F489657
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1079 | 479 | 2158 | 195 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2883577096|2883578382 |
| Length | 189 |
| Sequence | CVFCGAQPGHDEGHARLADALGTAIAKRGLGLVYGGGKVGLMGVVADAAIRGGAEVIGVIPEALMERELGHGEVTDLRVVPSMHVRKAMMNDLSDGFIVLPGGIGTLEEAVEIQSWSQLGIHRKGLVFLDTHGYWAPYFALLERMEGEGFIRPQHAGLALQARRPEQALDMLASWEPPKVTRWMTQTEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 30 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 31 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 32 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 33 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 36 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 37 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 38 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 87 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 88 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 94 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 96 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 97 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 98 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 106 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 111 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 112 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 113 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 116 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 117 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 118 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 119 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 120 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 121 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 122 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 123 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 124 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 125 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 126 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 127 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 128 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 129 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 130 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 131 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 132 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 133 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 134 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 135 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 136 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 137 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 138 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 139 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 140 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 141 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 142 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 143 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 144 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 145 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 146 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 147 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 148 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 149 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 150 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 241 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 242 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 243 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 244 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 247 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 248 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 249 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 269 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 270 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 271 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 272 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 273 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 274 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 275 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 276 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 277 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 278 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 279 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 280 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 281 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 282 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 283 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 284 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 285 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 286 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 287 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 288 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 289 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 290 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 291 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 292 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 293 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 294 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 295 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 296 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 297 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 298 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 299 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 300 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 301 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 302 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 303 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 304 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 305 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 306 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 307 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 308 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 309 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 310 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 311 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 312 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 313 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 314 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 315 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 316 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 317 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 318 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 319 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 320 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 321 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 322 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 323 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 324 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 325 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 326 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 327 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 328 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 329 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 330 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 331 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 332 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 333 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 334 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 335 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 336 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 337 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 338 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 339 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 340 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 341 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 342 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 343 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 344 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 345 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 346 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 347 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 348 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 349 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 350 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 351 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 352 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 353 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 354 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 355 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 356 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 357 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 358 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 359 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 360 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 361 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 362 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 363 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 364 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 365 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 366 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 367 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 368 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 369 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 370 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 371 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 372 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 373 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 374 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 375 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 376 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 377 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 378 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 379 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 380 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 381 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 382 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 383 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 384 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 385 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 386 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 387 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 388 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 389 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 390 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 391 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 392 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 393 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 394 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 395 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 396 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 397 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 398 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 399 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 400 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 401 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 402 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 403 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 404 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 405 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 406 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 407 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 408 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 409 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 410 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 411 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 412 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 413 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 414 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 415 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 416 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 417 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 418 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 419 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 420 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 421 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 422 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 423 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 424 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 425 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 426 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 427 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 428 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 429 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 430 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 431 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 432 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 433 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 434 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 435 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 436 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 437 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 438 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 439 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 440 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 441 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 442 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 443 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 444 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 445 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 446 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 447 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 448 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 449 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 450 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 451 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 452 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 453 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 454 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 455 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 456 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 457 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 458 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 459 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 460 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 461 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 462 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 463 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 464 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 465 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 466 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 467 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 468 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 469 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 470 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 471 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 472 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 473 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 474 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 475 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 476 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 477 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 478 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 479 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.44 |
| Metatranscriptomes | 0.09 |
| Isolates | 19.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 5.56 |
| Nodule | 2.5 |
| Rhizoplane | 7.14 |
| Rhizosphere | 73.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_17 | 2124908027 | Bacteria | 60592 |
| 2 | MRS2a_Contig_743 | 2124908027 | Bacteria | 5877 |
| 3 | SwRhRL2b_contig_1875519 | 2162886007 | Bacteria | 1525 |
| 4 | SwRhRL2b_contig_1906178 | 2162886007 | Bacteria | 1461 |
| 5 | SwRhRL2b_contig_802536 | 2162886007 | Bacteria | 1354 |
| 6 | JGI25162J39368_1000096 | 3300002737 | Bacteria | 97855 |
| 7 | JGI25162J39368_1001687 | 3300002737 | Bacteria | 10804 |
| 8 | JGI25163J39215_1000085 | 3300002771 | Bacteria | 40659 |
| 9 | JGI25163J39215_1000575 | 3300002771 | Bacteria | 10389 |
| 10 | JGI25164J39214_1000074 | 3300002772 | Bacteria | 97855 |
| 11 | JGI25164J39214_1000819 | 3300002772 | Bacteria | 10881 |
| 12 | JGI25165J46597_1000177 | 3300003214 | Bacteria | 97855 |
| 13 | JGI25165J46597_1001612 | 3300003214 | Bacteria | 10804 |
| 14 | rootH1_10233992 | 3300003323 | Bacteria | 1165 |
| 15 | Ga0006562J51391_1097134 | 3300003578 | Bacteria | 870 |
| 16 | Ga0055536_1000101 | 3300003781 | Bacteria | 73884 |
| 17 | Ga0055536_1000841 | 3300003781 | Bacteria | 20232 |
| 18 | Ga0055536_1003159 | 3300003781 | Bacteria | 8933 |
| 19 | Ga0055536_1050526 | 3300003781 | Bacteria | 916 |
| 20 | Ga0055530_10000097 | 3300003791 | Bacteria | 73884 |
| 21 | Ga0055530_10000216 | 3300003791 | Bacteria | 51438 |
| 22 | Ga0055530_10001211 | 3300003791 | Bacteria | 19954 |
| 23 | Ga0055530_10011795 | 3300003791 | Bacteria | 3104 |
| 24 | Ga0055540_1000108 | 3300003792 | Bacteria | 89907 |
| 25 | Ga0055540_1000232 | 3300003792 | Bacteria | 51558 |
| 26 | Ga0055540_1000837 | 3300003792 | Bacteria | 20668 |
| 27 | Ga0055531_10000811 | 3300003794 | Bacteria | 25894 |
| 28 | Ga0055531_10001535 | 3300003794 | Bacteria | 16904 |
| 29 | Ga0065714_10000496 | 3300005288 | Bacteria | 4546 |
| 30 | Ga0065714_10002602 | 3300005288 | Bacteria | 25747 |
| 31 | Ga0065714_10004617 | 3300005288 | Bacteria | 4673 |
| 32 | Ga0065714_10017343 | 3300005288 | Bacteria | 2149 |
| 33 | Ga0065714_10018028 | 3300005288 | Bacteria | 1480 |
| 34 | Ga0065714_10019951 | 3300005288 | Bacteria | 1179 |
| 35 | Ga0065714_10020229 | 3300005288 | Bacteria | 1158 |
| 36 | Ga0065714_10034541 | 3300005288 | Bacteria | 1256 |
| 37 | Ga0065714_10038529 | 3300005288 | Bacteria | 897 |
| 38 | Ga0065714_10068262 | 3300005288 | Bacteria | 4854 |
| 39 | Ga0065714_10071110 | 3300005288 | Bacteria | 3665 |
| 40 | Ga0065704_10000569 | 3300005289 | Bacteria | 17503 |
| 41 | Ga0065704_10101832 | 3300005289 | Bacteria | 2171 |
| 42 | Ga0065704_10107570 | 3300005289 | Bacteria | 2052 |
| 43 | Ga0065704_10142007 | 3300005289 | Bacteria | 1508 |
| 44 | Ga0065704_10228549 | 3300005289 | Bacteria | 1050 |
| 45 | Ga0065712_10069536 | 3300005290 | Bacteria | 7098 |
| 46 | Ga0065715_10093817 | 3300005293 | Bacteria | 4544 |
| 47 | Ga0068868_100921531 | 3300005338 | Bacteria | 795 |
| 48 | Ga0070689_100659285 | 3300005340 | Bacteria | 911 |
| 49 | Ga0070669_100000691 | 3300005353 | Bacteria | 24753 |
| 50 | Ga0070669_100641340 | 3300005353 | Bacteria | 893 |
| 51 | Ga0070688_100240307 | 3300005365 | Bacteria | 1285 |
| 52 | Ga0070694_100304069 | 3300005444 | Bacteria | 1223 |
| 53 | Ga0070662_100032515 | 3300005457 | Bacteria | 3666 |
| 54 | Ga0070685_10506884 | 3300005466 | Bacteria | 855 |
| 55 | Ga0070665_100036433 | 3300005548 | Bacteria | 4948 |
| 56 | Ga0070665_100367655 | 3300005548 | Bacteria | 1445 |
| 57 | Ga0068864_100050860 | 3300005618 | Bacteria | 3568 |
| 58 | Ga0068858_100123910 | 3300005842 | Bacteria | 2419 |
| 59 | Ga0068862_100790518 | 3300005844 | Bacteria | 926 |
| 60 | Ga0075364_10068367 | 3300006051 | Bacteria | 2336 |
| 61 | Ga0075364_10133161 | 3300006051 | Bacteria | 1669 |
| 62 | Ga0075364_10147421 | 3300006051 | Bacteria | 1585 |
| 63 | Ga0075364_10282461 | 3300006051 | Bacteria | 1129 |
| 64 | Ga0075432_10000430 | 3300006058 | Bacteria | 12297 |
| 65 | Ga0075432_10006793 | 3300006058 | Bacteria | 3896 |
| 66 | Ga0075432_10023232 | 3300006058 | Bacteria | 2123 |
| 67 | Ga0075432_10042013 | 3300006058 | Bacteria | 1598 |
| 68 | Ga0075362_10132803 | 3300006177 | Bacteria | 1185 |
| 69 | Ga0075362_10325196 | 3300006177 | Bacteria | 766 |
| 70 | Ga0075369_10135861 | 3300006186 | Bacteria | 1120 |
| 71 | Ga0075369_10140083 | 3300006186 | Bacteria | 1102 |
| 72 | Ga0075433_10076424 | 3300006852 | Bacteria | 2949 |
| 73 | Ga0075434_100000779 | 3300006871 | Bacteria | 25235 |
| 74 | Ga0075436_100003752 | 3300006914 | Bacteria | 10410 |
| 75 | Ga0075436_100107858 | 3300006914 | Bacteria | 1942 |
| 76 | Ga0075436_100224477 | 3300006914 | Bacteria | 1333 |
| 77 | Ga0079104_1000164 | 3300006946 | Bacteria | 94084 |
| 78 | Ga0079104_1001028 | 3300006946 | Bacteria | 21419 |
| 79 | Ga0079104_1038108 | 3300006946 | Bacteria | 1141 |
| 80 | Ga0099826_10036309 | 3300006948 | Bacteria | 3489 |
| 81 | Ga0075435_100004009 | 3300007076 | Bacteria | 10066 |
| 82 | Ga0105251_10000320 | 3300009011 | Bacteria | 48103 |
| 83 | Ga0105251_10005626 | 3300009011 | Bacteria | 8145 |
| 84 | Ga0105251_10007499 | 3300009011 | Bacteria | 6709 |
| 85 | Ga0105251_10012167 | 3300009011 | Bacteria | 4882 |
| 86 | Ga0105251_10024286 | 3300009011 | Bacteria | 3113 |
| 87 | Ga0105251_10038780 | 3300009011 | Bacteria | 2331 |
| 88 | Ga0105251_10043537 | 3300009011 | Bacteria | 2173 |
| 89 | Ga0105251_10056512 | 3300009011 | Bacteria | 1857 |
| 90 | Ga0105244_10004406 | 3300009036 | Bacteria | 9708 |
| 91 | Ga0105244_10020379 | 3300009036 | Bacteria | 3686 |
| 92 | Ga0105244_10020778 | 3300009036 | Bacteria | 3641 |
| 93 | Ga0105244_10023123 | 3300009036 | Bacteria | 3413 |
| 94 | Ga0105244_10026438 | 3300009036 | Bacteria | 3141 |
| 95 | Ga0105244_10033813 | 3300009036 | Bacteria | 2694 |
| 96 | Ga0105244_10038610 | 3300009036 | Bacteria | 2489 |
| 97 | Ga0105244_10042166 | 3300009036 | Bacteria | 2361 |
| 98 | Ga0105244_10057672 | 3300009036 | Bacteria | 1962 |
| 99 | Ga0105244_10079310 | 3300009036 | Bacteria | 1627 |
| 100 | Ga0105244_10149715 | 3300009036 | Bacteria | 1118 |
| 101 | Ga0105244_10153929 | 3300009036 | Bacteria | 1101 |
| 102 | Ga0105244_10156944 | 3300009036 | Bacteria | 1088 |
| 103 | Ga0105244_10330101 | 3300009036 | Bacteria | 704 |
| 104 | Ga0105250_10000907 | 3300009092 | Bacteria | 17427 |
| 105 | Ga0105250_10002683 | 3300009092 | Bacteria | 8806 |
| 106 | Ga0105250_10002966 | 3300009092 | Bacteria | 8249 |
| 107 | Ga0105250_10030607 | 3300009092 | Bacteria | 2163 |
| 108 | Ga0105250_10036444 | 3300009092 | Bacteria | 1974 |
| 109 | Ga0105250_10037704 | 3300009092 | Bacteria | 1939 |
| 110 | Ga0105250_10040685 | 3300009092 | Bacteria | 1864 |
| 111 | Ga0105250_10051361 | 3300009092 | Bacteria | 1654 |
| 112 | Ga0105250_10119559 | 3300009092 | Bacteria | 1082 |
| 113 | Ga0105250_10259505 | 3300009092 | Bacteria | 744 |
| 114 | Ga0111539_10033070 | 3300009094 | Bacteria | 6279 |
| 115 | Ga0105243_10000100 | 3300009148 | Bacteria | 99372 |
| 116 | Ga0105243_10000639 | 3300009148 | Bacteria | 34674 |
| 117 | Ga0105243_10009698 | 3300009148 | Bacteria | 7333 |
| 118 | Ga0105243_10145665 | 3300009148 | Bacteria | 2026 |
| 119 | Ga0105243_10612730 | 3300009148 | Bacteria | 1050 |
| 120 | Ga0105242_10434640 | 3300009176 | Bacteria | 1233 |
| 121 | Ga0105238_10553262 | 3300009551 | Bacteria | 1155 |
| 122 | Ga0105249_10039074 | 3300009553 | Bacteria | 4308 |
| 123 | Ga0105246_10025027 | 3300011119 | Bacteria | 3888 |
| 124 | Ga0105246_10093520 | 3300011119 | Bacteria | 2172 |
| 125 | Ga0105246_10352640 | 3300011119 | Bacteria | 1206 |
| 126 | Ga0157345_1000159 | 3300012498 | Bacteria | 11275 |
| 127 | Ga0157345_1000564 | 3300012498 | Bacteria | 3312 |
| 128 | Ga0157373_10002803 | 3300013100 | Bacteria | 13180 |
| 129 | Ga0157373_10007800 | 3300013100 | Bacteria | 7959 |
| 130 | Ga0157373_10013328 | 3300013100 | Bacteria | 6032 |
| 131 | Ga0157373_10201409 | 3300013100 | Bacteria | 1403 |
| 132 | Ga0157373_10313477 | 3300013100 | Bacteria | 1115 |
| 133 | Ga0157371_10001083 | 3300013102 | Bacteria | 29467 |
| 134 | Ga0157371_10004015 | 3300013102 | Bacteria | 13028 |
| 135 | Ga0157371_10004573 | 3300013102 | Bacteria | 12034 |
| 136 | Ga0157371_10357800 | 3300013102 | Bacteria | 1063 |
| 137 | Ga0157370_10000150 | 3300013104 | Bacteria | 85732 |
| 138 | Ga0157370_10016733 | 3300013104 | Bacteria | 7420 |
| 139 | Ga0157370_10026170 | 3300013104 | Bacteria | 5763 |
| 140 | Ga0157370_10087214 | 3300013104 | Bacteria | 2931 |
| 141 | Ga0157370_10122194 | 3300013104 | Bacteria | 2431 |
| 142 | Ga0157369_10014391 | 3300013105 | Bacteria | 8935 |
| 143 | Ga0157369_10016760 | 3300013105 | Bacteria | 8236 |
| 144 | Ga0157369_10689704 | 3300013105 | Bacteria | 1052 |
| 145 | Ga0163162_10000507 | 3300013306 | Bacteria | 36252 |
| 146 | Ga0163162_10809629 | 3300013306 | Bacteria | 1054 |
| 147 | Ga0157372_10070287 | 3300013307 | Bacteria | 3938 |
| 148 | Ga0157372_10216848 | 3300013307 | Bacteria | 2218 |
| 149 | Ga0157372_10654244 | 3300013307 | Bacteria | 1224 |
| 150 | Ga0157375_10607916 | 3300013308 | Bacteria | 1252 |
| 151 | Ga0157375_10979220 | 3300013308 | Bacteria | 986 |
| 152 | Ga0157375_11614519 | 3300013308 | Bacteria | 767 |
| 153 | Ga0182008_10001110 | 3300014497 | Bacteria | 18522 |
| 154 | Ga0182008_10002539 | 3300014497 | Bacteria | 11376 |
| 155 | Ga0182008_10022623 | 3300014497 | Bacteria | 3219 |
| 156 | Ga0182008_10159554 | 3300014497 | Bacteria | 1134 |
| 157 | Ga0182008_10189527 | 3300014497 | Bacteria | 1043 |
| 158 | Ga0157377_10541053 | 3300014745 | Bacteria | 821 |
| 159 | Ga0182006_1001690 | 3300015261 | Bacteria | 12908 |
| 160 | Ga0182006_1003213 | 3300015261 | Bacteria | 8490 |
| 161 | Ga0182006_1003327 | 3300015261 | Bacteria | 8287 |
| 162 | Ga0182006_1007654 | 3300015261 | Bacteria | 4935 |
| 163 | Ga0182006_1050776 | 3300015261 | Bacteria | 1597 |
| 164 | Ga0182006_1129432 | 3300015261 | Bacteria | 869 |
| 165 | Ga0182007_10001779 | 3300015262 | Bacteria | 11255 |
| 166 | Ga0182007_10064498 | 3300015262 | Bacteria | 1200 |
| 167 | Ga0182005_1002100 | 3300015265 | Bacteria | 7414 |
| 168 | Ga0182005_1006665 | 3300015265 | Bacteria | 3508 |
| 169 | Ga0182005_1011115 | 3300015265 | Bacteria | 2574 |
| 170 | Ga0182005_1014857 | 3300015265 | Bacteria | 2176 |
| 171 | Ga0163161_10006460 | 3300017792 | Bacteria | 8115 |
| 172 | Ga0163161_10015968 | 3300017792 | Bacteria | 5240 |
| 173 | Ga0163161_10022443 | 3300017792 | Bacteria | 4445 |
| 174 | Ga0163161_10307810 | 3300017792 | Bacteria | 1249 |
| 175 | Ga0163161_10518696 | 3300017792 | Bacteria | 973 |
| 176 | Ga0209760_100031 | 3300025207 | Bacteria | 141487 |
| 177 | Ga0209760_100056 | 3300025207 | Bacteria | 100067 |
| 178 | Ga0209760_100139 | 3300025207 | Bacteria | 46193 |
| 179 | Ga0209563_101468 | 3300025230 | Bacteria | 6220 |
| 180 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 181 | Ga0207427_100067 | 3300025231 | Bacteria | 164839 |
| 182 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 183 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 184 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 185 | Ga0209233_1000156 | 3300025261 | Bacteria | 164839 |
| 186 | Ga0209675_1003821 | 3300025291 | Bacteria | 6946 |
| 187 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 188 | Ga0209676_1000096 | 3300025292 | Bacteria | 240620 |
| 189 | Ga0209676_1000266 | 3300025292 | Bacteria | 109375 |
| 190 | Ga0209676_1000722 | 3300025292 | Bacteria | 45471 |
| 191 | Ga0209676_1002706 | 3300025292 | Bacteria | 11953 |
| 192 | Ga0209676_1003411 | 3300025292 | Bacteria | 9818 |
| 193 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 194 | Ga0209050_1000301 | 3300025298 | Bacteria | 103314 |
| 195 | Ga0209050_1000356 | 3300025298 | Bacteria | 88117 |
| 196 | Ga0209050_1001464 | 3300025298 | Bacteria | 25257 |
| 197 | Ga0209051_1000089 | 3300025303 | Bacteria | 175572 |
| 198 | Ga0209051_1000225 | 3300025303 | Bacteria | 95205 |
| 199 | Ga0209051_1000467 | 3300025303 | Bacteria | 52965 |
| 200 | Ga0209051_1025890 | 3300025303 | Bacteria | 2377 |
| 201 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 202 | Ga0209257_1002752 | 3300025304 | Bacteria | 16635 |
| 203 | Ga0207696_1000065 | 3300025711 | Bacteria | 231818 |
| 204 | Ga0207696_1000085 | 3300025711 | Bacteria | 195968 |
| 205 | Ga0207696_1000122 | 3300025711 | Bacteria | 143543 |
| 206 | Ga0207696_1000941 | 3300025711 | Bacteria | 17813 |
| 207 | Ga0207696_1002508 | 3300025711 | Bacteria | 8969 |
| 208 | Ga0207696_1007215 | 3300025711 | Bacteria | 4373 |
| 209 | Ga0207696_1019119 | 3300025711 | Bacteria | 2237 |
| 210 | Ga0207696_1052541 | 3300025711 | Bacteria | 1162 |
| 211 | Ga0207655_1000394 | 3300025728 | Bacteria | 60812 |
| 212 | Ga0207655_1002445 | 3300025728 | Bacteria | 15089 |
| 213 | Ga0207655_1004333 | 3300025728 | Bacteria | 10118 |
| 214 | Ga0207655_1006051 | 3300025728 | Bacteria | 8085 |
| 215 | Ga0207655_1008544 | 3300025728 | Bacteria | 6481 |
| 216 | Ga0207655_1020270 | 3300025728 | Bacteria | 3425 |
| 217 | Ga0207655_1024776 | 3300025728 | Bacteria | 2931 |
| 218 | Ga0207655_1038771 | 3300025728 | Bacteria | 2078 |
| 219 | Ga0207655_1076442 | 3300025728 | Bacteria | 1225 |
| 220 | Ga0207655_1089243 | 3300025728 | Bacteria | 1089 |
| 221 | Ga0207655_1093670 | 3300025728 | Bacteria | 1051 |
| 222 | Ga0207655_1172640 | 3300025728 | Bacteria | 666 |
| 223 | Ga0207713_1000094 | 3300025735 | Bacteria | 146176 |
| 224 | Ga0207713_1002036 | 3300025735 | Bacteria | 15131 |
| 225 | Ga0207713_1004076 | 3300025735 | Bacteria | 9632 |
| 226 | Ga0207713_1004450 | 3300025735 | Bacteria | 9075 |
| 227 | Ga0207713_1005201 | 3300025735 | Bacteria | 8212 |
| 228 | Ga0207713_1005328 | 3300025735 | Bacteria | 8082 |
| 229 | Ga0207713_1006372 | 3300025735 | Bacteria | 7201 |
| 230 | Ga0207713_1008122 | 3300025735 | Bacteria | 6085 |
| 231 | Ga0207713_1008210 | 3300025735 | Bacteria | 6042 |
| 232 | Ga0207713_1012779 | 3300025735 | Bacteria | 4466 |
| 233 | Ga0207713_1028190 | 3300025735 | Bacteria | 2537 |
| 234 | Ga0207713_1031572 | 3300025735 | Bacteria | 2339 |
| 235 | Ga0207713_1080780 | 3300025735 | Bacteria | 1171 |
| 236 | Ga0207681_10000917 | 3300025923 | Bacteria | 19251 |
| 237 | Ga0207681_10621091 | 3300025923 | Bacteria | 894 |
| 238 | Ga0207706_10006144 | 3300025933 | Bacteria | 11153 |
| 239 | Ga0207686_10009573 | 3300025934 | Bacteria | 5258 |
| 240 | Ga0207709_10000022 | 3300025935 | Bacteria | 383573 |
| 241 | Ga0207709_10000252 | 3300025935 | Bacteria | 64225 |
| 242 | Ga0207709_10008422 | 3300025935 | Bacteria | 5704 |
| 243 | Ga0207709_10043054 | 3300025935 | Bacteria | 2720 |
| 244 | Ga0207709_10612451 | 3300025935 | Bacteria | 863 |
| 245 | Ga0207670_10570637 | 3300025936 | Bacteria | 926 |
| 246 | Ga0207665_10215714 | 3300025939 | Bacteria | 1404 |
| 247 | Ga0207689_10489952 | 3300025942 | Bacteria | 1029 |
| 248 | Ga0207712_10093998 | 3300025961 | Bacteria | 2213 |
| 249 | Ga0207703_10335273 | 3300026035 | Bacteria | 1389 |
| 250 | Ga0207641_11171646 | 3300026088 | Bacteria | 768 |
| 251 | Ga0207676_10101076 | 3300026095 | Bacteria | 2390 |
| 252 | Ga0207674_10421042 | 3300026116 | Bacteria | 1290 |
| 253 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 254 | Ga0209281_1000159 | 3300027111 | Bacteria | 161872 |
| 255 | Ga0209281_1006627 | 3300027111 | Bacteria | 2998 |
| 256 | Ga0209281_1024782 | 3300027111 | Bacteria | 1124 |
| 257 | Ga0209389_1000298 | 3300027296 | Bacteria | 30991 |
| 258 | Ga0209371_1002187 | 3300027312 | Bacteria | 11404 |
| 259 | Ga0209981_1006882 | 3300027378 | Bacteria | 1527 |
| 260 | Ga0207428_10067474 | 3300027907 | Bacteria | 2816 |
| 261 | Ga0207428_10101146 | 3300027907 | Bacteria | 2228 |
| 262 | Ga0207428_10144231 | 3300027907 | Bacteria | 1816 |
| 263 | Ga0207428_10166442 | 3300027907 | Bacteria | 1671 |
| 264 | Ga0207428_10179985 | 3300027907 | Bacteria | 1598 |
| 265 | Ga0268266_10006145 | 3300028379 | Bacteria | 11053 |
| 266 | Ga0268264_10229265 | 3300028381 | Bacteria | 1714 |
| 267 | Ga0307517_10131827 | 3300028786 | Bacteria | 1796 |
| 268 | Ga0307517_10371744 | 3300028786 | Bacteria | 768 |
| 269 | Ga0268256_1001923 | 3300030500 | Bacteria | 11404 |
| 270 | Ga0314311_1080024 | 3300030733 | Bacteria | 4633 |
| 271 | Ga0316178_1013428 | 3300030735 | Bacteria | 34501 |
| 272 | Ga0316183_1055787 | 3300030742 | Bacteria | 2488 |
| 273 | Ga0265332_10000069 | 3300031238 | Bacteria | 88113 |
| 274 | Ga0265331_10063038 | 3300031250 | Bacteria | 1747 |
| 275 | Ga0265327_10000166 | 3300031251 | Bacteria | 141539 |
| 276 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 277 | Ga0307408_100005151 | 3300031548 | Bacteria | 8765 |
| 278 | Ga0307408_100174084 | 3300031548 | Bacteria | 1720 |
| 279 | Ga0307408_100363187 | 3300031548 | Bacteria | 1232 |
| 280 | Ga0307408_100540778 | 3300031548 | Bacteria | 1026 |
| 281 | Ga0307408_100595389 | 3300031548 | Bacteria | 981 |
| 282 | Ga0307408_101296173 | 3300031548 | Bacteria | 682 |
| 283 | Ga0307516_10050897 | 3300031730 | Bacteria | 4062 |
| 284 | Ga0307405_10006452 | 3300031731 | Bacteria | 5771 |
| 285 | Ga0307413_10458199 | 3300031824 | Bacteria | 1014 |
| 286 | Ga0307406_10726120 | 3300031901 | Bacteria | 832 |
| 287 | Ga0307407_10155338 | 3300031903 | Bacteria | 1491 |
| 288 | Ga0307412_10012425 | 3300031911 | Bacteria | 4965 |
| 289 | Ga0307412_10345454 | 3300031911 | Bacteria | 1192 |
| 290 | Ga0307412_10359717 | 3300031911 | Bacteria | 1171 |
| 291 | Ga0307412_10386717 | 3300031911 | Bacteria | 1134 |
| 292 | Ga0307412_10640123 | 3300031911 | Bacteria | 905 |
| 293 | Ga0307416_100708533 | 3300032002 | Bacteria | 1096 |
| 294 | Ga0307414_10050535 | 3300032004 | Bacteria | 2880 |
| 295 | Ga0307414_10330832 | 3300032004 | Bacteria | 1300 |
| 296 | Ga0307414_10478868 | 3300032004 | Bacteria | 1097 |
| 297 | Ga0307414_11057194 | 3300032004 | Bacteria | 748 |
| 298 | Ga0307411_10346032 | 3300032005 | Bacteria | 1210 |
| 299 | Ga0307510_10019083 | 3300033180 | Bacteria | 8045 |
| 300 | Ga0373928_0015934 | 3300035084 | Bacteria | 1534 |
| 301 | Ga0373940_0026620 | 3300035088 | Bacteria | 1514 |
| 302 | Ga0373931_0078429 | 3300035691 | Bacteria | 1817 |
| 303 | Ga0373931_0220739 | 3300035691 | Bacteria | 1141 |
| 304 | Ga0237819_12707 | 3300038705 | Bacteria | 1034 |
| 305 | Ga0439436_0000458 | 3300041404 | Bacteria | 10453 |
| 306 | Ga0439438_000954 | 3300041405 | Bacteria | 12906 |
| 307 | Ga0439438_001498 | 3300041405 | Bacteria | 10295 |
| 308 | Ga0439438_002086 | 3300041405 | Bacteria | 8655 |
| 309 | Ga0439438_002651 | 3300041405 | Bacteria | 7550 |
| 310 | Ga0439438_003029 | 3300041405 | Bacteria | 6922 |
| 311 | Ga0439438_005181 | 3300041405 | Bacteria | 4840 |
| 312 | Ga0439438_012977 | 3300041405 | Bacteria | 2532 |
| 313 | Ga0439438_016750 | 3300041405 | Bacteria | 2125 |
| 314 | Ga0439438_025491 | 3300041405 | Bacteria | 1610 |
| 315 | Ga0439447_000310 | 3300041407 | Bacteria | 17421 |
| 316 | Ga0439447_000501 | 3300041407 | Bacteria | 14560 |
| 317 | Ga0439447_000663 | 3300041407 | Bacteria | 12765 |
| 318 | Ga0439447_001475 | 3300041407 | Bacteria | 8615 |
| 319 | Ga0439466_0000334 | 3300041411 | Bacteria | 18158 |
| 320 | Ga0439466_0000620 | 3300041411 | Bacteria | 13368 |
| 321 | Ga0439466_0000760 | 3300041411 | Bacteria | 12194 |
| 322 | Ga0439466_0001782 | 3300041411 | Bacteria | 8420 |
| 323 | Ga0439466_0016057 | 3300041411 | Bacteria | 2710 |
| 324 | Ga0439466_0016062 | 3300041411 | Bacteria | 2710 |
| 325 | Ga0439466_0018107 | 3300041411 | Bacteria | 2529 |
| 326 | Ga0439466_0037859 | 3300041411 | Bacteria | 1622 |
| 327 | Ga0439466_0098917 | 3300041411 | Bacteria | 910 |
| 328 | Ga0439466_0139737 | 3300041411 | Bacteria | 743 |
| 329 | Ga0439431_0008113 | 3300041997 | Bacteria | 2354 |
| 330 | Ga0439431_0167279 | 3300041997 | Bacteria | 630 |
| 331 | Ga0439437_000115 | 3300042000 | Bacteria | 6227 |
| 332 | Ga0439432_001620 | 3300042006 | Bacteria | 8420 |
| 333 | Ga0439432_002572 | 3300042006 | Bacteria | 6836 |
| 334 | Ga0439432_030244 | 3300042006 | Bacteria | 1756 |
| 335 | Ga0439432_060316 | 3300042006 | Bacteria | 1170 |
| 336 | Ga0439432_062351 | 3300042006 | Bacteria | 1147 |
| 337 | Ga0439451_001646 | 3300042009 | Bacteria | 4434 |
| 338 | Ga0439451_005348 | 3300042009 | Bacteria | 2615 |
| 339 | Ga0439452_000570 | 3300042010 | Bacteria | 19237 |
| 340 | Ga0439452_000628 | 3300042010 | Bacteria | 17817 |
| 341 | Ga0439452_001241 | 3300042010 | Bacteria | 10847 |
| 342 | Ga0439452_001308 | 3300042010 | Bacteria | 10474 |
| 343 | Ga0439452_001398 | 3300042010 | Bacteria | 9926 |
| 344 | Ga0439452_002762 | 3300042010 | Bacteria | 6341 |
| 345 | Ga0439452_007140 | 3300042010 | Bacteria | 3440 |
| 346 | Ga0439452_009153 | 3300042010 | Bacteria | 2934 |
| 347 | Ga0439452_050851 | 3300042010 | Bacteria | 949 |
| 348 | Ga0439454_041528 | 3300042011 | Bacteria | 753 |
| 349 | Ga0439456_000115 | 3300042013 | Bacteria | 25406 |
| 350 | Ga0439456_001126 | 3300042013 | Bacteria | 5286 |
| 351 | Ga0439456_004058 | 3300042013 | Bacteria | 2971 |
| 352 | Ga0439456_004723 | 3300042013 | Bacteria | 2755 |
| 353 | Ga0439456_005418 | 3300042013 | Bacteria | 2588 |
| 354 | Ga0439456_012044 | 3300042013 | Bacteria | 1792 |
| 355 | Ga0439463_002768 | 3300042016 | Bacteria | 4446 |
| 356 | Ga0439463_044927 | 3300042016 | Bacteria | 1125 |
| 357 | Ga0450911_000006 | 3300042115 | Bacteria | 222143 |
| 358 | Ga0450911_000320 | 3300042115 | Bacteria | 17307 |
| 359 | Ga0450911_001728 | 3300042115 | Bacteria | 4748 |
| 360 | Ga0450919_002700 | 3300042121 | Bacteria | 2284 |
| 361 | Ga0450920_000248 | 3300042122 | Bacteria | 8070 |
| 362 | Ga0450922_005091 | 3300042124 | Bacteria | 1213 |
| 363 | Ga0450923_020079 | 3300042125 | Bacteria | 1292 |
| 364 | Ga0450923_020280 | 3300042125 | Bacteria | 1287 |
| 365 | Ga0450890_002225 | 3300042127 | Bacteria | 2695 |
| 366 | Ga0450902_000293 | 3300042137 | Bacteria | 5973 |
| 367 | Ga0450903_004291 | 3300042138 | Bacteria | 2440 |
| 368 | Ga0450903_004968 | 3300042138 | Bacteria | 2240 |
| 369 | Ga0450903_011263 | 3300042138 | Bacteria | 1442 |
| 370 | Ga0450904_000006 | 3300042139 | Bacteria | 59554 |
| 371 | Ga0450904_004966 | 3300042139 | Bacteria | 1365 |
| 372 | Ga0450905_006406 | 3300042142 | Bacteria | 1592 |
| 373 | Ga0450905_006408 | 3300042142 | Bacteria | 1592 |
| 374 | Ga0450905_027742 | 3300042142 | Bacteria | 862 |
| 375 | Ga0450907_000201 | 3300042146 | Bacteria | 21621 |
| 376 | Ga0450907_014392 | 3300042146 | Bacteria | 1320 |
| 377 | Ga0450910_000798 | 3300042147 | Bacteria | 3796 |
| 378 | Ga0450910_001658 | 3300042147 | Bacteria | 2851 |
| 379 | Ga0439446_0000905 | 3300042156 | Bacteria | 6391 |
| 380 | Ga0439446_0001535 | 3300042156 | Bacteria | 5297 |
| 381 | Ga0439446_0013529 | 3300042156 | Bacteria | 2240 |
| 382 | Ga0450908_029334 | 3300042184 | Bacteria | 956 |
| 383 | Ga0450909_000467 | 3300042185 | Bacteria | 5207 |
| 384 | Ga0450909_002351 | 3300042185 | Bacteria | 2681 |
| 385 | Ga0450909_003836 | 3300042185 | Bacteria | 2137 |
| 386 | Ga0439434_0000490 | 3300042435 | Bacteria | 11248 |
| 387 | Ga0439434_0000535 | 3300042435 | Bacteria | 10847 |
| 388 | Ga0439434_0040768 | 3300042435 | Bacteria | 1426 |
| 389 | Ga0439464_0000840 | 3300042439 | Bacteria | 6793 |
| 390 | Ga0439464_0002527 | 3300042439 | Bacteria | 4517 |
| 391 | Ga0439460_0000323 | 3300042461 | Bacteria | 10047 |
| 392 | Ga0439460_0009959 | 3300042461 | Bacteria | 2423 |
| 393 | Ga0439460_0013675 | 3300042461 | Bacteria | 2126 |
| 394 | Ga0450916_000103 | 3300042530 | Bacteria | 5499 |
| 395 | Ga0450918_030447 | 3300042531 | Bacteria | 953 |
| 396 | Ga0450901_000364 | 3300042533 | Bacteria | 5498 |
| 397 | Ga0450901_005029 | 3300042533 | Bacteria | 1360 |
| 398 | Ga0439440_0002562 | 3300042993 | Bacteria | 3442 |
| 399 | Ga0439440_0005864 | 3300042993 | Bacteria | 2450 |
| 400 | Ga0439440_0007439 | 3300042993 | Bacteria | 2225 |
| 401 | Ga0466963_0278436 | 3300044694 | Bacteria | 1175 |
| 402 | Ga0466959_0305715 | 3300045049 | Bacteria | 1089 |
| 403 | Ga0451576_0404201 | 3300045051 | Bacteria | 1432 |
| 404 | Ga0451576_0519155 | 3300045051 | Bacteria | 1251 |
| 405 | Ga0451576_1008408 | 3300045051 | Bacteria | 872 |
| 406 | Ga0451576_1042742 | 3300045051 | Bacteria | 857 |
| 407 | Ga0495617_000668 | 3300046452 | Bacteria | 17128 |
| 408 | Ga0495617_025418 | 3300046452 | Bacteria | 1996 |
| 409 | Ga0495617_083022 | 3300046452 | Bacteria | 1049 |
| 410 | Ga0495617_097017 | 3300046452 | Bacteria | 959 |
| 411 | Ga0495617_102326 | 3300046452 | Bacteria | 930 |
| 412 | Ga0495627_001495 | 3300046453 | Bacteria | 13521 |
| 413 | Ga0495627_002107 | 3300046453 | Bacteria | 10072 |
| 414 | Ga0495627_002824 | 3300046453 | Bacteria | 8046 |
| 415 | Ga0495627_002904 | 3300046453 | Bacteria | 7888 |
| 416 | Ga0495627_006008 | 3300046453 | Bacteria | 4815 |
| 417 | Ga0495627_014321 | 3300046453 | Bacteria | 2770 |
| 418 | Ga0495592_0061075 | 3300046454 | Bacteria | 2770 |
| 419 | Ga0495603_0004020 | 3300046455 | Bacteria | 8752 |
| 420 | Ga0495603_0010701 | 3300046455 | Bacteria | 5563 |
| 421 | Ga0495590_0000657 | 3300046457 | Bacteria | 16002 |
| 422 | Ga0495590_0000861 | 3300046457 | Bacteria | 13659 |
| 423 | Ga0495590_0005018 | 3300046457 | Bacteria | 5278 |
| 424 | Ga0495590_0005991 | 3300046457 | Bacteria | 4767 |
| 425 | Ga0495591_001018 | 3300046458 | Bacteria | 18940 |
| 426 | Ga0495591_002638 | 3300046458 | Bacteria | 9813 |
| 427 | Ga0495591_003243 | 3300046458 | Bacteria | 8542 |
| 428 | Ga0495591_003488 | 3300046458 | Bacteria | 8091 |
| 429 | Ga0495591_003947 | 3300046458 | Bacteria | 7438 |
| 430 | Ga0495591_005377 | 3300046458 | Bacteria | 5946 |
| 431 | Ga0495591_034913 | 3300046458 | Bacteria | 1476 |
| 432 | Ga0495591_042080 | 3300046458 | Bacteria | 1293 |
| 433 | Ga0495638_0003250 | 3300046460 | Bacteria | 12822 |
| 434 | Ga0495638_0007939 | 3300046460 | Bacteria | 7568 |
| 435 | Ga0495638_0013231 | 3300046460 | Bacteria | 5628 |
| 436 | Ga0495638_0041352 | 3300046460 | Bacteria | 2916 |
| 437 | Ga0495638_0046070 | 3300046460 | Bacteria | 2741 |
| 438 | Ga0495638_0084701 | 3300046460 | Bacteria | 1918 |
| 439 | Ga0495638_0096838 | 3300046460 | Bacteria | 1770 |
| 440 | Ga0495638_0189369 | 3300046460 | Bacteria | 1168 |
| 441 | Ga0495653_0037770 | 3300046463 | Bacteria | 3791 |
| 442 | Ga0495653_0074615 | 3300046463 | Bacteria | 2526 |
| 443 | Ga0495653_0197759 | 3300046463 | Bacteria | 1366 |
| 444 | Ga0495650_0002040 | 3300046471 | Bacteria | 17653 |
| 445 | Ga0495650_0003893 | 3300046471 | Bacteria | 10559 |
| 446 | Ga0495650_0019901 | 3300046471 | Bacteria | 3287 |
| 447 | Ga0495650_0021187 | 3300046471 | Bacteria | 3149 |
| 448 | Ga0495650_0084602 | 3300046471 | Bacteria | 1216 |
| 449 | Ga0495582_0073431 | 3300046473 | Bacteria | 1893 |
| 450 | Ga0495605_0001491 | 3300046474 | Bacteria | 15279 |
| 451 | Ga0495605_0001568 | 3300046474 | Bacteria | 14862 |
| 452 | Ga0495605_0005079 | 3300046474 | Bacteria | 7676 |
| 453 | Ga0495605_0015409 | 3300046474 | Bacteria | 4161 |
| 454 | Ga0495605_0021295 | 3300046474 | Bacteria | 3435 |
| 455 | Ga0495605_0072459 | 3300046474 | Bacteria | 1624 |
| 456 | Ga0495639_0000459 | 3300046475 | Bacteria | 19327 |
| 457 | Ga0495639_0059801 | 3300046475 | Bacteria | 1744 |
| 458 | Ga0495584_0003293 | 3300046491 | Bacteria | 8946 |
| 459 | Ga0495584_0006584 | 3300046491 | Bacteria | 6069 |
| 460 | Ga0495584_0009654 | 3300046491 | Bacteria | 4967 |
| 461 | Ga0495584_0015210 | 3300046491 | Bacteria | 3919 |
| 462 | Ga0495584_0015852 | 3300046491 | Bacteria | 3844 |
| 463 | Ga0495584_0032600 | 3300046491 | Bacteria | 2636 |
| 464 | Ga0495584_0378959 | 3300046491 | Bacteria | 718 |
| 465 | Ga0495585_0001600 | 3300046492 | Bacteria | 17498 |
| 466 | Ga0495585_0003756 | 3300046492 | Bacteria | 10137 |
| 467 | Ga0495585_0004425 | 3300046492 | Bacteria | 9115 |
| 468 | Ga0495585_0012821 | 3300046492 | Bacteria | 4930 |
| 469 | Ga0495585_0021387 | 3300046492 | Bacteria | 3715 |
| 470 | Ga0495585_0042304 | 3300046492 | Bacteria | 2552 |
| 471 | Ga0495585_0138747 | 3300046492 | Bacteria | 1274 |
| 472 | Ga0495585_0145104 | 3300046492 | Bacteria | 1241 |
| 473 | Ga0495594_0016430 | 3300046499 | Bacteria | 3899 |
| 474 | Ga0495596_0000810 | 3300046500 | Bacteria | 18926 |
| 475 | Ga0495596_0078628 | 3300046500 | Bacteria | 1281 |
| 476 | Ga0495607_0002501 | 3300046501 | Bacteria | 14896 |
| 477 | Ga0495607_0005610 | 3300046501 | Bacteria | 8950 |
| 478 | Ga0495607_0006757 | 3300046501 | Bacteria | 8020 |
| 479 | Ga0495607_0010753 | 3300046501 | Bacteria | 6128 |
| 480 | Ga0495607_0013661 | 3300046501 | Bacteria | 5310 |
| 481 | Ga0495607_0017489 | 3300046501 | Bacteria | 4598 |
| 482 | Ga0495607_0051336 | 3300046501 | Bacteria | 2395 |
| 483 | Ga0495607_0064907 | 3300046501 | Bacteria | 2060 |
| 484 | Ga0495583_0004611 | 3300046506 | Bacteria | 9744 |
| 485 | Ga0495583_0005527 | 3300046506 | Bacteria | 8558 |
| 486 | Ga0495606_0000613 | 3300046507 | Bacteria | 56133 |
| 487 | Ga0495606_0003599 | 3300046507 | Bacteria | 16310 |
| 488 | Ga0495606_0009739 | 3300046507 | Bacteria | 8083 |
| 489 | Ga0495606_0009990 | 3300046507 | Bacteria | 7937 |
| 490 | Ga0495606_0014067 | 3300046507 | Bacteria | 6268 |
| 491 | Ga0495606_0014214 | 3300046507 | Bacteria | 6229 |
| 492 | Ga0495606_0018106 | 3300046507 | Bacteria | 5295 |
| 493 | Ga0495606_0026817 | 3300046507 | Bacteria | 4098 |
| 494 | Ga0495606_0253278 | 3300046507 | Bacteria | 975 |
| 495 | Ga0495610_0004876 | 3300046512 | Bacteria | 9753 |
| 496 | Ga0495610_0009061 | 3300046512 | Bacteria | 6344 |
| 497 | Ga0495610_0024811 | 3300046512 | Bacteria | 3229 |
| 498 | Ga0495610_0028656 | 3300046512 | Bacteria | 2941 |
| 499 | Ga0495610_0088869 | 3300046512 | Bacteria | 1403 |
| 500 | Ga0495610_0135665 | 3300046512 | Bacteria | 1064 |
| 501 | Ga0495616_0001743 | 3300046513 | Bacteria | 14809 |
| 502 | Ga0495616_0002218 | 3300046513 | Bacteria | 12984 |
| 503 | Ga0495616_0002439 | 3300046513 | Bacteria | 12358 |
| 504 | Ga0495616_0003301 | 3300046513 | Bacteria | 10373 |
| 505 | Ga0495616_0007195 | 3300046513 | Bacteria | 6670 |
| 506 | Ga0495616_0018775 | 3300046513 | Bacteria | 3787 |
| 507 | Ga0495616_0091464 | 3300046513 | Bacteria | 1439 |
| 508 | Ga0495616_0156050 | 3300046513 | Bacteria | 1029 |
| 509 | Ga0495620_0001683 | 3300046515 | Bacteria | 13041 |
| 510 | Ga0495620_0007508 | 3300046515 | Bacteria | 5911 |
| 511 | Ga0495620_0008596 | 3300046515 | Bacteria | 5477 |
| 512 | Ga0495620_0008957 | 3300046515 | Bacteria | 5347 |
| 513 | Ga0495620_0021811 | 3300046515 | Bacteria | 3101 |
| 514 | Ga0495620_0043970 | 3300046515 | Bacteria | 1943 |
| 515 | Ga0495620_0095358 | 3300046515 | Bacteria | 1190 |
| 516 | Ga0495620_0102536 | 3300046515 | Bacteria | 1139 |
| 517 | Ga0495628_0129876 | 3300046516 | Bacteria | 1928 |
| 518 | Ga0495630_0082181 | 3300046517 | Bacteria | 2431 |
| 519 | Ga0495631_0000110 | 3300046518 | Bacteria | 54728 |
| 520 | Ga0495631_0003550 | 3300046518 | Bacteria | 8527 |
| 521 | Ga0495631_0012696 | 3300046518 | Bacteria | 4106 |
| 522 | Ga0495631_0034690 | 3300046518 | Bacteria | 2260 |
| 523 | Ga0495632_0001736 | 3300046519 | Bacteria | 17674 |
| 524 | Ga0495632_0004067 | 3300046519 | Bacteria | 10098 |
| 525 | Ga0495632_0006881 | 3300046519 | Bacteria | 7235 |
| 526 | Ga0495632_0008448 | 3300046519 | Bacteria | 6320 |
| 527 | Ga0495632_0009156 | 3300046519 | Bacteria | 5985 |
| 528 | Ga0495632_0019359 | 3300046519 | Bacteria | 3710 |
| 529 | Ga0495632_0027411 | 3300046519 | Bacteria | 2985 |
| 530 | Ga0495632_0067705 | 3300046519 | Bacteria | 1721 |
| 531 | Ga0495632_0166526 | 3300046519 | Bacteria | 1013 |
| 532 | Ga0495632_0174411 | 3300046519 | Bacteria | 986 |
| 533 | Ga0495632_0205749 | 3300046519 | Bacteria | 894 |
| 534 | Ga0495632_0235075 | 3300046519 | Bacteria | 825 |
| 535 | Ga0495637_0001645 | 3300046520 | Bacteria | 12919 |
| 536 | Ga0495637_0004763 | 3300046520 | Bacteria | 6998 |
| 537 | Ga0495637_0006267 | 3300046520 | Bacteria | 5984 |
| 538 | Ga0495637_0006296 | 3300046520 | Bacteria | 5973 |
| 539 | Ga0495637_0023311 | 3300046520 | Bacteria | 2815 |
| 540 | Ga0495637_0059827 | 3300046520 | Bacteria | 1566 |
| 541 | Ga0495637_0076171 | 3300046520 | Bacteria | 1344 |
| 542 | Ga0495637_0102271 | 3300046520 | Bacteria | 1118 |
| 543 | Ga0495643_0000585 | 3300046522 | Bacteria | 44407 |
| 544 | Ga0495643_0002726 | 3300046522 | Bacteria | 13592 |
| 545 | Ga0495643_0009165 | 3300046522 | Bacteria | 6180 |
| 546 | Ga0495643_0013916 | 3300046522 | Bacteria | 4797 |
| 547 | Ga0495643_0020785 | 3300046522 | Bacteria | 3777 |
| 548 | Ga0495643_0041612 | 3300046522 | Bacteria | 2504 |
| 549 | Ga0495643_0059553 | 3300046522 | Bacteria | 2029 |
| 550 | Ga0495643_0072191 | 3300046522 | Bacteria | 1810 |
| 551 | Ga0495643_0081585 | 3300046522 | Bacteria | 1681 |
| 552 | Ga0495643_0088947 | 3300046522 | Bacteria | 1595 |
| 553 | Ga0495643_0260537 | 3300046522 | Bacteria | 805 |
| 554 | Ga0495644_0001407 | 3300046523 | Bacteria | 9825 |
| 555 | Ga0495644_0026865 | 3300046523 | Bacteria | 2182 |
| 556 | Ga0495644_0071001 | 3300046523 | Bacteria | 1308 |
| 557 | Ga0495648_0001916 | 3300046524 | Bacteria | 19825 |
| 558 | Ga0495648_0005960 | 3300046524 | Bacteria | 10026 |
| 559 | Ga0495648_0007582 | 3300046524 | Bacteria | 8666 |
| 560 | Ga0495648_0008479 | 3300046524 | Bacteria | 8085 |
| 561 | Ga0495648_0008597 | 3300046524 | Bacteria | 8012 |
| 562 | Ga0495648_0023677 | 3300046524 | Bacteria | 4198 |
| 563 | Ga0495648_0036713 | 3300046524 | Bacteria | 3156 |
| 564 | Ga0495648_0058186 | 3300046524 | Bacteria | 2312 |
| 565 | Ga0495648_0145493 | 3300046524 | Bacteria | 1242 |
| 566 | Ga0495648_0176131 | 3300046524 | Bacteria | 1091 |
| 567 | Ga0495648_0194474 | 3300046524 | Bacteria | 1020 |
| 568 | Ga0495648_0213590 | 3300046524 | Bacteria | 956 |
| 569 | Ga0495666_0085078 | 3300046526 | Bacteria | 1493 |
| 570 | Ga0495666_0108392 | 3300046526 | Bacteria | 1305 |
| 571 | Ga0495642_0000361 | 3300046528 | Bacteria | 24687 |
| 572 | Ga0495642_0001257 | 3300046528 | Bacteria | 11551 |
| 573 | Ga0495654_0003070 | 3300046530 | Bacteria | 10398 |
| 574 | Ga0495654_0004441 | 3300046530 | Bacteria | 8320 |
| 575 | Ga0495654_0006568 | 3300046530 | Bacteria | 6587 |
| 576 | Ga0495654_0009334 | 3300046530 | Bacteria | 5377 |
| 577 | Ga0495654_0013702 | 3300046530 | Bacteria | 4333 |
| 578 | Ga0495654_0015758 | 3300046530 | Bacteria | 4009 |
| 579 | Ga0495654_0052797 | 3300046530 | Bacteria | 1977 |
| 580 | Ga0495654_0058010 | 3300046530 | Bacteria | 1869 |
| 581 | Ga0495654_0085762 | 3300046530 | Bacteria | 1468 |
| 582 | Ga0495654_0096665 | 3300046530 | Bacteria | 1364 |
| 583 | Ga0495654_0186528 | 3300046530 | Bacteria | 895 |
| 584 | Ga0495586_0003278 | 3300046535 | Bacteria | 8699 |
| 585 | Ga0495587_0003724 | 3300046536 | Bacteria | 10116 |
| 586 | Ga0495609_0001849 | 3300046538 | Bacteria | 13539 |
| 587 | Ga0495609_0008959 | 3300046538 | Bacteria | 4867 |
| 588 | Ga0495609_0055824 | 3300046538 | Bacteria | 1751 |
| 589 | Ga0495609_0117183 | 3300046538 | Bacteria | 1146 |
| 590 | Ga0495609_0122411 | 3300046538 | Bacteria | 1118 |
| 591 | Ga0495597_0004275 | 3300046542 | Bacteria | 7898 |
| 592 | Ga0495597_0007955 | 3300046542 | Bacteria | 5338 |
| 593 | Ga0495597_0013099 | 3300046542 | Bacteria | 3980 |
| 594 | Ga0495597_0033000 | 3300046542 | Bacteria | 2347 |
| 595 | Ga0495597_0042324 | 3300046542 | Bacteria | 2031 |
| 596 | Ga0495597_0133005 | 3300046542 | Bacteria | 1030 |
| 597 | Ga0495597_0245075 | 3300046542 | Bacteria | 705 |
| 598 | Ga0495622_0000577 | 3300046557 | Bacteria | 21933 |
| 599 | Ga0495622_0001471 | 3300046557 | Bacteria | 11841 |
| 600 | Ga0495622_0002243 | 3300046557 | Bacteria | 9406 |
| 601 | Ga0495622_0027898 | 3300046557 | Bacteria | 2635 |
| 602 | Ga0495622_0088702 | 3300046557 | Bacteria | 1421 |
| 603 | Ga0495633_0005304 | 3300046558 | Bacteria | 7924 |
| 604 | Ga0495633_0007007 | 3300046558 | Bacteria | 6580 |
| 605 | Ga0495633_0122898 | 3300046558 | Bacteria | 1202 |
| 606 | Ga0495656_0027017 | 3300046615 | Bacteria | 2289 |
| 607 | Ga0495656_0425093 | 3300046615 | Bacteria | 697 |
| 608 | Ga0495668_0001865 | 3300046616 | Bacteria | 18894 |
| 609 | Ga0495668_0012565 | 3300046616 | Bacteria | 5020 |
| 610 | Ga0495668_0012589 | 3300046616 | Bacteria | 5016 |
| 611 | Ga0495634_0001928 | 3300046642 | Bacteria | 17757 |
| 612 | Ga0495611_0001980 | 3300046648 | Bacteria | 9721 |
| 613 | Ga0495611_0097198 | 3300046648 | Bacteria | 1364 |
| 614 | Ga0495625_0005099 | 3300046660 | Bacteria | 12154 |
| 615 | Ga0495625_0007226 | 3300046660 | Bacteria | 9721 |
| 616 | Ga0495625_0044114 | 3300046660 | Bacteria | 3229 |
| 617 | Ga0495625_0051234 | 3300046660 | Bacteria | 2960 |
| 618 | Ga0495625_0074631 | 3300046660 | Bacteria | 2375 |
| 619 | Ga0495625_0083435 | 3300046660 | Bacteria | 2221 |
| 620 | Ga0495625_0089501 | 3300046660 | Bacteria | 2131 |
| 621 | Ga0495625_0261919 | 3300046660 | Bacteria | 1118 |
| 622 | Ga0495659_0001180 | 3300046664 | Bacteria | 9066 |
| 623 | Ga0495661_0002985 | 3300046665 | Bacteria | 12754 |
| 624 | Ga0495661_0022020 | 3300046665 | Bacteria | 4147 |
| 625 | Ga0495661_0038947 | 3300046665 | Bacteria | 2956 |
| 626 | Ga0495661_0068627 | 3300046665 | Bacteria | 2079 |
| 627 | Ga0495661_0124116 | 3300046665 | Bacteria | 1422 |
| 628 | Ga0495661_0169089 | 3300046665 | Bacteria | 1167 |
| 629 | Ga0495661_0205269 | 3300046665 | Bacteria | 1029 |
| 630 | Ga0495661_0299483 | 3300046665 | Bacteria | 805 |
| 631 | Ga0495623_0002535 | 3300046679 | Bacteria | 12081 |
| 632 | Ga0495646_0008586 | 3300046680 | Bacteria | 6488 |
| 633 | Ga0495646_0072841 | 3300046680 | Bacteria | 2019 |
| 634 | Ga0495669_0024336 | 3300046684 | Bacteria | 2637 |
| 635 | Ga0495613_0454496 | 3300046689 | Bacteria | 867 |
| 636 | Ga0495624_0003400 | 3300046690 | Bacteria | 11809 |
| 637 | Ga0495670_0002414 | 3300046691 | Bacteria | 9220 |
| 638 | Ga0495670_0004092 | 3300046691 | Bacteria | 7153 |
| 639 | Ga0495670_0005057 | 3300046691 | Bacteria | 6488 |
| 640 | Ga0495670_0007462 | 3300046691 | Bacteria | 5370 |
| 641 | Ga0495670_0217870 | 3300046691 | Bacteria | 1014 |
| 642 | Ga0495671_0000943 | 3300046692 | Bacteria | 20502 |
| 643 | Ga0495671_0002975 | 3300046692 | Bacteria | 10536 |
| 644 | Ga0495671_0003620 | 3300046692 | Bacteria | 9418 |
| 645 | Ga0495671_0011268 | 3300046692 | Bacteria | 4930 |
| 646 | Ga0495671_0015392 | 3300046692 | Bacteria | 4097 |
| 647 | Ga0495671_0023399 | 3300046692 | Bacteria | 3227 |
| 648 | Ga0495671_0025739 | 3300046692 | Bacteria | 3054 |
| 649 | Ga0495671_0048226 | 3300046692 | Bacteria | 2125 |
| 650 | Ga0495671_0134268 | 3300046692 | Bacteria | 1206 |
| 651 | Ga0495671_0158726 | 3300046692 | Bacteria | 1100 |
| 652 | Ga0495671_0164313 | 3300046692 | Bacteria | 1079 |
| 653 | Ga0495649_0002770 | 3300046694 | Bacteria | 12201 |
| 654 | Ga0495649_0003922 | 3300046694 | Bacteria | 9841 |
| 655 | Ga0495649_0005421 | 3300046694 | Bacteria | 8117 |
| 656 | Ga0495649_0005797 | 3300046694 | Bacteria | 7780 |
| 657 | Ga0495649_0011662 | 3300046694 | Bacteria | 5148 |
| 658 | Ga0495649_0014694 | 3300046694 | Bacteria | 4476 |
| 659 | Ga0495649_0018225 | 3300046694 | Bacteria | 3953 |
| 660 | Ga0495649_0044591 | 3300046694 | Bacteria | 2421 |
| 661 | Ga0495649_0048069 | 3300046694 | Bacteria | 2318 |
| 662 | Ga0495649_0051525 | 3300046694 | Bacteria | 2231 |
| 663 | Ga0495649_0061987 | 3300046694 | Bacteria | 2010 |
| 664 | Ga0495649_0242532 | 3300046694 | Bacteria | 928 |
| 665 | Ga0495649_0332084 | 3300046694 | Bacteria | 770 |
| 666 | Ga0495589_0000961 | 3300046794 | Bacteria | 17600 |
| 667 | Ga0495589_0003344 | 3300046794 | Bacteria | 8704 |
| 668 | Ga0495589_0007493 | 3300046794 | Bacteria | 5720 |
| 669 | Ga0495589_0008105 | 3300046794 | Bacteria | 5493 |
| 670 | Ga0495589_0012571 | 3300046794 | Bacteria | 4381 |
| 671 | Ga0495589_0013470 | 3300046794 | Bacteria | 4218 |
| 672 | Ga0495589_0020948 | 3300046794 | Bacteria | 3341 |
| 673 | Ga0495589_0186623 | 3300046794 | Bacteria | 982 |
| 674 | Ga0495600_0045725 | 3300046809 | Bacteria | 2856 |
| 675 | Ga0495660_0003064 | 3300046810 | Bacteria | 10424 |
| 676 | Ga0495660_0005058 | 3300046810 | Bacteria | 7922 |
| 677 | Ga0495660_0011565 | 3300046810 | Bacteria | 5118 |
| 678 | Ga0495660_0017700 | 3300046810 | Bacteria | 4099 |
| 679 | Ga0495660_0019909 | 3300046810 | Bacteria | 3848 |
| 680 | Ga0495660_0051192 | 3300046810 | Bacteria | 2247 |
| 681 | Ga0495660_0057198 | 3300046810 | Bacteria | 2104 |
| 682 | Ga0495660_0070591 | 3300046810 | Bacteria | 1853 |
| 683 | Ga0495660_0116040 | 3300046810 | Bacteria | 1360 |
| 684 | Ga0495604_0015251 | 3300047317 | Bacteria | 6134 |
| 685 | Ga0495604_0053180 | 3300047317 | Bacteria | 3132 |
| 686 | Ga0495604_0070234 | 3300047317 | Bacteria | 2652 |
| 687 | Ga0495604_0435473 | 3300047317 | Bacteria | 858 |
| 688 | Ga0495636_0004968 | 3300047318 | Bacteria | 5215 |
| 689 | Ga0495636_0010098 | 3300047318 | Bacteria | 3724 |
| 690 | Ga0495674_0014222 | 3300047319 | Bacteria | 7452 |
| 691 | Ga0495672_0002687 | 3300047320 | Bacteria | 16004 |
| 692 | Ga0495672_0005742 | 3300047320 | Bacteria | 9772 |
| 693 | Ga0495672_0005781 | 3300047320 | Bacteria | 9718 |
| 694 | Ga0495672_0007067 | 3300047320 | Bacteria | 8517 |
| 695 | Ga0495672_0026348 | 3300047320 | Bacteria | 3711 |
| 696 | Ga0495672_0036401 | 3300047320 | Bacteria | 3022 |
| 697 | Ga0495672_0052005 | 3300047320 | Bacteria | 2408 |
| 698 | Ga0495672_0080212 | 3300047320 | Bacteria | 1821 |
| 699 | Ga0495672_0098275 | 3300047320 | Bacteria | 1592 |
| 700 | Ga0495676_0026237 | 3300047321 | Bacteria | 5018 |
| 701 | Ga0495680_0031314 | 3300047322 | Bacteria | 4331 |
| 702 | Ga0495680_0039032 | 3300047322 | Bacteria | 3791 |
| 703 | Ga0495680_0099451 | 3300047322 | Bacteria | 2168 |
| 704 | Ga0495680_0235056 | 3300047322 | Bacteria | 1303 |
| 705 | Ga0495683_0002172 | 3300047323 | Bacteria | 12046 |
| 706 | Ga0495683_0003296 | 3300047323 | Bacteria | 9436 |
| 707 | Ga0495683_0035595 | 3300047323 | Bacteria | 2530 |
| 708 | Ga0495683_0077593 | 3300047323 | Bacteria | 1624 |
| 709 | Ga0495683_0173493 | 3300047323 | Bacteria | 989 |
| 710 | Ga0495687_004739 | 3300047443 | Bacteria | 9004 |
| 711 | Ga0495687_006813 | 3300047443 | Bacteria | 6897 |
| 712 | Ga0495687_099346 | 3300047443 | Bacteria | 1095 |
| 713 | Ga0495687_112356 | 3300047443 | Bacteria | 998 |
| 714 | Ga0495675_0052871 | 3300047444 | Bacteria | 2578 |
| 715 | Ga0495677_0002688 | 3300047445 | Bacteria | 6945 |
| 716 | Ga0495679_003285 | 3300047446 | Bacteria | 7835 |
| 717 | Ga0495679_004017 | 3300047446 | Bacteria | 6916 |
| 718 | Ga0495679_030734 | 3300047446 | Bacteria | 1740 |
| 719 | Ga0495685_071350 | 3300047447 | Bacteria | 1163 |
| 720 | Ga0495673_0000935 | 3300047469 | Bacteria | 26484 |
| 721 | Ga0495673_0002710 | 3300047469 | Bacteria | 12172 |
| 722 | Ga0495673_0002867 | 3300047469 | Bacteria | 11731 |
| 723 | Ga0495673_0003838 | 3300047469 | Bacteria | 9700 |
| 724 | Ga0495673_0005439 | 3300047469 | Bacteria | 7697 |
| 725 | Ga0495673_0007537 | 3300047469 | Bacteria | 6235 |
| 726 | Ga0495673_0015486 | 3300047469 | Bacteria | 3927 |
| 727 | Ga0495673_0017402 | 3300047469 | Bacteria | 3653 |
| 728 | Ga0495673_0094650 | 3300047469 | Bacteria | 1216 |
| 729 | Ga0495673_0098333 | 3300047469 | Bacteria | 1186 |
| 730 | Ga0495681_0002418 | 3300047470 | Bacteria | 13352 |
| 731 | Ga0495681_0003202 | 3300047470 | Bacteria | 11426 |
| 732 | Ga0495681_0003508 | 3300047470 | Bacteria | 10899 |
| 733 | Ga0495681_0003692 | 3300047470 | Bacteria | 10629 |
| 734 | Ga0495681_0003721 | 3300047470 | Bacteria | 10566 |
| 735 | Ga0495681_0004082 | 3300047470 | Bacteria | 10043 |
| 736 | Ga0495681_0008432 | 3300047470 | Bacteria | 6467 |
| 737 | Ga0495681_0010741 | 3300047470 | Bacteria | 5516 |
| 738 | Ga0495681_0011238 | 3300047470 | Bacteria | 5351 |
| 739 | Ga0495681_0024579 | 3300047470 | Bacteria | 3169 |
| 740 | Ga0495681_0029000 | 3300047470 | Bacteria | 2838 |
| 741 | Ga0495684_0456709 | 3300047471 | Bacteria | 886 |
| 742 | Ga0495686_0008077 | 3300047472 | Bacteria | 7788 |
| 743 | Ga0495686_0037949 | 3300047472 | Bacteria | 3084 |
| 744 | Ga0495686_0039456 | 3300047472 | Bacteria | 3015 |
| 745 | Ga0495686_0103541 | 3300047472 | Bacteria | 1715 |
| 746 | Ga0495686_0192103 | 3300047472 | Bacteria | 1176 |
| 747 | Ga0495686_0195468 | 3300047472 | Bacteria | 1163 |
| 748 | Ga0495593_0006784 | 3300047673 | Bacteria | 6702 |
| 749 | Ga0495593_0008472 | 3300047673 | Bacteria | 5978 |
| 750 | Ga0495593_0025981 | 3300047673 | Bacteria | 3238 |
| 751 | Ga0495602_0013623 | 3300048088 | Bacteria | 8296 |
| 752 | Ga0495626_0001629 | 3300048091 | Bacteria | 17429 |
| 753 | Ga0495626_0001739 | 3300048091 | Bacteria | 16606 |
| 754 | Ga0495626_0004676 | 3300048091 | Bacteria | 8309 |
| 755 | Ga0495626_0005055 | 3300048091 | Bacteria | 7869 |
| 756 | Ga0495626_0008827 | 3300048091 | Bacteria | 5481 |
| 757 | Ga0495626_0014326 | 3300048091 | Bacteria | 4094 |
| 758 | Ga0495626_0044054 | 3300048091 | Bacteria | 2090 |
| 759 | Ga0495626_0056819 | 3300048091 | Bacteria | 1790 |
| 760 | Ga0495626_0106098 | 3300048091 | Bacteria | 1220 |
| 761 | Ga0496102_0001561 | 3300048905 | Bacteria | 20220 |
| 762 | Ga0496103_0008656 | 3300048906 | Bacteria | 6042 |
| 763 | Ga0496104_0014763 | 3300048907 | Bacteria | 7058 |
| 764 | Ga0496104_0044426 | 3300048907 | Bacteria | 4175 |
| 765 | Ga0496106_0176455 | 3300048909 | Bacteria | 1695 |
| 766 | Ga0496106_0560397 | 3300048909 | Bacteria | 917 |
| 767 | Ga0496107_0299512 | 3300048910 | Bacteria | 1197 |
| 768 | Ga0496107_0302854 | 3300048910 | Bacteria | 1190 |
| 769 | Ga0496108_0001080 | 3300048911 | Bacteria | 21256 |
| 770 | Ga0496108_0029167 | 3300048911 | Bacteria | 4568 |
| 771 | Ga0496109_0003793 | 3300048912 | Bacteria | 12619 |
| 772 | Ga0496109_0107600 | 3300048912 | Bacteria | 2590 |
| 773 | Ga0496110_0312048 | 3300048913 | Bacteria | 1432 |
| 774 | Ga0496111_0053151 | 3300048914 | Bacteria | 2926 |
| 775 | Ga0496111_0420772 | 3300048914 | Bacteria | 987 |
| 776 | Ga0496112_0004358 | 3300048915 | Bacteria | 11973 |
| 777 | Ga0496112_0013335 | 3300048915 | Bacteria | 7586 |
| 778 | Ga0496112_0081616 | 3300048915 | Bacteria | 3198 |
| 779 | Ga0496113_0000556 | 3300048916 | Bacteria | 18514 |
| 780 | Ga0496113_0001353 | 3300048916 | Bacteria | 13569 |
| 781 | Ga0496116_0000234 | 3300048919 | Bacteria | 101720 |
| 782 | Ga0496116_0000960 | 3300048919 | Bacteria | 35604 |
| 783 | Ga0496116_0002607 | 3300048919 | Bacteria | 18730 |
| 784 | Ga0496116_0012873 | 3300048919 | Bacteria | 6794 |
| 785 | Ga0496116_0016057 | 3300048919 | Bacteria | 5881 |
| 786 | Ga0496116_0082989 | 3300048919 | Bacteria | 1980 |
| 787 | Ga0496117_0001930 | 3300048920 | Bacteria | 27662 |
| 788 | Ga0496117_0004181 | 3300048920 | Bacteria | 16143 |
| 789 | Ga0496117_0006118 | 3300048920 | Bacteria | 12317 |
| 790 | Ga0496117_0011127 | 3300048920 | Bacteria | 8090 |
| 791 | Ga0496117_0015032 | 3300048920 | Bacteria | 6631 |
| 792 | Ga0496117_0015867 | 3300048920 | Bacteria | 6387 |
| 793 | Ga0496118_0004537 | 3300048921 | Bacteria | 16390 |
| 794 | Ga0496118_0010603 | 3300048921 | Bacteria | 9101 |
| 795 | Ga0496118_0018405 | 3300048921 | Bacteria | 6306 |
| 796 | Ga0496118_0029366 | 3300048921 | Bacteria | 4611 |
| 797 | Ga0496118_0117643 | 3300048921 | Bacteria | 1742 |
| 798 | Ga0496119_0021643 | 3300048922 | Bacteria | 4636 |
| 799 | Ga0496119_0165321 | 3300048922 | Bacteria | 1172 |
| 800 | Ga0496120_0004433 | 3300048923 | Bacteria | 11775 |
| 801 | Ga0496121_0000346 | 3300048924 | Bacteria | 96825 |
| 802 | Ga0496121_0031595 | 3300048924 | Bacteria | 4833 |
| 803 | Ga0496121_0077102 | 3300048924 | Bacteria | 2655 |
| 804 | Ga0496121_0131702 | 3300048924 | Bacteria | 1870 |
| 805 | Ga0496122_0007280 | 3300048925 | Bacteria | 12366 |
| 806 | Ga0496122_0008343 | 3300048925 | Bacteria | 11208 |
| 807 | Ga0496122_0025979 | 3300048925 | Bacteria | 5067 |
| 808 | Ga0496122_0143958 | 3300048925 | Bacteria | 1485 |
| 809 | Ga0496122_0230870 | 3300048925 | Bacteria | 1052 |
| 810 | Ga0496122_0335079 | 3300048925 | Bacteria | 797 |
| 811 | Ga0496123_0014130 | 3300048926 | Bacteria | 6639 |
| 812 | Ga0496123_0063332 | 3300048926 | Bacteria | 2363 |
| 813 | Ga0496123_0081030 | 3300048926 | Bacteria | 1974 |
| 814 | Ga0496123_0081997 | 3300048926 | Bacteria | 1957 |
| 815 | Ga0496123_0118784 | 3300048926 | Bacteria | 1492 |
| 816 | Ga0496123_0303290 | 3300048926 | Bacteria | 761 |
| 817 | Ga0496123_0332063 | 3300048926 | Bacteria | 713 |
| 818 | Ga0496124_0000151 | 3300048927 | Bacteria | 142761 |
| 819 | Ga0496124_0004227 | 3300048927 | Bacteria | 16903 |
| 820 | Ga0496124_0006364 | 3300048927 | Bacteria | 12884 |
| 821 | Ga0496124_0013516 | 3300048927 | Bacteria | 7964 |
| 822 | Ga0496124_0017790 | 3300048927 | Bacteria | 6685 |
| 823 | Ga0496124_0026034 | 3300048927 | Bacteria | 5282 |
| 824 | Ga0496124_0038026 | 3300048927 | Bacteria | 4180 |
| 825 | Ga0496124_0041851 | 3300048927 | Bacteria | 3948 |
| 826 | Ga0496124_0048295 | 3300048927 | Bacteria | 3638 |
| 827 | Ga0496124_0107451 | 3300048927 | Bacteria | 2251 |
| 828 | Ga0496124_0201190 | 3300048927 | Bacteria | 1514 |
| 829 | Ga0496124_0269090 | 3300048927 | Bacteria | 1249 |
| 830 | Ga0496124_0442663 | 3300048927 | Bacteria | 888 |
| 831 | Ga0496125_0006506 | 3300048928 | Bacteria | 12604 |
| 832 | Ga0496125_0007308 | 3300048928 | Bacteria | 11761 |
| 833 | Ga0496125_0008984 | 3300048928 | Bacteria | 10362 |
| 834 | Ga0496125_0015094 | 3300048928 | Bacteria | 7493 |
| 835 | Ga0496125_0119152 | 3300048928 | Bacteria | 1888 |
| 836 | Ga0496125_0218506 | 3300048928 | Bacteria | 1230 |
| 837 | Ga0496126_0015959 | 3300048929 | Bacteria | 7532 |
| 838 | Ga0496126_0020765 | 3300048929 | Bacteria | 6429 |
| 839 | Ga0496126_0482943 | 3300048929 | Bacteria | 992 |
| 840 | Ga0495678_000328 | 3300049459 | Bacteria | 50414 |
| 841 | Ga0495678_001561 | 3300049459 | Bacteria | 17597 |
| 842 | Ga0495678_007885 | 3300049459 | Bacteria | 5468 |
| 843 | Ga0495678_010925 | 3300049459 | Bacteria | 4374 |
| 844 | Ga0495678_024761 | 3300049459 | Bacteria | 2586 |
| 845 | Ga0495678_035275 | 3300049459 | Bacteria | 2051 |
| 846 | Ga0495678_065470 | 3300049459 | Bacteria | 1349 |
| 847 | Ga0495678_078622 | 3300049459 | Bacteria | 1190 |
| 848 | Ga0495678_159371 | 3300049459 | Bacteria | 722 |
| 849 | Ga0495682_0033185 | 3300049460 | Bacteria | 1905 |
| 850 | Ga0495682_0118371 | 3300049460 | Bacteria | 948 |
| 851 | Ga0501032_0012424 | 3300049569 | Bacteria | 6084 |
| 852 | Ga0501034_0059481 | 3300049571 | Bacteria | 3838 |
| 853 | Ga0501034_0111107 | 3300049571 | Bacteria | 2731 |
| 854 | Ga0501036_1062014 | 3300049572 | Bacteria | 662 |
| 855 | Ga0501037_0414262 | 3300049573 | Bacteria | 923 |
| 856 | Ga0501039_0179010 | 3300049575 | Bacteria | 1667 |
| 857 | Ga0501241_000445 | 3300049758 | Bacteria | 8996 |
| 858 | Ga0501035_0136461 | 3300049822 | Bacteria | 2136 |
| 859 | Ga0501226_000004 | 3300049853 | Bacteria | 284656 |
| 860 | Ga0501226_002197 | 3300049853 | Bacteria | 2409 |
| 861 | nmdc:mga08y16_38962_c1 | 3300050511 | Bacteria | 4988 |
| 862 | nmdc:mga0n895_15523_c1 | 3300050512 | Bacteria | 6948 |
| 863 | nmdc:mga0rr50_357181_c1 | 3300050513 | Bacteria | 1230 |
| 864 | nmdc:mga08x19_1280_c1 | 3300050514 | Bacteria | 15609 |
| 865 | nmdc:mga0a205_2190_c1 | 3300050515 | Bacteria | 17194 |
| 866 | nmdc:mga0sz30_80283_c1 | 3300050516 | Bacteria | 1062 |
| 867 | Ga0500572_001243 | 3300053111 | Bacteria | 7191 |
| 868 | Ga0500595_003668 | 3300053119 | Bacteria | 7101 |
| 869 | Ga0500616_0000885 | 3300053153 | Bacteria | 33029 |
| 870 | 2883578382 | 2883577096 | Bacteria | 4709178 |
| 871 | 2510284235 | 2510065053 | Bacteria | 5005518 |
| 872 | 2510293081 | 2510065055 | Bacteria | 5037935 |
| 873 | 2510312582 | 2510065058 | Bacteria | 5005894 |
| 874 | 2511256186 | 2511231004 | Bacteria | 6669789 |
| 875 | 2511263411 | 2511231006 | Bacteria | 6794709 |
| 876 | 2511272280 | 2511231007 | Bacteria | 6306603 |
| 877 | 2511279331 | 2511231008 | Bacteria | 6624100 |
| 878 | 2511287559 | 2511231010 | Bacteria | 6373152 |
| 879 | 2511297464 | 2511231011 | Bacteria | 6149768 |
| 880 | 2511300954 | 2511231012 | Bacteria | 6738011 |
| 881 | 2511311571 | 2511231014 | Bacteria | 6462302 |
| 882 | 2511322632 | 2511231015 | Bacteria | 6598026 |
| 883 | 2511326405 | 2511231016 | Bacteria | 6704427 |
| 884 | 2511330882 | 2511231017 | Bacteria | 6503007 |
| 885 | 2511341471 | 2511231018 | Bacteria | 6436256 |
| 886 | 2511346513 | 2511231019 | Bacteria | 6520662 |
| 887 | 2511349225 | 2511231020 | Bacteria | 6115223 |
| 888 | 2511361485 | 2511231022 | Bacteria | 6719296 |
| 889 | 2511367173 | 2511231023 | Bacteria | 6808468 |
| 890 | 2511377662 | 2511231024 | Bacteria | 5835885 |
| 891 | 2511414412 | 2511231031 | Bacteria | 6558529 |
| 892 | 2511822572 | 2511231156 | Bacteria | 6845832 |
| 893 | 2512326066 | 2512047018 | Bacteria | 6663241 |
| 894 | 2548846535 | 2547132512 | Bacteria | 3416496 |
| 895 | 2555247476 | 2554235231 | Bacteria | 5215788 |
| 896 | 2555667539 | 2554235341 | Bacteria | 6867980 |
| 897 | 2583789696 | 2582580891 | Bacteria | 6800976 |
| 898 | 2597855768 | 2597489887 | Bacteria | 6666321 |
| 899 | 2599356760 | 2599185160 | Bacteria | 6844013 |
| 900 | 2599363210 | 2599185161 | Bacteria | 6960462 |
| 901 | 2599369838 | 2599185162 | Bacteria | 6957254 |
| 902 | 2599376319 | 2599185163 | Bacteria | 6995158 |
| 903 | 2599381865 | 2599185164 | Bacteria | 6841688 |
| 904 | 2599387991 | 2599185165 | Bacteria | 6843250 |
| 905 | 2599395483 | 2599185166 | Bacteria | 6959206 |
| 906 | 2599407248 | 2599185168 | Bacteria | 6997636 |
| 907 | 2599463593 | 2599185181 | Bacteria | 6844519 |
| 908 | 2599469059 | 2599185182 | Bacteria | 6883168 |
| 909 | 2599485670 | 2599185185 | Bacteria | 6652270 |
| 910 | 2599492612 | 2599185186 | Bacteria | 6831633 |
| 911 | 2599499991 | 2599185188 | Bacteria | 6164180 |
| 912 | 2599616704 | 2599185212 | Bacteria | 6765997 |
| 913 | 2599769532 | 2599185248 | Bacteria | 6696816 |
| 914 | 2599806800 | 2599185257 | Bacteria | 6492581 |
| 915 | 2599886953 | 2599185289 | Bacteria | 6778765 |
| 916 | 2599898282 | 2599185291 | Bacteria | 6775623 |
| 917 | 2599931013 | 2599185300 | Bacteria | 6062622 |
| 918 | 2599944606 | 2599185302 | Bacteria | 5954930 |
| 919 | 2599956051 | 2599185304 | Bacteria | 5951361 |
| 920 | 2599961224 | 2599185305 | Bacteria | 6748700 |
| 921 | 2599964669 | 2599185306 | Bacteria | 6637356 |
| 922 | 2599977399 | 2599185308 | Bacteria | 6621546 |
| 923 | 2599983182 | 2599185309 | Bacteria | 5969593 |
| 924 | 2599991115 | 2599185310 | Bacteria | 6014457 |
| 925 | 2599997768 | 2599185311 | Bacteria | 6354990 |
| 926 | 2600001013 | 2599185312 | Bacteria | 5912071 |
| 927 | 2600007062 | 2599185313 | Bacteria | 6658188 |
| 928 | 2600011568 | 2599185314 | Bacteria | 6621749 |
| 929 | 2600019200 | 2599185315 | Bacteria | 6771107 |
| 930 | 2600026424 | 2599185316 | Bacteria | 6320029 |
| 931 | 2600031984 | 2599185317 | Bacteria | 6435722 |
| 932 | 2600036832 | 2599185318 | Bacteria | 6961590 |
| 933 | 2600043272 | 2599185319 | Bacteria | 6637840 |
| 934 | 2600048186 | 2599185320 | Bacteria | 5963263 |
| 935 | 2600055792 | 2599185321 | Bacteria | 6764560 |
| 936 | 2600061177 | 2599185322 | Bacteria | 6763055 |
| 937 | 2600068421 | 2599185323 | Bacteria | 6688755 |
| 938 | 2600072457 | 2599185324 | Bacteria | 6590677 |
| 939 | 2600078427 | 2599185325 | Bacteria | 6324919 |
| 940 | 2600216222 | 2599185356 | Bacteria | 6843884 |
| 941 | 2600360263 | 2600254930 | Bacteria | 6431253 |
| 942 | 2600364770 | 2600254931 | Bacteria | 6734225 |
| 943 | 2600443782 | 2600254954 | Bacteria | 5100516 |
| 944 | 2601776389 | 2600255313 | Bacteria | 6842543 |
| 945 | 2601797953 | 2600255318 | Bacteria | 6383414 |
| 946 | 2602008762 | 2600255389 | Bacteria | 5275336 |
| 947 | 2606076564 | 2603880185 | Bacteria | 6379190 |
| 948 | 2606129022 | 2603880199 | Bacteria | 6377649 |
| 949 | 2608380735 | 2606217733 | Bacteria | 6360972 |
| 950 | 2624478339 | 2623620443 | Bacteria | 6427864 |
| 951 | 2624489886 | 2623620446 | Bacteria | 6500345 |
| 952 | 2643841105 | 2643221565 | Bacteria | 6216018 |
| 953 | 2643954785 | 2643221589 | Bacteria | 6250934 |
| 954 | 2644000440 | 2643221598 | Bacteria | 4578346 |
| 955 | 2644024425 | 2643221602 | Bacteria | 6249926 |
| 956 | 2644084782 | 2643221614 | Bacteria | 4260023 |
| 957 | 2644190118 | 2643221633 | Bacteria | 6733554 |
| 958 | 2644281383 | 2643221650 | Bacteria | 7029547 |
| 959 | 2644342334 | 2643221661 | Bacteria | 4267604 |
| 960 | 2644365634 | 2643221666 | Bacteria | 4265935 |
| 961 | 2652547082 | 2651869719 | Bacteria | 6047974 |
| 962 | 2671090679 | 2667528170 | Bacteria | 6786960 |
| 963 | 2671099852 | 2667528171 | Bacteria | 6900659 |
| 964 | 2671129219 | 2667528176 | Bacteria | 6724917 |
| 965 | 2671695637 | 2671180139 | Bacteria | 4196045 |
| 966 | 2671772451 | 2671180172 | Bacteria | 6495783 |
| 967 | 2678261112 | 2675903515 | Bacteria | 6580491 |
| 968 | 2715749329 | 2713897148 | Bacteria | 5883533 |
| 969 | 2715755595 | 2713897149 | Bacteria | 6506249 |
| 970 | 2718632281 | 2718217725 | Bacteria | 5758958 |
| 971 | 2729146024 | 2728369097 | Bacteria | 4333476 |
| 972 | 2739200577 | 2738543004 | Bacteria | 6381073 |
| 973 | 2739259945 | 2738543015 | Bacteria | 6750701 |
| 974 | 2739288626 | 2738543020 | Bacteria | 5718238 |
| 975 | 2739293938 | 2738543021 | Bacteria | 5718241 |
| 976 | 2739311407 | 2738543025 | Bacteria | 6600348 |
| 977 | 2743735187 | 2740892503 | Bacteria | 6855563 |
| 978 | 2745006423 | 2744054620 | Bacteria | 6551379 |
| 979 | 2765581720 | 2765235841 | Bacteria | 6137024 |
| 980 | 2774119434 | 2773857670 | Bacteria | 6407454 |
| 981 | 2774131450 | 2773857672 | Bacteria | 4993178 |
| 982 | 2774134854 | 2773857673 | Bacteria | 6513460 |
| 983 | 2784260926 | 2784132063 | Bacteria | 6262788 |
| 984 | 2784316357 | 2784132072 | Bacteria | 6596533 |
| 985 | 2794594149 | 2791355520 | Bacteria | 5948615 |
| 986 | 2807454700 | 2806310745 | Bacteria | 5742165 |
| 987 | 2808856225 | 2808606361 | Bacteria | 6136259 |
| 988 | 2808906719 | 2808606373 | Bacteria | 4423627 |
| 989 | 2808922623 | 2808606376 | Bacteria | 6248667 |
| 990 | 2808932661 | 2808606377 | Bacteria | 6646337 |
| 991 | 2808936269 | 2808606378 | Bacteria | 6177535 |
| 992 | 2808940148 | 2808606379 | Bacteria | 5022697 |
| 993 | 2808944310 | 2808606380 | Bacteria | 6248705 |
| 994 | 2808954782 | 2808606381 | Bacteria | 6646461 |
| 995 | 2808955989 | 2808606382 | Bacteria | 6841132 |
| 996 | 2808965622 | 2808606383 | Bacteria | 6138645 |
| 997 | 2808999618 | 2808606389 | Bacteria | 6138126 |
| 998 | 2809218095 | 2808606445 | Bacteria | 6057339 |
| 999 | 2812370334 | 2811994881 | Bacteria | 6298475 |
| 1000 | 2819657348 | 2818991456 | Bacteria | 6123676 |
| 1001 | 2819705332 | 2818991464 | Bacteria | 6907494 |
| 1002 | 2823425369 | 2823421272 | Bacteria | 5372474 |
| 1003 | 2825654146 | 2825651385 | Bacteria | 6715909 |
| 1004 | 2842807146 | 2842805378 | Bacteria | 5385175 |
| 1005 | 2842834285 | 2842832357 | Bacteria | 5959113 |
| 1006 | 2842846238 | 2842843487 | Bacteria | 6004777 |
| 1007 | 2842859961 | 2842854478 | Bacteria | 6143501 |
| 1008 | 2844668013 | 2844665904 | Bacteria | 6817974 |
| 1009 | 2852660332 | 2852657418 | Bacteria | 6472974 |
| 1010 | 2860343521 | 2860339153 | Bacteria | 6846989 |
| 1011 | 2878030284 | 2878029506 | Bacteria | 6418441 |
| 1012 | 2880231232 | 2880230671 | Bacteria | 6140320 |
| 1013 | 2904519688 | 2904518522 | Bacteria | 6068986 |
| 1014 | 2904553921 | 2904550169 | Bacteria | 6221258 |
| 1015 | 2912964296 | 2912963787 | Bacteria | 5646108 |
| 1016 | 2913037404 | 2913036834 | Bacteria | 6704877 |
| 1017 | 2917071290 | 2917070673 | Bacteria | 6868303 |
| 1018 | 2917836290 | 2917832318 | Bacteria | 5346010 |
| 1019 | 2919066031 | 2919063839 | Bacteria | 6302690 |
| 1020 | 2919127588 | 2919125081 | Bacteria | 5385106 |
| 1021 | 2919389648 | 2919385768 | Bacteria | 5897293 |
| 1022 | 2919460104 | 2919456309 | Bacteria | 6586567 |
| 1023 | 2919486547 | 2919481497 | Bacteria | 6907839 |
| 1024 | 2919488576 | 2919487758 | Bacteria | 5929766 |
| 1025 | 2919502112 | 2919501602 | Bacteria | 5286340 |
| 1026 | 2919698836 | 2919697872 | Bacteria | 6553725 |
| 1027 | 2923154183 | 2923153595 | Bacteria | 6870622 |
| 1028 | 2923524422 | 2923519811 | Bacteria | 6298479 |
| 1029 | 2923591638 | 2923586266 | Bacteria | 6565975 |
| 1030 | 2926063785 | 2926063275 | Bacteria | 5285848 |
| 1031 | 2929144936 | 2929144301 | Bacteria | 6622272 |
| 1032 | 2931371727 | 2931369376 | Bacteria | 6847892 |
| 1033 | 2931398962 | 2931396565 | Bacteria | 7251677 |
| 1034 | 2935359118 | 2935353572 | Unclassified | 6955622 |
| 1035 | 2939641224 | 2939636861 | Bacteria | 6297853 |
| 1036 | 2939655903 | 2939651529 | Bacteria | 5895393 |
| 1037 | 2945967706 | 2945961074 | Bacteria | 7342064 |
| 1038 | 2969305080 | 2969304461 | Bacteria | 6601805 |
| 1039 | 2974293226 | 2974289157 | Bacteria | 6080362 |
| 1040 | 2974301652 | 2974298342 | Bacteria | 4840922 |
| 1041 | 2984291875 | 2984286254 | Bacteria | 6702062 |
| 1042 | 2984500774 | 2984499530 | Bacteria | 5020881 |
| 1043 | 2984507311 | 2984504281 | Bacteria | 5262371 |
| 1044 | 2988732327 | 2988728565 | Bacteria | 6124362 |
| 1045 | 2990198675 | 2990196909 | Bacteria | 4054280 |
| 1046 | 2998140590 | 2998139840 | Bacteria | 6073514 |
| 1047 | 3007399738 | 3007395558 | Bacteria | 6755444 |
| 1048 | 3007518036 | 3007511990 | Bacteria | 6481491 |
| 1049 | 3007614976 | 3007614139 | Bacteria | 6053559 |
| 1050 | 3007622279 | 3007619802 | Bacteria | 6411688 |
| 1051 | 3007720383 | 3007718800 | Bacteria | 5971527 |
| 1052 | 3007808894 | 3007803356 | Bacteria | 5931491 |
| 1053 | 3007859817 | 3007855910 | Bacteria | 5637581 |
| 1054 | 3007864204 | 3007861166 | Bacteria | 6045338 |
| 1055 | 3007870824 | 3007866637 | Bacteria | 5899198 |
| 1056 | 3007872887 | 3007872151 | Bacteria | 5268868 |
| 1057 | 637317934 | 637000220 | Bacteria | 7074893 |
| 1058 | 640487056 | 640427133 | Bacteria | 4567418 |
| 1059 | 651174929 | 651053060 | Bacteria | 4689946 |
| 1060 | 8011352773 | 8011350971 | Bacteria | 6158957 |
| 1061 | 8015688433 | 8015687852 | Bacteria | 6613826 |
| 1062 | 8016730582 | 8016728285 | Bacteria | 5263933 |
| 1063 | 8019770414 | 8019769354 | Bacteria | 6924660 |
| 1064 | 8019777460 | 8019775933 | Bacteria | 6858656 |
| 1065 | 8030000150 | 8029995093 | Bacteria | 5990776 |
| 1066 | 8034963359 | 8034962539 | Bacteria | 4884839 |
| 1067 | 8052495160 | 8052494512 | Bacteria | 5765634 |
| 1068 | 8054930813 | 8054929484 | Bacteria | 5599761 |
| 1069 | 8055771533 | 8055770955 | Bacteria | 6827675 |
| 1070 | 8056116843 | 8056115690 | Bacteria | 5527654 |
| 1071 | 8056125358 | 8056120720 | Bacteria | 5758328 |
| 1072 | 8056126588 | 8056125926 | Bacteria | 6228218 |
| 1073 | 8056143868 | 8056143049 | Bacteria | 6307666 |
| 1074 | 8056158631 | 8056155041 | Bacteria | 6486948 |
| 1075 | 8056170461 | 8056166840 | Bacteria | 5820959 |
| 1076 | 8056176591 | 8056172158 | Bacteria | 6133900 |
| 1077 | 8056182923 | 8056177738 | Bacteria | 6748268 |
| 1078 | 8056573413 | 8056569372 | Bacteria | 5997322 |
| 1079 | 8057802817 | 8057798959 | Bacteria | 6713499 |
| 1080 | MRS2a_Contig_17 | |||
| 1081 | MRS2a_Contig_743 | |||
| 1082 | SwRhRL2b_contig_1875519 | |||
| 1083 | SwRhRL2b_contig_1906178 | |||
| 1084 | SwRhRL2b_contig_802536 | |||
| 1085 | JGI25162J39368_1000096 | |||
| 1086 | JGI25162J39368_1001687 | |||
| 1087 | JGI25163J39215_1000085 | |||
| 1088 | JGI25163J39215_1000575 | |||
| 1089 | JGI25164J39214_1000074 | |||
| 1090 | JGI25164J39214_1000819 | |||
| 1091 | JGI25165J46597_1000177 | |||
| 1092 | JGI25165J46597_1001612 | |||
| 1093 | rootH1_10233992 | |||
| 1094 | Ga0006562J51391_1097134 | |||
| 1095 | Ga0055536_1000101 | |||
| 1096 | Ga0055536_1000841 | |||
| 1097 | Ga0055536_1003159 | |||
| 1098 | Ga0055536_1050526 | |||
| 1099 | Ga0055530_10000097 | |||
| 1100 | Ga0055530_10000216 | |||
| 1101 | Ga0055530_10001211 | |||
| 1102 | Ga0055530_10011795 | |||
| 1103 | Ga0055540_1000108 | |||
| 1104 | Ga0055540_1000232 | |||
| 1105 | Ga0055540_1000837 | |||
| 1106 | Ga0055531_10000811 | |||
| 1107 | Ga0055531_10001535 | |||
| 1108 | Ga0065714_10000496 | |||
| 1109 | Ga0065714_10002602 | |||
| 1110 | Ga0065714_10004617 | |||
| 1111 | Ga0065714_10017343 | |||
| 1112 | Ga0065714_10018028 | |||
| 1113 | Ga0065714_10019951 | |||
| 1114 | Ga0065714_10020229 | |||
| 1115 | Ga0065714_10034541 | |||
| 1116 | Ga0065714_10038529 | |||
| 1117 | Ga0065714_10068262 | |||
| 1118 | Ga0065714_10071110 | |||
| 1119 | Ga0065704_10000569 | |||
| 1120 | Ga0065704_10101832 | |||
| 1121 | Ga0065704_10107570 | |||
| 1122 | Ga0065704_10142007 | |||
| 1123 | Ga0065704_10228549 | |||
| 1124 | Ga0065712_10069536 | |||
| 1125 | Ga0065715_10093817 | |||
| 1126 | Ga0068868_100921531 | |||
| 1127 | Ga0070689_100659285 | |||
| 1128 | Ga0070669_100000691 | |||
| 1129 | Ga0070669_100641340 | |||
| 1130 | Ga0070688_100240307 | |||
| 1131 | Ga0070694_100304069 | |||
| 1132 | Ga0070662_100032515 | |||
| 1133 | Ga0070685_10506884 | |||
| 1134 | Ga0070665_100036433 | |||
| 1135 | Ga0070665_100367655 | |||
| 1136 | Ga0068864_100050860 | |||
| 1137 | Ga0068858_100123910 | |||
| 1138 | Ga0068862_100790518 | |||
| 1139 | Ga0075364_10068367 | |||
| 1140 | Ga0075364_10133161 | |||
| 1141 | Ga0075364_10147421 | |||
| 1142 | Ga0075364_10282461 | |||
| 1143 | Ga0075432_10000430 | |||
| 1144 | Ga0075432_10006793 | |||
| 1145 | Ga0075432_10023232 | |||
| 1146 | Ga0075432_10042013 | |||
| 1147 | Ga0075362_10132803 | |||
| 1148 | Ga0075362_10325196 | |||
| 1149 | Ga0075369_10135861 | |||
| 1150 | Ga0075369_10140083 | |||
| 1151 | Ga0075433_10076424 | |||
| 1152 | Ga0075434_100000779 | |||
| 1153 | Ga0075436_100003752 | |||
| 1154 | Ga0075436_100107858 | |||
| 1155 | Ga0075436_100224477 | |||
| 1156 | Ga0079104_1000164 | |||
| 1157 | Ga0079104_1001028 | |||
| 1158 | Ga0079104_1038108 | |||
| 1159 | Ga0099826_10036309 | |||
| 1160 | Ga0075435_100004009 | |||
| 1161 | Ga0105251_10000320 | |||
| 1162 | Ga0105251_10005626 | |||
| 1163 | Ga0105251_10007499 | |||
| 1164 | Ga0105251_10012167 | |||
| 1165 | Ga0105251_10024286 | |||
| 1166 | Ga0105251_10038780 | |||
| 1167 | Ga0105251_10043537 | |||
| 1168 | Ga0105251_10056512 | |||
| 1169 | Ga0105244_10004406 | |||
| 1170 | Ga0105244_10020379 | |||
| 1171 | Ga0105244_10020778 | |||
| 1172 | Ga0105244_10023123 | |||
| 1173 | Ga0105244_10026438 | |||
| 1174 | Ga0105244_10033813 | |||
| 1175 | Ga0105244_10038610 | |||
| 1176 | Ga0105244_10042166 | |||
| 1177 | Ga0105244_10057672 | |||
| 1178 | Ga0105244_10079310 | |||
| 1179 | Ga0105244_10149715 | |||
| 1180 | Ga0105244_10153929 | |||
| 1181 | Ga0105244_10156944 | |||
| 1182 | Ga0105244_10330101 | |||
| 1183 | Ga0105250_10000907 | |||
| 1184 | Ga0105250_10002683 | |||
| 1185 | Ga0105250_10002966 | |||
| 1186 | Ga0105250_10030607 | |||
| 1187 | Ga0105250_10036444 | |||
| 1188 | Ga0105250_10037704 | |||
| 1189 | Ga0105250_10040685 | |||
| 1190 | Ga0105250_10051361 | |||
| 1191 | Ga0105250_10119559 | |||
| 1192 | Ga0105250_10259505 | |||
| 1193 | Ga0111539_10033070 | |||
| 1194 | Ga0105243_10000100 | |||
| 1195 | Ga0105243_10000639 | |||
| 1196 | Ga0105243_10009698 | |||
| 1197 | Ga0105243_10145665 | |||
| 1198 | Ga0105243_10612730 | |||
| 1199 | Ga0105242_10434640 | |||
| 1200 | Ga0105238_10553262 | |||
| 1201 | Ga0105249_10039074 | |||
| 1202 | Ga0105246_10025027 | |||
| 1203 | Ga0105246_10093520 | |||
| 1204 | Ga0105246_10352640 | |||
| 1205 | Ga0157345_1000159 | |||
| 1206 | Ga0157345_1000564 | |||
| 1207 | Ga0157373_10002803 | |||
| 1208 | Ga0157373_10007800 | |||
| 1209 | Ga0157373_10013328 | |||
| 1210 | Ga0157373_10201409 | |||
| 1211 | Ga0157373_10313477 | |||
| 1212 | Ga0157371_10001083 | |||
| 1213 | Ga0157371_10004015 | |||
| 1214 | Ga0157371_10004573 | |||
| 1215 | Ga0157371_10357800 | |||
| 1216 | Ga0157370_10000150 | |||
| 1217 | Ga0157370_10016733 | |||
| 1218 | Ga0157370_10026170 | |||
| 1219 | Ga0157370_10087214 | |||
| 1220 | Ga0157370_10122194 | |||
| 1221 | Ga0157369_10014391 | |||
| 1222 | Ga0157369_10016760 | |||
| 1223 | Ga0157369_10689704 | |||
| 1224 | Ga0163162_10000507 | |||
| 1225 | Ga0163162_10809629 | |||
| 1226 | Ga0157372_10070287 | |||
| 1227 | Ga0157372_10216848 | |||
| 1228 | Ga0157372_10654244 | |||
| 1229 | Ga0157375_10607916 | |||
| 1230 | Ga0157375_10979220 | |||
| 1231 | Ga0157375_11614519 | |||
| 1232 | Ga0182008_10001110 | |||
| 1233 | Ga0182008_10002539 | |||
| 1234 | Ga0182008_10022623 | |||
| 1235 | Ga0182008_10159554 | |||
| 1236 | Ga0182008_10189527 | |||
| 1237 | Ga0157377_10541053 | |||
| 1238 | Ga0182006_1001690 | |||
| 1239 | Ga0182006_1003213 | |||
| 1240 | Ga0182006_1003327 | |||
| 1241 | Ga0182006_1007654 | |||
| 1242 | Ga0182006_1050776 | |||
| 1243 | Ga0182006_1129432 | |||
| 1244 | Ga0182007_10001779 | |||
| 1245 | Ga0182007_10064498 | |||
| 1246 | Ga0182005_1002100 | |||
| 1247 | Ga0182005_1006665 | |||
| 1248 | Ga0182005_1011115 | |||
| 1249 | Ga0182005_1014857 | |||
| 1250 | Ga0163161_10006460 | |||
| 1251 | Ga0163161_10015968 | |||
| 1252 | Ga0163161_10022443 | |||
| 1253 | Ga0163161_10307810 | |||
| 1254 | Ga0163161_10518696 | |||
| 1255 | Ga0209760_100031 | |||
| 1256 | Ga0209760_100056 | |||
| 1257 | Ga0209760_100139 | |||
| 1258 | Ga0209563_101468 | |||
| 1259 | Ga0207427_100016 | |||
| 1260 | Ga0207427_100067 | |||
| 1261 | Ga0209437_100011 | |||
| 1262 | Ga0209437_100016 | |||
| 1263 | Ga0209233_1000019 | |||
| 1264 | Ga0209233_1000156 | |||
| 1265 | Ga0209675_1003821 | |||
| 1266 | Ga0209676_1000025 | |||
| 1267 | Ga0209676_1000096 | |||
| 1268 | Ga0209676_1000266 | |||
| 1269 | Ga0209676_1000722 | |||
| 1270 | Ga0209676_1002706 | |||
| 1271 | Ga0209676_1003411 | |||
| 1272 | Ga0209050_1000028 | |||
| 1273 | Ga0209050_1000301 | |||
| 1274 | Ga0209050_1000356 | |||
| 1275 | Ga0209050_1001464 | |||
| 1276 | Ga0209051_1000089 | |||
| 1277 | Ga0209051_1000225 | |||
| 1278 | Ga0209051_1000467 | |||
| 1279 | Ga0209051_1025890 | |||
| 1280 | Ga0209257_1000034 | |||
| 1281 | Ga0209257_1002752 | |||
| 1282 | Ga0207696_1000065 | |||
| 1283 | Ga0207696_1000085 | |||
| 1284 | Ga0207696_1000122 | |||
| 1285 | Ga0207696_1000941 | |||
| 1286 | Ga0207696_1002508 | |||
| 1287 | Ga0207696_1007215 | |||
| 1288 | Ga0207696_1019119 | |||
| 1289 | Ga0207696_1052541 | |||
| 1290 | Ga0207655_1000394 | |||
| 1291 | Ga0207655_1002445 | |||
| 1292 | Ga0207655_1004333 | |||
| 1293 | Ga0207655_1006051 | |||
| 1294 | Ga0207655_1008544 | |||
| 1295 | Ga0207655_1020270 | |||
| 1296 | Ga0207655_1024776 | |||
| 1297 | Ga0207655_1038771 | |||
| 1298 | Ga0207655_1076442 | |||
| 1299 | Ga0207655_1089243 | |||
| 1300 | Ga0207655_1093670 | |||
| 1301 | Ga0207655_1172640 | |||
| 1302 | Ga0207713_1000094 | |||
| 1303 | Ga0207713_1002036 | |||
| 1304 | Ga0207713_1004076 | |||
| 1305 | Ga0207713_1004450 | |||
| 1306 | Ga0207713_1005201 | |||
| 1307 | Ga0207713_1005328 | |||
| 1308 | Ga0207713_1006372 | |||
| 1309 | Ga0207713_1008122 | |||
| 1310 | Ga0207713_1008210 | |||
| 1311 | Ga0207713_1012779 | |||
| 1312 | Ga0207713_1028190 | |||
| 1313 | Ga0207713_1031572 | |||
| 1314 | Ga0207713_1080780 | |||
| 1315 | Ga0207681_10000917 | |||
| 1316 | Ga0207681_10621091 | |||
| 1317 | Ga0207706_10006144 | |||
| 1318 | Ga0207686_10009573 | |||
| 1319 | Ga0207709_10000022 | |||
| 1320 | Ga0207709_10000252 | |||
| 1321 | Ga0207709_10008422 | |||
| 1322 | Ga0207709_10043054 | |||
| 1323 | Ga0207709_10612451 | |||
| 1324 | Ga0207670_10570637 | |||
| 1325 | Ga0207665_10215714 | |||
| 1326 | Ga0207689_10489952 | |||
| 1327 | Ga0207712_10093998 | |||
| 1328 | Ga0207703_10335273 | |||
| 1329 | Ga0207641_11171646 | |||
| 1330 | Ga0207676_10101076 | |||
| 1331 | Ga0207674_10421042 | |||
| 1332 | Ga0209281_1000033 | |||
| 1333 | Ga0209281_1000159 | |||
| 1334 | Ga0209281_1006627 | |||
| 1335 | Ga0209281_1024782 | |||
| 1336 | Ga0209389_1000298 | |||
| 1337 | Ga0209371_1002187 | |||
| 1338 | Ga0209981_1006882 | |||
| 1339 | Ga0207428_10067474 | |||
| 1340 | Ga0207428_10101146 | |||
| 1341 | Ga0207428_10144231 | |||
| 1342 | Ga0207428_10166442 | |||
| 1343 | Ga0207428_10179985 | |||
| 1344 | Ga0268266_10006145 | |||
| 1345 | Ga0268264_10229265 | |||
| 1346 | Ga0307517_10131827 | |||
| 1347 | Ga0307517_10371744 | |||
| 1348 | Ga0268256_1001923 | |||
| 1349 | Ga0314311_1080024 | |||
| 1350 | Ga0316178_1013428 | |||
| 1351 | Ga0316183_1055787 | |||
| 1352 | Ga0265332_10000069 | |||
| 1353 | Ga0265331_10063038 | |||
| 1354 | Ga0265327_10000166 | |||
| 1355 | Ga0307408_100000002 | |||
| 1356 | Ga0307408_100005151 | |||
| 1357 | Ga0307408_100174084 | |||
| 1358 | Ga0307408_100363187 | |||
| 1359 | Ga0307408_100540778 | |||
| 1360 | Ga0307408_100595389 | |||
| 1361 | Ga0307408_101296173 | |||
| 1362 | Ga0307516_10050897 | |||
| 1363 | Ga0307405_10006452 | |||
| 1364 | Ga0307413_10458199 | |||
| 1365 | Ga0307406_10726120 | |||
| 1366 | Ga0307407_10155338 | |||
| 1367 | Ga0307412_10012425 | |||
| 1368 | Ga0307412_10345454 | |||
| 1369 | Ga0307412_10359717 | |||
| 1370 | Ga0307412_10386717 | |||
| 1371 | Ga0307412_10640123 | |||
| 1372 | Ga0307416_100708533 | |||
| 1373 | Ga0307414_10050535 | |||
| 1374 | Ga0307414_10330832 | |||
| 1375 | Ga0307414_10478868 | |||
| 1376 | Ga0307414_11057194 | |||
| 1377 | Ga0307411_10346032 | |||
| 1378 | Ga0307510_10019083 | |||
| 1379 | Ga0373928_0015934 | |||
| 1380 | Ga0373940_0026620 | |||
| 1381 | Ga0373931_0078429 | |||
| 1382 | Ga0373931_0220739 | |||
| 1383 | Ga0237819_12707 | |||
| 1384 | Ga0439436_0000458 | |||
| 1385 | Ga0439438_000954 | |||
| 1386 | Ga0439438_001498 | |||
| 1387 | Ga0439438_002086 | |||
| 1388 | Ga0439438_002651 | |||
| 1389 | Ga0439438_003029 | |||
| 1390 | Ga0439438_005181 | |||
| 1391 | Ga0439438_012977 | |||
| 1392 | Ga0439438_016750 | |||
| 1393 | Ga0439438_025491 | |||
| 1394 | Ga0439447_000310 | |||
| 1395 | Ga0439447_000501 | |||
| 1396 | Ga0439447_000663 | |||
| 1397 | Ga0439447_001475 | |||
| 1398 | Ga0439466_0000334 | |||
| 1399 | Ga0439466_0000620 | |||
| 1400 | Ga0439466_0000760 | |||
| 1401 | Ga0439466_0001782 | |||
| 1402 | Ga0439466_0016057 | |||
| 1403 | Ga0439466_0016062 | |||
| 1404 | Ga0439466_0018107 | |||
| 1405 | Ga0439466_0037859 | |||
| 1406 | Ga0439466_0098917 | |||
| 1407 | Ga0439466_0139737 | |||
| 1408 | Ga0439431_0008113 | |||
| 1409 | Ga0439431_0167279 | |||
| 1410 | Ga0439437_000115 | |||
| 1411 | Ga0439432_001620 | |||
| 1412 | Ga0439432_002572 | |||
| 1413 | Ga0439432_030244 | |||
| 1414 | Ga0439432_060316 | |||
| 1415 | Ga0439432_062351 | |||
| 1416 | Ga0439451_001646 | |||
| 1417 | Ga0439451_005348 | |||
| 1418 | Ga0439452_000570 | |||
| 1419 | Ga0439452_000628 | |||
| 1420 | Ga0439452_001241 | |||
| 1421 | Ga0439452_001308 | |||
| 1422 | Ga0439452_001398 | |||
| 1423 | Ga0439452_002762 | |||
| 1424 | Ga0439452_007140 | |||
| 1425 | Ga0439452_009153 | |||
| 1426 | Ga0439452_050851 | |||
| 1427 | Ga0439454_041528 | |||
| 1428 | Ga0439456_000115 | |||
| 1429 | Ga0439456_001126 | |||
| 1430 | Ga0439456_004058 | |||
| 1431 | Ga0439456_004723 | |||
| 1432 | Ga0439456_005418 | |||
| 1433 | Ga0439456_012044 | |||
| 1434 | Ga0439463_002768 | |||
| 1435 | Ga0439463_044927 | |||
| 1436 | Ga0450911_000006 | |||
| 1437 | Ga0450911_000320 | |||
| 1438 | Ga0450911_001728 | |||
| 1439 | Ga0450919_002700 | |||
| 1440 | Ga0450920_000248 | |||
| 1441 | Ga0450922_005091 | |||
| 1442 | Ga0450923_020079 | |||
| 1443 | Ga0450923_020280 | |||
| 1444 | Ga0450890_002225 | |||
| 1445 | Ga0450902_000293 | |||
| 1446 | Ga0450903_004291 | |||
| 1447 | Ga0450903_004968 | |||
| 1448 | Ga0450903_011263 | |||
| 1449 | Ga0450904_000006 | |||
| 1450 | Ga0450904_004966 | |||
| 1451 | Ga0450905_006406 | |||
| 1452 | Ga0450905_006408 | |||
| 1453 | Ga0450905_027742 | |||
| 1454 | Ga0450907_000201 | |||
| 1455 | Ga0450907_014392 | |||
| 1456 | Ga0450910_000798 | |||
| 1457 | Ga0450910_001658 | |||
| 1458 | Ga0439446_0000905 | |||
| 1459 | Ga0439446_0001535 | |||
| 1460 | Ga0439446_0013529 | |||
| 1461 | Ga0450908_029334 | |||
| 1462 | Ga0450909_000467 | |||
| 1463 | Ga0450909_002351 | |||
| 1464 | Ga0450909_003836 | |||
| 1465 | Ga0439434_0000490 | |||
| 1466 | Ga0439434_0000535 | |||
| 1467 | Ga0439434_0040768 | |||
| 1468 | Ga0439464_0000840 | |||
| 1469 | Ga0439464_0002527 | |||
| 1470 | Ga0439460_0000323 | |||
| 1471 | Ga0439460_0009959 | |||
| 1472 | Ga0439460_0013675 | |||
| 1473 | Ga0450916_000103 | |||
| 1474 | Ga0450918_030447 | |||
| 1475 | Ga0450901_000364 | |||
| 1476 | Ga0450901_005029 | |||
| 1477 | Ga0439440_0002562 | |||
| 1478 | Ga0439440_0005864 | |||
| 1479 | Ga0439440_0007439 | |||
| 1480 | Ga0466963_0278436 | |||
| 1481 | Ga0466959_0305715 | |||
| 1482 | Ga0451576_0404201 | |||
| 1483 | Ga0451576_0519155 | |||
| 1484 | Ga0451576_1008408 | |||
| 1485 | Ga0451576_1042742 | |||
| 1486 | Ga0495617_000668 | |||
| 1487 | Ga0495617_025418 | |||
| 1488 | Ga0495617_083022 | |||
| 1489 | Ga0495617_097017 | |||
| 1490 | Ga0495617_102326 | |||
| 1491 | Ga0495627_001495 | |||
| 1492 | Ga0495627_002107 | |||
| 1493 | Ga0495627_002824 | |||
| 1494 | Ga0495627_002904 | |||
| 1495 | Ga0495627_006008 | |||
| 1496 | Ga0495627_014321 | |||
| 1497 | Ga0495592_0061075 | |||
| 1498 | Ga0495603_0004020 | |||
| 1499 | Ga0495603_0010701 | |||
| 1500 | Ga0495590_0000657 | |||
| 1501 | Ga0495590_0000861 | |||
| 1502 | Ga0495590_0005018 | |||
| 1503 | Ga0495590_0005991 | |||
| 1504 | Ga0495591_001018 | |||
| 1505 | Ga0495591_002638 | |||
| 1506 | Ga0495591_003243 | |||
| 1507 | Ga0495591_003488 | |||
| 1508 | Ga0495591_003947 | |||
| 1509 | Ga0495591_005377 | |||
| 1510 | Ga0495591_034913 | |||
| 1511 | Ga0495591_042080 | |||
| 1512 | Ga0495638_0003250 | |||
| 1513 | Ga0495638_0007939 | |||
| 1514 | Ga0495638_0013231 | |||
| 1515 | Ga0495638_0041352 | |||
| 1516 | Ga0495638_0046070 | |||
| 1517 | Ga0495638_0084701 | |||
| 1518 | Ga0495638_0096838 | |||
| 1519 | Ga0495638_0189369 | |||
| 1520 | Ga0495653_0037770 | |||
| 1521 | Ga0495653_0074615 | |||
| 1522 | Ga0495653_0197759 | |||
| 1523 | Ga0495650_0002040 | |||
| 1524 | Ga0495650_0003893 | |||
| 1525 | Ga0495650_0019901 | |||
| 1526 | Ga0495650_0021187 | |||
| 1527 | Ga0495650_0084602 | |||
| 1528 | Ga0495582_0073431 | |||
| 1529 | Ga0495605_0001491 | |||
| 1530 | Ga0495605_0001568 | |||
| 1531 | Ga0495605_0005079 | |||
| 1532 | Ga0495605_0015409 | |||
| 1533 | Ga0495605_0021295 | |||
| 1534 | Ga0495605_0072459 | |||
| 1535 | Ga0495639_0000459 | |||
| 1536 | Ga0495639_0059801 | |||
| 1537 | Ga0495584_0003293 | |||
| 1538 | Ga0495584_0006584 | |||
| 1539 | Ga0495584_0009654 | |||
| 1540 | Ga0495584_0015210 | |||
| 1541 | Ga0495584_0015852 | |||
| 1542 | Ga0495584_0032600 | |||
| 1543 | Ga0495584_0378959 | |||
| 1544 | Ga0495585_0001600 | |||
| 1545 | Ga0495585_0003756 | |||
| 1546 | Ga0495585_0004425 | |||
| 1547 | Ga0495585_0012821 | |||
| 1548 | Ga0495585_0021387 | |||
| 1549 | Ga0495585_0042304 | |||
| 1550 | Ga0495585_0138747 | |||
| 1551 | Ga0495585_0145104 | |||
| 1552 | Ga0495594_0016430 | |||
| 1553 | Ga0495596_0000810 | |||
| 1554 | Ga0495596_0078628 | |||
| 1555 | Ga0495607_0002501 | |||
| 1556 | Ga0495607_0005610 | |||
| 1557 | Ga0495607_0006757 | |||
| 1558 | Ga0495607_0010753 | |||
| 1559 | Ga0495607_0013661 | |||
| 1560 | Ga0495607_0017489 | |||
| 1561 | Ga0495607_0051336 | |||
| 1562 | Ga0495607_0064907 | |||
| 1563 | Ga0495583_0004611 | |||
| 1564 | Ga0495583_0005527 | |||
| 1565 | Ga0495606_0000613 | |||
| 1566 | Ga0495606_0003599 | |||
| 1567 | Ga0495606_0009739 | |||
| 1568 | Ga0495606_0009990 | |||
| 1569 | Ga0495606_0014067 | |||
| 1570 | Ga0495606_0014214 | |||
| 1571 | Ga0495606_0018106 | |||
| 1572 | Ga0495606_0026817 | |||
| 1573 | Ga0495606_0253278 | |||
| 1574 | Ga0495610_0004876 | |||
| 1575 | Ga0495610_0009061 | |||
| 1576 | Ga0495610_0024811 | |||
| 1577 | Ga0495610_0028656 | |||
| 1578 | Ga0495610_0088869 | |||
| 1579 | Ga0495610_0135665 | |||
| 1580 | Ga0495616_0001743 | |||
| 1581 | Ga0495616_0002218 | |||
| 1582 | Ga0495616_0002439 | |||
| 1583 | Ga0495616_0003301 | |||
| 1584 | Ga0495616_0007195 | |||
| 1585 | Ga0495616_0018775 | |||
| 1586 | Ga0495616_0091464 | |||
| 1587 | Ga0495616_0156050 | |||
| 1588 | Ga0495620_0001683 | |||
| 1589 | Ga0495620_0007508 | |||
| 1590 | Ga0495620_0008596 | |||
| 1591 | Ga0495620_0008957 | |||
| 1592 | Ga0495620_0021811 | |||
| 1593 | Ga0495620_0043970 | |||
| 1594 | Ga0495620_0095358 | |||
| 1595 | Ga0495620_0102536 | |||
| 1596 | Ga0495628_0129876 | |||
| 1597 | Ga0495630_0082181 | |||
| 1598 | Ga0495631_0000110 | |||
| 1599 | Ga0495631_0003550 | |||
| 1600 | Ga0495631_0012696 | |||
| 1601 | Ga0495631_0034690 | |||
| 1602 | Ga0495632_0001736 | |||
| 1603 | Ga0495632_0004067 | |||
| 1604 | Ga0495632_0006881 | |||
| 1605 | Ga0495632_0008448 | |||
| 1606 | Ga0495632_0009156 | |||
| 1607 | Ga0495632_0019359 | |||
| 1608 | Ga0495632_0027411 | |||
| 1609 | Ga0495632_0067705 | |||
| 1610 | Ga0495632_0166526 | |||
| 1611 | Ga0495632_0174411 | |||
| 1612 | Ga0495632_0205749 | |||
| 1613 | Ga0495632_0235075 | |||
| 1614 | Ga0495637_0001645 | |||
| 1615 | Ga0495637_0004763 | |||
| 1616 | Ga0495637_0006267 | |||
| 1617 | Ga0495637_0006296 | |||
| 1618 | Ga0495637_0023311 | |||
| 1619 | Ga0495637_0059827 | |||
| 1620 | Ga0495637_0076171 | |||
| 1621 | Ga0495637_0102271 | |||
| 1622 | Ga0495643_0000585 | |||
| 1623 | Ga0495643_0002726 | |||
| 1624 | Ga0495643_0009165 | |||
| 1625 | Ga0495643_0013916 | |||
| 1626 | Ga0495643_0020785 | |||
| 1627 | Ga0495643_0041612 | |||
| 1628 | Ga0495643_0059553 | |||
| 1629 | Ga0495643_0072191 | |||
| 1630 | Ga0495643_0081585 | |||
| 1631 | Ga0495643_0088947 | |||
| 1632 | Ga0495643_0260537 | |||
| 1633 | Ga0495644_0001407 | |||
| 1634 | Ga0495644_0026865 | |||
| 1635 | Ga0495644_0071001 | |||
| 1636 | Ga0495648_0001916 | |||
| 1637 | Ga0495648_0005960 | |||
| 1638 | Ga0495648_0007582 | |||
| 1639 | Ga0495648_0008479 | |||
| 1640 | Ga0495648_0008597 | |||
| 1641 | Ga0495648_0023677 | |||
| 1642 | Ga0495648_0036713 | |||
| 1643 | Ga0495648_0058186 | |||
| 1644 | Ga0495648_0145493 | |||
| 1645 | Ga0495648_0176131 | |||
| 1646 | Ga0495648_0194474 | |||
| 1647 | Ga0495648_0213590 | |||
| 1648 | Ga0495666_0085078 | |||
| 1649 | Ga0495666_0108392 | |||
| 1650 | Ga0495642_0000361 | |||
| 1651 | Ga0495642_0001257 | |||
| 1652 | Ga0495654_0003070 | |||
| 1653 | Ga0495654_0004441 | |||
| 1654 | Ga0495654_0006568 | |||
| 1655 | Ga0495654_0009334 | |||
| 1656 | Ga0495654_0013702 | |||
| 1657 | Ga0495654_0015758 | |||
| 1658 | Ga0495654_0052797 | |||
| 1659 | Ga0495654_0058010 | |||
| 1660 | Ga0495654_0085762 | |||
| 1661 | Ga0495654_0096665 | |||
| 1662 | Ga0495654_0186528 | |||
| 1663 | Ga0495586_0003278 | |||
| 1664 | Ga0495587_0003724 | |||
| 1665 | Ga0495609_0001849 | |||
| 1666 | Ga0495609_0008959 | |||
| 1667 | Ga0495609_0055824 | |||
| 1668 | Ga0495609_0117183 | |||
| 1669 | Ga0495609_0122411 | |||
| 1670 | Ga0495597_0004275 | |||
| 1671 | Ga0495597_0007955 | |||
| 1672 | Ga0495597_0013099 | |||
| 1673 | Ga0495597_0033000 | |||
| 1674 | Ga0495597_0042324 | |||
| 1675 | Ga0495597_0133005 | |||
| 1676 | Ga0495597_0245075 | |||
| 1677 | Ga0495622_0000577 | |||
| 1678 | Ga0495622_0001471 | |||
| 1679 | Ga0495622_0002243 | |||
| 1680 | Ga0495622_0027898 | |||
| 1681 | Ga0495622_0088702 | |||
| 1682 | Ga0495633_0005304 | |||
| 1683 | Ga0495633_0007007 | |||
| 1684 | Ga0495633_0122898 | |||
| 1685 | Ga0495656_0027017 | |||
| 1686 | Ga0495656_0425093 | |||
| 1687 | Ga0495668_0001865 | |||
| 1688 | Ga0495668_0012565 | |||
| 1689 | Ga0495668_0012589 | |||
| 1690 | Ga0495634_0001928 | |||
| 1691 | Ga0495611_0001980 | |||
| 1692 | Ga0495611_0097198 | |||
| 1693 | Ga0495625_0005099 | |||
| 1694 | Ga0495625_0007226 | |||
| 1695 | Ga0495625_0044114 | |||
| 1696 | Ga0495625_0051234 | |||
| 1697 | Ga0495625_0074631 | |||
| 1698 | Ga0495625_0083435 | |||
| 1699 | Ga0495625_0089501 | |||
| 1700 | Ga0495625_0261919 | |||
| 1701 | Ga0495659_0001180 | |||
| 1702 | Ga0495661_0002985 | |||
| 1703 | Ga0495661_0022020 | |||
| 1704 | Ga0495661_0038947 | |||
| 1705 | Ga0495661_0068627 | |||
| 1706 | Ga0495661_0124116 | |||
| 1707 | Ga0495661_0169089 | |||
| 1708 | Ga0495661_0205269 | |||
| 1709 | Ga0495661_0299483 | |||
| 1710 | Ga0495623_0002535 | |||
| 1711 | Ga0495646_0008586 | |||
| 1712 | Ga0495646_0072841 | |||
| 1713 | Ga0495669_0024336 | |||
| 1714 | Ga0495613_0454496 | |||
| 1715 | Ga0495624_0003400 | |||
| 1716 | Ga0495670_0002414 | |||
| 1717 | Ga0495670_0004092 | |||
| 1718 | Ga0495670_0005057 | |||
| 1719 | Ga0495670_0007462 | |||
| 1720 | Ga0495670_0217870 | |||
| 1721 | Ga0495671_0000943 | |||
| 1722 | Ga0495671_0002975 | |||
| 1723 | Ga0495671_0003620 | |||
| 1724 | Ga0495671_0011268 | |||
| 1725 | Ga0495671_0015392 | |||
| 1726 | Ga0495671_0023399 | |||
| 1727 | Ga0495671_0025739 | |||
| 1728 | Ga0495671_0048226 | |||
| 1729 | Ga0495671_0134268 | |||
| 1730 | Ga0495671_0158726 | |||
| 1731 | Ga0495671_0164313 | |||
| 1732 | Ga0495649_0002770 | |||
| 1733 | Ga0495649_0003922 | |||
| 1734 | Ga0495649_0005421 | |||
| 1735 | Ga0495649_0005797 | |||
| 1736 | Ga0495649_0011662 | |||
| 1737 | Ga0495649_0014694 | |||
| 1738 | Ga0495649_0018225 | |||
| 1739 | Ga0495649_0044591 | |||
| 1740 | Ga0495649_0048069 | |||
| 1741 | Ga0495649_0051525 | |||
| 1742 | Ga0495649_0061987 | |||
| 1743 | Ga0495649_0242532 | |||
| 1744 | Ga0495649_0332084 | |||
| 1745 | Ga0495589_0000961 | |||
| 1746 | Ga0495589_0003344 | |||
| 1747 | Ga0495589_0007493 | |||
| 1748 | Ga0495589_0008105 | |||
| 1749 | Ga0495589_0012571 | |||
| 1750 | Ga0495589_0013470 | |||
| 1751 | Ga0495589_0020948 | |||
| 1752 | Ga0495589_0186623 | |||
| 1753 | Ga0495600_0045725 | |||
| 1754 | Ga0495660_0003064 | |||
| 1755 | Ga0495660_0005058 | |||
| 1756 | Ga0495660_0011565 | |||
| 1757 | Ga0495660_0017700 | |||
| 1758 | Ga0495660_0019909 | |||
| 1759 | Ga0495660_0051192 | |||
| 1760 | Ga0495660_0057198 | |||
| 1761 | Ga0495660_0070591 | |||
| 1762 | Ga0495660_0116040 | |||
| 1763 | Ga0495604_0015251 | |||
| 1764 | Ga0495604_0053180 | |||
| 1765 | Ga0495604_0070234 | |||
| 1766 | Ga0495604_0435473 | |||
| 1767 | Ga0495636_0004968 | |||
| 1768 | Ga0495636_0010098 | |||
| 1769 | Ga0495674_0014222 | |||
| 1770 | Ga0495672_0002687 | |||
| 1771 | Ga0495672_0005742 | |||
| 1772 | Ga0495672_0005781 | |||
| 1773 | Ga0495672_0007067 | |||
| 1774 | Ga0495672_0026348 | |||
| 1775 | Ga0495672_0036401 | |||
| 1776 | Ga0495672_0052005 | |||
| 1777 | Ga0495672_0080212 | |||
| 1778 | Ga0495672_0098275 | |||
| 1779 | Ga0495676_0026237 | |||
| 1780 | Ga0495680_0031314 | |||
| 1781 | Ga0495680_0039032 | |||
| 1782 | Ga0495680_0099451 | |||
| 1783 | Ga0495680_0235056 | |||
| 1784 | Ga0495683_0002172 | |||
| 1785 | Ga0495683_0003296 | |||
| 1786 | Ga0495683_0035595 | |||
| 1787 | Ga0495683_0077593 | |||
| 1788 | Ga0495683_0173493 | |||
| 1789 | Ga0495687_004739 | |||
| 1790 | Ga0495687_006813 | |||
| 1791 | Ga0495687_099346 | |||
| 1792 | Ga0495687_112356 | |||
| 1793 | Ga0495675_0052871 | |||
| 1794 | Ga0495677_0002688 | |||
| 1795 | Ga0495679_003285 | |||
| 1796 | Ga0495679_004017 | |||
| 1797 | Ga0495679_030734 | |||
| 1798 | Ga0495685_071350 | |||
| 1799 | Ga0495673_0000935 | |||
| 1800 | Ga0495673_0002710 | |||
| 1801 | Ga0495673_0002867 | |||
| 1802 | Ga0495673_0003838 | |||
| 1803 | Ga0495673_0005439 | |||
| 1804 | Ga0495673_0007537 | |||
| 1805 | Ga0495673_0015486 | |||
| 1806 | Ga0495673_0017402 | |||
| 1807 | Ga0495673_0094650 | |||
| 1808 | Ga0495673_0098333 | |||
| 1809 | Ga0495681_0002418 | |||
| 1810 | Ga0495681_0003202 | |||
| 1811 | Ga0495681_0003508 | |||
| 1812 | Ga0495681_0003692 | |||
| 1813 | Ga0495681_0003721 | |||
| 1814 | Ga0495681_0004082 | |||
| 1815 | Ga0495681_0008432 | |||
| 1816 | Ga0495681_0010741 | |||
| 1817 | Ga0495681_0011238 | |||
| 1818 | Ga0495681_0024579 | |||
| 1819 | Ga0495681_0029000 | |||
| 1820 | Ga0495684_0456709 | |||
| 1821 | Ga0495686_0008077 | |||
| 1822 | Ga0495686_0037949 | |||
| 1823 | Ga0495686_0039456 | |||
| 1824 | Ga0495686_0103541 | |||
| 1825 | Ga0495686_0192103 | |||
| 1826 | Ga0495686_0195468 | |||
| 1827 | Ga0495593_0006784 | |||
| 1828 | Ga0495593_0008472 | |||
| 1829 | Ga0495593_0025981 | |||
| 1830 | Ga0495602_0013623 | |||
| 1831 | Ga0495626_0001629 | |||
| 1832 | Ga0495626_0001739 | |||
| 1833 | Ga0495626_0004676 | |||
| 1834 | Ga0495626_0005055 | |||
| 1835 | Ga0495626_0008827 | |||
| 1836 | Ga0495626_0014326 | |||
| 1837 | Ga0495626_0044054 | |||
| 1838 | Ga0495626_0056819 | |||
| 1839 | Ga0495626_0106098 | |||
| 1840 | Ga0496102_0001561 | |||
| 1841 | Ga0496103_0008656 | |||
| 1842 | Ga0496104_0014763 | |||
| 1843 | Ga0496104_0044426 | |||
| 1844 | Ga0496106_0176455 | |||
| 1845 | Ga0496106_0560397 | |||
| 1846 | Ga0496107_0299512 | |||
| 1847 | Ga0496107_0302854 | |||
| 1848 | Ga0496108_0001080 | |||
| 1849 | Ga0496108_0029167 | |||
| 1850 | Ga0496109_0003793 | |||
| 1851 | Ga0496109_0107600 | |||
| 1852 | Ga0496110_0312048 | |||
| 1853 | Ga0496111_0053151 | |||
| 1854 | Ga0496111_0420772 | |||
| 1855 | Ga0496112_0004358 | |||
| 1856 | Ga0496112_0013335 | |||
| 1857 | Ga0496112_0081616 | |||
| 1858 | Ga0496113_0000556 | |||
| 1859 | Ga0496113_0001353 | |||
| 1860 | Ga0496116_0000234 | |||
| 1861 | Ga0496116_0000960 | |||
| 1862 | Ga0496116_0002607 | |||
| 1863 | Ga0496116_0012873 | |||
| 1864 | Ga0496116_0016057 | |||
| 1865 | Ga0496116_0082989 | |||
| 1866 | Ga0496117_0001930 | |||
| 1867 | Ga0496117_0004181 | |||
| 1868 | Ga0496117_0006118 | |||
| 1869 | Ga0496117_0011127 | |||
| 1870 | Ga0496117_0015032 | |||
| 1871 | Ga0496117_0015867 | |||
| 1872 | Ga0496118_0004537 | |||
| 1873 | Ga0496118_0010603 | |||
| 1874 | Ga0496118_0018405 | |||
| 1875 | Ga0496118_0029366 | |||
| 1876 | Ga0496118_0117643 | |||
| 1877 | Ga0496119_0021643 | |||
| 1878 | Ga0496119_0165321 | |||
| 1879 | Ga0496120_0004433 | |||
| 1880 | Ga0496121_0000346 | |||
| 1881 | Ga0496121_0031595 | |||
| 1882 | Ga0496121_0077102 | |||
| 1883 | Ga0496121_0131702 | |||
| 1884 | Ga0496122_0007280 | |||
| 1885 | Ga0496122_0008343 | |||
| 1886 | Ga0496122_0025979 | |||
| 1887 | Ga0496122_0143958 | |||
| 1888 | Ga0496122_0230870 | |||
| 1889 | Ga0496122_0335079 | |||
| 1890 | Ga0496123_0014130 | |||
| 1891 | Ga0496123_0063332 | |||
| 1892 | Ga0496123_0081030 | |||
| 1893 | Ga0496123_0081997 | |||
| 1894 | Ga0496123_0118784 | |||
| 1895 | Ga0496123_0303290 | |||
| 1896 | Ga0496123_0332063 | |||
| 1897 | Ga0496124_0000151 | |||
| 1898 | Ga0496124_0004227 | |||
| 1899 | Ga0496124_0006364 | |||
| 1900 | Ga0496124_0013516 | |||
| 1901 | Ga0496124_0017790 | |||
| 1902 | Ga0496124_0026034 | |||
| 1903 | Ga0496124_0038026 | |||
| 1904 | Ga0496124_0041851 | |||
| 1905 | Ga0496124_0048295 | |||
| 1906 | Ga0496124_0107451 | |||
| 1907 | Ga0496124_0201190 | |||
| 1908 | Ga0496124_0269090 | |||
| 1909 | Ga0496124_0442663 | |||
| 1910 | Ga0496125_0006506 | |||
| 1911 | Ga0496125_0007308 | |||
| 1912 | Ga0496125_0008984 | |||
| 1913 | Ga0496125_0015094 | |||
| 1914 | Ga0496125_0119152 | |||
| 1915 | Ga0496125_0218506 | |||
| 1916 | Ga0496126_0015959 | |||
| 1917 | Ga0496126_0020765 | |||
| 1918 | Ga0496126_0482943 | |||
| 1919 | Ga0495678_000328 | |||
| 1920 | Ga0495678_001561 | |||
| 1921 | Ga0495678_007885 | |||
| 1922 | Ga0495678_010925 | |||
| 1923 | Ga0495678_024761 | |||
| 1924 | Ga0495678_035275 | |||
| 1925 | Ga0495678_065470 | |||
| 1926 | Ga0495678_078622 | |||
| 1927 | Ga0495678_159371 | |||
| 1928 | Ga0495682_0033185 | |||
| 1929 | Ga0495682_0118371 | |||
| 1930 | Ga0501032_0012424 | |||
| 1931 | Ga0501034_0059481 | |||
| 1932 | Ga0501034_0111107 | |||
| 1933 | Ga0501036_1062014 | |||
| 1934 | Ga0501037_0414262 | |||
| 1935 | Ga0501039_0179010 | |||
| 1936 | Ga0501241_000445 | |||
| 1937 | Ga0501035_0136461 | |||
| 1938 | Ga0501226_000004 | |||
| 1939 | Ga0501226_002197 | |||
| 1940 | nmdc:mga08y16_38962_c1 | |||
| 1941 | nmdc:mga0n895_15523_c1 | |||
| 1942 | nmdc:mga0rr50_357181_c1 | |||
| 1943 | nmdc:mga08x19_1280_c1 | |||
| 1944 | nmdc:mga0a205_2190_c1 | |||
| 1945 | nmdc:mga0sz30_80283_c1 | |||
| 1946 | Ga0500572_001243 | |||
| 1947 | Ga0500595_003668 | |||
| 1948 | Ga0500616_0000885 | |||
| 1949 | 2883578382 | |||
| 1950 | 2510284235 | |||
| 1951 | 2510293081 | |||
| 1952 | 2510312582 | |||
| 1953 | 2511256186 | |||
| 1954 | 2511263411 | |||
| 1955 | 2511272280 | |||
| 1956 | 2511279331 | |||
| 1957 | 2511287559 | |||
| 1958 | 2511297464 | |||
| 1959 | 2511300954 | |||
| 1960 | 2511311571 | |||
| 1961 | 2511322632 | |||
| 1962 | 2511326405 | |||
| 1963 | 2511330882 | |||
| 1964 | 2511341471 | |||
| 1965 | 2511346513 | |||
| 1966 | 2511349225 | |||
| 1967 | 2511361485 | |||
| 1968 | 2511367173 | |||
| 1969 | 2511377662 | |||
| 1970 | 2511414412 | |||
| 1971 | 2511822572 | |||
| 1972 | 2512326066 | |||
| 1973 | 2548846535 | |||
| 1974 | 2555247476 | |||
| 1975 | 2555667539 | |||
| 1976 | 2583789696 | |||
| 1977 | 2597855768 | |||
| 1978 | 2599356760 | |||
| 1979 | 2599363210 | |||
| 1980 | 2599369838 | |||
| 1981 | 2599376319 | |||
| 1982 | 2599381865 | |||
| 1983 | 2599387991 | |||
| 1984 | 2599395483 | |||
| 1985 | 2599407248 | |||
| 1986 | 2599463593 | |||
| 1987 | 2599469059 | |||
| 1988 | 2599485670 | |||
| 1989 | 2599492612 | |||
| 1990 | 2599499991 | |||
| 1991 | 2599616704 | |||
| 1992 | 2599769532 | |||
| 1993 | 2599806800 | |||
| 1994 | 2599886953 | |||
| 1995 | 2599898282 | |||
| 1996 | 2599931013 | |||
| 1997 | 2599944606 | |||
| 1998 | 2599956051 | |||
| 1999 | 2599961224 | |||
| 2000 | 2599964669 | |||
| 2001 | 2599977399 | |||
| 2002 | 2599983182 | |||
| 2003 | 2599991115 | |||
| 2004 | 2599997768 | |||
| 2005 | 2600001013 | |||
| 2006 | 2600007062 | |||
| 2007 | 2600011568 | |||
| 2008 | 2600019200 | |||
| 2009 | 2600026424 | |||
| 2010 | 2600031984 | |||
| 2011 | 2600036832 | |||
| 2012 | 2600043272 | |||
| 2013 | 2600048186 | |||
| 2014 | 2600055792 | |||
| 2015 | 2600061177 | |||
| 2016 | 2600068421 | |||
| 2017 | 2600072457 | |||
| 2018 | 2600078427 | |||
| 2019 | 2600216222 | |||
| 2020 | 2600360263 | |||
| 2021 | 2600364770 | |||
| 2022 | 2600443782 | |||
| 2023 | 2601776389 | |||
| 2024 | 2601797953 | |||
| 2025 | 2602008762 | |||
| 2026 | 2606076564 | |||
| 2027 | 2606129022 | |||
| 2028 | 2608380735 | |||
| 2029 | 2624478339 | |||
| 2030 | 2624489886 | |||
| 2031 | 2643841105 | |||
| 2032 | 2643954785 | |||
| 2033 | 2644000440 | |||
| 2034 | 2644024425 | |||
| 2035 | 2644084782 | |||
| 2036 | 2644190118 | |||
| 2037 | 2644281383 | |||
| 2038 | 2644342334 | |||
| 2039 | 2644365634 | |||
| 2040 | 2652547082 | |||
| 2041 | 2671090679 | |||
| 2042 | 2671099852 | |||
| 2043 | 2671129219 | |||
| 2044 | 2671695637 | |||
| 2045 | 2671772451 | |||
| 2046 | 2678261112 | |||
| 2047 | 2715749329 | |||
| 2048 | 2715755595 | |||
| 2049 | 2718632281 | |||
| 2050 | 2729146024 | |||
| 2051 | 2739200577 | |||
| 2052 | 2739259945 | |||
| 2053 | 2739288626 | |||
| 2054 | 2739293938 | |||
| 2055 | 2739311407 | |||
| 2056 | 2743735187 | |||
| 2057 | 2745006423 | |||
| 2058 | 2765581720 | |||
| 2059 | 2774119434 | |||
| 2060 | 2774131450 | |||
| 2061 | 2774134854 | |||
| 2062 | 2784260926 | |||
| 2063 | 2784316357 | |||
| 2064 | 2794594149 | |||
| 2065 | 2807454700 | |||
| 2066 | 2808856225 | |||
| 2067 | 2808906719 | |||
| 2068 | 2808922623 | |||
| 2069 | 2808932661 | |||
| 2070 | 2808936269 | |||
| 2071 | 2808940148 | |||
| 2072 | 2808944310 | |||
| 2073 | 2808954782 | |||
| 2074 | 2808955989 | |||
| 2075 | 2808965622 | |||
| 2076 | 2808999618 | |||
| 2077 | 2809218095 | |||
| 2078 | 2812370334 | |||
| 2079 | 2819657348 | |||
| 2080 | 2819705332 | |||
| 2081 | 2823425369 | |||
| 2082 | 2825654146 | |||
| 2083 | 2842807146 | |||
| 2084 | 2842834285 | |||
| 2085 | 2842846238 | |||
| 2086 | 2842859961 | |||
| 2087 | 2844668013 | |||
| 2088 | 2852660332 | |||
| 2089 | 2860343521 | |||
| 2090 | 2878030284 | |||
| 2091 | 2880231232 | |||
| 2092 | 2904519688 | |||
| 2093 | 2904553921 | |||
| 2094 | 2912964296 | |||
| 2095 | 2913037404 | |||
| 2096 | 2917071290 | |||
| 2097 | 2917836290 | |||
| 2098 | 2919066031 | |||
| 2099 | 2919127588 | |||
| 2100 | 2919389648 | |||
| 2101 | 2919460104 | |||
| 2102 | 2919486547 | |||
| 2103 | 2919488576 | |||
| 2104 | 2919502112 | |||
| 2105 | 2919698836 | |||
| 2106 | 2923154183 | |||
| 2107 | 2923524422 | |||
| 2108 | 2923591638 | |||
| 2109 | 2926063785 | |||
| 2110 | 2929144936 | |||
| 2111 | 2931371727 | |||
| 2112 | 2931398962 | |||
| 2113 | 2935359118 | |||
| 2114 | 2939641224 | |||
| 2115 | 2939655903 | |||
| 2116 | 2945967706 | |||
| 2117 | 2969305080 | |||
| 2118 | 2974293226 | |||
| 2119 | 2974301652 | |||
| 2120 | 2984291875 | |||
| 2121 | 2984500774 | |||
| 2122 | 2984507311 | |||
| 2123 | 2988732327 | |||
| 2124 | 2990198675 | |||
| 2125 | 2998140590 | |||
| 2126 | 3007399738 | |||
| 2127 | 3007518036 | |||
| 2128 | 3007614976 | |||
| 2129 | 3007622279 | |||
| 2130 | 3007720383 | |||
| 2131 | 3007808894 | |||
| 2132 | 3007859817 | |||
| 2133 | 3007864204 | |||
| 2134 | 3007870824 | |||
| 2135 | 3007872887 | |||
| 2136 | 637317934 | |||
| 2137 | 640487056 | |||
| 2138 | 651174929 | |||
| 2139 | 8011352773 | |||
| 2140 | 8015688433 | |||
| 2141 | 8016730582 | |||
| 2142 | 8019770414 | |||
| 2143 | 8019777460 | |||
| 2144 | 8030000150 | |||
| 2145 | 8034963359 | |||
| 2146 | 8052495160 | |||
| 2147 | 8054930813 | |||
| 2148 | 8055771533 | |||
| 2149 | 8056116843 | |||
| 2150 | 8056125358 | |||
| 2151 | 8056126588 | |||
| 2152 | 8056143868 | |||
| 2153 | 8056158631 | |||
| 2154 | 8056170461 | |||
| 2155 | 8056176591 | |||
| 2156 | 8056182923 | |||
| 2157 | 8056573413 | |||
| 2158 | 8057802817 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zbk-assembly1.cif.gz_A-2 | crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp | 0.9897 | 2 | 182 |
| 5zbj-assembly1.cif.gz_A-2 | crystal structure of type-i log from pseudomonas aeruginosa pao1 | 0.9799 | 2 | 185 |
| 5zbk-assembly1.cif.gz_A-2 | crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp | 0.9789 | 2 | 182 |
| 5zbl-assembly2.cif.gz_D | crystal structure of type-i log from corynebacterium glutamicum in complex with amp | 0.9753 | 2 | 182 |
| 5zbl-assembly2.cif.gz_C | crystal structure of type-i log from corynebacterium glutamicum in complex with amp | 0.9752 | 2 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0B7_1_186_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.971 | 4 | 185 | 3.40.50.450 |
| af_A0A1D6K2U3_1_187_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9513 | 3 | 178 | 3.40.50.450 |
| af_Q2G0B7_1_186_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9456 | 4 | 185 | 3.40.50.450 |
| 5zblB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9455 | 1 | 189 | 3.40.50.450 |
| 3sbxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9436 | 4 | 180 | 3.40.50.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8VYP7-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9851 | 2 | 176 |
GO:0005829
GO:0009691 GO:0016799 |
| AF-A0A7U8GRU3-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.984 | 4 | 184 |
GO:0005829
GO:0009691 GO:0016799 |
| AF-A0A7Z0LKD0-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.983 | 4 | 178 |
GO:0005829
GO:0009691 GO:0016799 |
| AF-A0A084IPJ1-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9829 | 4 | 179 |
GO:0005829
GO:0008714 GO:0009691 |
| AF-A0A7J5F5Z5-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9824 | 4 | 178 |
GO:0005829
GO:0009691 GO:0016799 |