F489653

General Info

Members Datasets Scaffolds Average Seq Length
1079 886 2158 341

Family's Representative Sequence

Representative Sequence 3300059503|Ga0587080_006015|Ga0587080_006015_293_1555
Length 420
Sequence MKKSVLAFGALALGVTFSAPVMAADVAACLITKTDTNPFFVKMKEGATAKAKELGVSLKSYAGKIDGDSESQVAAIESCIADGAKGILLTASDTKGIVPAVKKARDAGLLVIALDTPLEPADAADATFATDNLLAGKLIGQWAKETLGDKAKDAKVGFLDLTPSQPTVDVLRDQGFMMGFGIDPKNPDKIGDEDDKRIVGHDVTNGNEEGGRKAMENLLQKDPGINVIHTINEPAAVGAYQALKAVGMEKNVLIVSVDGGCPGVKSVKEGVIGATSQQYPLLMASLGIEAIKKFADSGEKPKPIMKPWSHRTSTVGCDGVRSRKPILASLALSPMVAAAHWPISLPASRLSVAKVASAAVAGSRGVSSAITRMPASWAFLTWSTMALVSEAAIRIPLAPSAMQDSIAATWLSWSPSTLPA

Samples

Sample ID Description Type Environment
1 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
58 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
74 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
75 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
76 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
138 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
139 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
150 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
151 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
152 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
153 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
156 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
157 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
216 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
220 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
223 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
224 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
259 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
260 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
261 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
262 2509276019 Ensifer aridi TW10 Isolate Nodule
263 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
264 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
265 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
266 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
267 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
268 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
269 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
270 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
271 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
272 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
273 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
274 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
275 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
276 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
277 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
278 2512875024
279 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
280 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
281 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
282 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
283 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
284 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
285 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
286 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
287 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
288 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
289 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
290 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
291 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
292 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
293 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
294 2516143018 Ensifer sp. BR816 Isolate Nodule
295 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
296 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
297 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
298 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
299 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
300 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
301 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
302 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
303 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
304 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
305 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
306 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
307 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
308 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
309 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
310 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
311 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
312 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
313 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
314 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
315 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
316 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
317 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
318 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
319 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
320 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
321 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
322 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
323 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
324 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
325 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
326 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
327 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
328 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
329 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
330 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
331 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
332 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
333 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
334 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
335 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
336 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
337 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
338 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
339 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
340 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
341 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
342 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
343 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
344 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
345 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
346 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
347 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
348 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
349 2643221557 Ensifer sp. Root558 Isolate Unclassified
350 2643221558 Rhizobium sp. Root149 Isolate Unclassified
351 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
352 2643221568 Rhizobium sp. Root564 Isolate Unclassified
353 2643221582 Rhizobium sp. Root651 Isolate Unclassified
354 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
355 2643221599 Rhizobium sp. Root708 Isolate Unclassified
356 2643221610 Ensifer sp. Root74 Isolate Unclassified
357 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
358 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
359 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
360 2643221668 Ensifer sp. Root423 Isolate Unclassified
361 2643221675 Ensifer sp. Root1298 Isolate Unclassified
362 2643221680 Ensifer sp. Root1312 Isolate Unclassified
363 2643221693 Rhizobium sp. Root491 Isolate Unclassified
364 2643221723 Ensifer sp. Root278 Isolate Unclassified
365 2643221726 Ensifer sp. Root954 Isolate Unclassified
366 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
367 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
368 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
369 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
370 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
371 2738541293 Rhizobium sp. GV031 Isolate Unclassified
372 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
373 2738543024 Aminobacter sp. AP02 Isolate Unclassified
374 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
375 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
376 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
377 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
378 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
379 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
380 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
381 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
382 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
383 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
384 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
385 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
386 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
387 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
388 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
389 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
390 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
391 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
392 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
393 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
394 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
395 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
396 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
397 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
398 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
399 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
400 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
401 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
402 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
403 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
404 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
405 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
406 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
407 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
408 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
409 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
410 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
411 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
412 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
413 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
414 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
415 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
416 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
417 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
418 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
419 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
420 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
421 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
422 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
423 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
424 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
425 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
426 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
427 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
428 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
429 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
430 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
431 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
432 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
433 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
434 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
435 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
436 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
437 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
438 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
439 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
440 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
441 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
442 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
443 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
444 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
445 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
446 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
447 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
448 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
449 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
450 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
451 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
452 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
453 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
454 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
455 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
456 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
457 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
458 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
459 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
460 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
461 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
462 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
463 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
464 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
465 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
466 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
467 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
468 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
469 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
470 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
471 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
472 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
473 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
474 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
475 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
476 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
477 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
478 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
479 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
480 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
481 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
482 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
483 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
484 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
485 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
486 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
487 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
488 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
489 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
490 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
491 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
492 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
493 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
494 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
495 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
496 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
497 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
498 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
499 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
500 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
501 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
502 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
503 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
504 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
505 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
506 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
507 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
508 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
509 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
510 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
511 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
512 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
513 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
514 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
515 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
516 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
517 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
518 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
519 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
520 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
521 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
522 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
523 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
524 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
525 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
526 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
527 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
528 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
529 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
530 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
531 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
532 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
533 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
534 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
535 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
536 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
537 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
538 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
539 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
540 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
541 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
542 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
543 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
544 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
545 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
546 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
547 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
548 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
549 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
550 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
551 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
552 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
553 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
554 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
555 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
556 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
557 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
558 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
559 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
560 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
561 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
562 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
563 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
564 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
565 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
566 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
567 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
568 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
569 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
570 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
571 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
572 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
573 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
574 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
575 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
576 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
577 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
578 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
579 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
580 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
581 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
582 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
583 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
584 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
585 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
586 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
587 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
588 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
589 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
590 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
591 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
592 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
593 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
594 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
595 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
596 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
597 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
598 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
599 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
600 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
601 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
602 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
603 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
604 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
605 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
606 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
607 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
608 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
609 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
610 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
611 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
612 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
613 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
614 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
615 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
616 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
617 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
618 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
619 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
620 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
621 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
622 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
623 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
624 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
625 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
626 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
627 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
628 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
629 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
630 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
631 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
632 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
633 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
634 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
635 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
636 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
637 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
638 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
639 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
640 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
641 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
642 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
643 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
644 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
645 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
646 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
647 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
648 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
649 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
650 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
651 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
652 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
653 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
654 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
655 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
656 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
657 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
658 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
659 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
660 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
661 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
662 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
663 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
664 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
665 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
666 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
667 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
668 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
669 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
670 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
671 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
672 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
673 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
674 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
675 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
676 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
677 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
678 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
679 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
680 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
681 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
682 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
683 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
684 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
685 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
686 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
687 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
688 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
689 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
690 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
691 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
692 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
693 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
694 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
695 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
696 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
697 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
698 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
699 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
700 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
701 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
702 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
703 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
704 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
705 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
706 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
707 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
708 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
709 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
710 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
711 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
712 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
713 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
714 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
715 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
716 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
717 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
718 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
719 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
720 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
721 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
722 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
723 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
724 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
725 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
726 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
727 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
728 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
729 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
730 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
731 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
732 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
733 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
734 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
735 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
736 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
737 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
738 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
739 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
740 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
741 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
742 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
743 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
744 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
745 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
746 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
747 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
748 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
749 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
750 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
751 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
752 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
753 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
754 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
755 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
756 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
757 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
758 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
759 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
760 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
761 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
762 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
763 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
764 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
765 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
766 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
767 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
768 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
769 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
770 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
771 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
772 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
773 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
774 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
775 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
776 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
777 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
778 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
779 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
780 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
781 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
782 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
783 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
784 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
785 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
786 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
787 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
788 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
789 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
790 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
791 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
792 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
793 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
794 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
795 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
796 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
797 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
798 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
799 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
800 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
801 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
802 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
803 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
804 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
805 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
806 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
807 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
808 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
809 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
810 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
811 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
812 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
813 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
814 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
815 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
816 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
817 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
818 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
819 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
820 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
821 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
822 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
823 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
824 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
825 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
826 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
827 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
828 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
829 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
830 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
831 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
832 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
833 2996887358 Rhizobium sp. R711 Isolate Nodule
834 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
835 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
836 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
837 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
838 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
839 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
840 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
841 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
842 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
843 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
844 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
845 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
846 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
847 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
848 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
849 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
850 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
851 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
852 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
853 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
854 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
855 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
856 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
857 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
858 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
859 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
860 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
861 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
862 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
863 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
864 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
865 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
866 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
867 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
868 8005258706 Rhizobium sp. R693 Isolate Nodule
869 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
870 8005321885 Rhizobium sp. R72 Isolate Nodule
871 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
872 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
873 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
874 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
875 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
876 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
877 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
878 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
879 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
880 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
881 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
882 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
883 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
884 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
885 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
886 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 35.87
Metatranscriptomes 5.65
Isolates 58.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 13.9
Nodule 44.95
Rhizoplane 1.39
Rhizosphere 21.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587080_006015 3300059503 Bacteria 1654
2 RicEn_C8857 2010549000 Bacteria 1442
3 JGI24740J21852_10003158 3300001979 Bacteria 7270
4 JGI25155J39150_1000013 3300002704 Bacteria 198215
5 JGI25156J39149_1000011 3300002705 Bacteria 198215
6 JGI25162J39368_1000689 3300002737 Bacteria 23547
7 JGI25154J39366_1000030 3300002738 Bacteria 191444
8 JGI25158J39367_1000035 3300002739 Bacteria 30451
9 JGI25158J39367_1000131 3300002739 Bacteria 17548
10 JGI25157J39369_1000013 3300002741 Bacteria 198211
11 JGI25152J39213_1000865 3300002773 Bacteria 14942
12 JGI25152J39213_1001575 3300002773 Bacteria 9574
13 JGI25152J39213_1009843 3300002773 Bacteria 2233
14 JGI25159J45721_1000003 3300002987 Bacteria 274069
15 JGI25159J45721_1000744 3300002987 Bacteria 14188
16 JGI25151J46595_10003116 3300003187 Bacteria 9331
17 JGI25151J46595_10006323 3300003187 Bacteria 5970
18 JGI25151J46595_10021695 3300003187 Bacteria 2681
19 JGI25165J46597_1000570 3300003214 Bacteria 33114
20 JGI25165J46597_1000585 3300003214 Bacteria 31924
21 JGI25153J46596_10012357 3300003215 Bacteria 3692
22 JGI25160J50197_1000003 3300003354 Bacteria 482719
23 JGI25160J50197_1003267 3300003354 Bacteria 7299
24 JGI25160J50197_1009347 3300003354 Bacteria 3647
25 JGI25161J50226_1000117 3300003374 Bacteria 59670
26 JGI25161J50226_1000239 3300003374 Bacteria 32969
27 JGI25161J50226_1003492 3300003374 Bacteria 3579
28 Ga0006562J51391_1004927 3300003578 Bacteria 4700
29 Ga0055526_1003533 3300003771 Bacteria 9871
30 Ga0055526_1004786 3300003771 Bacteria 8014
31 Ga0055526_1005685 3300003771 Bacteria 7079
32 Ga0055526_1008119 3300003771 Bacteria 5292
33 Ga0055524_1000434 3300003775 Bacteria 34967
34 Ga0055524_1002834 3300003775 Bacteria 8692
35 Ga0055524_1004206 3300003775 Bacteria 6704
36 Ga0055524_1012460 3300003775 Bacteria 3262
37 Ga0055536_1001453 3300003781 Bacteria 14249
38 Ga0055528_1000594 3300003790 Bacteria 27215
39 Ga0055528_1000980 3300003790 Bacteria 18963
40 Ga0055528_1006042 3300003790 Bacteria 5539
41 Ga0055528_1028470 3300003790 Bacteria 1540
42 Ga0055528_1036924 3300003790 Bacteria 1158
43 Ga0055540_1000272 3300003792 Bacteria 46628
44 Ga0055540_1012520 3300003792 Bacteria 2656
45 Ga0055540_1019494 3300003792 Bacteria 1824
46 Ga0055531_10004167 3300003794 Bacteria 8915
47 Ga0058692_1002864 3300003856 Bacteria 5620
48 Ga0055543_1000037 3300004625 Bacteria 125386
49 Ga0055543_1000043 3300004625 Bacteria 116599
50 Ga0055543_1000774 3300004625 Bacteria 15885
51 Ga0065165_1000025 3300005262 Bacteria 246909
52 Ga0065165_1004348 3300005262 Bacteria 8885
53 Ga0065165_1011568 3300005262 Bacteria 3661
54 Ga0070670_100000804 3300005331 Bacteria 24410
55 Ga0070668_100129247 3300005347 Bacteria 2026
56 Ga0070669_100066935 3300005353 Bacteria 2649
57 Ga0070663_100144349 3300005455 Bacteria 1820
58 Ga0070707_100006738 3300005468 Bacteria 10645
59 Ga0070665_100000937 3300005548 Bacteria 37328
60 Ga0070665_100094359 3300005548 Bacteria 2997
61 Ga0068855_100112120 3300005563 Bacteria 3130
62 Ga0068854_100015003 3300005578 Bacteria 5121
63 Ga0068856_100034847 3300005614 Bacteria 4932
64 Ga0068852_100049407 3300005616 Bacteria 3599
65 Ga0068863_100225197 3300005841 Bacteria 1808
66 Ga0068860_100118591 3300005843 Bacteria 2533
67 Ga0081538_10002139 3300005981 Bacteria 19677
68 Ga0075365_10011572 3300006038 Bacteria 5194
69 Ga0075368_10000351 3300006042 Bacteria 13518
70 Ga0075364_10000006 3300006051 Bacteria 86571
71 Ga0075364_10011946 3300006051 Bacteria 5292
72 Ga0075364_10038606 3300006051 Bacteria 3094
73 Ga0075362_10000690 3300006177 Bacteria 9988
74 Ga0075362_10004229 3300006177 Bacteria 5129
75 Ga0075367_10001705 3300006178 Bacteria 9613
76 Ga0075369_10013253 3300006186 Bacteria 3269
77 Ga0075369_10080906 3300006186 Bacteria 1440
78 Ga0075366_10024036 3300006195 Bacteria 3553
79 Ga0075370_10018681 3300006353 Bacteria 3762
80 Ga0075429_100152228 3300006880 Bacteria 2025
81 Ga0079104_1000207 3300006946 Bacteria 82261
82 Ga0079104_1003701 3300006946 Bacteria 6934
83 Ga0099826_10000728 3300006948 Bacteria 17292
84 Ga0099826_10036233 3300006948 Bacteria 3494
85 Ga0105251_10046146 3300009011 Bacteria 2098
86 Ga0105244_10041849 3300009036 Bacteria 2373
87 Ga0105244_10051060 3300009036 Bacteria 2108
88 Ga0105240_10000024 3300009093 Bacteria 375919
89 Ga0111539_10000600 3300009094 Bacteria 46579
90 Ga0105243_10005598 3300009148 Bacteria 9786
91 Ga0105237_10000836 3300009545 Bacteria 42087
92 Ga0123341_1000038 3300009765 Bacteria 60679
93 Ga0123342_1018935 3300009766 Bacteria 5364
94 Ga0105239_10002164 3300010375 Bacteria 25271
95 Ga0105246_10124880 3300011119 Bacteria 1913
96 Ga0157373_10026645 3300013100 Bacteria 4173
97 Ga0157371_10000004 3300013102 Bacteria 512593
98 Ga0157371_10005722 3300013102 Bacteria 10420
99 Ga0157370_10001986 3300013104 Bacteria 25145
100 Ga0157370_10002813 3300013104 Bacteria 20790
101 Ga0157370_10068485 3300013104 Bacteria 3354
102 Ga0157369_10004082 3300013105 Bacteria 17282
103 Ga0157369_10073712 3300013105 Bacteria 3662
104 Ga0171463_1001 3300013249 Bacteria 1406070
105 Ga0163163_10138594 3300014325 Bacteria 2474
106 Ga0182008_10071246 3300014497 Bacteria 1710
107 Ga0182007_10007500 3300015262 Bacteria 4569
108 Ga0182007_10027450 3300015262 Bacteria 1963
109 Ga0183363_1081 3300015690 Bacteria 29051
110 Ga0206352_10289082 3300020078 Bacteria 1196
111 Ga0214544_1000105 3300021320 Bacteria 114109
112 Ga0214542_1000029 3300021321 Bacteria 174097
113 Ga0214543_1000027 3300021327 Bacteria 215065
114 Ga0214543_1000040 3300021327 Bacteria 174142
115 Ga0228710_1000008 3300022740 Bacteria 174306
116 Ga0209435_100026 3300025206 Bacteria 198295
117 Ga0209436_100054 3300025208 Bacteria 62857
118 Ga0209672_103076 3300025228 Bacteria 3630
119 Ga0209437_100050 3300025233 Bacteria 394010
120 Ga0209437_100056 3300025233 Bacteria 363071
121 Ga0207425_1000012 3300025245 Bacteria 528324
122 Ga0209646_1000084 3300025246 Bacteria 198295
123 Ga0209026_1000080 3300025250 Bacteria 198295
124 Ga0209677_100965 3300025253 Bacteria 13977
125 Ga0209148_1000056 3300025254 Bacteria 363380
126 Ga0209759_1000061 3300025256 Bacteria 198295
127 Ga0209129_1000110 3300025258 Bacteria 150918
128 Ga0209129_1000192 3300025258 Bacteria 83041
129 Ga0209129_1000322 3300025258 Bacteria 42277
130 Ga0209129_1002601 3300025258 Bacteria 8623
131 Ga0209129_1002974 3300025258 Bacteria 7724
132 Ga0209129_1007653 3300025258 Bacteria 3161
133 Ga0209129_1009984 3300025258 Bacteria 2420
134 Ga0209233_1000037 3300025261 Bacteria 554620
135 Ga0209233_1000071 3300025261 Bacteria 363290
136 Ga0209233_1000327 3300025261 Bacteria 49691
137 Ga0209455_1000285 3300025272 Bacteria 54489
138 Ga0209673_1000024 3300025273 Bacteria 409632
139 Ga0209673_1000063 3300025273 Bacteria 256709
140 Ga0209673_1002213 3300025273 Bacteria 14182
141 Ga0209673_1004086 3300025273 Bacteria 8039
142 Ga0209673_1010991 3300025273 Bacteria 3770
143 Ga0209673_1031389 3300025273 Bacteria 1654
144 Ga0209130_1000002 3300025284 Bacteria 722648
145 Ga0209130_1000005 3300025284 Bacteria 599620
146 Ga0209130_1012626 3300025284 Bacteria 2200
147 Ga0209676_1006349 3300025292 Bacteria 5859
148 Ga0209025_1000024 3300025294 Bacteria 528324
149 Ga0209025_1000377 3300025294 Bacteria 92728
150 Ga0209025_1000640 3300025294 Bacteria 61714
151 Ga0209025_1001341 3300025294 Bacteria 33186
152 Ga0209025_1002318 3300025294 Bacteria 20601
153 Ga0209025_1007903 3300025294 Bacteria 7792
154 Ga0209025_1013561 3300025294 Bacteria 5109
155 Ga0209025_1019667 3300025294 Bacteria 3741
156 Ga0209025_1025007 3300025294 Bacteria 3057
157 Ga0209564_1000093 3300025295 Bacteria 245793
158 Ga0209564_1000316 3300025295 Bacteria 94849
159 Ga0209564_1000850 3300025295 Bacteria 40751
160 Ga0209564_1001378 3300025295 Bacteria 25367
161 Ga0209564_1028987 3300025295 Bacteria 1753
162 Ga0209758_1000150 3300025297 Bacteria 163494
163 Ga0209758_1000260 3300025297 Bacteria 104985
164 Ga0209758_1002404 3300025297 Bacteria 19205
165 Ga0209758_1003956 3300025297 Bacteria 12860
166 Ga0209758_1012282 3300025297 Bacteria 4810
167 Ga0209758_1033693 3300025297 Bacteria 2051
168 Ga0209050_1009758 3300025298 Bacteria 4852
169 Ga0209050_1011244 3300025298 Bacteria 4278
170 Ga0209256_1000027 3300025299 Bacteria 423283
171 Ga0209256_1001654 3300025299 Bacteria 21679
172 Ga0209256_1004071 3300025299 Bacteria 9499
173 Ga0209256_1004369 3300025299 Bacteria 8944
174 Ga0209256_1010844 3300025299 Bacteria 3746
175 Ga0207426_1000013 3300025302 Bacteria 721897
176 Ga0207426_1000015 3300025302 Bacteria 599316
177 Ga0207426_1000070 3300025302 Bacteria 331559
178 Ga0207426_1006180 3300025302 Bacteria 5268
179 Ga0207426_1030014 3300025302 Bacteria 1787
180 Ga0209051_1000197 3300025303 Bacteria 106822
181 Ga0209051_1008107 3300025303 Bacteria 5616
182 Ga0209051_1011032 3300025303 Bacteria 4503
183 Ga0209051_1015226 3300025303 Bacteria 3549
184 Ga0209051_1043942 3300025303 Bacteria 1562
185 Ga0209257_1001105 3300025304 Bacteria 35073
186 Ga0209257_1001210 3300025304 Bacteria 32401
187 Ga0207655_1041768 3300025728 Bacteria 1961
188 Ga0207713_1037915 3300025735 Bacteria 2050
189 Ga0207647_10025575 3300025904 Bacteria 3876
190 Ga0207695_10000036 3300025913 Bacteria 477897
191 Ga0207671_10000153 3300025914 Bacteria 107114
192 Ga0207646_10008095 3300025922 Bacteria 10594
193 Ga0207681_10071220 3300025923 Bacteria 2424
194 Ga0207650_10000782 3300025925 Bacteria 24485
195 Ga0207659_10137639 3300025926 Bacteria 1892
196 Ga0207711_10147983 3300025941 Bacteria 2117
197 Ga0207668_10107749 3300025972 Bacteria 2084
198 Ga0207640_10107406 3300025981 Bacteria 1971
199 Ga0207678_10093546 3300026067 Bacteria 2568
200 Ga0207678_10107863 3300026067 Bacteria 2375
201 Ga0207702_10097326 3300026078 Bacteria 2590
202 Ga0207641_10103435 3300026088 Bacteria 2513
203 Ga0207683_10176060 3300026121 Bacteria 1939
204 Ga0209281_1000028 3300027111 Bacteria 440027
205 Ga0209281_1000306 3300027111 Bacteria 87720
206 Ga0209281_1000809 3300027111 Bacteria 28568
207 Ga0209371_1000009 3300027312 Bacteria 963030
208 Ga0209371_1000942 3300027312 Bacteria 22686
209 Ga0209371_1002557 3300027312 Bacteria 10046
210 Ga0209282_1000121 3300027666 Bacteria 49713
211 Ga0209282_1000274 3300027666 Bacteria 25687
212 Ga0209282_1048053 3300027666 Bacteria 2473
213 Ga0209813_10000391 3300027866 Bacteria 10873
214 Ga0207428_10001207 3300027907 Bacteria 27710
215 Ga0268266_10026360 3300028379 Bacteria 4945
216 Ga0268266_10066214 3300028379 Bacteria 3124
217 Ga0268266_10179605 3300028379 Bacteria 1926
218 Ga0268266_10290975 3300028379 Bacteria 1521
219 Ga0268265_10068168 3300028380 Bacteria 2757
220 Ga0307517_10092939 3300028786 Bacteria 2450
221 Ga0307515_10026670 3300028794 Bacteria 9929
222 Ga0307515_10117175 3300028794 Bacteria 3051
223 Ga0268256_1000010 3300030500 Bacteria 963034
224 Ga0268256_1002463 3300030500 Bacteria 9407
225 Ga0268256_1011473 3300030500 Bacteria 2799
226 Ga0268256_1038214 3300030500 Bacteria 1093
227 Ga0307513_10073472 3300031456 Bacteria 3560
228 Ga0316576_10365125 3300031727 Bacteria 1073
229 Ga0307516_10053978 3300031730 Bacteria 3928
230 Ga0307405_10001510 3300031731 Bacteria 9858
231 Ga0307410_10110398 3300031852 Bacteria 1989
232 Ga0307406_10002121 3300031901 Bacteria 10797
233 Ga0307407_10020794 3300031903 Bacteria 3370
234 Ga0307412_10000777 3300031911 Bacteria 18415
235 Ga0315914_1000754 3300031967 Bacteria 43901
236 Ga0307414_10306804 3300032004 Bacteria 1345
237 Ga0307411_10051108 3300032005 Bacteria 2695
238 Ga0307510_10014676 3300033180 Bacteria 9272
239 Ga0315913_1000195 3300033430 Bacteria 44144
240 Ga0315915_1000247 3300033464 Bacteria 49711
241 Ga0316587_1010349 3300033529 Bacteria 1491
242 Ga0316596_1003761 3300033541 Bacteria 3354
243 Ga0316596_1025986 3300033541 Bacteria 1508
244 Ga0373927_0006032 3300035695 Bacteria 8301
245 Ga0373925_0019083 3300037068 Bacteria 4985
246 Ga0395899_0000090 3300037312 Bacteria 156587
247 Ga0395900_0000017 3300037418 Bacteria 369602
248 Ga0395898_0000030 3300037466 Bacteria 369577
249 Ga0395905_0000081 3300037471 Bacteria 160409
250 Ga0395901_0000015 3300038443 Bacteria 373388
251 Ga0395901_0065263 3300038443 Bacteria 3790
252 Ga0395901_0134057 3300038443 Bacteria 2603
253 Ga0400483_008082 3300039062 Bacteria 11543
254 Ga0400483_070891 3300039062 Bacteria 4191
255 Ga0400483_189810 3300039062 Bacteria 2749
256 Ga0400483_209776 3300039062 Bacteria 2075
257 Ga0400483_210439 3300039062 Bacteria 2327
258 Ga0400483_267446 3300039062 Bacteria 9530
259 Ga0451787_012670 3300041441 Bacteria 3144
260 Ga0451798_0155342 3300041458 Bacteria 2533
261 Ga0451833_0106057 3300041491 Bacteria 4438
262 Ga0451839_0499510 3300041496 Bacteria 1466
263 Ga0451840_17434 3300041497 Bacteria 1208
264 Ga0451841_0249018 3300041498 Bacteria 2987
265 Ga0451847_0253069 3300041503 Bacteria 7757
266 Ga0451849_0240187 3300041505 Bacteria 3766
267 Ga0451851_0622038 3300041507 Bacteria 4766
268 Ga0451843_1077451 3300041509 Bacteria 4580
269 Ga0451854_18626 3300041510 Bacteria 2309
270 Ga0451853_3983291 3300041512 Bacteria 3410
271 Ga0495617_025521 3300046452 Bacteria 1992
272 Ga0495638_0073393 3300046460 Bacteria 2088
273 Ga0495605_0001299 3300046474 Bacteria 16555
274 Ga0495610_0027090 3300046512 Bacteria 3052
275 Ga0495610_0058911 3300046512 Bacteria 1835
276 Ga0495620_0014278 3300046515 Bacteria 4040
277 Ga0495632_0015362 3300046519 Bacteria 4298
278 Ga0495652_0129541 3300046529 Bacteria 1999
279 Ga0495654_0000661 3300046530 Bacteria 27152
280 Ga0495609_0039101 3300046538 Bacteria 2137
281 Ga0495597_0028043 3300046542 Bacteria 2579
282 Ga0495668_0012485 3300046616 Bacteria 5036
283 Ga0495625_0015581 3300046660 Bacteria 6014
284 Ga0495646_0087030 3300046680 Bacteria 1811
285 Ga0495671_0010393 3300046692 Bacteria 5158
286 Ga0495604_0046684 3300047317 Bacteria 3377
287 Ga0495686_0028312 3300047472 Bacteria 3649
288 Ga0495686_0108650 3300047472 Bacteria 1666
289 Ga0496102_0196417 3300048905 Bacteria 1901
290 Ga0496111_0000148 3300048914 Bacteria 31473
291 Ga0496116_0000817 3300048919 Bacteria 39421
292 Ga0496116_0020419 3300048919 Bacteria 5031
293 Ga0496116_0024318 3300048919 Bacteria 4484
294 Ga0496116_0026809 3300048919 Bacteria 4204
295 Ga0496116_0029539 3300048919 Bacteria 3950
296 Ga0496116_0043028 3300048919 Bacteria 3080
297 Ga0496117_0000002 3300048920 Bacteria 2483758
298 Ga0496117_0001790 3300048920 Bacteria 29267
299 Ga0496117_0003078 3300048920 Bacteria 19963
300 Ga0496117_0004943 3300048920 Bacteria 14321
301 Ga0496117_0014559 3300048920 Bacteria 6768
302 Ga0496117_0022611 3300048920 Bacteria 5039
303 Ga0496118_0002959 3300048921 Bacteria 22001
304 Ga0496118_0003699 3300048921 Bacteria 18959
305 Ga0496118_0017618 3300048921 Bacteria 6489
306 Ga0496118_0047854 3300048921 Bacteria 3310
307 Ga0496119_0021915 3300048922 Bacteria 4594
308 Ga0496119_0027341 3300048922 Bacteria 3923
309 Ga0496119_0028415 3300048922 Bacteria 3816
310 Ga0496119_0079370 3300048922 Bacteria 1896
311 Ga0496120_0002040 3300048923 Bacteria 21866
312 Ga0496120_0022937 3300048923 Bacteria 3916
313 Ga0496120_0031684 3300048923 Bacteria 3197
314 Ga0496120_0042334 3300048923 Bacteria 2660
315 Ga0496121_0000005 3300048924 Bacteria 1034486
316 Ga0496121_0002060 3300048924 Bacteria 31830
317 Ga0496121_0004411 3300048924 Bacteria 18960
318 Ga0496121_0008438 3300048924 Bacteria 12116
319 Ga0496121_0027658 3300048924 Bacteria 5301
320 Ga0496121_0041516 3300048924 Bacteria 4018
321 Ga0496121_0205161 3300048924 Bacteria 1401
322 Ga0496122_0000001 3300048925 Bacteria 1827766
323 Ga0496122_0000321 3300048925 Bacteria 105353
324 Ga0496122_0000559 3300048925 Bacteria 76330
325 Ga0496122_0004983 3300048925 Bacteria 16067
326 Ga0496122_0034812 3300048925 Bacteria 4112
327 Ga0496122_0094968 3300048925 Bacteria 2016
328 Ga0496122_0111370 3300048925 Bacteria 1795
329 Ga0496123_0000001 3300048926 Bacteria 1831497
330 Ga0496123_0000435 3300048926 Bacteria 75306
331 Ga0496123_0002294 3300048926 Bacteria 24023
332 Ga0496123_0002453 3300048926 Bacteria 22987
333 Ga0496123_0021438 3300048926 Bacteria 5022
334 Ga0496123_0031270 3300048926 Bacteria 3875
335 Ga0496124_0000558 3300048927 Bacteria 63070
336 Ga0496124_0000855 3300048927 Bacteria 49698
337 Ga0496124_0002598 3300048927 Bacteria 23360
338 Ga0496124_0004301 3300048927 Bacteria 16726
339 Ga0496124_0008779 3300048927 Bacteria 10497
340 Ga0496124_0071750 3300048927 Bacteria 2869
341 Ga0496124_0112714 3300048927 Bacteria 2186
342 Ga0496124_0292250 3300048927 Bacteria 1182
343 Ga0496125_0000163 3300048928 Bacteria 148473
344 Ga0496125_0000628 3300048928 Bacteria 59302
345 Ga0496125_0006143 3300048928 Bacteria 13095
346 Ga0496125_0165146 3300048928 Bacteria 1497
347 Ga0496126_0000378 3300048929 Bacteria 92187
348 Ga0496126_0001398 3300048929 Bacteria 38223
349 Ga0496126_0074381 3300048929 Bacteria 3017
350 Ga0501033_0002685 3300049570 Bacteria 14934
351 Ga0501034_0123458 3300049571 Bacteria 2575
352 Ga0501034_0294144 3300049571 Bacteria 1561
353 Ga0501036_0126160 3300049572 Bacteria 2161
354 Ga0501036_0184590 3300049572 Bacteria 1755
355 Ga0501037_0067712 3300049573 Bacteria 2599
356 Ga0501038_0044615 3300049574 Bacteria 3850
357 Ga0501038_0111543 3300049574 Bacteria 2265
358 Ga0501039_0118104 3300049575 Bacteria 2077
359 Ga0501040_0220555 3300049576 Bacteria 1349
360 Ga0501043_0061963 3300049579 Bacteria 2937
361 Ga0501047_0194226 3300049581 Bacteria 1892
362 Ga0501070_0068253 3300049586 Bacteria 2943
363 Ga0501073_0019253 3300049589 Bacteria 4931
364 Ga0501074_0053705 3300049590 Bacteria 2906
365 Ga0501080_0144440 3300049742 Bacteria 2199
366 Ga0501035_0001858 3300049822 Bacteria 21271
367 nmdc:mga03683_27355_c1 3300050489 Bacteria 2258
368 nmdc:mga00v17_1020_c1 3300050491 Bacteria 14978
369 nmdc:mga00v17_102_c1 3300050491 Bacteria 50732
370 nmdc:mga00v17_139_c1 3300050491 Bacteria 42380
371 nmdc:mga0yw44_1116_c1 3300050492 Bacteria 10359
372 nmdc:mga0k408_13257_c1 3300050493 Bacteria 3080
373 nmdc:mga0k408_162106_c1 3300050493 Bacteria 1333
374 nmdc:mga06z11_2829_c1 3300050494 Bacteria 6659
375 nmdc:mga07m45_126548_c1 3300050496 Bacteria 1478
376 nmdc:mga07m45_32093_c1 3300050496 Bacteria 2912
377 nmdc:mga0qj67_348064_c1 3300050509 Bacteria 1198
378 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
379 nmdc:mga0sz30_19036_c1 3300050516 Bacteria 2753
380 nmdc:mga0sz30_223_c1 3300050516 Bacteria 21634
381 Ga0500644_0018707 3300053088 Bacteria 2034
382 Ga0500641_0007723 3300053096 Bacteria 3833
383 Ga0500555_008752 3300053103 Bacteria 2889
384 Ga0500569_010349 3300053109 Bacteria 2194
385 Ga0500658_0000834 3300053134 Bacteria 12685
386 Ga0500559_0015974 3300053136 Bacteria 3169
387 Ga0500561_0000389 3300053137 Bacteria 7235
388 Ga0500573_0006984 3300053140 Bacteria 6132
389 Ga0500616_0000294 3300053153 Bacteria 72551
390 Ga0500616_0002294 3300053153 Bacteria 16178
391 Ga0500616_0074237 3300053153 Bacteria 1724
392 Ga0500622_0000117 3300053156 Bacteria 82720
393 Ga0500634_0006267 3300053161 Bacteria 5740
394 Ga0590071_005131 3300059421 Bacteria 3160
395 Ga0590075_004304 3300059424 Bacteria 3372
396 Ga0587084_003712 3300059477 Bacteria 1697
397 Ga0587066_005560 3300059490 Bacteria 1620
398 Ga0587066_008156 3300059490 Bacteria 1445
399 Ga0587066_015460 3300059490 Bacteria 1187
400 Ga0587070_008653 3300059491 Bacteria 1448
401 Ga0587070_008714 3300059491 Bacteria 1445
402 Ga0587070_012780 3300059491 Bacteria 1283
403 Ga0587077_001317 3300059493 Bacteria 2625
404 Ga0587077_016361 3300059493 Bacteria 1248
405 Ga0587080_014954 3300059503 Bacteria 1207
406 Ga0587082_000987 3300059504 Bacteria 2743
407 Ga0587082_005079 3300059504 Bacteria 1693
408 Ga0587083_0020043 3300059505 Bacteria 1228
409 Ga0587085_009703 3300059506 Bacteria 1260
410 Ga0587086_008626 3300059507 Bacteria 1195
411 Ga0587088_000476 3300059508 Bacteria 3310
412 Ga0587088_011624 3300059508 Bacteria 1315
413 Ga0587089_001595 3300059509 Bacteria 2150
414 Ga0587090_002648 3300059510 Bacteria 1993
415 Ga0587090_012749 3300059510 Bacteria 1204
416 Ga0587091_000290 3300059511 Bacteria 3883
417 Ga0587091_003576 3300059511 Bacteria 1969
418 Ga0587091_010807 3300059511 Bacteria 1407
419 Ga0587092_015003 3300059512 Bacteria 1130
420 Ga0587094_010609 3300059513 Bacteria 1198
421 Ga0587125_000753 3300059607 Bacteria 2088
422 Ga0587099_003394 3300059622 Bacteria 1319
423 Ga0587101_001563 3300059623 Bacteria 2000
424 Ga0587101_007717 3300059623 Bacteria 1279
425 Ga0587127_001454 3300059629 Bacteria 1332
426 Ga0587128_000635 3300059630 Bacteria 2786
427 Ga0587128_005209 3300059630 Bacteria 1544
428 Ga0587062_000279 3300059639 Bacteria 3254
429 Ga0587062_005667 3300059639 Bacteria 1389
430 Ga0587068_018148 3300059641 Bacteria 1130
431 Ga0587072_001742 3300059643 Bacteria 2784
432 Ga0587072_008323 3300059643 Bacteria 1640
433 Ga0587072_011694 3300059643 Bacteria 1439
434 Ga0587072_018958 3300059643 Bacteria 1200
435 Ga0587075_004320 3300059644 Bacteria 1643
436 Ga0587076_002999 3300059645 Bacteria 1963
437 Ga0587079_001526 3300059647 Bacteria 2621
438 Ga0587079_002606 3300059647 Bacteria 2237
439 Ga0587102_004418 3300059649 Bacteria 1200
440 Ga0587104_001713 3300059650 Bacteria 1202
441 Ga0587107_002266 3300059652 Bacteria 1717
442 Ga0587108_000558 3300059653 Bacteria 1961
443 Ga0587119_003891 3300059658 Bacteria 1450
444 Ga0587071_020808 3300060344 Bacteria 1199
445 Ga0587111_0001234 3300060346 Bacteria 2981
446 Ga0587111_0001516 3300060346 Bacteria 2822
447 Ga0587111_0004398 3300060346 Bacteria 2093
448 Ga0587111_0007902 3300060346 Bacteria 1746
449 2509109047 2508501122 Bacteria 6292184
450 2509118985 2508501123 Bacteria 6283661
451 2509141172 2508501127 Bacteria 7037543
452 2509370949 2509276018 Bacteria 6910194
453 2509375219 2509276019 Bacteria 6802256
454 2509397933 2509276022 Bacteria 6200534
455 2510283945 2510065053 Bacteria 5005518
456 2510293382 2510065055 Bacteria 5037935
457 2510303440 2510065057 Bacteria 6649661
458 2510312874 2510065058 Bacteria 5005894
459 2510316512 2510065059 Bacteria 6847884
460 2510839445 2510461069 Bacteria 5505000
461 2511134685 2510917022 Bacteria 6504556
462 2511172673 2510917026 Bacteria 7046020
463 2511186900 2510917028 Bacteria 6185411
464 2511197801 2510917030 Bacteria 7460662
465 2511391212 2511231027 Bacteria 5013807
466 2511500239 2511231052 Bacteria 6974333
467 2512531733 2512047086 Bacteria 6850303
468 2512929594 2512875016 Bacteria 6529530
469 2512964377 2512875024 Bacteria 7195110
470 2512972968 2512875026 Bacteria 6861065
471 2513582349 2513237086 Bacteria 7265287
472 2513597360 2513237088 Bacteria 6927906
473 2513604450 2513237089 Bacteria 6553624
474 2513616052 2513237091 Bacteria 6900273
475 2513869079 2513237138 Bacteria 7368160
476 2513884746 2513237140 Bacteria 7076289
477 2513905141 2513237143 Bacteria 6664116
478 2513986785 2513237156 Bacteria 6402557
479 2513996531 2513237159 Bacteria 6810126
480 2514007149 2513237160 Bacteria 6650282
481 2514036910 2513237164 Bacteria 7563725
482 2514422853 2513237305 Bacteria 7293571
483 2514591554 2513237351 Bacteria 6968952
484 2515607512 2515154107 Bacteria 6795637
485 2516204542 2516143018 Bacteria 6951533
486 2516891640 2516653046 Bacteria 6989037
487 2517568415 2517487022 Bacteria 7227575
488 2524450754 2524023207 Bacteria 6813453
489 2524458182 2524023209 Bacteria 6679728
490 2535514838 2534681796 Bacteria 7146037
491 2537877211 2537561587 Bacteria 5425293
492 2551680038 2551306084 Bacteria 8942552
493 2551683607 2551306085 Bacteria 7347181
494 2551690903 2551306086 Bacteria 6843938
495 2551704050 2551306087 Bacteria 7351905
496 2551713687 2551306089 Bacteria 7162724
497 2551717234 2551306090 Bacteria 7953713
498 2551727621 2551306091 Bacteria 7086830
499 2551737136 2551306092 Bacteria 6992595
500 2551742362 2551306093 Bacteria 7064773
501 2554246106 2554235003 Bacteria 5877155
502 2558866321 2558860100 Bacteria 8458965
503 2559293329 2558860242 Bacteria 5568029
504 2561469312 2558860983 Bacteria 4133860
505 2585223525 2582581298 Bacteria 7315509
506 2585229584 2582581299 Bacteria 6518058
507 2585256128 2582581304 Bacteria 5831370
508 2585273766 2582581307 Bacteria 6597605
509 2585280058 2582581308 Bacteria 7413247
510 2585326165 2582581315 Bacteria 7318924
511 2585330331 2582581316 Bacteria 7774528
512 2585392146 2582581866 Bacteria 6859583
513 2585398819 2582581867 Bacteria 7184437
514 2585533690 2585427527 Bacteria 7273426
515 2585545879 2585427529 Bacteria 7395659
516 2585553283 2585427530 Bacteria 7383882
517 2585559940 2585427531 Bacteria 6992870
518 2585819061 2585427590 Bacteria 6824633
519 2585843976 2585427594 Bacteria 6180594
520 2585900616 2585427608 Bacteria 6544331
521 2585905881 2585427609 Bacteria 6667127
522 2585996398 2585427633 Bacteria 6413184
523 2586001006 2585427634 Bacteria 6455027
524 2587979004 2585428125 Bacteria 6662905
525 2588515166 2588253730 Bacteria 6881675
526 2597815896 2597489875 Bacteria 7010078
527 2599332807 2599185156 Bacteria 5403036
528 2599604212 2599185210 Bacteria 5624189
529 2599722569 2599185236 Bacteria 6875203
530 2600191175 2599185352 Bacteria 7228948
531 2600373661 2600254933 Bacteria 4750527
532 2601609653 2600255279 Bacteria 5605316
533 2601746428 2600255308 Bacteria 5611129
534 2616309306 2615840626 Bacteria 7921970
535 2616553220 2615840698 Bacteria 7319877
536 2617380440 2617270742 Bacteria 6808054
537 2643774140 2643221550 Bacteria 4619371
538 2643774761 2643221551 Bacteria 3750538
539 2643793205 2643221555 Bacteria 3749717
540 2643806061 2643221557 Bacteria 7184309
541 2643813885 2643221558 Bacteria 5460675
542 2643838595 2643221564 Bacteria 4193379
543 2643857449 2643221568 Bacteria 5187270
544 2643920485 2643221582 Bacteria 5804683
545 2643989065 2643221595 Bacteria 6565519
546 2644004667 2643221599 Bacteria 6292121
547 2644066238 2643221610 Bacteria 7480339
548 2644132710 2643221623 Bacteria 5239945
549 2644152250 2643221627 Bacteria 6761570
550 2644237419 2643221643 Bacteria 5749658
551 2644377322 2643221668 Bacteria 7306521
552 2644417569 2643221675 Bacteria 7473456
553 2644450965 2643221680 Bacteria 7473610
554 2644519705 2643221693 Bacteria 5513853
555 2644671745 2643221723 Bacteria 7095460
556 2644692612 2643221726 Bacteria 7455827
557 2657683002 2657244999 Bacteria 5946535
558 2671113846 2667528174 Bacteria 6435400
559 2688600346 2687453392 Bacteria 6880454
560 2715499417 2713897090 Bacteria 3353799
561 2723577638 2721755686 Bacteria 7343952
562 2738804509 2738541293 Bacteria 7065685
563 2738947232 2738541317 Bacteria 5340176
564 2739308605 2738543024 Bacteria 5603683
565 2753462661 2751185821 Bacteria 6189929
566 2756673090 2756170246 Bacteria 7451806
567 2757570205 2757320392 Bacteria 3737298
568 2765467241 2765235802 Bacteria 5618596
569 2770198744 2767802442 Bacteria 5747986
570 2774131886 2773857672 Bacteria 4993178
571 2776273048 2775506902 Bacteria 6208009
572 2776282109 2775506904 Bacteria 5954060
573 2776911797 2775507049 Bacteria 6284736
574 2778177131 2775507266 Bacteria 7392367
575 2792583122 2791355082 Bacteria 5973319
576 2792621205 2791355091 Bacteria 6135441
577 2792625420 2791355092 Bacteria 6248105
578 2792637852 2791355094 Bacteria 7011481
579 2793283394 2791355253 Bacteria 5171699
580 2802718536 2802428858 Bacteria 6636079
581 2802724217 2802428859 Bacteria 6667919
582 2802730122 2802428860 Bacteria 6525526
583 2802737464 2802428861 Bacteria 6534206
584 2802742380 2802428862 Bacteria 6633353
585 2802749063 2802428863 Bacteria 6410669
586 2804750719 2802429268 Bacteria 6094027
587 2808986902 2808606387 Bacteria 5697198
588 2819556977 2818991439 Bacteria 6907412
589 2819608591 2818991448 Bacteria 6772224
590 2819640700 2818991453 Bacteria 7181617
591 2819686401 2818991461 Bacteria 7026071
592 2821129268 2821123053 Bacteria 7836056
593 2837682304 2837678835 Bacteria 5252418
594 2838029474 2838029111 Bacteria 6603031
595 2838075136 2838074704 Bacteria 6785777
596 2838677717 2838675328 Bacteria 4909118
597 2838716606 2838714209 Bacteria 5525906
598 2838719594 2838719591 Bacteria 5523910
599 2838727357 2838724970 Bacteria 4908691
600 2838742107 2838736955 Bacteria 5760694
601 2839996458 2839993093 Bacteria 5512535
602 2840770401 2840764183 Bacteria 6358399
603 2841734964 2841734538 Bacteria 6784580
604 2841845963 2841840854 Bacteria 5761912
605 2841846523 2841846520 Bacteria 5345850
606 2841860944 2841859092 Bacteria 5436171
607 2842127448 2842124991 Bacteria 5346824
608 2842132610 2842130223 Bacteria 4909145
609 2842145672 2842140634 Bacteria 5759631
610 2842152221 2842152218 Bacteria 4908957
611 2842172852 2842170452 Bacteria 5525737
612 2842175840 2842175837 Bacteria 4908771
613 2842189714 2842187318 Bacteria 5524014
614 2842214028 2842211629 Bacteria 5523832
615 2842224354 2842224351 Bacteria 5524473
616 2842299633 2842298080 Bacteria 6123127
617 2842361062 2842357229 Bacteria 6485165
618 2842476096 2842475841 Bacteria 6603183
619 2842486182 2842482326 Bacteria 7212537
620 2842503002 2842502639 Bacteria 6604161
621 2842512856 2842509118 Bacteria 6850950
622 2842517729 2842515876 Bacteria 5436280
623 2842521457 2842521101 Bacteria 6569494
624 2842875795 2842871566 Bacteria 4827117
625 2842923083 2842922631 Bacteria 5824079
626 2844005539 2844002411 Bacteria 7168230
627 2844015658 2844009547 Bacteria 6728125
628 2847672030 2847670302 Bacteria 6165597
629 2847688340 2847686936 Bacteria 6278406
630 2850079719 2850079185 Bacteria 6848280
631 2852388264 2852387548 Bacteria 8025568
632 2854899806 2854896431 Bacteria 5869725
633 2854920974 2854916844 Bacteria 5725939
634 2855828007 2855825444 Bacteria 6785811
635 2855839777 2855839649 Bacteria 7135830
636 2856318230 2856314179 Bacteria 6477897
637 2856324198 2856320880 Bacteria 7263508
638 2856328640 2856328259 Bacteria 6528202
639 2856337442 2856334872 Bacteria 7037011
640 2856345371 2856342000 Bacteria 7176905
641 2856351208 2856349417 Bacteria 6230045
642 2856360374 2856356410 Bacteria 6297484
643 2856364873 2856364286 Bacteria 6939991
644 2857354871 2857349434 Bacteria 7926032
645 2857370966 2857367948 Bacteria 6965560
646 2857536209 2857531043 Bacteria 6754041
647 2858803652 2858800743 Bacteria 6603254
648 2869175871 2869169390 Bacteria 6659796
649 2869240575 2869234852 Bacteria 6654993
650 2869253612 2869249662 Bacteria 6868783
651 2869259413 2869256925 Bacteria 6981691
652 2869278540 2869271264 Bacteria 6908218
653 2869281804 2869278585 Bacteria 7077053
654 2869289678 2869285874 Bacteria 6901219
655 2871431744 2871429161 Bacteria 6547891
656 2871438214 2871435913 Bacteria 6880295
657 2871456891 2871451962 Bacteria 7336357
658 2871466051 2871459585 Bacteria 6866887
659 2871475427 2871474448 Bacteria 6806570
660 2871494140 2871488783 Bacteria 6929816
661 2871499002 2871495908 Bacteria 6935695
662 2874103964 2874102143 Bacteria 6342645
663 2874111426 2874109183 Bacteria 6517025
664 2874127771 2874123672 Bacteria 7238285
665 2874140518 2874139085 Bacteria 7021506
666 2874155422 2874146452 Bacteria 7533118
667 2874162279 2874155637 Bacteria 6724144
668 2874166607 2874162495 Bacteria 6174670
669 2876366844 2876363079 Bacteria 6544991
670 2876375288 2876369609 Bacteria 6807521
671 2876387424 2876386047 Bacteria 6698674
672 2876398819 2876392853 Bacteria 6660880
673 2876404654 2876399893 Bacteria 6927900
674 2876412213 2876406927 Bacteria 6191900
675 2876420767 2876413966 Bacteria 6831344
676 2876427009 2876420981 Bacteria 6687741
677 2878037542 2878035449 Bacteria 6555736
678 2878739464 2878738818 Bacteria 7136951
679 2878748350 2878745973 Bacteria 6867388
680 2878756715 2878753008 Bacteria 6922523
681 2878763212 2878760144 Bacteria 6823465
682 2878770190 2878767105 Bacteria 6898628
683 2878776240 2878774303 Bacteria 6108671
684 2881153959 2881147464 Bacteria 7779814
685 2881157665 2881155292 Bacteria 6461656
686 2881163032 2881161766 Bacteria 7127907
687 2881851059 2881845957 Bacteria 6611900
688 2881859873 2881853255 Bacteria 6698367
689 2882636931 2882632389 Bacteria 8154593
690 2882915405 2882912400 Bacteria 6801539
691 2885311967 2885305155 Bacteria 7348390
692 2885315937 2885312484 Bacteria 6415165
693 2885325347 2885318864 Bacteria 6729568
694 2885331751 2885326080 Bacteria 7134805
695 2885342082 2885334103 Bacteria 7216818
696 2885349700 2885342637 Bacteria 7011821
697 2885353320 2885350715 Bacteria 6787678
698 2888341723 2888337043 Bacteria 6629336
699 2888349013 2888343758 Bacteria 6611049
700 2888350865 2888350351 Bacteria 7372807
701 2889021936 2889016732 Bacteria 6700763
702 2891374760 2891373044 Bacteria 5202277
703 2894656895 2894652903 Bacteria 4587256
704 2896388545 2896384573 Bacteria 7700774
705 2899260484 2899259804 Bacteria 3320927
706 2899794231 2899792073 Bacteria 4926588
707 2899808783 2899803654 Bacteria 5577784
708 2899848995 2899845264 Bacteria 5672268
709 2903453688 2903448605 Bacteria 7357801
710 2903502356 2903492973 Bacteria 13473544
711 2903506027 2903492973 Bacteria 13473544
712 2903521119 2903513507 Bacteria 6344008
713 2903524711 2903521522 Bacteria 6525694
714 2903531046 2903528002 Bacteria 6586099
715 2903543803 2903540706 Bacteria 7062119
716 2904582594 2904578770 Bacteria 5302906
717 2904665351 2904659560 Bacteria 6685615
718 2906311967 2906308376 Bacteria 6841989
719 2906323705 2906321335 Bacteria 6579571
720 2906331504 2906328253 Bacteria 6585166
721 2906365047 2906363423 Bacteria 6856682
722 2906371137 2906370794 Bacteria 6881062
723 2906385714 2906378014 Bacteria 6911440
724 2906389235 2906386501 Bacteria 5977019
725 2906405898 2906401398 Bacteria 6693206
726 2906408441 2906408224 Bacteria 6162342
727 2906418267 2906414383 Bacteria 6580790
728 2913298192 2913295892 Bacteria 6333755
729 2913312671 2913308742 Bacteria 5350706
730 2915986459 2915980308 Bacteria 6624279
731 2915987788 2915986958 Bacteria 6739310
732 2915997216 2915993759 Bacteria 7016183
733 2916000878 2916000859 Bacteria 6865702
734 2916014110 2916007675 Bacteria 6898660
735 2916021239 2916014648 Bacteria 6946486
736 2916021934 2916021584 Bacteria 6854472
737 2916034157 2916028427 Bacteria 6748433
738 2916040800 2916035215 Bacteria 6755766
739 2916042645 2916041962 Bacteria 6820487
740 2916053608 2916048683 Bacteria 6543552
741 2916057016 2916055098 Bacteria 6758838
742 2916065199 2916061851 Bacteria 6737736
743 2916072746 2916068649 Bacteria 6943657
744 2916078431 2916076590 Bacteria 6596108
745 2919101593 2919100787 Bacteria 7710546
746 2919116822 2919114240 Bacteria 5700270
747 2919124074 2919119836 Bacteria 5208557
748 2919166572 2919166419 Bacteria 4952238
749 2919174521 2919171160 Bacteria 6499771
750 2919408614 2919408235 Bacteria 6149349
751 2919451394 2919450847 Bacteria 5631160
752 2920763612 2920760137 Bacteria 7427611
753 2920823095 2920822456 Bacteria 6897201
754 2921207088 2921201388 Bacteria 6926299
755 2921213749 2921208531 Bacteria 6745326
756 2921241470 2921237296 Bacteria 6876710
757 2921247034 2921244191 Bacteria 6568419
758 2921252693 2921250672 Bacteria 6677771
759 2921262783 2921257292 Bacteria 6808382
760 2921268762 2921263974 Bacteria 6864552
761 2921288163 2921282425 Bacteria 6826397
762 2921293742 2921289301 Bacteria 7316391
763 2921299391 2921296804 Bacteria 7176999
764 2922136671 2922130491 Bacteria 7173936
765 2922153489 2922151315 Bacteria 6902399
766 2922178136 2922172374 Bacteria 6167644
767 2922181988 2922178524 Bacteria 6025201
768 2922190564 2922185730 Bacteria 7113964
769 2923556455 2923556063 Bacteria 6793593
770 2924150714 2924144063 Bacteria 6883928
771 2924152765 2924150972 Bacteria 7169444
772 2924164697 2924158325 Bacteria 7188855
773 2924170782 2924165586 Bacteria 7260590
774 2924176924 2924172951 Bacteria 6749356
775 2924184913 2924179722 Bacteria 6843264
776 2924190388 2924186466 Bacteria 6876637
777 2924198941 2924193448 Bacteria 6955718
778 2924209310 2924207177 Bacteria 6917007
779 2924215021 2924214083 Bacteria 7080103
780 2924228247 2924221636 Bacteria 7113495
781 2924232701 2924228884 Bacteria 6633132
782 2924710789 2924710171 Bacteria 6752351
783 2924722384 2924718760 Bacteria 6331356
784 2924733137 2924726620 Bacteria 6271473
785 2924746346 2924741084 Bacteria 6661321
786 2924751417 2924748358 Bacteria 6154725
787 2924764399 2924762789 Bacteria 6561353
788 2924776989 2924776078 Bacteria 7492003
789 2924788304 2924784321 Bacteria 7416538
790 2926754834 2926754445 Bacteria 5964435
791 2926761999 2926760298 Bacteria 5505990
792 2928525206 2928521798 Bacteria 4960112
793 2929143228 2929138655 Bacteria 5810547
794 2933006868 2933006813 Bacteria 4912075
795 2933015540 2933011516 Bacteria 5439334
796 2933594069 2933594066 Bacteria 5594265
797 2936998503 2936996657 Bacteria 6298727
798 2937007753 2937002841 Bacteria 6934057
799 2937015002 2937009748 Bacteria 6746052
800 2937022254 2937016420 Bacteria 6782579
801 2937023422 2937023124 Bacteria 6815156
802 2937031552 2937029754 Bacteria 6424026
803 2937040550 2937036028 Bacteria 6846469
804 2937053318 2937049772 Bacteria 6757901
805 2937057589 2937056579 Bacteria 7107896
806 2937065392 2937063883 Bacteria 7199456
807 2937077166 2937071275 Bacteria 6984483
808 2937083274 2937078374 Bacteria 6610289
809 2937088778 2937084907 Bacteria 6618516
810 2937092095 2937091812 Bacteria 6979387
811 2937102748 2937098957 Bacteria 7249374
812 2937106462 2937106411 Bacteria 6947143
813 2937119425 2937113482 Bacteria 6505872
814 2937126236 2937119839 Bacteria 6597547
815 2937131659 2937126314 Bacteria 6771275
816 2937818210 2937813078 Bacteria 7783518
817 2937838571 2937836603 Bacteria 6811263
818 2937850643 2937848649 Bacteria 6983481
819 2937863163 2937861824 Bacteria 6660327
820 2937873655 2937868953 Bacteria 6639878
821 2937880294 2937877337 Bacteria 7246526
822 2937896417 2937891427 Bacteria 6357007
823 2937976159 2937972304 Bacteria 7532020
824 2937986502 2937980651 Bacteria 6517427
825 2937997653 2937994558 Bacteria 7036190
826 2954011253 2954011201 Bacteria 4762601
827 2957377750 2957375807 Bacteria 6425588
828 2957387104 2957382221 Bacteria 6737050
829 2957393333 2957388812 Bacteria 6778072
830 2957397779 2957395598 Bacteria 6822399
831 2957407247 2957402308 Bacteria 6741770
832 2957413368 2957408893 Bacteria 6558585
833 2957417722 2957415311 Bacteria 6991633
834 2957425292 2957422303 Bacteria 7172205
835 2957436840 2957430029 Bacteria 7022557
836 2957438883 2957437181 Bacteria 6568994
837 2957447344 2957443900 Bacteria 6869977
838 2957456633 2957450854 Bacteria 6765715
839 2957460651 2957457609 Bacteria 6967680
840 2957469514 2957464669 Bacteria 6568877
841 2957473424 2957471148 Bacteria 6797643
842 2957481933 2957478035 Bacteria 6756658
843 2957490953 2957484790 Bacteria 6703082
844 2957495733 2957491536 Bacteria 6695180
845 2957500715 2957498199 Bacteria 7126688
846 2957508077 2957505466 Bacteria 7253085
847 2958037765 2958034702 Bacteria 6989922
848 2958047477 2958041894 Bacteria 13082850
849 2958056269 2958041894 Bacteria 13082850
850 2958074601 2958071322 Bacteria 6815895
851 2958087430 2958084443 Bacteria 7312792
852 2958100067 2958092219 Bacteria 6861151
853 2958104017 2958100919 Bacteria 6800575
854 2958112668 2958108152 Bacteria 6681128
855 2958116700 2958115193 Bacteria 6923548
856 2958128843 2958122699 Bacteria 7280457
857 2958134051 2958130278 Bacteria 6897202
858 2958142978 2958137437 Bacteria 6050276
859 2958149074 2958144490 Bacteria 6677056
860 2958164527 2958158011 Bacteria 6058449
861 2958168127 2958165035 Bacteria 6906348
862 2958183697 2958179912 Bacteria 6874908
863 2960590281 2960584000 Bacteria 6864594
864 2960594549 2960591022 Bacteria 6622873
865 2960603337 2960597568 Bacteria 6550735
866 2960607856 2960603979 Bacteria 6898737
867 2960611676 2960610863 Bacteria 6691244
868 2960620073 2960617483 Bacteria 6727748
869 2960626723 2960624210 Bacteria 6875384
870 2960637189 2960631154 Bacteria 6732508
871 2960641488 2960637947 Bacteria 7296468
872 2960648132 2960645483 Bacteria 7211087
873 2960654429 2960652885 Bacteria 7083688
874 2960660628 2960660292 Bacteria 7041660
875 2960672137 2960667422 Bacteria 6763020
876 2960678668 2960674078 Bacteria 6609048
877 2960684439 2960680706 Bacteria 6624464
878 2960687455 2960687367 Bacteria 6535474
879 2960698588 2960693952 Bacteria 6749742
880 2961081663 2961077736 Bacteria 7079850
881 2961120351 2961114664 Bacteria 6680456
882 2961134138 2961127735 Bacteria 7196641
883 2961139441 2961136820 Bacteria 6775228
884 2961166592 2961163497 Bacteria 6901077
885 2961173005 2961170736 Bacteria 7072258
886 2961187025 2961183825 Bacteria 6688536
887 2963649638 2963644680 Bacteria 6530403
888 2964613466 2964607997 Bacteria 7101408
889 2964618379 2964615318 Bacteria 6809089
890 2964625502 2964621998 Bacteria 6834995
891 2964633738 2964628898 Bacteria 7083044
892 2964643097 2964636051 Bacteria 7091832
893 2964649430 2964643177 Bacteria 6820887
894 2964650116 2964649959 Bacteria 6675118
895 2964663128 2964656573 Bacteria 7100150
896 2964668046 2964663802 Bacteria 7019362
897 2964675453 2964670856 Bacteria 6851364
898 2964682633 2964678106 Bacteria 6792020
899 2964687635 2964685014 Bacteria 6839111
900 2964696616 2964691889 Bacteria 6802758
901 2964703995 2964698721 Bacteria 6765331
902 2964710272 2964705432 Bacteria 7114648
903 2964718903 2964712639 Bacteria 6695970
904 2964721984 2964719344 Bacteria 7286602
905 2965021415 2965018300 Bacteria 6883036
906 2965026261 2965025482 Bacteria 6532201
907 2965037533 2965032056 Bacteria 6887443
908 2965046564 2965040258 Bacteria 6855979
909 2965051309 2965047637 Bacteria 6623551
910 2965070153 2965062239 Bacteria 7412989
911 2965094968 2965089291 Bacteria 6866420
912 2965106520 2965102966 Bacteria 6800987
913 2967671423 2967664464 Bacteria 6948836
914 2967678472 2967671571 Bacteria 7021409
915 2967682540 2967678726 Bacteria 7264382
916 2967690375 2967686174 Bacteria 6678622
917 2967694854 2967693043 Bacteria 6804451
918 2967703584 2967699805 Bacteria 6854538
919 2967712723 2967706974 Bacteria 7186053
920 2967714448 2967714385 Bacteria 7000047
921 2967723772 2967721400 Bacteria 7073753
922 2967730341 2967728569 Bacteria 6641507
923 2967739198 2967735183 Bacteria 6827012
924 2967746355 2967742019 Bacteria 6794534
925 2967754719 2967748971 Bacteria 6733771
926 2967758201 2967755722 Bacteria 6814706
927 2967766605 2967762386 Bacteria 6923502
928 2967769890 2967769361 Bacteria 6587838
929 2967998216 2967996073 Bacteria 6787468
930 2968008868 2968003550 Bacteria 6929263
931 2968019387 2968016561 Bacteria 7022047
932 2968087052 2968083720 Bacteria 7351627
933 2968095696 2968091066 Bacteria 6052692
934 2968099616 2968097103 Bacteria 6107094
935 2968116818 2968110612 Bacteria 6814636
936 2968118544 2968117919 Bacteria 6536078
937 2968131876 2968128360 Bacteria 6270294
938 2968145753 2968138860 Bacteria 6605449
939 2968174997 2968171901 Bacteria 6894245
940 2970027285 2970026789 Bacteria 6785236
941 2970034749 2970033650 Bacteria 7118744
942 2970041065 2970040964 Bacteria 6731123
943 2970049493 2970047711 Bacteria 7088379
944 2970056899 2970054988 Bacteria 6611507
945 2970062213 2970061556 Bacteria 7099761
946 2970069776 2970068827 Bacteria 7123112
947 2970080802 2970076120 Bacteria 6697332
948 2970088138 2970082768 Bacteria 6183754
949 2970089451 2970088815 Bacteria 6933825
950 2970098841 2970095765 Bacteria 6936963
951 2970106034 2970102677 Bacteria 6812532
952 2970110956 2970109326 Bacteria 6863976
953 2970118213 2970116247 Bacteria 6501857
954 2970125239 2970122695 Bacteria 6625855
955 2970131352 2970129317 Bacteria 6806560
956 2970142089 2970136068 Bacteria 7207982
957 2970144231 2970143518 Bacteria 6446480
958 2970154563 2970149975 Bacteria 6779706
959 2970163738 2970156795 Bacteria 7168044
960 2970170167 2970164137 Bacteria 6861252
961 2970175876 2970170962 Bacteria 6876229
962 2970183608 2970177841 Bacteria 6768001
963 2970188743 2970184632 Bacteria 7054431
964 2970197503 2970191845 Bacteria 7032787
965 2970472708 2970469710 Bacteria 6969209
966 2970494715 2970489779 Bacteria 6517260
967 2970505599 2970503327 Bacteria 7099517
968 2970515901 2970510686 Bacteria 7006402
969 2970529205 2970524798 Bacteria 6840927
970 2970539297 2970532167 Bacteria 6553173
971 2970544232 2970540015 Bacteria 6977556
972 2970550669 2970547951 Bacteria 6931819
973 2970558056 2970554993 Bacteria 6814252
974 2970596408 2970593180 Bacteria 7073582
975 2970624137 2970619444 Bacteria 6986144
976 2970627447 2970627176 Bacteria 6680862
977 2974301315 2974298342 Bacteria 4840922
978 2977521064 2977516862 Bacteria 6940108
979 2977528495 2977523885 Bacteria 6960446
980 2977531133 2977530762 Bacteria 6951399
981 2977543740 2977537788 Bacteria 6929320
982 2977550710 2977544691 Bacteria 6875412
983 2977554771 2977551784 Bacteria 7125765
984 2977563776 2977558990 Bacteria 6863948
985 2977571507 2977565890 Bacteria 6901543
986 2977574733 2977572785 Bacteria 6763888
987 2977584389 2977579622 Bacteria 6772100
988 2977825895 2977821940 Bacteria 6906439
989 2977836550 2977828996 Bacteria 7007971
990 2977851306 2977843712 Bacteria 6753583
991 2977854966 2977851361 Bacteria 6694324
992 2977874972 2977872689 Bacteria 7270173
993 2977927668 2977922695 Bacteria 6956781
994 2977938607 2977935797 Bacteria 6252826
995 2977946654 2977942078 Bacteria 7570577
996 2977955371 2977950692 Bacteria 6893264
997 2977960411 2977957713 Bacteria 6877875
998 2977979720 2977971508 Bacteria 7472917
999 2977989749 2977986579 Bacteria 6581278
1000 2978972963 2978969890 Bacteria 5400756
1001 2979092733 2979089926 Bacteria 5670289
1002 2979099877 2979095461 Bacteria 5669583
1003 2979104706 2979100975 Bacteria 5423623
1004 2979748530 2979742915 Bacteria 7301278
1005 2979776253 2979772303 Bacteria 6618277
1006 2979781247 2979779861 Bacteria 6219781
1007 2979799720 2979793036 Bacteria 6808957
1008 2979810320 2979808191 Bacteria 7179355
1009 2984503792 2984499530 Bacteria 5020881
1010 2984513496 2984509177 Bacteria 5274802
1011 2984520135 2984518228 Bacteria 5277463
1012 2984539432 2984537506 Bacteria 5277481
1013 2984591211 2984587000 Bacteria 5263363
1014 2984601658 2984601300 Bacteria 5455244
1015 2987643473 2987636660 Bacteria 8088555
1016 2987649309 2987645492 Bacteria 6117018
1017 2987654954 2987652177 Bacteria 6969023
1018 2987662603 2987659509 Bacteria 6966464
1019 2987672755 2987666974 Bacteria 6509233
1020 2987679200 2987673487 Bacteria 6884027
1021 2989351924 2989349275 Bacteria 6349068
1022 2996313107 2996310559 Bacteria 6357320
1023 2996347096 2996341866 Bacteria 6643098
1024 2996352159 2996348954 Bacteria 7239054
1025 2996391949 2996386984 Bacteria 6978667
1026 2996888257 2996887358 Bacteria 5795980
1027 3000142073 3000135777 Bacteria 6891109
1028 3002145459 3002141150 Bacteria 5254435
1029 3003931472 3003930520 Bacteria 5667563
1030 3004191654 3004188549 Bacteria 6952365
1031 3004198773 3004195979 Bacteria 6776956
1032 3004207018 3004203850 Bacteria 7307914
1033 3004213938 3004211236 Bacteria 7417683
1034 3004223529 3004218560 Bacteria 7421728
1035 3004240050 3004239961 Bacteria 6892290
1036 3004254236 3004248173 Bacteria 6563236
1037 3004273270 3004268573 Bacteria 7043476
1038 3004278857 3004275668 Bacteria 7114440
1039 3004339175 3004334049 Bacteria 8449246
1040 3005422995 3005416602 Bacteria 7064308
1041 3005456624 3005452660 Bacteria 5889319
1042 637079340 637000159 Bacteria 7596297
1043 643824319 643692032 Bacteria 6891900
1044 648736826 648276728 Bacteria 6968865
1045 649874808 649633066 Bacteria 6690028
1046 650738564 650716007 Bacteria 5573770
1047 8001847915 8001845381 Bacteria 5804942
1048 8002288013 8002285264 Bacteria 6717907
1049 8003572103 8003570095 Bacteria 5747666
1050 8003992230 8003992118 Bacteria 7266902
1051 8003999496 8003999396 Bacteria 7063185
1052 8004306075 8004300914 Bacteria 6132239
1053 8004319338 8004312739 Bacteria 7444653
1054 8004362608 8004361976 Bacteria 6858373
1055 8004378303 8004374579 Bacteria 6898112
1056 8004391556 8004387939 Bacteria 7049250
1057 8004635884 8004633249 Bacteria 6723080
1058 8004698065 8004695233 Bacteria 6731676
1059 8004705041 8004703790 Bacteria 8006957
1060 8004716925 8004714634 Bacteria 6776161
1061 8005261191 8005258706 Bacteria 6184835
1062 8005315322 8005314921 Bacteria 7072929
1063 8005322784 8005321885 Bacteria 5795980
1064 8005484762 8005484373 Bacteria 6297373
1065 8005543510 8005542996 Bacteria 7077758
1066 8005649455 8005645114 Bacteria 6950293
1067 8005661770 8005658619 Bacteria 4500593
1068 8005685302 8005682033 Bacteria 6726518
1069 8005692507 8005688590 Bacteria 6610080
1070 8018153486 8018150411 Bacteria 5549903
1071 8024491589 8024486573 Bacteria 6540512
1072 8046770888 8046767195 Bacteria 7547379
1073 8049293271 8049293176 Bacteria 6128433
1074 8054463968 8054460903 Bacteria 4872905
1075 8054562430 8054558443 Bacteria 5204801
1076 8055433134 8055431914 Bacteria 4551896
1077 8055623282 8055617313 Bacteria 7548464
1078 8056876390 8056875544 Bacteria 4355797
1079 8057580503 8057575449 Bacteria 7367519
1080 Ga0587080_006015
1081 RicEn_C8857
1082 JGI24740J21852_10003158
1083 JGI25155J39150_1000013
1084 JGI25156J39149_1000011
1085 JGI25162J39368_1000689
1086 JGI25154J39366_1000030
1087 JGI25158J39367_1000035
1088 JGI25158J39367_1000131
1089 JGI25157J39369_1000013
1090 JGI25152J39213_1000865
1091 JGI25152J39213_1001575
1092 JGI25152J39213_1009843
1093 JGI25159J45721_1000003
1094 JGI25159J45721_1000744
1095 JGI25151J46595_10003116
1096 JGI25151J46595_10006323
1097 JGI25151J46595_10021695
1098 JGI25165J46597_1000570
1099 JGI25165J46597_1000585
1100 JGI25153J46596_10012357
1101 JGI25160J50197_1000003
1102 JGI25160J50197_1003267
1103 JGI25160J50197_1009347
1104 JGI25161J50226_1000117
1105 JGI25161J50226_1000239
1106 JGI25161J50226_1003492
1107 Ga0006562J51391_1004927
1108 Ga0055526_1003533
1109 Ga0055526_1004786
1110 Ga0055526_1005685
1111 Ga0055526_1008119
1112 Ga0055524_1000434
1113 Ga0055524_1002834
1114 Ga0055524_1004206
1115 Ga0055524_1012460
1116 Ga0055536_1001453
1117 Ga0055528_1000594
1118 Ga0055528_1000980
1119 Ga0055528_1006042
1120 Ga0055528_1028470
1121 Ga0055528_1036924
1122 Ga0055540_1000272
1123 Ga0055540_1012520
1124 Ga0055540_1019494
1125 Ga0055531_10004167
1126 Ga0058692_1002864
1127 Ga0055543_1000037
1128 Ga0055543_1000043
1129 Ga0055543_1000774
1130 Ga0065165_1000025
1131 Ga0065165_1004348
1132 Ga0065165_1011568
1133 Ga0070670_100000804
1134 Ga0070668_100129247
1135 Ga0070669_100066935
1136 Ga0070663_100144349
1137 Ga0070707_100006738
1138 Ga0070665_100000937
1139 Ga0070665_100094359
1140 Ga0068855_100112120
1141 Ga0068854_100015003
1142 Ga0068856_100034847
1143 Ga0068852_100049407
1144 Ga0068863_100225197
1145 Ga0068860_100118591
1146 Ga0081538_10002139
1147 Ga0075365_10011572
1148 Ga0075368_10000351
1149 Ga0075364_10000006
1150 Ga0075364_10011946
1151 Ga0075364_10038606
1152 Ga0075362_10000690
1153 Ga0075362_10004229
1154 Ga0075367_10001705
1155 Ga0075369_10013253
1156 Ga0075369_10080906
1157 Ga0075366_10024036
1158 Ga0075370_10018681
1159 Ga0075429_100152228
1160 Ga0079104_1000207
1161 Ga0079104_1003701
1162 Ga0099826_10000728
1163 Ga0099826_10036233
1164 Ga0105251_10046146
1165 Ga0105244_10041849
1166 Ga0105244_10051060
1167 Ga0105240_10000024
1168 Ga0111539_10000600
1169 Ga0105243_10005598
1170 Ga0105237_10000836
1171 Ga0123341_1000038
1172 Ga0123342_1018935
1173 Ga0105239_10002164
1174 Ga0105246_10124880
1175 Ga0157373_10026645
1176 Ga0157371_10000004
1177 Ga0157371_10005722
1178 Ga0157370_10001986
1179 Ga0157370_10002813
1180 Ga0157370_10068485
1181 Ga0157369_10004082
1182 Ga0157369_10073712
1183 Ga0171463_1001
1184 Ga0163163_10138594
1185 Ga0182008_10071246
1186 Ga0182007_10007500
1187 Ga0182007_10027450
1188 Ga0183363_1081
1189 Ga0206352_10289082
1190 Ga0214544_1000105
1191 Ga0214542_1000029
1192 Ga0214543_1000027
1193 Ga0214543_1000040
1194 Ga0228710_1000008
1195 Ga0209435_100026
1196 Ga0209436_100054
1197 Ga0209672_103076
1198 Ga0209437_100050
1199 Ga0209437_100056
1200 Ga0207425_1000012
1201 Ga0209646_1000084
1202 Ga0209026_1000080
1203 Ga0209677_100965
1204 Ga0209148_1000056
1205 Ga0209759_1000061
1206 Ga0209129_1000110
1207 Ga0209129_1000192
1208 Ga0209129_1000322
1209 Ga0209129_1002601
1210 Ga0209129_1002974
1211 Ga0209129_1007653
1212 Ga0209129_1009984
1213 Ga0209233_1000037
1214 Ga0209233_1000071
1215 Ga0209233_1000327
1216 Ga0209455_1000285
1217 Ga0209673_1000024
1218 Ga0209673_1000063
1219 Ga0209673_1002213
1220 Ga0209673_1004086
1221 Ga0209673_1010991
1222 Ga0209673_1031389
1223 Ga0209130_1000002
1224 Ga0209130_1000005
1225 Ga0209130_1012626
1226 Ga0209676_1006349
1227 Ga0209025_1000024
1228 Ga0209025_1000377
1229 Ga0209025_1000640
1230 Ga0209025_1001341
1231 Ga0209025_1002318
1232 Ga0209025_1007903
1233 Ga0209025_1013561
1234 Ga0209025_1019667
1235 Ga0209025_1025007
1236 Ga0209564_1000093
1237 Ga0209564_1000316
1238 Ga0209564_1000850
1239 Ga0209564_1001378
1240 Ga0209564_1028987
1241 Ga0209758_1000150
1242 Ga0209758_1000260
1243 Ga0209758_1002404
1244 Ga0209758_1003956
1245 Ga0209758_1012282
1246 Ga0209758_1033693
1247 Ga0209050_1009758
1248 Ga0209050_1011244
1249 Ga0209256_1000027
1250 Ga0209256_1001654
1251 Ga0209256_1004071
1252 Ga0209256_1004369
1253 Ga0209256_1010844
1254 Ga0207426_1000013
1255 Ga0207426_1000015
1256 Ga0207426_1000070
1257 Ga0207426_1006180
1258 Ga0207426_1030014
1259 Ga0209051_1000197
1260 Ga0209051_1008107
1261 Ga0209051_1011032
1262 Ga0209051_1015226
1263 Ga0209051_1043942
1264 Ga0209257_1001105
1265 Ga0209257_1001210
1266 Ga0207655_1041768
1267 Ga0207713_1037915
1268 Ga0207647_10025575
1269 Ga0207695_10000036
1270 Ga0207671_10000153
1271 Ga0207646_10008095
1272 Ga0207681_10071220
1273 Ga0207650_10000782
1274 Ga0207659_10137639
1275 Ga0207711_10147983
1276 Ga0207668_10107749
1277 Ga0207640_10107406
1278 Ga0207678_10093546
1279 Ga0207678_10107863
1280 Ga0207702_10097326
1281 Ga0207641_10103435
1282 Ga0207683_10176060
1283 Ga0209281_1000028
1284 Ga0209281_1000306
1285 Ga0209281_1000809
1286 Ga0209371_1000009
1287 Ga0209371_1000942
1288 Ga0209371_1002557
1289 Ga0209282_1000121
1290 Ga0209282_1000274
1291 Ga0209282_1048053
1292 Ga0209813_10000391
1293 Ga0207428_10001207
1294 Ga0268266_10026360
1295 Ga0268266_10066214
1296 Ga0268266_10179605
1297 Ga0268266_10290975
1298 Ga0268265_10068168
1299 Ga0307517_10092939
1300 Ga0307515_10026670
1301 Ga0307515_10117175
1302 Ga0268256_1000010
1303 Ga0268256_1002463
1304 Ga0268256_1011473
1305 Ga0268256_1038214
1306 Ga0307513_10073472
1307 Ga0316576_10365125
1308 Ga0307516_10053978
1309 Ga0307405_10001510
1310 Ga0307410_10110398
1311 Ga0307406_10002121
1312 Ga0307407_10020794
1313 Ga0307412_10000777
1314 Ga0315914_1000754
1315 Ga0307414_10306804
1316 Ga0307411_10051108
1317 Ga0307510_10014676
1318 Ga0315913_1000195
1319 Ga0315915_1000247
1320 Ga0316587_1010349
1321 Ga0316596_1003761
1322 Ga0316596_1025986
1323 Ga0373927_0006032
1324 Ga0373925_0019083
1325 Ga0395899_0000090
1326 Ga0395900_0000017
1327 Ga0395898_0000030
1328 Ga0395905_0000081
1329 Ga0395901_0000015
1330 Ga0395901_0065263
1331 Ga0395901_0134057
1332 Ga0400483_008082
1333 Ga0400483_070891
1334 Ga0400483_189810
1335 Ga0400483_209776
1336 Ga0400483_210439
1337 Ga0400483_267446
1338 Ga0451787_012670
1339 Ga0451798_0155342
1340 Ga0451833_0106057
1341 Ga0451839_0499510
1342 Ga0451840_17434
1343 Ga0451841_0249018
1344 Ga0451847_0253069
1345 Ga0451849_0240187
1346 Ga0451851_0622038
1347 Ga0451843_1077451
1348 Ga0451854_18626
1349 Ga0451853_3983291
1350 Ga0495617_025521
1351 Ga0495638_0073393
1352 Ga0495605_0001299
1353 Ga0495610_0027090
1354 Ga0495610_0058911
1355 Ga0495620_0014278
1356 Ga0495632_0015362
1357 Ga0495652_0129541
1358 Ga0495654_0000661
1359 Ga0495609_0039101
1360 Ga0495597_0028043
1361 Ga0495668_0012485
1362 Ga0495625_0015581
1363 Ga0495646_0087030
1364 Ga0495671_0010393
1365 Ga0495604_0046684
1366 Ga0495686_0028312
1367 Ga0495686_0108650
1368 Ga0496102_0196417
1369 Ga0496111_0000148
1370 Ga0496116_0000817
1371 Ga0496116_0020419
1372 Ga0496116_0024318
1373 Ga0496116_0026809
1374 Ga0496116_0029539
1375 Ga0496116_0043028
1376 Ga0496117_0000002
1377 Ga0496117_0001790
1378 Ga0496117_0003078
1379 Ga0496117_0004943
1380 Ga0496117_0014559
1381 Ga0496117_0022611
1382 Ga0496118_0002959
1383 Ga0496118_0003699
1384 Ga0496118_0017618
1385 Ga0496118_0047854
1386 Ga0496119_0021915
1387 Ga0496119_0027341
1388 Ga0496119_0028415
1389 Ga0496119_0079370
1390 Ga0496120_0002040
1391 Ga0496120_0022937
1392 Ga0496120_0031684
1393 Ga0496120_0042334
1394 Ga0496121_0000005
1395 Ga0496121_0002060
1396 Ga0496121_0004411
1397 Ga0496121_0008438
1398 Ga0496121_0027658
1399 Ga0496121_0041516
1400 Ga0496121_0205161
1401 Ga0496122_0000001
1402 Ga0496122_0000321
1403 Ga0496122_0000559
1404 Ga0496122_0004983
1405 Ga0496122_0034812
1406 Ga0496122_0094968
1407 Ga0496122_0111370
1408 Ga0496123_0000001
1409 Ga0496123_0000435
1410 Ga0496123_0002294
1411 Ga0496123_0002453
1412 Ga0496123_0021438
1413 Ga0496123_0031270
1414 Ga0496124_0000558
1415 Ga0496124_0000855
1416 Ga0496124_0002598
1417 Ga0496124_0004301
1418 Ga0496124_0008779
1419 Ga0496124_0071750
1420 Ga0496124_0112714
1421 Ga0496124_0292250
1422 Ga0496125_0000163
1423 Ga0496125_0000628
1424 Ga0496125_0006143
1425 Ga0496125_0165146
1426 Ga0496126_0000378
1427 Ga0496126_0001398
1428 Ga0496126_0074381
1429 Ga0501033_0002685
1430 Ga0501034_0123458
1431 Ga0501034_0294144
1432 Ga0501036_0126160
1433 Ga0501036_0184590
1434 Ga0501037_0067712
1435 Ga0501038_0044615
1436 Ga0501038_0111543
1437 Ga0501039_0118104
1438 Ga0501040_0220555
1439 Ga0501043_0061963
1440 Ga0501047_0194226
1441 Ga0501070_0068253
1442 Ga0501073_0019253
1443 Ga0501074_0053705
1444 Ga0501080_0144440
1445 Ga0501035_0001858
1446 nmdc:mga03683_27355_c1
1447 nmdc:mga00v17_1020_c1
1448 nmdc:mga00v17_102_c1
1449 nmdc:mga00v17_139_c1
1450 nmdc:mga0yw44_1116_c1
1451 nmdc:mga0k408_13257_c1
1452 nmdc:mga0k408_162106_c1
1453 nmdc:mga06z11_2829_c1
1454 nmdc:mga07m45_126548_c1
1455 nmdc:mga07m45_32093_c1
1456 nmdc:mga0qj67_348064_c1
1457 nmdc:mga08y16_16_c1
1458 nmdc:mga0sz30_19036_c1
1459 nmdc:mga0sz30_223_c1
1460 Ga0500644_0018707
1461 Ga0500641_0007723
1462 Ga0500555_008752
1463 Ga0500569_010349
1464 Ga0500658_0000834
1465 Ga0500559_0015974
1466 Ga0500561_0000389
1467 Ga0500573_0006984
1468 Ga0500616_0000294
1469 Ga0500616_0002294
1470 Ga0500616_0074237
1471 Ga0500622_0000117
1472 Ga0500634_0006267
1473 Ga0590071_005131
1474 Ga0590075_004304
1475 Ga0587084_003712
1476 Ga0587066_005560
1477 Ga0587066_008156
1478 Ga0587066_015460
1479 Ga0587070_008653
1480 Ga0587070_008714
1481 Ga0587070_012780
1482 Ga0587077_001317
1483 Ga0587077_016361
1484 Ga0587080_014954
1485 Ga0587082_000987
1486 Ga0587082_005079
1487 Ga0587083_0020043
1488 Ga0587085_009703
1489 Ga0587086_008626
1490 Ga0587088_000476
1491 Ga0587088_011624
1492 Ga0587089_001595
1493 Ga0587090_002648
1494 Ga0587090_012749
1495 Ga0587091_000290
1496 Ga0587091_003576
1497 Ga0587091_010807
1498 Ga0587092_015003
1499 Ga0587094_010609
1500 Ga0587125_000753
1501 Ga0587099_003394
1502 Ga0587101_001563
1503 Ga0587101_007717
1504 Ga0587127_001454
1505 Ga0587128_000635
1506 Ga0587128_005209
1507 Ga0587062_000279
1508 Ga0587062_005667
1509 Ga0587068_018148
1510 Ga0587072_001742
1511 Ga0587072_008323
1512 Ga0587072_011694
1513 Ga0587072_018958
1514 Ga0587075_004320
1515 Ga0587076_002999
1516 Ga0587079_001526
1517 Ga0587079_002606
1518 Ga0587102_004418
1519 Ga0587104_001713
1520 Ga0587107_002266
1521 Ga0587108_000558
1522 Ga0587119_003891
1523 Ga0587071_020808
1524 Ga0587111_0001234
1525 Ga0587111_0001516
1526 Ga0587111_0004398
1527 Ga0587111_0007902
1528 2509109047
1529 2509118985
1530 2509141172
1531 2509370949
1532 2509375219
1533 2509397933
1534 2510283945
1535 2510293382
1536 2510303440
1537 2510312874
1538 2510316512
1539 2510839445
1540 2511134685
1541 2511172673
1542 2511186900
1543 2511197801
1544 2511391212
1545 2511500239
1546 2512531733
1547 2512929594
1548 2512964377
1549 2512972968
1550 2513582349
1551 2513597360
1552 2513604450
1553 2513616052
1554 2513869079
1555 2513884746
1556 2513905141
1557 2513986785
1558 2513996531
1559 2514007149
1560 2514036910
1561 2514422853
1562 2514591554
1563 2515607512
1564 2516204542
1565 2516891640
1566 2517568415
1567 2524450754
1568 2524458182
1569 2535514838
1570 2537877211
1571 2551680038
1572 2551683607
1573 2551690903
1574 2551704050
1575 2551713687
1576 2551717234
1577 2551727621
1578 2551737136
1579 2551742362
1580 2554246106
1581 2558866321
1582 2559293329
1583 2561469312
1584 2585223525
1585 2585229584
1586 2585256128
1587 2585273766
1588 2585280058
1589 2585326165
1590 2585330331
1591 2585392146
1592 2585398819
1593 2585533690
1594 2585545879
1595 2585553283
1596 2585559940
1597 2585819061
1598 2585843976
1599 2585900616
1600 2585905881
1601 2585996398
1602 2586001006
1603 2587979004
1604 2588515166
1605 2597815896
1606 2599332807
1607 2599604212
1608 2599722569
1609 2600191175
1610 2600373661
1611 2601609653
1612 2601746428
1613 2616309306
1614 2616553220
1615 2617380440
1616 2643774140
1617 2643774761
1618 2643793205
1619 2643806061
1620 2643813885
1621 2643838595
1622 2643857449
1623 2643920485
1624 2643989065
1625 2644004667
1626 2644066238
1627 2644132710
1628 2644152250
1629 2644237419
1630 2644377322
1631 2644417569
1632 2644450965
1633 2644519705
1634 2644671745
1635 2644692612
1636 2657683002
1637 2671113846
1638 2688600346
1639 2715499417
1640 2723577638
1641 2738804509
1642 2738947232
1643 2739308605
1644 2753462661
1645 2756673090
1646 2757570205
1647 2765467241
1648 2770198744
1649 2774131886
1650 2776273048
1651 2776282109
1652 2776911797
1653 2778177131
1654 2792583122
1655 2792621205
1656 2792625420
1657 2792637852
1658 2793283394
1659 2802718536
1660 2802724217
1661 2802730122
1662 2802737464
1663 2802742380
1664 2802749063
1665 2804750719
1666 2808986902
1667 2819556977
1668 2819608591
1669 2819640700
1670 2819686401
1671 2821129268
1672 2837682304
1673 2838029474
1674 2838075136
1675 2838677717
1676 2838716606
1677 2838719594
1678 2838727357
1679 2838742107
1680 2839996458
1681 2840770401
1682 2841734964
1683 2841845963
1684 2841846523
1685 2841860944
1686 2842127448
1687 2842132610
1688 2842145672
1689 2842152221
1690 2842172852
1691 2842175840
1692 2842189714
1693 2842214028
1694 2842224354
1695 2842299633
1696 2842361062
1697 2842476096
1698 2842486182
1699 2842503002
1700 2842512856
1701 2842517729
1702 2842521457
1703 2842875795
1704 2842923083
1705 2844005539
1706 2844015658
1707 2847672030
1708 2847688340
1709 2850079719
1710 2852388264
1711 2854899806
1712 2854920974
1713 2855828007
1714 2855839777
1715 2856318230
1716 2856324198
1717 2856328640
1718 2856337442
1719 2856345371
1720 2856351208
1721 2856360374
1722 2856364873
1723 2857354871
1724 2857370966
1725 2857536209
1726 2858803652
1727 2869175871
1728 2869240575
1729 2869253612
1730 2869259413
1731 2869278540
1732 2869281804
1733 2869289678
1734 2871431744
1735 2871438214
1736 2871456891
1737 2871466051
1738 2871475427
1739 2871494140
1740 2871499002
1741 2874103964
1742 2874111426
1743 2874127771
1744 2874140518
1745 2874155422
1746 2874162279
1747 2874166607
1748 2876366844
1749 2876375288
1750 2876387424
1751 2876398819
1752 2876404654
1753 2876412213
1754 2876420767
1755 2876427009
1756 2878037542
1757 2878739464
1758 2878748350
1759 2878756715
1760 2878763212
1761 2878770190
1762 2878776240
1763 2881153959
1764 2881157665
1765 2881163032
1766 2881851059
1767 2881859873
1768 2882636931
1769 2882915405
1770 2885311967
1771 2885315937
1772 2885325347
1773 2885331751
1774 2885342082
1775 2885349700
1776 2885353320
1777 2888341723
1778 2888349013
1779 2888350865
1780 2889021936
1781 2891374760
1782 2894656895
1783 2896388545
1784 2899260484
1785 2899794231
1786 2899808783
1787 2899848995
1788 2903453688
1789 2903502356
1790 2903506027
1791 2903521119
1792 2903524711
1793 2903531046
1794 2903543803
1795 2904582594
1796 2904665351
1797 2906311967
1798 2906323705
1799 2906331504
1800 2906365047
1801 2906371137
1802 2906385714
1803 2906389235
1804 2906405898
1805 2906408441
1806 2906418267
1807 2913298192
1808 2913312671
1809 2915986459
1810 2915987788
1811 2915997216
1812 2916000878
1813 2916014110
1814 2916021239
1815 2916021934
1816 2916034157
1817 2916040800
1818 2916042645
1819 2916053608
1820 2916057016
1821 2916065199
1822 2916072746
1823 2916078431
1824 2919101593
1825 2919116822
1826 2919124074
1827 2919166572
1828 2919174521
1829 2919408614
1830 2919451394
1831 2920763612
1832 2920823095
1833 2921207088
1834 2921213749
1835 2921241470
1836 2921247034
1837 2921252693
1838 2921262783
1839 2921268762
1840 2921288163
1841 2921293742
1842 2921299391
1843 2922136671
1844 2922153489
1845 2922178136
1846 2922181988
1847 2922190564
1848 2923556455
1849 2924150714
1850 2924152765
1851 2924164697
1852 2924170782
1853 2924176924
1854 2924184913
1855 2924190388
1856 2924198941
1857 2924209310
1858 2924215021
1859 2924228247
1860 2924232701
1861 2924710789
1862 2924722384
1863 2924733137
1864 2924746346
1865 2924751417
1866 2924764399
1867 2924776989
1868 2924788304
1869 2926754834
1870 2926761999
1871 2928525206
1872 2929143228
1873 2933006868
1874 2933015540
1875 2933594069
1876 2936998503
1877 2937007753
1878 2937015002
1879 2937022254
1880 2937023422
1881 2937031552
1882 2937040550
1883 2937053318
1884 2937057589
1885 2937065392
1886 2937077166
1887 2937083274
1888 2937088778
1889 2937092095
1890 2937102748
1891 2937106462
1892 2937119425
1893 2937126236
1894 2937131659
1895 2937818210
1896 2937838571
1897 2937850643
1898 2937863163
1899 2937873655
1900 2937880294
1901 2937896417
1902 2937976159
1903 2937986502
1904 2937997653
1905 2954011253
1906 2957377750
1907 2957387104
1908 2957393333
1909 2957397779
1910 2957407247
1911 2957413368
1912 2957417722
1913 2957425292
1914 2957436840
1915 2957438883
1916 2957447344
1917 2957456633
1918 2957460651
1919 2957469514
1920 2957473424
1921 2957481933
1922 2957490953
1923 2957495733
1924 2957500715
1925 2957508077
1926 2958037765
1927 2958047477
1928 2958056269
1929 2958074601
1930 2958087430
1931 2958100067
1932 2958104017
1933 2958112668
1934 2958116700
1935 2958128843
1936 2958134051
1937 2958142978
1938 2958149074
1939 2958164527
1940 2958168127
1941 2958183697
1942 2960590281
1943 2960594549
1944 2960603337
1945 2960607856
1946 2960611676
1947 2960620073
1948 2960626723
1949 2960637189
1950 2960641488
1951 2960648132
1952 2960654429
1953 2960660628
1954 2960672137
1955 2960678668
1956 2960684439
1957 2960687455
1958 2960698588
1959 2961081663
1960 2961120351
1961 2961134138
1962 2961139441
1963 2961166592
1964 2961173005
1965 2961187025
1966 2963649638
1967 2964613466
1968 2964618379
1969 2964625502
1970 2964633738
1971 2964643097
1972 2964649430
1973 2964650116
1974 2964663128
1975 2964668046
1976 2964675453
1977 2964682633
1978 2964687635
1979 2964696616
1980 2964703995
1981 2964710272
1982 2964718903
1983 2964721984
1984 2965021415
1985 2965026261
1986 2965037533
1987 2965046564
1988 2965051309
1989 2965070153
1990 2965094968
1991 2965106520
1992 2967671423
1993 2967678472
1994 2967682540
1995 2967690375
1996 2967694854
1997 2967703584
1998 2967712723
1999 2967714448
2000 2967723772
2001 2967730341
2002 2967739198
2003 2967746355
2004 2967754719
2005 2967758201
2006 2967766605
2007 2967769890
2008 2967998216
2009 2968008868
2010 2968019387
2011 2968087052
2012 2968095696
2013 2968099616
2014 2968116818
2015 2968118544
2016 2968131876
2017 2968145753
2018 2968174997
2019 2970027285
2020 2970034749
2021 2970041065
2022 2970049493
2023 2970056899
2024 2970062213
2025 2970069776
2026 2970080802
2027 2970088138
2028 2970089451
2029 2970098841
2030 2970106034
2031 2970110956
2032 2970118213
2033 2970125239
2034 2970131352
2035 2970142089
2036 2970144231
2037 2970154563
2038 2970163738
2039 2970170167
2040 2970175876
2041 2970183608
2042 2970188743
2043 2970197503
2044 2970472708
2045 2970494715
2046 2970505599
2047 2970515901
2048 2970529205
2049 2970539297
2050 2970544232
2051 2970550669
2052 2970558056
2053 2970596408
2054 2970624137
2055 2970627447
2056 2974301315
2057 2977521064
2058 2977528495
2059 2977531133
2060 2977543740
2061 2977550710
2062 2977554771
2063 2977563776
2064 2977571507
2065 2977574733
2066 2977584389
2067 2977825895
2068 2977836550
2069 2977851306
2070 2977854966
2071 2977874972
2072 2977927668
2073 2977938607
2074 2977946654
2075 2977955371
2076 2977960411
2077 2977979720
2078 2977989749
2079 2978972963
2080 2979092733
2081 2979099877
2082 2979104706
2083 2979748530
2084 2979776253
2085 2979781247
2086 2979799720
2087 2979810320
2088 2984503792
2089 2984513496
2090 2984520135
2091 2984539432
2092 2984591211
2093 2984601658
2094 2987643473
2095 2987649309
2096 2987654954
2097 2987662603
2098 2987672755
2099 2987679200
2100 2989351924
2101 2996313107
2102 2996347096
2103 2996352159
2104 2996391949
2105 2996888257
2106 3000142073
2107 3002145459
2108 3003931472
2109 3004191654
2110 3004198773
2111 3004207018
2112 3004213938
2113 3004223529
2114 3004240050
2115 3004254236
2116 3004273270
2117 3004278857
2118 3004339175
2119 3005422995
2120 3005456624
2121 637079340
2122 643824319
2123 648736826
2124 649874808
2125 650738564
2126 8001847915
2127 8002288013
2128 8003572103
2129 8003992230
2130 8003999496
2131 8004306075
2132 8004319338
2133 8004362608
2134 8004378303
2135 8004391556
2136 8004635884
2137 8004698065
2138 8004705041
2139 8004716925
2140 8005261191
2141 8005315322
2142 8005322784
2143 8005484762
2144 8005543510
2145 8005649455
2146 8005661770
2147 8005685302
2148 8005692507
2149 8018153486
2150 8024491589
2151 8046770888
2152 8049293271
2153 8054463968
2154 8054562430
2155 8055433134
2156 8055623282
2157 8056876390
2158 8057580503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

26

300

0.91

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

25

296

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pu4-assembly2.cif.gz_C crystal structure of the dimer rbp-n and rbp-trunc from thermotoga maritima ribose binding protein 0.9446 31 153
7qsq-assembly2.cif.gz_B permutated n-terminal lobe of the ribose binding protein from thermotoga maritima 0.9413 31 118
7pu4-assembly2.cif.gz_C crystal structure of the dimer rbp-n and rbp-trunc from thermotoga maritima ribose binding protein 0.9228 31 153
2fn9-assembly2.cif.gz_B thermotoga maritima ribose binding protein unliganded form 0.9102 32 325
2fn9-assembly2.cif.gz_B thermotoga maritima ribose binding protein unliganded form 0.904 32 325
ID Description Score Start End Superfamily
af_P76142_29_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9485 33 132 3.40.50.2300
5ibqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9452 30 135 3.40.50.2300
af_P37387_24_127_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9404 30 134 3.40.50.2300
2qvcB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9385 31 135 3.40.50.2300
2fn9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9361 32 132 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y7A216-F1-model_v4 deleted 0.9479 207 344
AF-A0A7Y7A216-F1-model_v4 deleted 0.9348 207 344
AF-A0A357X3J4-F1-model_v4 deleted 0.9329 214 344
AF-A0A1H8ALF0-F1-model_v4 deleted 0.9282 186 344
AF-A0A536UNS8-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.927 85 344 GO:0030246
GO:0030313

Map