 328 | Ga0268265_10727088 | 3300028380 | Bacteria | 961 |
| 329 | Ga0268264_10000582 | 3300028381 | Bacteria | 44285 |
| 330 | Ga0268264_10800901 | 3300028381 | Bacteria | 941 |
| 331 | Ga0265318_10009370 | 3300028577 | Bacteria | 4309 |
| 332 | Ga0265322_10029347 | 3300028654 | Bacteria | 1572 |
| 333 | Ga0265336_10000859 | 3300028666 | Bacteria | 15784 |
| 334 | Ga0307517_10021522 | 3300028786 | Bacteria | 8140 |
| 335 | Ga0307517_10052593 | 3300028786 | Bacteria | 4078 |
| 336 | Ga0307515_10026858 | 3300028794 | Bacteria | 9877 |
| 337 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 338 | Ga0265324_10021279 | 3300029957 | Bacteria | 2326 |
| 339 | Ga0265327_10138513 | 3300031251 | Bacteria | 1139 |
| 340 | Ga0307513_10003740 | 3300031456 | Bacteria | 20550 |
| 341 | Ga0307513_10004795 | 3300031456 | Bacteria | 17963 |
| 342 | Ga0307509_10002287 | 3300031507 | Bacteria | 31311 |
| 343 | Ga0307408_100010494 | 3300031548 | Bacteria | 6109 |
| 344 | Ga0307408_100036834 | 3300031548 | Bacteria | 3441 |
| 345 | Ga0307408_100174792 | 3300031548 | Bacteria | 1717 |
| 346 | Ga0307408_100223793 | 3300031548 | Bacteria | 1537 |
| 347 | Ga0307516_10086960 | 3300031730 | Bacteria | 2961 |
| 348 | Ga0307516_10175613 | 3300031730 | Bacteria | 1879 |
| 349 | Ga0307405_10279380 | 3300031731 | Bacteria | 1256 |
| 350 | Ga0307413_10017189 | 3300031824 | Bacteria | 3761 |
| 351 | Ga0307413_10077624 | 3300031824 | Bacteria | 2116 |
| 352 | Ga0307410_10131729 | 3300031852 | Bacteria | 1837 |
| 353 | Ga0307406_10205477 | 3300031901 | Bacteria | 1453 |
| 354 | Ga0307412_10000003 | 3300031911 | Bacteria | 659081 |
| 355 | Ga0307412_10019961 | 3300031911 | Bacteria | 4069 |
| 356 | Ga0307412_10061744 | 3300031911 | Bacteria | 2520 |
| 357 | Ga0307412_10380078 | 3300031911 | Bacteria | 1143 |
| 358 | Ga0315914_1000121 | 3300031967 | Bacteria | 70704 |
| 359 | Ga0307409_100176956 | 3300031995 | Bacteria | 1884 |
| 360 | Ga0307416_100153428 | 3300032002 | Bacteria | 2116 |
| 361 | Ga0307416_100697871 | 3300032002 | Bacteria | 1104 |
| 362 | Ga0307414_10000536 | 3300032004 | Bacteria | 19786 |
| 363 | Ga0307414_10001051 | 3300032004 | Bacteria | 14107 |
| 364 | Ga0307414_10021372 | 3300032004 | Bacteria | 4059 |
| 365 | Ga0307414_10022530 | 3300032004 | Bacteria | 3976 |
| 366 | Ga0307414_10104516 | 3300032004 | Bacteria | 2139 |
| 367 | Ga0307414_10200207 | 3300032004 | Bacteria | 1623 |
| 368 | Ga0307414_10249936 | 3300032004 | Bacteria | 1473 |
| 369 | Ga0307414_10361613 | 3300032004 | Bacteria | 1249 |
| 370 | Ga0307411_10466043 | 3300032005 | Bacteria | 1060 |
| 371 | Ga0307415_100902000 | 3300032126 | Bacteria | 815 |
| 372 | Ga0315913_1000046 | 3300033430 | Bacteria | 62008 |
| 373 | Ga0315915_1000004 | 3300033464 | Bacteria | 403083 |
| 374 | Ga0373937_0277486 | 3300036401 | Bacteria | 1582 |
| 375 | Ga0395898_0036347 | 3300037466 | Bacteria | 4890 |
| 376 | Ga0436365_0654829 | 3300039437 | Bacteria | 5264 |
| 377 | Ga0436365_1097678 | 3300039437 | Bacteria | 902 |
| 378 | Ga0439439_0002567 | 3300041406 | Bacteria | 3879 |
| 379 | Ga0439465_0006311 | 3300041413 | Bacteria | 3764 |
| 380 | Ga0439465_0141468 | 3300041413 | Bacteria | 855 |
| 381 | Ga0451791_0474554 | 3300041451 | Bacteria | 1252 |
| 382 | Ga0451795_1076342 | 3300041456 | Bacteria | 818 |
| 383 | Ga0451802_1573622 | 3300041460 | Bacteria | 1841 |
| 384 | Ga0451807_2178245 | 3300041486 | Bacteria | 1737 |
| 385 | Ga0451837_1810866 | 3300041494 | Bacteria | 920 |
| 386 | Ga0451843_0184918 | 3300041509 | Bacteria | 1438 |
| 387 | Ga0451843_0511461 | 3300041509 | Bacteria | 1217 |
| 388 | Ga0451853_0332407 | 3300041512 | Bacteria | 1297 |
| 389 | Ga0439431_0007141 | 3300041997 | Bacteria | 2487 |
| 390 | Ga0439445_0033116 | 3300042004 | Bacteria | 1349 |
| 391 | Ga0439449_0008122 | 3300042007 | Bacteria | 3989 |
| 392 | Ga0450911_001396 | 3300042115 | Bacteria | 5603 |
| 393 | Ga0439434_0102338 | 3300042435 | Bacteria | 923 |
| 394 | Ga0451576_0000053 | 3300045051 | Bacteria | 308708 |
| 395 | Ga0495627_000103 | 3300046453 | Bacteria | 104335 |
| 396 | Ga0495627_000105 | 3300046453 | Bacteria | 103413 |
| 397 | Ga0495627_000185 | 3300046453 | Bacteria | 69533 |
| 398 | Ga0495592_0063903 | 3300046454 | Bacteria | 2698 |
| 399 | Ga0495638_0000021 | 3300046460 | Bacteria | 365602 |
| 400 | Ga0495638_0002128 | 3300046460 | Bacteria | 16657 |
| 401 | Ga0495638_0002254 | 3300046460 | Bacteria | 15983 |
| 402 | Ga0495638_0004335 | 3300046460 | Bacteria | 10752 |
| 403 | Ga0495638_0006082 | 3300046460 | Bacteria | 8833 |
| 404 | Ga0495638_0086206 | 3300046460 | Bacteria | 1898 |
| 405 | Ga0495651_0437393 | 3300046462 | Bacteria | 847 |
| 406 | Ga0495653_0162114 | 3300046463 | Bacteria | 1551 |
| 407 | Ga0495650_0000045 | 3300046471 | Bacteria | 346204 |
| 408 | Ga0495650_0000862 | 3300046471 | Bacteria | 36369 |
| 409 | Ga0495650_0001034 | 3300046471 | Bacteria | 31214 |
| 410 | Ga0495650_0005530 | 3300046471 | Bacteria | 8166 |
| 411 | Ga0495580_0000047 | 3300046472 | Bacteria | 68842 |
| 412 | Ga0495580_0053620 | 3300046472 | Bacteria | 2845 |
| 413 | Ga0495605_0003880 | 3300046474 | Bacteria | 8861 |
| 414 | Ga0495605_0005837 | 3300046474 | Bacteria | 7119 |
| 415 | Ga0495664_0012632 | 3300046477 | Bacteria | 4785 |
| 416 | Ga0495584_0172349 | 3300046491 | Bacteria | 1100 |
| 417 | Ga0495585_0001506 | 3300046492 | Bacteria | 18152 |
| 418 | Ga0495596_0000171 | 3300046500 | Bacteria | 45024 |
| 419 | Ga0495596_0001194 | 3300046500 | Bacteria | 15178 |
| 420 | Ga0495596_0005301 | 3300046500 | Bacteria | 6111 |
| 421 | Ga0495607_0006779 | 3300046501 | Bacteria | 8001 |
| 422 | Ga0495583_0000069 | 3300046506 | Bacteria | 186863 |
| 423 | Ga0495583_0000184 | 3300046506 | Bacteria | 105978 |
| 424 | Ga0495583_0000401 | 3300046506 | Bacteria | 65722 |
| 425 | Ga0495583_0034485 | 3300046506 | Bacteria | 2423 |
| 426 | Ga0495583_0043219 | 3300046506 | Bacteria | 2099 |
| 427 | Ga0495606_0008550 | 3300046507 | Bacteria | 8864 |
| 428 | Ga0495606_0089105 | 3300046507 | Bacteria | 1901 |
| 429 | Ga0495606_0255917 | 3300046507 | Bacteria | 969 |
| 430 | Ga0495610_0000013 | 3300046512 | Bacteria | 465872 |
| 431 | Ga0495610_0000018 | 3300046512 | Bacteria | 355044 |
| 432 | Ga0495610_0000101 | 3300046512 | Bacteria | 99012 |
| 433 | Ga0495610_0002633 | 3300046512 | Bacteria | 14848 |
| 434 | Ga0495610_0002639 | 3300046512 | Bacteria | 14830 |
| 435 | Ga0495610_0142206 | 3300046512 | Bacteria | 1031 |
| 436 | Ga0495616_0000270 | 3300046513 | Bacteria | 42085 |
| 437 | Ga0495616_0176222 | 3300046513 | Bacteria | 953 |
| 438 | Ga0495620_0033849 | 3300046515 | Bacteria | 2315 |
| 439 | Ga0495620_0039025 | 3300046515 | Bacteria | 2103 |
| 440 | Ga0495620_0045054 | 3300046515 | Bacteria | 1913 |
| 441 | Ga0495628_0062359 | 3300046516 | Bacteria | 2922 |
| 442 | Ga0495628_0345569 | 3300046516 | Bacteria | 1094 |
| 443 | Ga0495630_0172398 | 3300046517 | Bacteria | 1648 |
| 444 | Ga0495631_0052696 | 3300046518 | Bacteria | 1777 |
| 445 | Ga0495631_0099404 | 3300046518 | Bacteria | 1252 |
| 446 | Ga0495632_0001639 | 3300046519 | Bacteria | 18335 |
| 447 | Ga0495632_0001694 | 3300046519 | Bacteria | 18032 |
| 448 | Ga0495643_0000336 | 3300046522 | Bacteria | 64049 |
| 449 | Ga0495643_0027804 | 3300046522 | Bacteria | 3174 |
| 450 | Ga0495643_0030778 | 3300046522 | Bacteria | 2993 |
| 451 | Ga0495643_0034028 | 3300046522 | Bacteria | 2814 |
| 452 | Ga0495643_0044552 | 3300046522 | Bacteria | 2411 |
| 453 | Ga0495643_0114051 | 3300046522 | Bacteria | 1371 |
| 454 | Ga0495648_0000026 | 3300046524 | Bacteria | 232162 |
| 455 | Ga0495648_0000111 | 3300046524 | Bacteria | 100648 |
| 456 | Ga0495648_0048047 | 3300046524 | Bacteria | 2631 |
| 457 | Ga0495648_0049703 | 3300046524 | Bacteria | 2568 |
| 458 | Ga0495648_0067184 | 3300046524 | Bacteria | 2098 |
| 459 | Ga0495663_0000757 | 3300046525 | Bacteria | 11087 |
| 460 | Ga0495663_0052964 | 3300046525 | Bacteria | 1261 |
| 461 | Ga0495666_0004701 | 3300046526 | Bacteria | 6904 |
| 462 | Ga0495642_0007084 | 3300046528 | Bacteria | 4302 |
| 463 | Ga0495642_0106553 | 3300046528 | Bacteria | 1196 |
| 464 | Ga0495652_0051478 | 3300046529 | Bacteria | 3517 |
| 465 | Ga0495652_0156210 | 3300046529 | Bacteria | 1776 |
| 466 | Ga0495654_0000018 | 3300046530 | Bacteria | 293124 |
| 467 | Ga0495640_0066032 | 3300046533 | Bacteria | 2441 |
| 468 | Ga0495609_0074614 | 3300046538 | Bacteria | 1487 |
| 469 | Ga0495597_0002618 | 3300046542 | Bacteria | 11199 |
| 470 | Ga0495597_0024054 | 3300046542 | Bacteria | 2813 |
| 471 | Ga0495597_0105938 | 3300046542 | Bacteria | 1182 |
| 472 | Ga0495645_0378934 | 3300046543 | Bacteria | 905 |
| 473 | Ga0495622_0003300 | 3300046557 | Bacteria | 7628 |
| 474 | Ga0495622_0047054 | 3300046557 | Bacteria | 2005 |
| 475 | Ga0495622_0097704 | 3300046557 | Bacteria | 1347 |
| 476 | Ga0495633_0003416 | 3300046558 | Bacteria | 10577 |
| 477 | Ga0495633_0004092 | 3300046558 | Bacteria | 9409 |
| 478 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 479 | Ga0495668_0000325 | 3300046616 | Bacteria | 65404 |
| 480 | Ga0495668_0031231 | 3300046616 | Bacteria | 3003 |
| 481 | Ga0495668_0117517 | 3300046616 | Bacteria | 1454 |
| 482 | Ga0495668_0143886 | 3300046616 | Bacteria | 1305 |
| 483 | Ga0495668_0167114 | 3300046616 | Bacteria | 1205 |
| 484 | Ga0495611_0020290 | 3300046648 | Bacteria | 2860 |
| 485 | Ga0495611_0104509 | 3300046648 | Bacteria | 1317 |
| 486 | Ga0495625_0000011 | 3300046660 | Bacteria | 377120 |
| 487 | Ga0495625_0002609 | 3300046660 | Bacteria | 19289 |
| 488 | Ga0495625_0002714 | 3300046660 | Bacteria | 18781 |
| 489 | Ga0495625_0004251 | 3300046660 | Bacteria | 13639 |
| 490 | Ga0495625_0018596 | 3300046660 | Bacteria | 5417 |
| 491 | Ga0495625_0038770 | 3300046660 | Bacteria | 3484 |
| 492 | Ga0495625_0038875 | 3300046660 | Bacteria | 3478 |
| 493 | Ga0495625_0043927 | 3300046660 | Bacteria | 3238 |
| 494 | Ga0495625_0055530 | 3300046660 | Bacteria | 2824 |
| 495 | Ga0495661_0007978 | 3300046665 | Bacteria | 7351 |
| 496 | Ga0495661_0012689 | 3300046665 | Bacteria | 5688 |
| 497 | Ga0495661_0066993 | 3300046665 | Bacteria | 2111 |
| 498 | Ga0495661_0119451 | 3300046665 | Bacteria | 1458 |
| 499 | Ga0495599_0013711 | 3300046678 | Bacteria | 5011 |
| 500 | Ga0495599_0040463 | 3300046678 | Bacteria | 2927 |
| 501 | Ga0495646_0055361 | 3300046680 | Bacteria | 2382 |
| 502 | Ga0495669_0001020 | 3300046684 | Bacteria | 11676 |
| 503 | Ga0495669_0002307 | 3300046684 | Bacteria | 7813 |
| 504 | Ga0495613_0004913 | 3300046689 | Bacteria | 10050 |
| 505 | Ga0495671_0000050 | 3300046692 | Bacteria | 141936 |
| 506 | Ga0495671_0021372 | 3300046692 | Bacteria | 3401 |
| 507 | Ga0495649_0026157 | 3300046694 | Bacteria | 3248 |
| 508 | Ga0495589_0008502 | 3300046794 | Bacteria | 5354 |
| 509 | Ga0495604_0020344 | 3300047317 | Bacteria | 5302 |
| 510 | Ga0495674_0034286 | 3300047319 | Bacteria | 4591 |
| 511 | Ga0495672_0004230 | 3300047320 | Bacteria | 11857 |
| 512 | Ga0495672_0004815 | 3300047320 | Bacteria | 10884 |
| 513 | Ga0495683_0012468 | 3300047323 | Bacteria | 4459 |
| 514 | Ga0495683_0016369 | 3300047323 | Bacteria | 3853 |
| 515 | Ga0495683_0030145 | 3300047323 | Bacteria | 2768 |
| 516 | Ga0495687_001092 | 3300047443 | Bacteria | 26544 |
| 517 | Ga0495687_001844 | 3300047443 | Bacteria | 18546 |
| 518 | Ga0495687_007250 | 3300047443 | Bacteria | 6582 |
| 519 | Ga0495687_018058 | 3300047443 | Bacteria | 3498 |
| 520 | Ga0495675_0189287 | 3300047444 | Bacteria | 1257 |
| 521 | Ga0495677_0053767 | 3300047445 | Bacteria | 1485 |
| 522 | Ga0495673_0000056 | 3300047469 | Bacteria | 245918 |
| 523 | Ga0495673_0000125 | 3300047469 | Bacteria | 141937 |
| 524 | Ga0495673_0020024 | 3300047469 | Bacteria | 3339 |
| 525 | Ga0495681_0000036 | 3300047470 | Bacteria | 124207 |
| 526 | Ga0495681_0000174 | 3300047470 | Bacteria | 53932 |
| 527 | Ga0495681_0005853 | 3300047470 | Bacteria | 8166 |
| 528 | Ga0495681_0006465 | 3300047470 | Bacteria | 7698 |
| 529 | Ga0495686_0000057 | 3300047472 | Bacteria | 250088 |
| 530 | Ga0495686_0000808 | 3300047472 | Bacteria | 40566 |
| 531 | Ga0495686_0000944 | 3300047472 | Bacteria | 36054 |
| 532 | Ga0495686_0002660 | 3300047472 | Bacteria | 16456 |
| 533 | Ga0495686_0003856 | 3300047472 | Bacteria | 12676 |
| 534 | Ga0495686_0016945 | 3300047472 | Bacteria | 4922 |
| 535 | Ga0495686_0027554 | 3300047472 | Bacteria | 3708 |
| 536 | Ga0495686_0028511 | 3300047472 | Bacteria | 3636 |
| 537 | Ga0495686_0036965 | 3300047472 | Bacteria | 3131 |
| 538 | Ga0495602_0025013 | 3300048088 | Bacteria | 5785 |
| 539 | Ga0495602_0392296 | 3300048088 | Bacteria | 992 |
| 540 | Ga0495615_0000006 | 3300048090 | Bacteria | 96050 |
| 541 | Ga0495615_0000009 | 3300048090 | Bacteria | 76727 |
| 542 | Ga0495615_0000022 | 3300048090 | Bacteria | 51294 |
| 543 | Ga0495615_0000056 | 3300048090 | Bacteria | 35338 |
| 544 | Ga0495626_0034390 | 3300048091 | Bacteria | 2424 |
| 545 | Ga0495626_0092043 | 3300048091 | Bacteria | 1332 |
| 546 | Ga0496100_0004363 | 3300048903 | Bacteria | 7490 |
| 547 | Ga0496100_0580091 | 3300048903 | Bacteria | 869 |
| 548 | Ga0496101_0000647 | 3300048904 | Bacteria | 21009 |
| 549 | Ga0496101_0414580 | 3300048904 | Bacteria | 1061 |
| 550 | Ga0496102_0000067 | 3300048905 | Bacteria | 156790 |
| 551 | Ga0496102_0008560 | 3300048905 | Bacteria | 8774 |
| 552 | Ga0496102_0052303 | 3300048905 | Bacteria | 3721 |
| 553 | Ga0496102_0568457 | 3300048905 | Bacteria | 1057 |
| 554 | Ga0496103_0002600 | 3300048906 | Bacteria | 11306 |
| 555 | Ga0496103_0276162 | 3300048906 | Bacteria | 1081 |
| 556 | Ga0496104_0016161 | 3300048907 | Bacteria | 6773 |
| 557 | Ga0496104_0561403 | 3300048907 | Bacteria | 1052 |
| 558 | Ga0496105_0000662 | 3300048908 | Bacteria | 23132 |
| 559 | Ga0496106_0059203 | 3300048909 | Bacteria | 2901 |
| 560 | Ga0496106_0068882 | 3300048909 | Bacteria | 2700 |
| 561 | Ga0496106_0084941 | 3300048909 | Bacteria | 2436 |
| 562 | Ga0496107_0000136 | 3300048910 | Bacteria | 36033 |
| 563 | Ga0496107_0000515 | 3300048910 | Bacteria | 21514 |
| 564 | Ga0496107_0018371 | 3300048910 | Bacteria | 4924 |
| 565 | Ga0496110_0058225 | 3300048913 | Bacteria | 3403 |
| 566 | Ga0496111_0002307 | 3300048914 | Bacteria | 11473 |
| 567 | Ga0496112_0697702 | 3300048915 | Bacteria | 943 |
| 568 | Ga0496113_0064418 | 3300048916 | Bacteria | 2771 |
| 569 | Ga0496113_0492592 | 3300048916 | Bacteria | 984 |
| 570 | Ga0496114_0040025 | 3300048917 | Bacteria | 3879 |
| 571 | Ga0496115_0000056 | 3300048918 | Bacteria | 104434 |
| 572 | Ga0496116_0000545 | 3300048919 | Bacteria | 50407 |
| 573 | Ga0496116_0006376 | 3300048919 | Bacteria | 10721 |
| 574 | Ga0496116_0036283 | 3300048919 | Bacteria | 3452 |
| 575 | Ga0496117_0000114 | 3300048920 | Bacteria | 180658 |
| 576 | Ga0496117_0012932 | 3300048920 | Bacteria | 7314 |
| 577 | Ga0496117_0013436 | 3300048920 | Bacteria | 7145 |
| 578 | Ga0496117_0026934 | 3300048920 | Bacteria | 4489 |
| 579 | Ga0496117_0062312 | 3300048920 | Bacteria | 2556 |
| 580 | Ga0496118_0000082 | 3300048921 | Bacteria | 185820 |
| 581 | Ga0496118_0000439 | 3300048921 | Bacteria | 68828 |
| 582 | Ga0496118_0001437 | 3300048921 | Bacteria | 35866 |
| 583 | Ga0496118_0004598 | 3300048921 | Bacteria | 16223 |
| 584 | Ga0496118_0014789 | 3300048921 | Bacteria | 7279 |
| 585 | Ga0496118_0061924 | 3300048921 | Bacteria | 2766 |
| 586 | Ga0496119_0002162 | 3300048922 | Bacteria | 22091 |
| 587 | Ga0496119_0019495 | 3300048922 | Bacteria | 4993 |
| 588 | Ga0496120_0006533 | 3300048923 | Bacteria | 8927 |
| 589 | Ga0496120_0048673 | 3300048923 | Bacteria | 2438 |
| 590 | Ga0496121_0000021 | 3300048924 | Bacteria | 478544 |
| 591 | Ga0496121_0000190 | 3300048924 | Bacteria | 136607 |
| 592 | Ga0496121_0000344 | 3300048924 | Bacteria | 96865 |
| 593 | Ga0496121_0000721 | 3300048924 | Bacteria | 61207 |
| 594 | Ga0496121_0002392 | 3300048924 | Bacteria | 28763 |
| 595 | Ga0496121_0009736 | 3300048924 | Bacteria | 10996 |
| 596 | Ga0496121_0028182 | 3300048924 | Bacteria | 5234 |
| 597 | Ga0496121_0032836 | 3300048924 | Bacteria | 4709 |
| 598 | Ga0496121_0034383 | 3300048924 | Bacteria | 4562 |
| 599 | Ga0496121_0230957 | 3300048924 | Bacteria | 1296 |
| 600 | Ga0496122_0000462 | 3300048925 | Bacteria | 84546 |
| 601 | Ga0496122_0001343 | 3300048925 | Bacteria | 40125 |
| 602 | Ga0496122_0004042 | 3300048925 | Bacteria | 18642 |
| 603 | Ga0496122_0004742 | 3300048925 | Bacteria | 16663 |
| 604 | Ga0496122_0008010 | 3300048925 | Bacteria | 11540 |
| 605 | Ga0496122_0010005 | 3300048925 | Bacteria | 9870 |
| 606 | Ga0496122_0021500 | 3300048925 | Bacteria | 5774 |
| 607 | Ga0496122_0031248 | 3300048925 | Bacteria | 4437 |
| 608 | Ga0496122_0078878 | 3300048925 | Bacteria | 2304 |
| 609 | Ga0496123_0000048 | 3300048926 | Bacteria | 244152 |
| 610 | Ga0496123_0000300 | 3300048926 | Bacteria | 96475 |
| 611 | Ga0496123_0000643 | 3300048926 | Bacteria | 58206 |
| 612 | Ga0496123_0002078 | 3300048926 | Bacteria | 25781 |
| 613 | Ga0496123_0013351 | 3300048926 | Bacteria | 6905 |
| 614 | Ga0496123_0017198 | 3300048926 | Bacteria | 5833 |
| 615 | Ga0496123_0025200 | 3300048926 | Bacteria | 4491 |
| 616 | Ga0496123_0065530 | 3300048926 | Bacteria | 2308 |
| 617 | Ga0496123_0143732 | 3300048926 | Bacteria | 1299 |
| 618 | Ga0496124_0000068 | 3300048927 | Bacteria | 221819 |
| 619 | Ga0496124_0003193 | 3300048927 | Bacteria | 20246 |
| 620 | Ga0496124_0006400 | 3300048927 | Bacteria | 12839 |
| 621 | Ga0496124_0019388 | 3300048927 | Bacteria | 6332 |
| 622 | Ga0496124_0056514 | 3300048927 | Bacteria | 3309 |
| 623 | Ga0496124_0061695 | 3300048927 | Bacteria | 3141 |
| 624 | Ga0496124_0119858 | 3300048927 | Bacteria | 2104 |
| 625 | Ga0496124_0175482 | 3300048927 | Bacteria | 1655 |
| 626 | Ga0496125_0000488 | 3300048928 | Bacteria | 69299 |
| 627 | Ga0496125_0002303 | 3300048928 | Bacteria | 25208 |
| 628 | Ga0496125_0004268 | 3300048928 | Bacteria | 16627 |
| 629 | Ga0496125_0012254 | 3300048928 | Bacteria | 8525 |
| 630 | Ga0496125_0035284 | 3300048928 | Bacteria | 4391 |
| 631 | Ga0496125_0070822 | 3300048928 | Bacteria | 2727 |
| 632 | Ga0496125_0102467 | 3300048928 | Bacteria | 2103 |
| 633 | Ga0496125_0159962 | 3300048928 | Bacteria | 1531 |
| 634 | Ga0496125_0230986 | 3300048928 | Bacteria | 1183 |
| 635 | Ga0496126_0000157 | 3300048929 | Bacteria | 156203 |
| 636 | Ga0496126_0000503 | 3300048929 | Bacteria | 76786 |
| 637 | Ga0496126_0011995 | 3300048929 | Bacteria | 8906 |
| 638 | Ga0496126_0018537 | 3300048929 | Bacteria | 6891 |
| 639 | Ga0496126_0027270 | 3300048929 | Bacteria | 5458 |
| 640 | Ga0496126_0265064 | 3300048929 | Bacteria | 1427 |
| 641 | Ga0495682_0028086 | 3300049460 | Bacteria | 2086 |
| 642 | Ga0501292_000003 | 3300049515 | Bacteria | 161908 |
| 643 | Ga0501031_0011456 | 3300049568 | Bacteria | 5777 |
| 644 | Ga0501032_0010834 | 3300049569 | Bacteria | 6562 |
| 645 | Ga0501032_0027261 | 3300049569 | Bacteria | 3926 |
| 646 | Ga0501033_0005862 | 3300049570 | Bacteria | 9657 |
| 647 | Ga0501033_0029586 | 3300049570 | Bacteria | 4116 |
| 648 | Ga0501033_0064704 | 3300049570 | Bacteria | 2691 |
| 649 | Ga0501033_0131204 | 3300049570 | Bacteria | 1815 |
| 650 | Ga0501034_0000215 | 3300049571 | Bacteria | 110067 |
| 651 | Ga0501034_0028660 | 3300049571 | Bacteria | 5665 |
| 652 | Ga0501034_0092516 | 3300049571 | Bacteria | 3021 |
| 653 | Ga0501034_0186316 | 3300049571 | Bacteria | 2039 |
| 654 | Ga0501034_0473074 | 3300049571 | Bacteria | 1169 |
| 655 | Ga0501038_0122898 | 3300049574 | Bacteria | 2139 |
| 656 | Ga0501039_0266539 | 3300049575 | Bacteria | 1346 |
| 657 | Ga0501043_0210689 | 3300049579 | Bacteria | 1506 |
| 658 | Ga0501043_0309235 | 3300049579 | Bacteria | 1206 |
| 659 | Ga0501047_0000307 | 3300049581 | Bacteria | 56284 |
| 660 | Ga0501047_0001806 | 3300049581 | Bacteria | 20665 |
| 661 | Ga0501047_0010908 | 3300049581 | Bacteria | 8593 |
| 662 | Ga0501047_0274153 | 3300049581 | Bacteria | 1533 |
| 663 | Ga0501048_0063616 | 3300049582 | Bacteria | 2609 |
| 664 | Ga0501048_0239907 | 3300049582 | Bacteria | 1286 |
| 665 | Ga0501073_0000140 | 3300049589 | Bacteria | 47436 |
| 666 | Ga0501223_000007 | 3300049663 | Bacteria | 132601 |
| 667 | Ga0501238_000513 | 3300049671 | Bacteria | 4442 |
| 668 | Ga0501246_000376 | 3300049676 | Bacteria | 3180 |
| 669 | Ga0501249_000267 | 3300049679 | Bacteria | 14967 |
| 670 | Ga0501249_000588 | 3300049679 | Bacteria | 8509 |
| 671 | Ga0501225_0000010 | 3300049705 | Bacteria | 82395 |
| 672 | Ga0501080_0018648 | 3300049742 | Bacteria | 6421 |
| 673 | Ga0501083_0079772 | 3300049744 | Bacteria | 2170 |
| 674 | Ga0501262_002548 | 3300049759 | Bacteria | 2059 |
| 675 | Ga0501279_000009 | 3300049775 | Bacteria | 117146 |
| 676 | Ga0501035_0004268 | 3300049822 | Bacteria | 13569 |
| 677 | Ga0501035_0092439 | 3300049822 | Bacteria | 2662 |
| 678 | Ga0501035_0102217 | 3300049822 | Bacteria | 2514 |
| 679 | Ga0501044_0000109 | 3300049823 | Bacteria | 100674 |
| 680 | Ga0501044_0000453 | 3300049823 | Bacteria | 49990 |
| 681 | Ga0501044_0043037 | 3300049823 | Bacteria | 4693 |
| 682 | Ga0501044_0105330 | 3300049823 | Bacteria | 2833 |
| 683 | Ga0501044_0672560 | 3300049823 | Bacteria | 923 |
| 684 | nmdc:mga03n38_68_c1 | 3300050490 | Bacteria | 21917 |
| 685 | nmdc:mga03n38_71089_c1 | 3300050490 | Bacteria | 1611 |
| 686 | nmdc:mga00v17_91_c1 | 3300050491 | Bacteria | 53223 |
| 687 | nmdc:mga00v17_9_c1 | 3300050491 | Bacteria | 138453 |
| 688 | nmdc:mga0yw44_452865_c1 | 3300050492 | Bacteria | 870 |
| 689 | nmdc:mga0yw44_567_c1 | 3300050492 | Bacteria | 13324 |
| 690 | nmdc:mga0yw44_727_c2 | 3300050492 | Bacteria | 11571 |
| 691 | nmdc:mga0k408_156526_c1 | 3300050493 | Bacteria | 1041 |
| 692 | nmdc:mga0k408_28620_c1 | 3300050493 | Bacteria | 3168 |
| 693 | nmdc:mga0k408_415_c1 | 3300050493 | Bacteria | 23295 |
| 694 | nmdc:mga0k408_59038_c1 | 3300050493 | Bacteria | 2228 |
| 695 | nmdc:mga0k408_80036_c1 | 3300050493 | Bacteria | 1912 |
| 696 | nmdc:mga06z11_121710_c1 | 3300050494 | Bacteria | 1456 |
| 697 | nmdc:mga06z11_3_c1 | 3300050494 | Bacteria | 138457 |
| 698 | nmdc:mga06z11_41_c1 | 3300050494 | Bacteria | 53112 |
| 699 | nmdc:mga06z11_48_c1 | 3300050494 | Bacteria | 51095 |
| 700 | nmdc:mga06z11_60931_c1 | 3300050494 | Bacteria | 1966 |
| 701 | nmdc:mga06z11_71_c1 | 3300050494 | Bacteria | 42338 |
| 702 | nmdc:mga04h51_27_c1 | 3300050495 | Bacteria | 53116 |
| 703 | nmdc:mga04h51_43_c1 | 3300050495 | Bacteria | 42355 |
| 704 | nmdc:mga04h51_57_c1 | 3300050495 | Bacteria | 35214 |
| 705 | nmdc:mga04h51_5_c1 | 3300050495 | Bacteria | 138278 |
| 706 | nmdc:mga07m45_18_c1 | 3300050496 | Bacteria | 138462 |
| 707 | nmdc:mga07m45_22856_c1 | 3300050496 | Bacteria | 3415 |
| 708 | nmdc:mga07m45_26825_c1 | 3300050496 | Bacteria | 3168 |
| 709 | nmdc:mga07m45_2787_c1 | 3300050496 | Bacteria | 8259 |
| 710 | nmdc:mga09592_163515_c1 | 3300050508 | Bacteria | 1923 |
| 711 | nmdc:mga0sz30_271_c1 | 3300050516 | Bacteria | 19815 |
| 712 | nmdc:mga0sz30_3064_c1 | 3300050516 | Bacteria | 5987 |
| 713 | nmdc:mga0sz30_34_c1 | 3300050516 | Bacteria | 53573 |
| 714 | nmdc:mga0sz30_397_c1 | 3300050516 | Bacteria | 16569 |
| 715 | Ga0495601_0046860 | 3300053077 | Bacteria | 2721 |
| 716 | Ga0500610_0000206 | 3300053079 | Bacteria | 18104 |
| 717 | Ga0500635_0000154 | 3300053080 | Bacteria | 38155 |
| 718 | Ga0495619_0066359 | 3300053085 | Bacteria | 2408 |
| 719 | Ga0500643_000203 | 3300053087 | Bacteria | 56433 |
| 720 | Ga0500643_030347 | 3300053087 | Bacteria | 1656 |
| 721 | Ga0500646_0007574 | 3300053090 | Bacteria | 2775 |
| 722 | Ga0500647_0014019 | 3300053091 | Bacteria | 3636 |
| 723 | Ga0500651_0000062 | 3300053093 | Bacteria | 71042 |
| 724 | Ga0500651_0004291 | 3300053093 | Bacteria | 7964 |
| 725 | Ga0500566_0000824 | 3300053094 | Bacteria | 17698 |
| 726 | Ga0500566_0022100 | 3300053094 | Bacteria | 3739 |
| 727 | Ga0500566_0076541 | 3300053094 | Bacteria | 1870 |
| 728 | Ga0500566_0082680 | 3300053094 | Bacteria | 1784 |
| 729 | Ga0500641_0001855 | 3300053096 | Bacteria | 7498 |
| 730 | Ga0500650_0170650 | 3300053098 | Bacteria | 1000 |
| 731 | Ga0500654_078918 | 3300053099 | Bacteria | 1549 |
| 732 | Ga0500555_000448 | 3300053103 | Bacteria | 17084 |
| 733 | Ga0500592_016490 | 3300053116 | Bacteria | 1185 |
| 734 | Ga0500592_019210 | 3300053116 | Bacteria | 1097 |
| 735 | Ga0500595_002134 | 3300053119 | Bacteria | 10068 |
| 736 | Ga0500595_002188 | 3300053119 | Bacteria | 9926 |
| 737 | Ga0500595_004324 | 3300053119 | Bacteria | 6398 |
| 738 | Ga0500595_021474 | 3300053119 | Bacteria | 2303 |
| 739 | Ga0500607_000293 | 3300053121 | Bacteria | 47399 |
| 740 | Ga0500608_000135 | 3300053122 | Bacteria | 30072 |
| 741 | Ga0500608_000353 | 3300053122 | Bacteria | 17755 |
| 742 | Ga0500608_002030 | 3300053122 | Bacteria | 7258 |
| 743 | Ga0500614_000155 | 3300053123 | Bacteria | 17375 |
| 744 | Ga0500614_004939 | 3300053123 | Bacteria | 2804 |
| 745 | Ga0500614_023077 | 3300053123 | Bacteria | 1459 |
| 746 | Ga0500618_000178 | 3300053125 | Bacteria | 52653 |
| 747 | Ga0500618_000606 | 3300053125 | Bacteria | 21912 |
| 748 | Ga0500618_000707 | 3300053125 | Bacteria | 19471 |
| 749 | Ga0500618_006287 | 3300053125 | Bacteria | 3506 |
| 750 | Ga0500642_0000471 | 3300053130 | Bacteria | 12520 |
| 751 | Ga0500642_0031645 | 3300053130 | Bacteria | 2212 |
| 752 | Ga0500655_000055 | 3300053133 | Bacteria | 30746 |
| 753 | Ga0500655_017095 | 3300053133 | Bacteria | 1339 |
| 754 | Ga0500559_0000031 | 3300053136 | Bacteria | 114782 |
| 755 | Ga0500559_0000879 | 3300053136 | Bacteria | 19217 |
| 756 | Ga0500559_0000984 | 3300053136 | Bacteria | 17768 |
| 757 | Ga0500559_0003462 | 3300053136 | Bacteria | 7753 |
| 758 | Ga0500559_0008942 | 3300053136 | Bacteria | 4359 |
| 759 | Ga0500559_0021988 | 3300053136 | Bacteria | 2705 |
| 760 | Ga0500559_0220483 | 3300053136 | Bacteria | 894 |
| 761 | Ga0500568_0069966 | 3300053139 | Bacteria | 1345 |
| 762 | Ga0500573_0047098 | 3300053140 | Bacteria | 2484 |
| 763 | Ga0500590_000433 | 3300053148 | Bacteria | 14077 |
| 764 | Ga0500603_000737 | 3300053150 | Bacteria | 7972 |
| 765 | Ga0500604_0000520 | 3300053151 | Bacteria | 10639 |
| 766 | Ga0500622_0003059 | 3300053156 | Bacteria | 11547 |
| 767 | Ga0500622_0005037 | 3300053156 | Bacteria | 8048 |
| 768 | Ga0500622_0005173 | 3300053156 | Bacteria | 7907 |
| 769 | Ga0500622_0005293 | 3300053156 | Bacteria | 7784 |
| 770 | Ga0500624_000002 | 3300053157 | Bacteria | 257900 |
| 771 | Ga0500627_0000020 | 3300053158 | Bacteria | 109977 |
| 772 | Ga0500639_101614 | 3300053163 | Bacteria | 1414 |
| 773 | Ga0500636_0001943 | 3300053177 | Bacteria | 11357 |
| 774 | Ga0500637_0004224 | 3300053178 | Bacteria | 6780 |
| 775 | Ga0500570_006654 | 3300053724 | Bacteria | 6292 |
| 776 | Ga0500625_000007 | 3300053729 | Bacteria | 177638 |
| 777 | Ga0500645_000585 | 3300053730 | Bacteria | 23518 |
| 778 | Ga0500645_001694 | 3300053730 | Bacteria | 10762 |
| 779 | Ga0500645_002181 | 3300053730 | Bacteria | 8957 |
| 780 | Ga0500645_014440 | 3300053730 | Bacteria | 2515 |
| 781 | Ga0501084_0021531 | 3300054114 | Bacteria | 5374 |
| 782 | Ga0500661_000033 | 3300055283 | Bacteria | 20509 |
| 783 | Ga0501082_0043906 | 3300060353 | Bacteria | 3856 |
| 784 | Ga0530510_0211114 | 3300061734 | Bacteria | 1442 |
| 785 | 2509374508 | 2509276019 | Bacteria | 6802256 |
| 786 | 2510306598 | 2510065057 | Bacteria | 6649661 |
| 787 | 2510842739 | 2510461069 | Bacteria | 5505000 |
| 788 | 2511124402 | 2510917020 | Bacteria | 5657507 |
| 789 | 2511500961 | 2511231052 | Bacteria | 6974333 |
| 790 | 2512532376 | 2512047086 | Bacteria | 6850303 |
| 791 | 2512974772 | 2512875026 | Bacteria | 6861065 |
| 792 | 2513583501 | 2513237086 | Bacteria | 7265287 |
| 793 | 2513603894 | 2513237089 | Bacteria | 6553624 |
| 794 | 2513617650 | 2513237091 | Bacteria | 6900273 |
| 795 | 2513882714 | 2513237140 | Bacteria | 7076289 |
| 796 | 2513905259 | 2513237143 | Bacteria | 6664116 |
| 797 | 2513914506 | 2513237144 | Bacteria | 7530820 |
| 798 | 2513928245 | 2513237146 | Bacteria | 7166346 |
| 799 | 2513957704 | 2513237150 | Bacteria | 6553639 |
| 800 | 2513984799 | 2513237156 | Bacteria | 6402557 |
| 801 | 2513999503 | 2513237159 | Bacteria | 6810126 |
| 802 | 2514004151 | 2513237160 | Bacteria | 6650282 |
| 803 | 2514045559 | 2513237165 | Bacteria | 6771773 |
| 804 | 2515610215 | 2515154107 | Bacteria | 6795637 |
| 805 | 2516892242 | 2516653046 | Bacteria | 6989037 |
| 806 | 2517567419 | 2517487022 | Bacteria | 7227575 |
| 807 | 2524454505 | 2524023207 | Bacteria | 6813453 |
| 808 | 2524614013 | 2524023250 | Bacteria | 5457705 |
| 809 | 2551676421 | 2551306084 | Bacteria | 8942552 |
| 810 | 2551687222 | 2551306085 | Bacteria | 7347181 |
| 811 | 2551694402 | 2551306086 | Bacteria | 6843938 |
| 812 | 2551703175 | 2551306087 | Bacteria | 7351905 |
| 813 | 2551740391 | 2551306093 | Bacteria | 7064773 |
| 814 | 2558863535 | 2558860100 | Bacteria | 8458965 |
| 815 | 2585259935 | 2582581305 | Bacteria | 4895574 |
| 816 | 2585266237 | 2582581306 | Bacteria | 6450535 |
| 817 | 2585387239 | 2582581865 | Bacteria | 6644329 |
| 818 | 2599416862 | 2599185170 | Bacteria | 7295545 |
| 819 | 2600200418 | 2599185354 | Bacteria | 4398675 |
| 820 | 2643729558 | 2643221541 | Bacteria | 5498788 |
| 821 | 2643832609 | 2643221563 | Bacteria | 4726935 |
| 822 | 2643834711 | 2643221563 | Bacteria | 4726935 |
| 823 | 2643926097 | 2643221583 | Bacteria | 5218014 |
| 824 | 2643928721 | 2643221584 | Bacteria | 5511711 |
| 825 | 2644001519 | 2643221598 | Bacteria | 4578346 |
| 826 | 2644040957 | 2643221605 | Bacteria | 4772303 |
| 827 | 2644043915 | 2643221606 | Bacteria | 5588032 |
| 828 | 2644053596 | 2643221608 | Bacteria | 4724829 |
| 829 | 2644055638 | 2643221608 | Bacteria | 4724829 |
| 830 | 2644087198 | 2643221614 | Bacteria | 4260023 |
| 831 | 2644342151 | 2643221661 | Bacteria | 4267604 |
| 832 | 2644368437 | 2643221666 | Bacteria | 4265935 |
| 833 | 2644392386 | 2643221671 | Bacteria | 5496681 |
| 834 | 2687583756 | 2687453130 | Bacteria | 4227172 |
| 835 | 2739649610 | 2739367664 | Bacteria | 4114334 |
| 836 | 2739652359 | 2739367664 | Bacteria | 4114334 |
| 837 | 2740028083 | 2739367865 | Bacteria | 4114482 |
| 838 | 2740030833 | 2739367865 | Bacteria | 4114482 |
| 839 | 2753767250 | 2751185897 | Bacteria | 5322941 |
| 840 | 2778126862 | 2775507255 | Bacteria | 3945731 |
| 841 | 2792458920 | 2791355048 | Bacteria | 5832535 |
| 842 | 2792462237 | 2791355048 | Bacteria | 5832535 |
| 843 | 2792462246 | 2791355048 | Bacteria | 5832535 |
| 844 | 2802725820 | 2802428859 | Bacteria | 6667919 |
| 845 | 2802731472 | 2802428860 | Bacteria | 6525526 |
| 846 | 2802736337 | 2802428861 | Bacteria | 6534206 |
| 847 | 2802750099 | 2802428863 | Bacteria | 6410669 |
| 848 | 2809064532 | 2808606401 | Bacteria | 4586670 |
| 849 | 2809080557 | 2808606404 | Bacteria | 4652788 |
| 850 | 2809084921 | 2808606405 | Bacteria | 4586632 |
| 851 | 2819713795 | 2818991466 | Bacteria | 4748179 |
| 852 | 2830078833 | 2830075706 | Bacteria | 3855215 |
| 853 | 2838041808 | 2838035591 | Bacteria | 7166484 |
| 854 | 2838661187 | 2838661181 | Bacteria | 7385261 |
| 855 | 2841915630 | 2841911363 | Bacteria | 6173697 |
| 856 | 2841920832 | 2841917233 | Bacteria | 6173500 |
| 857 | 2842525297 | 2842521101 | Bacteria | 6569494 |
| 858 | 2843749076 | 2843744320 | Bacteria | 5659202 |
| 859 | 2848298222 | 2848297114 | Bacteria | 3608511 |
| 860 | 2849563761 | 2849560528 | Bacteria | 5393480 |
| 861 | 2849576443 | 2849573788 | Bacteria | 5421256 |
| 862 | 2850080426 | 2850079185 | Bacteria | 6848280 |
| 863 | 2851154939 | 2851153111 | Bacteria | 5542585 |
| 864 | 2852656984 | 2852653556 | Bacteria | 4050083 |
| 865 | 2852681249 | 2852680915 | Bacteria | 4100189 |
| 866 | 2855831312 | 2855825444 | Bacteria | 6785811 |
| 867 | 2855840437 | 2855839649 | Bacteria | 7135830 |
| 868 | 2857507213 | 2857504554 | Bacteria | 5369913 |
| 869 | 2858800965 | 2858800743 | Bacteria | 6603254 |
| 870 | 2874220725 | 2874220319 | Bacteria | 4594709 |
| 871 | 2876808932 | 2876808645 | Bacteria | 8824342 |
| 872 | 2879110278 | 2879110137 | Bacteria | 8907982 |
| 873 | 2880523668 | 2880518877 | Bacteria | 5012590 |
| 874 | 2884961984 | 2884960567 | Bacteria | 5437054 |
| 875 | 2885429103 | 2885427238 | Bacteria | 2291351 |
| 876 | 2885433150 | 2885429604 | Bacteria | 3642894 |
| 877 | 2894417496 | 2894414249 | Bacteria | 4405451 |
| 878 | 2898331475 | 2898329390 | Bacteria | 5168154 |
| 879 | 2915980963 | 2915980308 | Bacteria | 6624279 |
| 880 | 2915990905 | 2915986958 | Bacteria | 6739310 |
| 881 | 2915996271 | 2915993759 | Bacteria | 7016183 |
| 882 | 2916005749 | 2916000859 | Bacteria | 6865702 |
| 883 | 2916010916 | 2916007675 | Bacteria | 6898660 |
| 884 | 2916016553 | 2916014648 | Bacteria | 6946486 |
| 885 | 2916024752 | 2916021584 | Bacteria | 6854472 |
| 886 | 2916032191 | 2916028427 | Bacteria | 6748433 |
| 887 | 2916038154 | 2916035215 | Bacteria | 6755766 |
| 888 | 2916047918 | 2916041962 | Bacteria | 6820487 |
| 889 | 2916054361 | 2916048683 | Bacteria | 6543552 |
| 890 | 2916055368 | 2916055098 | Bacteria | 6758838 |
| 891 | 2916064490 | 2916061851 | Bacteria | 6737736 |
| 892 | 2916073448 | 2916068649 | Bacteria | 6943657 |
| 893 | 2916078178 | 2916076590 | Bacteria | 6596108 |
| 894 | 2917705606 | 2917699015 | Bacteria | 7043791 |
| 895 | 2919090755 | 2919089067 | Bacteria | 4560942 |
| 896 | 2919140636 | 2919138771 | Bacteria | 5281312 |
| 897 | 2919682705 | 2919679072 | Bacteria | 4629602 |
| 898 | 2919708895 | 2919704043 | Bacteria | 5560311 |
| 899 | 2919709460 | 2919709256 | Bacteria | 4318106 |
| 900 | 2921204930 | 2921201388 | Bacteria | 6926299 |
| 901 | 2921213520 | 2921208531 | Bacteria | 6745326 |
| 902 | 2921241612 | 2921237296 | Bacteria | 6876710 |
| 903 | 2921247526 | 2921244191 | Bacteria | 6568419 |
| 904 | 2921251303 | 2921250672 | Bacteria | 6677771 |
| 905 | 2921261599 | 2921257292 | Bacteria | 6808382 |
| 906 | 2921264245 | 2921263974 | Bacteria | 6864552 |
| 907 | 2921282758 | 2921282425 | Bacteria | 6826397 |
| 908 | 2921290140 | 2921289301 | Bacteria | 7316391 |
| 909 | 2921303397 | 2921296804 | Bacteria | 7176999 |
| 910 | 2924145610 | 2924144063 | Bacteria | 6883928 |
| 911 | 2924157260 | 2924150972 | Bacteria | 7169444 |
| 912 | 2924160563 | 2924158325 | Bacteria | 7188855 |
| 913 | 2924168161 | 2924165586 | Bacteria | 7260590 |
| 914 | 2924173408 | 2924172951 | Bacteria | 6749356 |
| 915 | 2924186324 | 2924179722 | Bacteria | 6843264 |
| 916 | 2924189502 | 2924186466 | Bacteria | 6876637 |
| 917 | 2924198238 | 2924193448 | Bacteria | 6955718 |
| 918 | 2924204069 | 2924200457 | Bacteria | 6757188 |
| 919 | 2924209899 | 2924207177 | Bacteria | 6917007 |
| 920 | 2924215186 | 2924214083 | Bacteria | 7080103 |
| 921 | 2924226239 | 2924221636 | Bacteria | 7113495 |
| 922 | 2924234924 | 2924228884 | Bacteria | 6633132 |
| 923 | 2928496739 | 2928496128 | Bacteria | 4631123 |
| 924 | 2928534089 | 2928531327 | Bacteria | 5101314 |
| 925 | 2928969803 | 2928968154 | Bacteria | 4633371 |
| 926 | 2931381641 | 2931380184 | Bacteria | 4455911 |
| 927 | 2933019853 | 2933016740 | Bacteria | 6355406 |
| 928 | 2937000765 | 2936996657 | Bacteria | 6298727 |
| 929 | 2937009524 | 2937002841 | Bacteria | 6934057 |
| 930 | 2937010876 | 2937009748 | Bacteria | 6746052 |
| 931 | 2937018995 | 2937016420 | Bacteria | 6782579 |
| 932 | 2937027935 | 2937023124 | Bacteria | 6815156 |
| 933 | 2937035893 | 2937029754 | Bacteria | 6424026 |
| 934 | 2937036359 | 2937036028 | Bacteria | 6846469 |
| 935 | 2937048979 | 2937042894 | Bacteria | 6741576 |
| 936 | 2937056294 | 2937049772 | Bacteria | 6757901 |
| 937 | 2937063363 | 2937056579 | Bacteria | 7107896 |
| 938 | 2937070635 | 2937063883 | Bacteria | 7199456 |
| 939 | 2937072169 | 2937071275 | Bacteria | 6984483 |
| 940 | 2937084741 | 2937078374 | Bacteria | 6610289 |
| 941 | 2937086888 | 2937084907 | Bacteria | 6618516 |
| 942 | 2937095579 | 2937091812 | Bacteria | 6979387 |
| 943 | 2937103645 | 2937098957 | Bacteria | 7249374 |
| 944 | 2937112552 | 2937106411 | Bacteria | 6947143 |
| 945 | 2937118184 | 2937113482 | Bacteria | 6505872 |
| 946 | 2937121175 | 2937119839 | Bacteria | 6597547 |
| 947 | 2937129809 | 2937126314 | Bacteria | 6771275 |
| 948 | 2939627491 | 2939626828 | Bacteria | 4695272 |
| 949 | 2941486494 | 2941485952 | Bacteria | 3591484 |
| 950 | 2941506422 | 2941499720 | Bacteria | 7599444 |
| 951 | 2946790953 | 2946787523 | Bacteria | 4366789 |
| 952 | 2957375998 | 2957375807 | Bacteria | 6425588 |
| 953 | 2957385079 | 2957382221 | Bacteria | 6737050 |
| 954 | 2957389142 | 2957388812 | Bacteria | 6778072 |
| 955 | 2957396396 | 2957395598 | Bacteria | 6822399 |
| 956 | 2957405458 | 2957402308 | Bacteria | 6741770 |
| 957 | 2957413261 | 2957408893 | Bacteria | 6558585 |
| 958 | 2957419188 | 2957415311 | Bacteria | 6991633 |
| 959 | 2957419369 | 2957415311 | Bacteria | 6991633 |
| 960 | 2957421810 | 2957415311 | Bacteria | 6991633 |
| 961 | 2957427723 | 2957422303 | Bacteria | 7172205 |
| 962 | 2957431101 | 2957430029 | Bacteria | 7022557 |
| 963 | 2957439587 | 2957437181 | Bacteria | 6568994 |
| 964 | 2957446664 | 2957443900 | Bacteria | 6869977 |
| 965 | 2957450504 | 2957443900 | Bacteria | 6869977 |
| 966 | 2957454180 | 2957450854 | Bacteria | 6765715 |
| 967 | 2957457613 | 2957457609 | Bacteria | 6967680 |
| 968 | 2957463576 | 2957457609 | Bacteria | 6967680 |
| 969 | 2957467758 | 2957464669 | Bacteria | 6568877 |
| 970 | 2957477800 | 2957471148 | Bacteria | 6797643 |
| 971 | 2957480638 | 2957478035 | Bacteria | 6756658 |
| 972 | 2957485800 | 2957484790 | Bacteria | 6703082 |
| 973 | 2957495984 | 2957491536 | Bacteria | 6695180 |
| 974 | 2957501026 | 2957498199 | Bacteria | 7126688 |
| 975 | 2957509582 | 2957505466 | Bacteria | 7253085 |
| 976 | 2960586634 | 2960584000 | Bacteria | 6864594 |
| 977 | 2960592469 | 2960591022 | Bacteria | 6622873 |
| 978 | 2960600585 | 2960597568 | Bacteria | 6550735 |
| 979 | 2960609485 | 2960603979 | Bacteria | 6898737 |
| 980 | 2960616721 | 2960610863 | Bacteria | 6691244 |
| 981 | 2960617693 | 2960617483 | Bacteria | 6727748 |
| 982 | 2960622637 | 2960617483 | Bacteria | 6727748 |
| 983 | 2960629778 | 2960624210 | Bacteria | 6875384 |
| 984 | 2960636146 | 2960631154 | Bacteria | 6732508 |
| 985 | 2960640197 | 2960637947 | Bacteria | 7296468 |
| 986 | 2960648738 | 2960645483 | Bacteria | 7211087 |
| 987 | 2960659496 | 2960652885 | Bacteria | 7083688 |
| 988 | 2960666394 | 2960660292 | Bacteria | 7041660 |
| 989 | 2960666751 | 2960660292 | Bacteria | 7041660 |
| 990 | 2960673915 | 2960667422 | Bacteria | 6763020 |
| 991 | 2960678822 | 2960674078 | Bacteria | 6609048 |
| 992 | 2960681106 | 2960680706 | Bacteria | 6624464 |
| 993 | 2960692069 | 2960687367 | Bacteria | 6535474 |
| 994 | 2960694106 | 2960693952 | Bacteria | 6749742 |
| 995 | 2961047490 | 2961047084 | Bacteria | 4594415 |
| 996 | 2964609722 | 2964607997 | Bacteria | 7101408 |
| 997 | 2964620711 | 2964615318 | Bacteria | 6809089 |
| 998 | 2964627797 | 2964621998 | Bacteria | 6834995 |
| 999 | 2964633127 | 2964628898 | Bacteria | 7083044 |
| 1000 | 2964637207 | 2964636051 | Bacteria | 7091832 |
| 1001 | 2964646037 | 2964643177 | Bacteria | 6820887 |
| 1002 | 2964646151 | 2964643177 | Bacteria | 6820887 |
| 1003 | 2964653093 | 2964649959 | Bacteria | 6675118 |
| 1004 | 2964661894 | 2964656573 | Bacteria | 7100150 |
| 1005 | 2964671696 | 2964670856 | Bacteria | 6851364 |
| 1006 | 2964678977 | 2964678106 | Bacteria | 6792020 |
| 1007 | 2964688098 | 2964685014 | Bacteria | 6839111 |
| 1008 | 2964695831 | 2964691889 | Bacteria | 6802758 |
| 1009 | 2964703605 | 2964698721 | Bacteria | 6765331 |
| 1010 | 2964706166 | 2964705432 | Bacteria | 7114648 |
| 1011 | 2964716289 | 2964712639 | Bacteria | 6695970 |
| 1012 | 2964726467 | 2964719344 | Bacteria | 7286602 |
| 1013 | 2967667361 | 2967664464 | Bacteria | 6948836 |
| 1014 | 2967672154 | 2967671571 | Bacteria | 7021409 |
| 1015 | 2967678915 | 2967678726 | Bacteria | 7264382 |
| 1016 | 2967692032 | 2967686174 | Bacteria | 6678622 |
| 1017 | 2967693235 | 2967693043 | Bacteria | 6804451 |
| 1018 | 2967704250 | 2967699805 | Bacteria | 6854538 |
| 1019 | 2967712938 | 2967706974 | Bacteria | 7186053 |
| 1020 | 2967716539 | 2967714385 | Bacteria | 7000047 |
| 1021 | 2967724576 | 2967721400 | Bacteria | 7073753 |
| 1022 | 2967731364 | 2967728569 | Bacteria | 6641507 |
| 1023 | 2967737590 | 2967735183 | Bacteria | 6827012 |
| 1024 | 2967740159 | 2967735183 | Bacteria | 6827012 |
| 1025 | 2967742200 | 2967742019 | Bacteria | 6794534 |
| 1026 | 2967747863 | 2967742019 | Bacteria | 6794534 |
| 1027 | 2967752115 | 2967748971 | Bacteria | 6733771 |
| 1028 | 2967757724 | 2967755722 | Bacteria | 6814706 |
| 1029 | 2967763809 | 2967762386 | Bacteria | 6923502 |
| 1030 | 2967770782 | 2967769361 | Bacteria | 6587838 |
| 1031 | 2967782167 | 2967775926 | Bacteria | 6738189 |
| 1032 | 2970026061 | 2970019648 | Bacteria | 7072033 |
| 1033 | 2970029635 | 2970026789 | Bacteria | 6785236 |
| 1034 | 2970037792 | 2970033650 | Bacteria | 7118744 |
| 1035 | 2970043295 | 2970040964 | Bacteria | 6731123 |
| 1036 | 2970049930 | 2970047711 | Bacteria | 7088379 |
| 1037 | 2970059618 | 2970054988 | Bacteria | 6611507 |
| 1038 | 2970065304 | 2970061556 | Bacteria | 7099761 |
| 1039 | 2970075673 | 2970068827 | Bacteria | 7123112 |
| 1040 | 2970076979 | 2970076120 | Bacteria | 6697332 |
| 1041 | 2970085658 | 2970082768 | Bacteria | 6183754 |
| 1042 | 2970093298 | 2970088815 | Bacteria | 6933825 |
| 1043 | 2970096805 | 2970095765 | Bacteria | 6936963 |
| 1044 | 2970108554 | 2970102677 | Bacteria | 6812532 |
| 1045 | 2970109829 | 2970109326 | Bacteria | 6863976 |
| 1046 | 2970117978 | 2970116247 | Bacteria | 6501857 |
| 1047 | 2970124152 | 2970122695 | Bacteria | 6625855 |
| 1048 | 2970129508 | 2970129317 | Bacteria | 6806560 |
| 1049 | 2970143160 | 2970136068 | Bacteria | 7207982 |
| 1050 | 2970144954 | 2970143518 | Bacteria | 6446480 |
| 1051 | 2970153824 | 2970149975 | Bacteria | 6779706 |
| 1052 | 2970162816 | 2970156795 | Bacteria | 7168044 |
| 1053 | 2970167494 | 2970164137 | Bacteria | 6861252 |
| 1054 | 2970171784 | 2970170962 | Bacteria | 6876229 |
| 1055 | 2970184114 | 2970177841 | Bacteria | 6768001 |
| 1056 | 2970185134 | 2970184632 | Bacteria | 7054431 |
| 1057 | 2970198334 | 2970191845 | Bacteria | 7032787 |
| 1058 | 2977523657 | 2977516862 | Bacteria | 6940108 |
| 1059 | 2977527645 | 2977523885 | Bacteria | 6960446 |
| 1060 | 2977528876 | 2977523885 | Bacteria | 6960446 |
| 1061 | 2977537306 | 2977530762 | Bacteria | 6951399 |
| 1062 | 2977537979 | 2977537788 | Bacteria | 6929320 |
| 1063 | 2977550078 | 2977544691 | Bacteria | 6875412 |
| 1064 | 2977551977 | 2977551784 | Bacteria | 7125765 |
| 1065 | 2977561682 | 2977558990 | Bacteria | 6863948 |
| 1066 | 2977568972 | 2977565890 | Bacteria | 6901543 |
| 1067 | 2977578971 | 2977572785 | Bacteria | 6763888 |
| 1068 | 2977581504 | 2977579622 | Bacteria | 6772100 |
| 1069 | 2979103089 | 2979100975 | Bacteria | 5423623 |
| 1070 | 2984606509 | 2984601300 | Bacteria | 5455244 |
| 1071 | 2990269394 | 2990265787 | Bacteria | 3943888 |
| 1072 | 2993697504 | 2993693658 | Bacteria | 4040749 |
| 1073 | 644750038 | 644736347 | Bacteria | 6476522 |
| 1074 | 648736356 | 648276728 | Bacteria | 6968865 |
| 1075 | 8003992934 | 8003992118 | Bacteria | 7266902 |
| 1076 | 8004006137 | 8003999396 | Bacteria | 7063185 |
| 1077 | 8054305125 | 8054302542 | Bacteria | 5698134 |
| 1078 | 8055272054 | 8055266321 | Bacteria | 7999742 |
| 1079 | 8056679075 | 8056673599 | Bacteria | 7871253 |
| 1080 | Ga0501241_001086 | |||
| 1081 | SwRhRL2b_contig_1483352 | |||
| 1082 | SwRhRL2b_contig_1901739 | |||
| 1083 | JGI24740J21852_10009449 | |||
| 1084 | JGI24740J21852_10024760 | |||
| 1085 | JGI24739J22299_10005502 | |||
| 1086 | JGI24739J22299_10013439 | |||
| 1087 | JGI24737J22298_10004941 | |||
| 1088 | JGI24737J22298_10006147 | |||
| 1089 | JGI24737J22298_10008641 | |||
| 1090 | JGI24737J22298_10036595 | |||
| 1091 | JGI24735J21928_10000694 | |||
| 1092 | JGI24735J21928_10006314 | |||
| 1093 | JGI24735J21928_10037938 | |||
| 1094 | JGI24738J21930_10002762 | |||
| 1095 | JGI24738J21930_10004350 | |||
| 1096 | JGI24738J21930_10023083 | |||
| 1097 | JGI25150J39212_1000369 | |||
| 1098 | JGI25151J46595_10000639 | |||
| 1099 | JGI25153J46596_10000124 | |||
| 1100 | rootH1_10030986 | |||
| 1101 | rootL2_10275712 | |||
| 1102 | rootH1_10005886 | |||
| 1103 | rootH1_10160732 | |||
| 1104 | Ga0055532_1003824 | |||
| 1105 | Ga0055532_1004520 | |||
| 1106 | Ga0055525_1000104 | |||
| 1107 | Ga0055542_1000037 | |||
| 1108 | Ga0055529_1000042 | |||
| 1109 | Ga0055526_1003257 | |||
| 1110 | Ga0055537_1002473 | |||
| 1111 | Ga0055524_1000470 | |||
| 1112 | Ga0055524_1002798 | |||
| 1113 | Ga0055524_1014354 | |||
| 1114 | Ga0055536_1000121 | |||
| 1115 | Ga0055536_1000288 | |||
| 1116 | Ga0055536_1000616 | |||
| 1117 | Ga0055536_1001415 | |||
| 1118 | Ga0055536_1002431 | |||
| 1119 | Ga0055536_1004304 | |||
| 1120 | Ga0055536_1046923 | |||
| 1121 | Ga0055534_1007990 | |||
| 1122 | Ga0055528_1006831 | |||
| 1123 | Ga0055530_10000897 | |||
| 1124 | Ga0055530_10001863 | |||
| 1125 | Ga0055530_10002377 | |||
| 1126 | Ga0055530_10004849 | |||
| 1127 | Ga0055530_10005341 | |||
| 1128 | Ga0055530_10014423 | |||
| 1129 | Ga0055530_10018168 | |||
| 1130 | Ga0055540_1001358 | |||
| 1131 | Ga0055540_1029201 | |||
| 1132 | Ga0055540_1046215 | |||
| 1133 | Ga0055531_10000096 | |||
| 1134 | Ga0055531_10002825 | |||
| 1135 | Ga0055531_10004227 | |||
| 1136 | Ga0055531_10022413 | |||
| 1137 | Ga0055531_10022508 | |||
| 1138 | Ga0058692_1002907 | |||
| 1139 | Ga0058692_1030815 | |||
| 1140 | Ga0065165_1008723 | |||
| 1141 | Ga0065704_10000204 | |||
| 1142 | Ga0065704_10099817 | |||
| 1143 | Ga0065704_10123610 | |||
| 1144 | Ga0065704_10211406 | |||
| 1145 | Ga0070658_10012637 | |||
| 1146 | Ga0070658_10019655 | |||
| 1147 | Ga0070670_100152681 | |||
| 1148 | Ga0070666_10032969 | |||
| 1149 | Ga0070660_100327848 | |||
| 1150 | Ga0070661_100005592 | |||
| 1151 | Ga0070661_100136756 | |||
| 1152 | Ga0070668_100034378 | |||
| 1153 | Ga0070668_100037160 | |||
| 1154 | Ga0070671_100219745 | |||
| 1155 | Ga0070674_100012527 | |||
| 1156 | Ga0070659_100017489 | |||
| 1157 | Ga0070667_100000429 | |||
| 1158 | Ga0070667_100002234 | |||
| 1159 | Ga0070667_100072346 | |||
| 1160 | Ga0070662_100015566 | |||
| 1161 | Ga0070662_100040479 | |||
| 1162 | Ga0070685_10077215 | |||
| 1163 | Ga0070707_100069477 | |||
| 1164 | Ga0068853_100005287 | |||
| 1165 | Ga0068853_100096300 | |||
| 1166 | Ga0070665_100000884 | |||
| 1167 | Ga0070665_100071210 | |||
| 1168 | Ga0068855_100073172 | |||
| 1169 | Ga0068855_100338275 | |||
| 1170 | Ga0070664_100021924 | |||
| 1171 | Ga0070664_100115685 | |||
| 1172 | Ga0068857_100029220 | |||
| 1173 | Ga0068857_101049809 | |||
| 1174 | Ga0068854_100014957 | |||
| 1175 | Ga0068854_100037728 | |||
| 1176 | Ga0068856_100479732 | |||
| 1177 | Ga0068859_100001448 | |||
| 1178 | Ga0068864_100017949 | |||
| 1179 | Ga0068861_100001768 | |||
| 1180 | Ga0068861_100145803 | |||
| 1181 | Ga0068861_100201101 | |||
| 1182 | Ga0068863_100043382 | |||
| 1183 | Ga0068860_100000573 | |||
| 1184 | Ga0068860_100833691 | |||
| 1185 | Ga0068862_100008954 | |||
| 1186 | Ga0068862_100009968 | |||
| 1187 | Ga0070717_10307434 | |||
| 1188 | Ga0075365_10002570 | |||
| 1189 | Ga0075365_10012014 | |||
| 1190 | Ga0075365_10455720 | |||
| 1191 | Ga0075368_10000158 | |||
| 1192 | Ga0075368_10000190 | |||
| 1193 | Ga0075368_10000214 | |||
| 1194 | Ga0075368_10000330 | |||
| 1195 | Ga0075363_100000005 | |||
| 1196 | Ga0075363_100017140 | |||
| 1197 | Ga0075363_100036200 | |||
| 1198 | Ga0075363_100083720 | |||
| 1199 | Ga0075364_10000003 | |||
| 1200 | Ga0075364_10000022 | |||
| 1201 | Ga0075432_10003631 | |||
| 1202 | Ga0075362_10000118 | |||
| 1203 | Ga0075367_10001760 | |||
| 1204 | Ga0075367_10002007 | |||
| 1205 | Ga0075367_10003779 | |||
| 1206 | Ga0075367_10014566 | |||
| 1207 | Ga0075367_10061128 | |||
| 1208 | Ga0075369_10000533 | |||
| 1209 | Ga0075369_10001184 | |||
| 1210 | Ga0075369_10002521 | |||
| 1211 | Ga0075369_10010635 | |||
| 1212 | Ga0075366_10025738 | |||
| 1213 | Ga0075366_10113625 | |||
| 1214 | Ga0075366_10177627 | |||
| 1215 | Ga0075366_10200046 | |||
| 1216 | Ga0075370_10000006 | |||
| 1217 | Ga0075370_10003734 | |||
| 1218 | Ga0075370_10004824 | |||
| 1219 | Ga0075370_10027468 | |||
| 1220 | Ga0075370_10027640 | |||
| 1221 | Ga0075370_10118177 | |||
| 1222 | Ga0075429_100208924 | |||
| 1223 | Ga0097620_100001448 | |||
| 1224 | Ga0079104_1004220 | |||
| 1225 | Ga0079104_1045489 | |||
| 1226 | Ga0105251_10018057 | |||
| 1227 | Ga0105251_10069781 | |||
| 1228 | Ga0105240_10030854 | |||
| 1229 | Ga0105240_10342380 | |||
| 1230 | Ga0105240_10414549 | |||
| 1231 | Ga0105241_10012879 | |||
| 1232 | Ga0105241_10173195 | |||
| 1233 | Ga0105248_10022524 | |||
| 1234 | Ga0105248_10059186 | |||
| 1235 | Ga0105248_10092062 | |||
| 1236 | Ga0105248_10103815 | |||
| 1237 | Ga0105248_10299391 | |||
| 1238 | Ga0105237_10004065 | |||
| 1239 | Ga0105237_10065031 | |||
| 1240 | Ga0105237_10339863 | |||
| 1241 | Ga0105238_10211033 | |||
| 1242 | Ga0105249_10003624 | |||
| 1243 | Ga0105249_10068891 | |||
| 1244 | Ga0105239_10000385 | |||
| 1245 | Ga0105239_10584241 | |||
| 1246 | Ga0157373_10038189 | |||
| 1247 | Ga0157373_10085510 | |||
| 1248 | Ga0157373_10530797 | |||
| 1249 | Ga0157371_10000183 | |||
| 1250 | Ga0157371_10006898 | |||
| 1251 | Ga0157370_10017512 | |||
| 1252 | Ga0157369_10029788 | |||
| 1253 | Ga0157369_10063890 | |||
| 1254 | Ga0157369_10285001 | |||
| 1255 | Ga0157369_10440589 | |||
| 1256 | Ga0157369_10488566 | |||
| 1257 | Ga0157374_10432129 | |||
| 1258 | Ga0163162_10003415 | |||
| 1259 | Ga0163162_10053910 | |||
| 1260 | Ga0163162_10077504 | |||
| 1261 | Ga0163162_10655526 | |||
| 1262 | Ga0157375_10002079 | |||
| 1263 | Ga0157380_10230418 | |||
| 1264 | Ga0182008_10037660 | |||
| 1265 | Ga0157379_10305126 | |||
| 1266 | Ga0182006_1027560 | |||
| 1267 | Ga0182007_10012367 | |||
| 1268 | Ga0182007_10088705 | |||
| 1269 | Ga0183369_1007 | |||
| 1270 | Ga0183363_1009 | |||
| 1271 | Ga0163161_10001715 | |||
| 1272 | Ga0163161_10016323 | |||
| 1273 | Ga0163161_10029808 | |||
| 1274 | Ga0163161_10101478 | |||
| 1275 | Ga0163161_10447814 | |||
| 1276 | Ga0214543_1000003 | |||
| 1277 | Ga0228711_1020746 | |||
| 1278 | Ga0228710_1022297 | |||
| 1279 | Ga0209672_101064 | |||
| 1280 | Ga0209147_100205 | |||
| 1281 | Ga0209147_100558 | |||
| 1282 | Ga0209147_100607 | |||
| 1283 | Ga0209147_108381 | |||
| 1284 | Ga0209563_100116 | |||
| 1285 | Ga0207425_1000022 | |||
| 1286 | Ga0209677_110133 | |||
| 1287 | Ga0209148_1000026 | |||
| 1288 | Ga0209759_1008921 | |||
| 1289 | Ga0209129_1001190 | |||
| 1290 | Ga0209233_1000455 | |||
| 1291 | Ga0209233_1045290 | |||
| 1292 | Ga0209565_1000065 | |||
| 1293 | Ga0209455_1000005 | |||
| 1294 | Ga0209673_1000818 | |||
| 1295 | Ga0209675_1000724 | |||
| 1296 | Ga0209676_1000060 | |||
| 1297 | Ga0209676_1000072 | |||
| 1298 | Ga0209676_1000184 | |||
| 1299 | Ga0209676_1000247 | |||
| 1300 | Ga0209676_1000297 | |||
| 1301 | Ga0209676_1001039 | |||
| 1302 | Ga0209676_1019584 | |||
| 1303 | Ga0209676_1024680 | |||
| 1304 | Ga0209025_1000018 | |||
| 1305 | Ga0209025_1000326 | |||
| 1306 | Ga0209025_1000371 | |||
| 1307 | Ga0209025_1033530 | |||
| 1308 | Ga0209564_1004449 | |||
| 1309 | Ga0209564_1025384 | |||
| 1310 | Ga0209564_1027816 | |||
| 1311 | Ga0209758_1000004 | |||
| 1312 | Ga0209758_1001185 | |||
| 1313 | Ga0209758_1026850 | |||
| 1314 | Ga0209050_1000001 | |||
| 1315 | Ga0209050_1000057 | |||
| 1316 | Ga0209050_1000077 | |||
| 1317 | Ga0209050_1000402 | |||
| 1318 | Ga0209050_1000548 | |||
| 1319 | Ga0209050_1000622 | |||
| 1320 | Ga0209050_1016408 | |||
| 1321 | Ga0209256_1003381 | |||
| 1322 | Ga0209051_1000303 | |||
| 1323 | Ga0209051_1003506 | |||
| 1324 | Ga0209051_1034867 | |||
| 1325 | Ga0209257_1000088 | |||
| 1326 | Ga0209257_1001450 | |||
| 1327 | Ga0209257_1001686 | |||
| 1328 | Ga0209257_1002690 | |||
| 1329 | Ga0209257_1016515 | |||
| 1330 | Ga0209257_1020328 | |||
| 1331 | Ga0207688_10059879 | |||
| 1332 | Ga0207680_10011950 | |||
| 1333 | Ga0207647_10027364 | |||
| 1334 | Ga0207647_10052205 | |||
| 1335 | Ga0207705_10000397 | |||
| 1336 | Ga0207654_10024820 | |||
| 1337 | Ga0207695_10008826 | |||
| 1338 | Ga0207695_10164752 | |||
| 1339 | Ga0207695_10442779 | |||
| 1340 | Ga0207671_10001440 | |||
| 1341 | Ga0207671_10016082 | |||
| 1342 | Ga0207671_10167441 | |||
| 1343 | Ga0207657_10065059 | |||
| 1344 | Ga0207657_10412079 | |||
| 1345 | Ga0207649_10003218 | |||
| 1346 | Ga0207649_10236072 | |||
| 1347 | Ga0207694_10005402 | |||
| 1348 | Ga0207694_10036765 | |||
| 1349 | Ga0207694_10060062 | |||
| 1350 | Ga0207644_10169376 | |||
| 1351 | Ga0207644_10585917 | |||
| 1352 | Ga0207690_10001443 | |||
| 1353 | Ga0207706_10007581 | |||
| 1354 | Ga0207706_10069138 | |||
| 1355 | Ga0207669_10039679 | |||
| 1356 | Ga0207711_10015556 | |||
| 1357 | Ga0207711_10034224 | |||
| 1358 | Ga0207711_10035470 | |||
| 1359 | Ga0207711_10075038 | |||
| 1360 | Ga0207711_10165342 | |||
| 1361 | Ga0207667_10000107 | |||
| 1362 | Ga0207667_10011452 | |||
| 1363 | Ga0207667_10490866 | |||
| 1364 | Ga0207712_10004353 | |||
| 1365 | Ga0207712_10038029 | |||
| 1366 | Ga0207712_10246841 | |||
| 1367 | Ga0207668_10003517 | |||
| 1368 | Ga0207668_10003735 | |||
| 1369 | Ga0207640_10007563 | |||
| 1370 | Ga0207640_10013814 | |||
| 1371 | Ga0207640_10200657 | |||
| 1372 | Ga0207658_10000368 | |||
| 1373 | Ga0207658_10009771 | |||
| 1374 | Ga0207658_10062027 | |||
| 1375 | Ga0207658_10631176 | |||
| 1376 | Ga0207639_10002138 | |||
| 1377 | Ga0207639_10009537 | |||
| 1378 | Ga0207639_10020899 | |||
| 1379 | Ga0207678_10002748 | |||
| 1380 | Ga0207678_10030255 | |||
| 1381 | Ga0207702_10005233 | |||
| 1382 | Ga0207702_10007230 | |||
| 1383 | Ga0207702_10007530 | |||
| 1384 | Ga0207641_10027348 | |||
| 1385 | Ga0207676_10009756 | |||
| 1386 | Ga0207674_10002464 | |||
| 1387 | Ga0207674_10087483 | |||
| 1388 | Ga0207675_100000016 | |||
| 1389 | Ga0207675_100216677 | |||
| 1390 | Ga0207675_100455070 | |||
| 1391 | Ga0207683_10074155 | |||
| 1392 | Ga0207698_10018963 | |||
| 1393 | Ga0209281_1000332 | |||
| 1394 | Ga0209281_1000360 | |||
| 1395 | Ga0209281_1033727 | |||
| 1396 | Ga0209282_1000060 | |||
| 1397 | Ga0209813_10000022 | |||
| 1398 | Ga0209813_10000038 | |||
| 1399 | Ga0209813_10000092 | |||
| 1400 | Ga0209813_10000105 | |||
| 1401 | Ga0207428_10013576 | |||
| 1402 | Ga0268266_10001163 | |||
| 1403 | Ga0268266_10253345 | |||
| 1404 | Ga0268265_10012328 | |||
| 1405 | Ga0268265_10015937 | |||
| 1406 | Ga0268265_10151002 | |||
| 1407 | Ga0268265_10727088 | |||
| 1408 | Ga0268264_10000582 | |||
| 1409 | Ga0268264_10800901 | |||
| 1410 | Ga0265318_10009370 | |||
| 1411 | Ga0265322_10029347 | |||
| 1412 | Ga0265336_10000859 | |||
| 1413 | Ga0307517_10021522 | |||
| 1414 | Ga0307517_10052593 | |||
| 1415 | Ga0307515_10026858 | |||
| 1416 | Ga0265338_10000013 | |||
| 1417 | Ga0265324_10021279 | |||
| 1418 | Ga0265327_10138513 | |||
| 1419 | Ga0307513_10003740 | |||
| 1420 | Ga0307513_10004795 | |||
| 1421 | Ga0307509_10002287 | |||
| 1422 | Ga0307408_100010494 | |||
| 1423 | Ga0307408_100036834 | |||
| 1424 | Ga0307408_100174792 | |||
| 1425 | Ga0307408_100223793 | |||
| 1426 | Ga0307516_10086960 | |||
| 1427 | Ga0307516_10175613 | |||
| 1428 | Ga0307405_10279380 | |||
| 1429 | Ga0307413_10017189 | |||
| 1430 | Ga0307413_10077624 | |||
| 1431 | Ga0307410_10131729 | |||
| 1432 | Ga0307406_10205477 | |||
| 1433 | Ga0307412_10000003 | |||
| 1434 | Ga0307412_10019961 | |||
| 1435 | Ga0307412_10061744 | |||
| 1436 | Ga0307412_10380078 | |||
| 1437 | Ga0315914_1000121 | |||
| 1438 | Ga0307409_100176956 | |||
| 1439 | Ga0307416_100153428 | |||
| 1440 | Ga0307416_100697871 | |||
| 1441 | Ga0307414_10000536 | |||
| 1442 | Ga0307414_10001051 | |||
| 1443 | Ga0307414_10021372 | |||
| 1444 | Ga0307414_10022530 | |||
| 1445 | Ga0307414_10104516 | |||
| 1446 | Ga0307414_10200207 | |||
| 1447 | Ga0307414_10249936 | |||
| 1448 | Ga0307414_10361613 | |||
| 1449 | Ga0307411_10466043 | |||
| 1450 | Ga0307415_100902000 | |||
| 1451 | Ga0315913_1000046 | |||
| 1452 | Ga0315915_1000004 | |||
| 1453 | Ga0373937_0277486 | |||
| 1454 | Ga0395898_0036347 | |||
| 1455 | Ga0436365_0654829 | |||
| 1456 | Ga0436365_1097678 | |||
| 1457 | Ga0439439_0002567 | |||
| 1458 | Ga0439465_0006311 | |||
| 1459 | Ga0439465_0141468 | |||
| 1460 | Ga0451791_0474554 | |||
| 1461 | Ga0451795_1076342 | |||
| 1462 | Ga0451802_1573622 | |||
| 1463 | Ga0451807_2178245 | |||
| 1464 | Ga0451837_1810866 | |||
| 1465 | Ga0451843_0184918 | |||
| 1466 | Ga0451843_0511461 | |||
| 1467 | Ga0451853_0332407 | |||
| 1468 | Ga0439431_0007141 | |||
| 1469 | Ga0439445_0033116 | |||
| 1470 | Ga0439449_0008122 | |||
| 1471 | Ga0450911_001396 | |||
| 1472 | Ga0439434_0102338 | |||
| 1473 | Ga0451576_0000053 | |||
| 1474 | Ga0495627_000103 | |||
| 1475 | Ga0495627_000105 | |||
| 1476 | Ga0495627_000185 | |||
| 1477 | Ga0495592_0063903 | |||
| 1478 | Ga0495638_0000021 | |||
| 1479 | Ga0495638_0002128 | |||
| 1480 | Ga0495638_0002254 | |||
| 1481 | Ga0495638_0004335 | |||
| 1482 | Ga0495638_0006082 | |||
| 1483 | Ga0495638_0086206 | |||
| 1484 | Ga0495651_0437393 | |||
| 1485 | Ga0495653_0162114 | |||
| 1486 | Ga0495650_0000045 | |||
| 1487 | Ga0495650_0000862 | |||
| 1488 | Ga0495650_0001034 | |||
| 1489 | Ga0495650_0005530 | |||
| 1490 | Ga0495580_0000047 | |||
| 1491 | Ga0495580_0053620 | |||
| 1492 | Ga0495605_0003880 | |||
| 1493 | Ga0495605_0005837 | |||
| 1494 | Ga0495664_0012632 | |||
| 1495 | Ga0495584_0172349 | |||
| 1496 | Ga0495585_0001506 | |||
| 1497 | Ga0495596_0000171 | |||
| 1498 | Ga0495596_0001194 | |||
| 1499 | Ga0495596_0005301 | |||
| 1500 | Ga0495607_0006779 | |||
| 1501 | Ga0495583_0000069 | |||
| 1502 | Ga0495583_0000184 | |||
| 1503 | Ga0495583_0000401 | |||
| 1504 | Ga0495583_0034485 | |||
| 1505 | Ga0495583_0043219 | |||
| 1506 | Ga0495606_0008550 | |||
| 1507 | Ga0495606_0089105 | |||
| 1508 | Ga0495606_0255917 | |||
| 1509 | Ga0495610_0000013 | |||
| 1510 | Ga0495610_0000018 | |||
| 1511 | Ga0495610_0000101 | |||
| 1512 | Ga0495610_0002633 | |||
| 1513 | Ga0495610_0002639 | |||
| 1514 | Ga0495610_0142206 | |||
| 1515 | Ga0495616_0000270 | |||
| 1516 | Ga0495616_0176222 | |||
| 1517 | Ga0495620_0033849 | |||
| 1518 | Ga0495620_0039025 | |||
| 1519 | Ga0495620_0045054 | |||
| 1520 | Ga0495628_0062359 | |||
| 1521 | Ga0495628_0345569 | |||
| 1522 | Ga0495630_0172398 | |||
| 1523 | Ga0495631_0052696 | |||
| 1524 | Ga0495631_0099404 | |||
| 1525 | Ga0495632_0001639 | |||
| 1526 | Ga0495632_0001694 | |||
| 1527 | Ga0495643_0000336 | |||
| 1528 | Ga0495643_0027804 | |||
| 1529 | Ga0495643_0030778 | |||
| 1530 | Ga0495643_0034028 | |||
| 1531 | Ga0495643_0044552 | |||
| 1532 | Ga0495643_0114051 | |||
| 1533 | Ga0495648_0000026 | |||
| 1534 | Ga0495648_0000111 | |||
| 1535 | Ga0495648_0048047 | |||
| 1536 | Ga0495648_0049703 | |||
| 1537 | Ga0495648_0067184 | |||
| 1538 | Ga0495663_0000757 | |||
| 1539 | Ga0495663_0052964 | |||
| 1540 | Ga0495666_0004701 | |||
| 1541 | Ga0495642_0007084 | |||
| 1542 | Ga0495642_0106553 | |||
| 1543 | Ga0495652_0051478 | |||
| 1544 | Ga0495652_0156210 | |||
| 1545 | Ga0495654_0000018 | |||
| 1546 | Ga0495640_0066032 | |||
| 1547 | Ga0495609_0074614 | |||
| 1548 | Ga0495597_0002618 | |||
| 1549 | Ga0495597_0024054 | |||
| 1550 | Ga0495597_0105938 | |||
| 1551 | Ga0495645_0378934 | |||
| 1552 | Ga0495622_0003300 | |||
| 1553 | Ga0495622_0047054 | |||
| 1554 | Ga0495622_0097704 | |||
| 1555 | Ga0495633_0003416 | |||
| 1556 | Ga0495633_0004092 | |||
| 1557 | Ga0495668_0000002 | |||
| 1558 | Ga0495668_0000325 | |||
| 1559 | Ga0495668_0031231 | |||
| 1560 | Ga0495668_0117517 | |||
| 1561 | Ga0495668_0143886 | |||
| 1562 | Ga0495668_0167114 | |||
| 1563 | Ga0495611_0020290 | |||
| 1564 | Ga0495611_0104509 | |||
| 1565 | Ga0495625_0000011 | |||
| 1566 | Ga0495625_0002609 | |||
| 1567 | Ga0495625_0002714 | |||
| 1568 | Ga0495625_0004251 | |||
| 1569 | Ga0495625_0018596 | |||
| 1570 | Ga0495625_0038770 | |||
| 1571 | Ga0495625_0038875 | |||
| 1572 | Ga0495625_0043927 | |||
| 1573 | Ga0495625_0055530 | |||
| 1574 | Ga0495661_0007978 | |||
| 1575 | Ga0495661_0012689 | |||
| 1576 | Ga0495661_0066993 | |||
| 1577 | Ga0495661_0119451 | |||
| 1578 | Ga0495599_0013711 | |||
| 1579 | Ga0495599_0040463 | |||
| 1580 | Ga0495646_0055361 | |||
| 1581 | Ga0495669_0001020 | |||
| 1582 | Ga0495669_0002307 | |||
| 1583 | Ga0495613_0004913 | |||
| 1584 | Ga0495671_0000050 | |||
| 1585 | Ga0495671_0021372 | |||
| 1586 | Ga0495649_0026157 | |||
| 1587 | Ga0495589_0008502 | |||
| 1588 | Ga0495604_0020344 | |||
| 1589 | Ga0495674_0034286 | |||
| 1590 | Ga0495672_0004230 | |||
| 1591 | Ga0495672_0004815 | |||
| 1592 | Ga0495683_0012468 | |||
| 1593 | Ga0495683_0016369 | |||
| 1594 | Ga0495683_0030145 | |||
| 1595 | Ga0495687_001092 | |||
| 1596 | Ga0495687_001844 | |||
| 1597 | Ga0495687_007250 | |||
| 1598 | Ga0495687_018058 | |||
| 1599 | Ga0495675_0189287 | |||
| 1600 | Ga0495677_0053767 | |||
| 1601 | Ga0495673_0000056 | |||
| 1602 | Ga0495673_0000125 | |||
| 1603 | Ga0495673_0020024 | |||
| 1604 | Ga0495681_0000036 | |||
| 1605 | Ga0495681_0000174 | |||
| 1606 | Ga0495681_0005853 | |||
| 1607 | Ga0495681_0006465 | |||
| 1608 | Ga0495686_0000057 | |||
| 1609 | Ga0495686_0000808 | |||
| 1610 | Ga0495686_0000944 | |||
| 1611 | Ga0495686_0002660 | |||
| 1612 | Ga0495686_0003856 | |||
| 1613 | Ga0495686_0016945 | |||
| 1614 | Ga0495686_0027554 | |||
| 1615 | Ga0495686_0028511 | |||
| 1616 | Ga0495686_0036965 | |||
| 1617 | Ga0495602_0025013 | |||
| 1618 | Ga0495602_0392296 | |||
| 1619 | Ga0495615_0000006 | |||
| 1620 | Ga0495615_0000009 | |||
| 1621 | Ga0495615_0000022 | |||
| 1622 | Ga0495615_0000056 | |||
| 1623 | Ga0495626_0034390 | |||
| 1624 | Ga0495626_0092043 | |||
| 1625 | Ga0496100_0004363 | |||
| 1626 | Ga0496100_0580091 | |||
| 1627 | Ga0496101_0000647 | |||
| 1628 | Ga0496101_0414580 | |||
| 1629 | Ga0496102_0000067 | |||
| 1630 | Ga0496102_0008560 | |||
| 1631 | Ga0496102_0052303 | |||
| 1632 | Ga0496102_0568457 | |||
| 1633 | Ga0496103_0002600 | |||
| 1634 | Ga0496103_0276162 | |||
| 1635 | Ga0496104_0016161 | |||
| 1636 | Ga0496104_0561403 | |||
| 1637 | Ga0496105_0000662 | |||
| 1638 | Ga0496106_0059203 | |||
| 1639 | Ga0496106_0068882 | |||
| 1640 | Ga0496106_0084941 | |||
| 1641 | Ga0496107_0000136 | |||
| 1642 | Ga0496107_0000515 | |||
| 1643 | Ga0496107_0018371 | |||
| 1644 | Ga0496110_0058225 | |||
| 1645 | Ga0496111_0002307 | |||
| 1646 | Ga0496112_0697702 | |||
| 1647 | Ga0496113_0064418 | |||
| 1648 | Ga0496113_0492592 | |||
| 1649 | Ga0496114_0040025 | |||
| 1650 | Ga0496115_0000056 | |||
| 1651 | Ga0496116_0000545 | |||
| 1652 | Ga0496116_0006376 | |||
| 1653 | Ga0496116_0036283 | |||
| 1654 | Ga0496117_0000114 | |||
| 1655 | Ga0496117_0012932 | |||
| 1656 | Ga0496117_0013436 | |||
| 1657 | Ga0496117_0026934 | |||
| 1658 | Ga0496117_0062312 | |||
| 1659 | Ga0496118_0000082 | |||
| 1660 | Ga0496118_0000439 | |||
| 1661 | Ga0496118_0001437 | |||
| 1662 | Ga0496118_0004598 | |||
| 1663 | Ga0496118_0014789 | |||
| 1664 | Ga0496118_0061924 | |||
| 1665 | Ga0496119_0002162 | |||
| 1666 | Ga0496119_0019495 | |||
| 1667 | Ga0496120_0006533 | |||
| 1668 | Ga0496120_0048673 | |||
| 1669 | Ga0496121_0000021 | |||
| 1670 | Ga0496121_0000190 | |||
| 1671 | Ga0496121_0000344 | |||
| 1672 | Ga0496121_0000721 | |||
| 1673 | Ga0496121_0002392 | |||
| 1674 | Ga0496121_0009736 | |||
| 1675 | Ga0496121_0028182 | |||
| 1676 | Ga0496121_0032836 | |||
| 1677 | Ga0496121_0034383 | |||
| 1678 | Ga0496121_0230957 | |||
| 1679 | Ga0496122_0000462 | |||
| 1680 | Ga0496122_0001343 | |||
| 1681 | Ga0496122_0004042 | |||
| 1682 | Ga0496122_0004742 | |||
| 1683 | Ga0496122_0008010 | |||
| 1684 | Ga0496122_0010005 | |||
| 1685 | Ga0496122_0021500 | |||
| 1686 | Ga0496122_0031248 | |||
| 1687 | Ga0496122_0078878 | |||
| 1688 | Ga0496123_0000048 | |||
| 1689 | Ga0496123_0000300 | |||
| 1690 | Ga0496123_0000643 | |||
| 1691 | Ga0496123_0002078 | |||
| 1692 | Ga0496123_0013351 | |||
| 1693 | Ga0496123_0017198 | |||
| 1694 | Ga0496123_0025200 | |||
| 1695 | Ga0496123_0065530 | |||
| 1696 | Ga0496123_0143732 | |||
| 1697 | Ga0496124_0000068 | |||
| 1698 | Ga0496124_0003193 | |||
| 1699 | Ga0496124_0006400 | |||
| 1700 | Ga0496124_0019388 | |||
| 1701 | Ga0496124_0056514 | |||
| 1702 | Ga0496124_0061695 | |||
| 1703 | Ga0496124_0119858 | |||
| 1704 | Ga0496124_0175482 | |||
| 1705 | Ga0496125_0000488 | |||
| 1706 | Ga0496125_0002303 | |||
| 1707 | Ga0496125_0004268 | |||
| 1708 | Ga0496125_0012254 | |||
| 1709 | Ga0496125_0035284 | |||
| 1710 | Ga0496125_0070822 | |||
| 1711 | Ga0496125_0102467 | |||
| 1712 | Ga0496125_0159962 | |||
| 1713 | Ga0496125_0230986 | |||
| 1714 | Ga0496126_0000157 | |||
| 1715 | Ga0496126_0000503 | |||
| 1716 | Ga0496126_0011995 | |||
| 1717 | Ga0496126_0018537 | |||
| 1718 | Ga0496126_0027270 | |||
| 1719 | Ga0496126_0265064 | |||
| 1720 | Ga0495682_0028086 | |||
| 1721 | Ga0501292_000003 | |||
| 1722 | Ga0501031_0011456 | |||
| 1723 | Ga0501032_0010834 | |||
| 1724 | Ga0501032_0027261 | |||
| 1725 | Ga0501033_0005862 | |||
| 1726 | Ga0501033_0029586 | |||
| 1727 | Ga0501033_0064704 | |||
| 1728 | Ga0501033_0131204 | |||
| 1729 | Ga0501034_0000215 | |||
| 1730 | Ga0501034_0028660 | |||
| 1731 | Ga0501034_0092516 | |||
| 1732 | Ga0501034_0186316 | |||
| 1733 | Ga0501034_0473074 | |||
| 1734 | Ga0501038_0122898 | |||
| 1735 | Ga0501039_0266539 | |||
| 1736 | Ga0501043_0210689 | |||
| 1737 | Ga0501043_0309235 | |||
| 1738 | Ga0501047_0000307 | |||
| 1739 | Ga0501047_0001806 | |||
| 1740 | Ga0501047_0010908 | |||
| 1741 | Ga0501047_0274153 | |||
| 1742 | Ga0501048_0063616 | |||
| 1743 | Ga0501048_0239907 | |||
| 1744 | Ga0501073_0000140 | |||
| 1745 | Ga0501223_000007 | |||
| 1746 | Ga0501238_000513 | |||
| 1747 | Ga0501246_000376 | |||
| 1748 | Ga0501249_000267 | |||
| 1749 | Ga0501249_000588 | |||
| 1750 | Ga0501225_0000010 | |||
| 1751 | Ga0501080_0018648 | |||
| 1752 | Ga0501083_0079772 | |||
| 1753 | Ga0501262_002548 | |||
| 1754 | Ga0501279_000009 | |||
| 1755 | Ga0501035_0004268 | |||
| 1756 | Ga0501035_0092439 | |||
| 1757 | Ga0501035_0102217 | |||
| 1758 | Ga0501044_0000109 | |||
| 1759 | Ga0501044_0000453 | |||
| 1760 | Ga0501044_0043037 | |||
| 1761 | Ga0501044_0105330 | |||
| 1762 | Ga0501044_0672560 | |||
| 1763 | nmdc:mga03n38_68_c1 | |||
| 1764 | nmdc:mga03n38_71089_c1 | |||
| 1765 | nmdc:mga00v17_91_c1 | |||
| 1766 | nmdc:mga00v17_9_c1 | |||
| 1767 | nmdc:mga0yw44_452865_c1 | |||
| 1768 | nmdc:mga0yw44_567_c1 | |||
| 1769 | nmdc:mga0yw44_727_c2 | |||
| 1770 | nmdc:mga0k408_156526_c1 | |||
| 1771 | nmdc:mga0k408_28620_c1 | |||
| 1772 | nmdc:mga0k408_415_c1 | |||
| 1773 | nmdc:mga0k408_59038_c1 | |||
| 1774 | nmdc:mga0k408_80036_c1 | |||
| 1775 | nmdc:mga06z11_121710_c1 | |||
| 1776 | nmdc:mga06z11_3_c1 | |||
| 1777 | nmdc:mga06z11_41_c1 | |||
| 1778 | nmdc:mga06z11_48_c1 | |||
| 1779 | nmdc:mga06z11_60931_c1 | |||
| 1780 | nmdc:mga06z11_71_c1 | |||
| 1781 | nmdc:mga04h51_27_c1 | |||
| 1782 | nmdc:mga04h51_43_c1 | |||
| 1783 | nmdc:mga04h51_57_c1 | |||
| 1784 | nmdc:mga04h51_5_c1 | |||
| 1785 | nmdc:mga07m45_18_c1 | |||
| 1786 | nmdc:mga07m45_22856_c1 | |||
| 1787 | nmdc:mga07m45_26825_c1 | |||
| 1788 | nmdc:mga07m45_2787_c1 | |||
| 1789 | nmdc:mga09592_163515_c1 | |||
| 1790 | nmdc:mga0sz30_271_c1 | |||
| 1791 | nmdc:mga0sz30_3064_c1 | |||
| 1792 | nmdc:mga0sz30_34_c1 | |||
| 1793 | nmdc:mga0sz30_397_c1 | |||
| 1794 | Ga0495601_0046860 | |||
| 1795 | Ga0500610_0000206 | |||
| 1796 | Ga0500635_0000154 | |||
| 1797 | Ga0495619_0066359 | |||
| 1798 | Ga0500643_000203 | |||
| 1799 | Ga0500643_030347 | |||
| 1800 | Ga0500646_0007574 | |||
| 1801 | Ga0500647_0014019 | |||
| 1802 | Ga0500651_0000062 | |||
| 1803 | Ga0500651_0004291 | |||
| 1804 | Ga0500566_0000824 | |||
| 1805 | Ga0500566_0022100 | |||
| 1806 | Ga0500566_0076541 | |||
| 1807 | Ga0500566_0082680 | |||
| 1808 | Ga0500641_0001855 | |||
| 1809 | Ga0500650_0170650 | |||
| 1810 | Ga0500654_078918 | |||
| 1811 | Ga0500555_000448 | |||
| 1812 | Ga0500592_016490 | |||
| 1813 | Ga0500592_019210 | |||
| 1814 | Ga0500595_002134 | |||
| 1815 | Ga0500595_002188 | |||
| 1816 | Ga0500595_004324 | |||
| 1817 | Ga0500595_021474 | |||
| 1818 | Ga0500607_000293 | |||
| 1819 | Ga0500608_000135 | |||
| 1820 | Ga0500608_000353 | |||
| 1821 | Ga0500608_002030 | |||
| 1822 | Ga0500614_000155 | |||
| 1823 | Ga0500614_004939 | |||
| 1824 | Ga0500614_023077 | |||
| 1825 | Ga0500618_000178 | |||
| 1826 | Ga0500618_000606 | |||
| 1827 | Ga0500618_000707 | |||
| 1828 | Ga0500618_006287 | |||
| 1829 | Ga0500642_0000471 | |||
| 1830 | Ga0500642_0031645 | |||
| 1831 | Ga0500655_000055 | |||
| 1832 | Ga0500655_017095 | |||
| 1833 | Ga0500559_0000031 | |||
| 1834 | Ga0500559_0000879 | |||
| 1835 | Ga0500559_0000984 | |||
| 1836 | Ga0500559_0003462 | |||
| 1837 | Ga0500559_0008942 | |||
| 1838 | Ga0500559_0021988 | |||
| 1839 | Ga0500559_0220483 | |||
| 1840 | Ga0500568_0069966 | |||
| 1841 | Ga0500573_0047098 | |||
| 1842 | Ga0500590_000433 | |||
| 1843 | Ga0500603_000737 | |||
| 1844 | Ga0500604_0000520 | |||
| 1845 | Ga0500622_0003059 | |||
| 1846 | Ga0500622_0005037 | |||
| 1847 | Ga0500622_0005173 | |||
| 1848 | Ga0500622_0005293 | |||
| 1849 | Ga0500624_000002 | |||
| 1850 | Ga0500627_0000020 | |||
| 1851 | Ga0500639_101614 | |||
| 1852 | Ga0500636_0001943 | |||
| 1853 | Ga0500637_0004224 | |||
| 1854 | Ga0500570_006654 | |||
| 1855 | Ga0500625_000007 | |||
| 1856 | Ga0500645_000585 | |||
| 1857 | Ga0500645_001694 | |||
| 1858 | Ga0500645_002181 | |||
| 1859 | Ga0500645_014440 | |||
| 1860 | Ga0501084_0021531 | |||
| 1861 | Ga0500661_000033 | |||
| 1862 | Ga0501082_0043906 | |||
| 1863 | Ga0530510_0211114 | |||
| 1864 | 2509374508 | |||
| 1865 | 2510306598 | |||
| 1866 | 2510842739 | |||
| 1867 | 2511124402 | |||
| 1868 | 2511500961 | |||
| 1869 | 2512532376 | |||
| 1870 | 2512974772 | |||
| 1871 | 2513583501 | |||
| 1872 | 2513603894 | |||
| 1873 | 2513617650 | |||
| 1874 | 2513882714 | |||
| 1875 | 2513905259 | |||
| 1876 | 2513914506 | |||
| 1877 | 2513928245 | |||
| 1878 | 2513957704 | |||
| 1879 | 2513984799 | |||
| 1880 | 2513999503 | |||
| 1881 | 2514004151 | |||
| 1882 | 2514045559 | |||
| 1883 | 2515610215 | |||
| 1884 | 2516892242 | |||
| 1885 | 2517567419 | |||
| 1886 | 2524454505 | |||
| 1887 | 2524614013 | |||
| 1888 | 2551676421 | |||
| 1889 | 2551687222 | |||
| 1890 | 2551694402 | |||
| 1891 | 2551703175 | |||
| 1892 | 2551740391 | |||
| 1893 | 2558863535 | |||
| 1894 | 2585259935 | |||
| 1895 | 2585266237 | |||
| 1896 | 2585387239 | |||
| 1897 | 2599416862 | |||
| 1898 | 2600200418 | |||
| 1899 | 2643729558 | |||
| 1900 | 2643832609 | |||
| 1901 | 2643834711 | |||
| 1902 | 2643926097 | |||
| 1903 | 2643928721 | |||
| 1904 | 2644001519 | |||
| 1905 | 2644040957 | |||
| 1906 | 2644043915 | |||
| 1907 | 2644053596 | |||
| 1908 | 2644055638 | |||
| 1909 | 2644087198 | |||
| 1910 | 2644342151 | |||
| 1911 | 2644368437 | |||
| 1912 | 2644392386 | |||
| 1913 | 2687583756 | |||
| 1914 | 2739649610 | |||
| 1915 | 2739652359 | |||
| 1916 | 2740028083 | |||
| 1917 | 2740030833 | |||
| 1918 | 2753767250 | |||
| 1919 | 2778126862 | |||
| 1920 | 2792458920 | |||
| 1921 | 2792462237 | |||
| 1922 | 2792462246 | |||
| 1923 | 2802725820 | |||
| 1924 | 2802731472 | |||
| 1925 | 2802736337 | |||
| 1926 | 2802750099 | |||
| 1927 | 2809064532 | |||
| 1928 | 2809080557 | |||
| 1929 | 2809084921 | |||
| 1930 | 2819713795 | |||
| 1931 | 2830078833 | |||
| 1932 | 2838041808 | |||
| 1933 | 2838661187 | |||
| 1934 | 2841915630 | |||
| 1935 | 2841920832 | |||
| 1936 | 2842525297 | |||
| 1937 | 2843749076 | |||
| 1938 | 2848298222 | |||
| 1939 | 2849563761 | |||
| 1940 | 2849576443 | |||
| 1941 | 2850080426 | |||
| 1942 | 2851154939 | |||
| 1943 | 2852656984 | |||
| 1944 | 2852681249 | |||
| 1945 | 2855831312 | |||
| 1946 | 2855840437 | |||
| 1947 | 2857507213 | |||
| 1948 | 2858800965 | |||
| 1949 | 2874220725 | |||
| 1950 | 2876808932 | |||
| 1951 | 2879110278 | |||
| 1952 | 2880523668 | |||
| 1953 | 2884961984 | |||
| 1954 | 2885429103 | |||
| 1955 | 2885433150 | |||
| 1956 | 2894417496 | |||
| 1957 | 2898331475 | |||
| 1958 | 2915980963 | |||
| 1959 | 2915990905 | |||
| 1960 | 2915996271 | |||
| 1961 | 2916005749 | |||
| 1962 | 2916010916 | |||
| 1963 | 2916016553 | |||
| 1964 | 2916024752 | |||
| 1965 | 2916032191 | |||
| 1966 | 2916038154 | |||
| 1967 | 2916047918 | |||
| 1968 | 2916054361 | |||
| 1969 | 2916055368 | |||
| 1970 | 2916064490 | |||
| 1971 | 2916073448 | |||
| 1972 | 2916078178 | |||
| 1973 | 2917705606 | |||
| 1974 | 2919090755 | |||
| 1975 | 2919140636 | |||
| 1976 | 2919682705 | |||
| 1977 | 2919708895 | |||
| 1978 | 2919709460 | |||
| 1979 | 2921204930 | |||
| 1980 | 2921213520 | |||
| 1981 | 2921241612 | |||
| 1982 | 2921247526 | |||
| 1983 | 2921251303 | |||
| 1984 | 2921261599 | |||
| 1985 | 2921264245 | |||
| 1986 | 2921282758 | |||
| 1987 | 2921290140 | |||
| 1988 | 2921303397 | |||
| 1989 | 2924145610 | |||
| 1990 | 2924157260 | |||
| 1991 | 2924160563 | |||
| 1992 | 2924168161 | |||
| 1993 | 2924173408 | |||
| 1994 | 2924186324 | |||
| 1995 | 2924189502 | |||
| 1996 | 2924198238 | |||
| 1997 | 2924204069 | |||
| 1998 | 2924209899 | |||
| 1999 | 2924215186 | |||
| 2000 | 2924226239 | |||
| 2001 | 2924234924 | |||
| 2002 | 2928496739 | |||
| 2003 | 2928534089 | |||
| 2004 | 2928969803 | |||
| 2005 | 2931381641 | |||
| 2006 | 2933019853 | |||
| 2007 | 2937000765 | |||
| 2008 | 2937009524 | |||
| 2009 | 2937010876 | |||
| 2010 | 2937018995 | |||
| 2011 | 2937027935 | |||
| 2012 | 2937035893 | |||
| 2013 | 2937036359 | |||
| 2014 | 2937048979 | |||
| 2015 | 2937056294 | |||
| 2016 | 2937063363 | |||
| 2017 | 2937070635 | |||
| 2018 | 2937072169 | |||
| 2019 | 2937084741 | |||
| 2020 | 2937086888 | |||
| 2021 | 2937095579 | |||
| 2022 | 2937103645 | |||
| 2023 | 2937112552 | |||
| 2024 | 2937118184 | |||
| 2025 | 2937121175 | |||
| 2026 | 2937129809 | |||
| 2027 | 2939627491 | |||
| 2028 | 2941486494 | |||
| 2029 | 2941506422 | |||
| 2030 | 2946790953 | |||
| 2031 | 2957375998 | |||
| 2032 | 2957385079 | |||
| 2033 | 2957389142 | |||
| 2034 | 2957396396 | |||
| 2035 | 2957405458 | |||
| 2036 | 2957413261 | |||
| 2037 | 2957419188 | |||
| 2038 | 2957419369 | |||
| 2039 | 2957421810 | |||
| 2040 | 2957427723 | |||
| 2041 | 2957431101 | |||
| 2042 | 2957439587 | |||
| 2043 | 2957446664 | |||
| 2044 | 2957450504 | |||
| 2045 | 2957454180 | |||
| 2046 | 2957457613 | |||
| 2047 | 2957463576 | |||
| 2048 | 2957467758 | |||
| 2049 | 2957477800 | |||
| 2050 | 2957480638 | |||
| 2051 | 2957485800 | |||
| 2052 | 2957495984 | |||
| 2053 | 2957501026 | |||
| 2054 | 2957509582 | |||
| 2055 | 2960586634 | |||
| 2056 | 2960592469 | |||
| 2057 | 2960600585 | |||
| 2058 | 2960609485 | |||
| 2059 | 2960616721 | |||
| 2060 | 2960617693 | |||
| 2061 | 2960622637 | |||
| 2062 | 2960629778 | |||
| 2063 | 2960636146 | |||
| 2064 | 2960640197 | |||
| 2065 | 2960648738 | |||
| 2066 | 2960659496 | |||
| 2067 | 2960666394 | |||
| 2068 | 2960666751 | |||
| 2069 | 2960673915 | |||
| 2070 | 2960678822 | |||
| 2071 | 2960681106 | |||
| 2072 | 2960692069 | |||
| 2073 | 2960694106 | |||
| 2074 | 2961047490 | |||
| 2075 | 2964609722 | |||
| 2076 | 2964620711 | |||
| 2077 | 2964627797 | |||
| 2078 | 2964633127 | |||
| 2079 | 2964637207 | |||
| 2080 | 2964646037 | |||
| 2081 | 2964646151 | |||
| 2082 | 2964653093 | |||
| 2083 | 2964661894 | |||
| 2084 | 2964671696 | |||
| 2085 | 2964678977 | |||
| 2086 | 2964688098 | |||
| 2087 | 2964695831 | |||
| 2088 | 2964703605 | |||
| 2089 | 2964706166 | |||
| 2090 | 2964716289 | |||
| 2091 | 2964726467 | |||
| 2092 | 2967667361 | |||
| 2093 | 2967672154 | |||
| 2094 | 2967678915 | |||
| 2095 | 2967692032 | |||
| 2096 | 2967693235 | |||
| 2097 | 2967704250 | |||
| 2098 | 2967712938 | |||
| 2099 | 2967716539 | |||
| 2100 | 2967724576 | |||
| 2101 | 2967731364 | |||
| 2102 | 2967737590 | |||
| 2103 | 2967740159 | |||
| 2104 | 2967742200 | |||
| 2105 | 2967747863 | |||
| 2106 | 2967752115 | |||
| 2107 | 2967757724 | |||
| 2108 | 2967763809 | |||
| 2109 | 2967770782 | |||
| 2110 | 2967782167 | |||
| 2111 | 2970026061 | |||
| 2112 | 2970029635 | |||
| 2113 | 2970037792 | |||
| 2114 | 2970043295 | |||
| 2115 | 2970049930 | |||
| 2116 | 2970059618 | |||
| 2117 | 2970065304 | |||
| 2118 | 2970075673 | |||
| 2119 | 2970076979 | |||
| 2120 | 2970085658 | |||
| 2121 | 2970093298 | |||
| 2122 | 2970096805 | |||
| 2123 | 2970108554 | |||
| 2124 | 2970109829 | |||
| 2125 | 2970117978 | |||
| 2126 | 2970124152 | |||
| 2127 | 2970129508 | |||
| 2128 | 2970143160 | |||
| 2129 | 2970144954 | |||
| 2130 | 2970153824 | |||
| 2131 | 2970162816 | |||
| 2132 | 2970167494 | |||
| 2133 | 2970171784 | |||
| 2134 | 2970184114 | |||
| 2135 | 2970185134 | |||
| 2136 | 2970198334 | |||
| 2137 | 2977523657 | |||
| 2138 | 2977527645 | |||
| 2139 | 2977528876 | |||
| 2140 | 2977537306 | |||
| 2141 | 2977537979 | |||
| 2142 | 2977550078 | |||
| 2143 | 2977551977 | |||
| 2144 | 2977561682 | |||
| 2145 | 2977568972 | |||
| 2146 | 2977578971 | |||
| 2147 | 2977581504 | |||
| 2148 | 2979103089 | |||
| 2149 | 2984606509 | |||
| 2150 | 2990269394 | |||
| 2151 | 2993697504 | |||
| 2152 | 644750038 | |||
| 2153 | 648736356 | |||
| 2154 | 8003992934 | |||
| 2155 | 8004006137 | |||
| 2156 | 8054305125 | |||
| 2157 | 8055272054 | |||
| 2158 | 8056679075 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fzv-assembly1.cif.gz_B | crystal structure of an apo form of a flavin-binding protein from shigella flexneri | 0.9351 | 1 | 231 |
| 2fzv-assembly1.cif.gz_A | crystal structure of an apo form of a flavin-binding protein from shigella flexneri | 0.9338 | 3 | 233 |
| 2fzv-assembly1.cif.gz_D | crystal structure of an apo form of a flavin-binding protein from shigella flexneri | 0.9272 | 2 | 231 |
| 2fzv-assembly1.cif.gz_C | crystal structure of an apo form of a flavin-binding protein from shigella flexneri | 0.9237 | 1 | 231 |
| 2fzv-assembly1.cif.gz_A | crystal structure of an apo form of a flavin-binding protein from shigella flexneri | 0.9147 | 3 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fzvC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9237 | 1 | 231 | 3.40.50.360 |
| 2q62A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9214 | 34 | 228 | 3.40.50.360 |
| 2fzvC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8863 | 1 | 231 | 3.40.50.360 |
| 2q62A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8658 | 34 | 228 | 3.40.50.360 |
| 1x77B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8514 | 37 | 206 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3A6A9-F1-model_v4 | Arsenical resistance protein ArsH | 0.9912 | 1 | 98 |
GO:0016655
|
| AF-A0A6S4VTP6-F1-model_v4 | deleted | 0.9901 | 2 | 106 |
|
| AF-A0A2D8TFP3-F1-model_v4 | deleted | 0.9881 | 1 | 82 |
|
| AF-A0A6I1JFG8-F1-model_v4 | NADPH-dependent FMN reductase | 0.9788 | 1 | 72 |
GO:0016655
|
| AF-A0A2D8TFP3-F1-model_v4 | deleted | 0.9763 | 1 | 82 |
|