F489657

General Info

Members Datasets Scaffolds Average Seq Length
1079 479 2158 195

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2883577096|2883578382
Length 189
Sequence CVFCGAQPGHDEGHARLADALGTAIAKRGLGLVYGGGKVGLMGVVADAAIRGGAEVIGVIPEALMERELGHGEVTDLRVVPSMHVRKAMMNDLSDGFIVLPGGIGTLEEAVEIQSWSQLGIHRKGLVFLDTHGYWAPYFALLERMEGEGFIRPQHAGLALQARRPEQALDMLASWEPPKVTRWMTQTEA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
96 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
97 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
116 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
117 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
118 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
119 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
122 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
123 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
124 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
125 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
126 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
127 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
128 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
129 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
130 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
131 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
132 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
133 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
134 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
135 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
136 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
137 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
138 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
139 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
142 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
149 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
271 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
272 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
273 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
274 2511231004 Pseudomonas sp. GM102 Isolate Nodule
275 2511231006 Pseudomonas sp. GM17 Isolate Nodule
276 2511231007 Pseudomonas sp. GM18 Isolate Nodule
277 2511231008 Pseudomonas sp. GM21 Isolate Nodule
278 2511231010 Pseudomonas sp. GM25 Isolate Nodule
279 2511231011 Pseudomonas sp. GM30 Isolate Nodule
280 2511231012 Pseudomonas sp. GM33 Isolate Nodule
281 2511231014 Pseudomonas sp. GM48 Isolate Nodule
282 2511231015 Pseudomonas sp. GM49 Isolate Nodule
283 2511231016 Pseudomonas sp. GM50 Isolate Nodule
284 2511231017 Pseudomonas sp. GM55 Isolate Nodule
285 2511231018 Pseudomonas sp. GM60 Isolate Nodule
286 2511231019 Pseudomonas sp. GM67 Isolate Nodule
287 2511231020 Pseudomonas sp. GM74 Isolate Nodule
288 2511231022 Pseudomonas sp. GM79 Isolate Nodule
289 2511231023 Pseudomonas sp. GM80 Isolate Nodule
290 2511231024 Pseudomonas sp. GM84 Isolate Nodule
291 2511231031 Pseudomonas sp. GM16 Isolate Nodule
292 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
293 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
294 2547132512 Azospira oryzae 6a3 Isolate Unclassified
295 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
296 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
297 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
298 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
299 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
300 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
301 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
302 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
303 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
304 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
305 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
306 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
307 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
308 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
309 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
310 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
311 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
312 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
313 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
314 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
315 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
316 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
317 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
318 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
319 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
320 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
321 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
322 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
323 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
324 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
325 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
326 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
327 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
328 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
329 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
330 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
331 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
332 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
333 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
334 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
335 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
336 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
337 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
338 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
339 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
340 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
341 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
342 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
343 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
344 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
345 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
346 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
347 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
348 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
349 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
350 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
351 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
352 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
353 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
354 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
355 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
356 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
357 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
358 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
359 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
360 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
361 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
362 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
363 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
364 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
365 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
366 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
367 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
368 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
369 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
370 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
371 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
372 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
373 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
374 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
375 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
376 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
377 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
378 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
379 2765235841 Pseudomonas putida AA7 Isolate Unclassified
380 2773857670 Pseudomonas sp. 478 Isolate Unclassified
381 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
382 2773857673 Pseudomonas sp. 443 Isolate Unclassified
383 2784132063 Pseudomonas sp. 424 Isolate Unclassified
384 2784132072 Pseudomonas sp. 460 Isolate Unclassified
385 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
386 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
387 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
388 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
389 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
390 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
391 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
392 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
393 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
394 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
395 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
396 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
397 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
398 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
399 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
400 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
401 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
402 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
403 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
404 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
405 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
406 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
407 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
408 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
409 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
410 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
411 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
412 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
413 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
414 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
415 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
416 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
417 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
418 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
419 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
420 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
421 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
422 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
423 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
424 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
425 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
426 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
427 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
428 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
429 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
430 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
431 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
432 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
433 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
434 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
435 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
436 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
437 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
438 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
439 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
440 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
441 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
442 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
443 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
444 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
445 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
446 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
447 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
448 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
449 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
450 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
451 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
452 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
453 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
454 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
455 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
456 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
457 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
458 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
459 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
460 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
461 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
462 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
463 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
464 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
465 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
466 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
467 8052494512 Pseudomonas putida LD6 Isolate Unclassified
468 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
469 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
470 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
471 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
472 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
473 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
474 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
475 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
476 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
477 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
478 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
479 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.44
Metatranscriptomes 0.09
Isolates 19.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 5.56
Nodule 2.5
Rhizoplane 7.14
Rhizosphere 73.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_17 2124908027 Bacteria 60592
2 MRS2a_Contig_743 2124908027 Bacteria 5877
3 SwRhRL2b_contig_1875519 2162886007 Bacteria 1525
4 SwRhRL2b_contig_1906178 2162886007 Bacteria 1461
5 SwRhRL2b_contig_802536 2162886007 Bacteria 1354
6 JGI25162J39368_1000096 3300002737 Bacteria 97855
7 JGI25162J39368_1001687 3300002737 Bacteria 10804
8 JGI25163J39215_1000085 3300002771 Bacteria 40659
9 JGI25163J39215_1000575 3300002771 Bacteria 10389
10 JGI25164J39214_1000074 3300002772 Bacteria 97855
11 JGI25164J39214_1000819 3300002772 Bacteria 10881
12 JGI25165J46597_1000177 3300003214 Bacteria 97855
13 JGI25165J46597_1001612 3300003214 Bacteria 10804
14 rootH1_10233992 3300003323 Bacteria 1165
15 Ga0006562J51391_1097134 3300003578 Bacteria 870
16 Ga0055536_1000101 3300003781 Bacteria 73884
17 Ga0055536_1000841 3300003781 Bacteria 20232
18 Ga0055536_1003159 3300003781 Bacteria 8933
19 Ga0055536_1050526 3300003781 Bacteria 916
20 Ga0055530_10000097 3300003791 Bacteria 73884
21 Ga0055530_10000216 3300003791 Bacteria 51438
22 Ga0055530_10001211 3300003791 Bacteria 19954
23 Ga0055530_10011795 3300003791 Bacteria 3104
24 Ga0055540_1000108 3300003792 Bacteria 89907
25 Ga0055540_1000232 3300003792 Bacteria 51558
26 Ga0055540_1000837 3300003792 Bacteria 20668
27 Ga0055531_10000811 3300003794 Bacteria 25894
28 Ga0055531_10001535 3300003794 Bacteria 16904
29 Ga0065714_10000496 3300005288 Bacteria 4546
30 Ga0065714_10002602 3300005288 Bacteria 25747
31 Ga0065714_10004617 3300005288 Bacteria 4673
32 Ga0065714_10017343 3300005288 Bacteria 2149
33 Ga0065714_10018028 3300005288 Bacteria 1480
34 Ga0065714_10019951 3300005288 Bacteria 1179
35 Ga0065714_10020229 3300005288 Bacteria 1158
36 Ga0065714_10034541 3300005288 Bacteria 1256
37 Ga0065714_10038529 3300005288 Bacteria 897
38 Ga0065714_10068262 3300005288 Bacteria 4854
39 Ga0065714_10071110 3300005288 Bacteria 3665
40 Ga0065704_10000569 3300005289 Bacteria 17503
41 Ga0065704_10101832 3300005289 Bacteria 2171
42 Ga0065704_10107570 3300005289 Bacteria 2052
43 Ga0065704_10142007 3300005289 Bacteria 1508
44 Ga0065704_10228549 3300005289 Bacteria 1050
45 Ga0065712_10069536 3300005290 Bacteria 7098
46 Ga0065715_10093817 3300005293 Bacteria 4544
47 Ga0068868_100921531 3300005338 Bacteria 795
48 Ga0070689_100659285 3300005340 Bacteria 911
49 Ga0070669_100000691 3300005353 Bacteria 24753
50 Ga0070669_100641340 3300005353 Bacteria 893
51 Ga0070688_100240307 3300005365 Bacteria 1285
52 Ga0070694_100304069 3300005444 Bacteria 1223
53 Ga0070662_100032515 3300005457 Bacteria 3666
54 Ga0070685_10506884 3300005466 Bacteria 855
55 Ga0070665_100036433 3300005548 Bacteria 4948
56 Ga0070665_100367655 3300005548 Bacteria 1445
57 Ga0068864_100050860 3300005618 Bacteria 3568
58 Ga0068858_100123910 3300005842 Bacteria 2419
59 Ga0068862_100790518 3300005844 Bacteria 926
60 Ga0075364_10068367 3300006051 Bacteria 2336
61 Ga0075364_10133161 3300006051 Bacteria 1669
62 Ga0075364_10147421 3300006051 Bacteria 1585
63 Ga0075364_10282461 3300006051 Bacteria 1129
64 Ga0075432_10000430 3300006058 Bacteria 12297
65 Ga0075432_10006793 3300006058 Bacteria 3896
66 Ga0075432_10023232 3300006058 Bacteria 2123
67 Ga0075432_10042013 3300006058 Bacteria 1598
68 Ga0075362_10132803 3300006177 Bacteria 1185
69 Ga0075362_10325196 3300006177 Bacteria 766
70 Ga0075369_10135861 3300006186 Bacteria 1120
71 Ga0075369_10140083 3300006186 Bacteria 1102
72 Ga0075433_10076424 3300006852 Bacteria 2949
73 Ga0075434_100000779 3300006871 Bacteria 25235
74 Ga0075436_100003752 3300006914 Bacteria 10410
75 Ga0075436_100107858 3300006914 Bacteria 1942
76 Ga0075436_100224477 3300006914 Bacteria 1333
77 Ga0079104_1000164 3300006946 Bacteria 94084
78 Ga0079104_1001028 3300006946 Bacteria 21419
79 Ga0079104_1038108 3300006946 Bacteria 1141
80 Ga0099826_10036309 3300006948 Bacteria 3489
81 Ga0075435_100004009 3300007076 Bacteria 10066
82 Ga0105251_10000320 3300009011 Bacteria 48103
83 Ga0105251_10005626 3300009011 Bacteria 8145
84 Ga0105251_10007499 3300009011 Bacteria 6709
85 Ga0105251_10012167 3300009011 Bacteria 4882
86 Ga0105251_10024286 3300009011 Bacteria 3113
87 Ga0105251_10038780 3300009011 Bacteria 2331
88 Ga0105251_10043537 3300009011 Bacteria 2173
89 Ga0105251_10056512 3300009011 Bacteria 1857
90 Ga0105244_10004406 3300009036 Bacteria 9708
91 Ga0105244_10020379 3300009036 Bacteria 3686
92 Ga0105244_10020778 3300009036 Bacteria 3641
93 Ga0105244_10023123 3300009036 Bacteria 3413
94 Ga0105244_10026438 3300009036 Bacteria 3141
95 Ga0105244_10033813 3300009036 Bacteria 2694
96 Ga0105244_10038610 3300009036 Bacteria 2489
97 Ga0105244_10042166 3300009036 Bacteria 2361
98 Ga0105244_10057672 3300009036 Bacteria 1962
99 Ga0105244_10079310 3300009036 Bacteria 1627
100 Ga0105244_10149715 3300009036 Bacteria 1118
101 Ga0105244_10153929 3300009036 Bacteria 1101
102 Ga0105244_10156944 3300009036 Bacteria 1088
103 Ga0105244_10330101 3300009036 Bacteria 704
104 Ga0105250_10000907 3300009092 Bacteria 17427
105 Ga0105250_10002683 3300009092 Bacteria 8806
106 Ga0105250_10002966 3300009092 Bacteria 8249
107 Ga0105250_10030607 3300009092 Bacteria 2163
108 Ga0105250_10036444 3300009092 Bacteria 1974
109 Ga0105250_10037704 3300009092 Bacteria 1939
110 Ga0105250_10040685 3300009092 Bacteria 1864
111 Ga0105250_10051361 3300009092 Bacteria 1654
112 Ga0105250_10119559 3300009092 Bacteria 1082
113 Ga0105250_10259505 3300009092 Bacteria 744
114 Ga0111539_10033070 3300009094 Bacteria 6279
115 Ga0105243_10000100 3300009148 Bacteria 99372
116 Ga0105243_10000639 3300009148 Bacteria 34674
117 Ga0105243_10009698 3300009148 Bacteria 7333
118 Ga0105243_10145665 3300009148 Bacteria 2026
119 Ga0105243_10612730 3300009148 Bacteria 1050
120 Ga0105242_10434640 3300009176 Bacteria 1233
121 Ga0105238_10553262 3300009551 Bacteria 1155
122 Ga0105249_10039074 3300009553 Bacteria 4308
123 Ga0105246_10025027 3300011119 Bacteria 3888
124 Ga0105246_10093520 3300011119 Bacteria 2172
125 Ga0105246_10352640 3300011119 Bacteria 1206
126 Ga0157345_1000159 3300012498 Bacteria 11275
127 Ga0157345_1000564 3300012498 Bacteria 3312
128 Ga0157373_10002803 3300013100 Bacteria 13180
129 Ga0157373_10007800 3300013100 Bacteria 7959
130 Ga0157373_10013328 3300013100 Bacteria 6032
131 Ga0157373_10201409 3300013100 Bacteria 1403
132 Ga0157373_10313477 3300013100 Bacteria 1115
133 Ga0157371_10001083 3300013102 Bacteria 29467
134 Ga0157371_10004015 3300013102 Bacteria 13028
135 Ga0157371_10004573 3300013102 Bacteria 12034
136 Ga0157371_10357800 3300013102 Bacteria 1063
137 Ga0157370_10000150 3300013104 Bacteria 85732
138 Ga0157370_10016733 3300013104 Bacteria 7420
139 Ga0157370_10026170 3300013104 Bacteria 5763
140 Ga0157370_10087214 3300013104 Bacteria 2931
141 Ga0157370_10122194 3300013104 Bacteria 2431
142 Ga0157369_10014391 3300013105 Bacteria 8935
143 Ga0157369_10016760 3300013105 Bacteria 8236
144 Ga0157369_10689704 3300013105 Bacteria 1052
145 Ga0163162_10000507 3300013306 Bacteria 36252
146 Ga0163162_10809629 3300013306 Bacteria 1054
147 Ga0157372_10070287 3300013307 Bacteria 3938
148 Ga0157372_10216848 3300013307 Bacteria 2218
149 Ga0157372_10654244 3300013307 Bacteria 1224
150 Ga0157375_10607916 3300013308 Bacteria 1252
151 Ga0157375_10979220 3300013308 Bacteria 986
152 Ga0157375_11614519 3300013308 Bacteria 767
153 Ga0182008_10001110 3300014497 Bacteria 18522
154 Ga0182008_10002539 3300014497 Bacteria 11376
155 Ga0182008_10022623 3300014497 Bacteria 3219
156 Ga0182008_10159554 3300014497 Bacteria 1134
157 Ga0182008_10189527 3300014497 Bacteria 1043
158 Ga0157377_10541053 3300014745 Bacteria 821
159 Ga0182006_1001690 3300015261 Bacteria 12908
160 Ga0182006_1003213 3300015261 Bacteria 8490
161 Ga0182006_1003327 3300015261 Bacteria 8287
162 Ga0182006_1007654 3300015261 Bacteria 4935
163 Ga0182006_1050776 3300015261 Bacteria 1597
164 Ga0182006_1129432 3300015261 Bacteria 869
165 Ga0182007_10001779 3300015262 Bacteria 11255
166 Ga0182007_10064498 3300015262 Bacteria 1200
167 Ga0182005_1002100 3300015265 Bacteria 7414
168 Ga0182005_1006665 3300015265 Bacteria 3508
169 Ga0182005_1011115 3300015265 Bacteria 2574
170 Ga0182005_1014857 3300015265 Bacteria 2176
171 Ga0163161_10006460 3300017792 Bacteria 8115
172 Ga0163161_10015968 3300017792 Bacteria 5240
173 Ga0163161_10022443 3300017792 Bacteria 4445
174 Ga0163161_10307810 3300017792 Bacteria 1249
175 Ga0163161_10518696 3300017792 Bacteria 973
176 Ga0209760_100031 3300025207 Bacteria 141487
177 Ga0209760_100056 3300025207 Bacteria 100067
178 Ga0209760_100139 3300025207 Bacteria 46193
179 Ga0209563_101468 3300025230 Bacteria 6220
180 Ga0207427_100016 3300025231 Bacteria 538697
181 Ga0207427_100067 3300025231 Bacteria 164839
182 Ga0209437_100011 3300025233 Bacteria 818520
183 Ga0209437_100016 3300025233 Bacteria 710118
184 Ga0209233_1000019 3300025261 Bacteria 818520
185 Ga0209233_1000156 3300025261 Bacteria 164839
186 Ga0209675_1003821 3300025291 Bacteria 6946
187 Ga0209676_1000025 3300025292 Bacteria 577569
188 Ga0209676_1000096 3300025292 Bacteria 240620
189 Ga0209676_1000266 3300025292 Bacteria 109375
190 Ga0209676_1000722 3300025292 Bacteria 45471
191 Ga0209676_1002706 3300025292 Bacteria 11953
192 Ga0209676_1003411 3300025292 Bacteria 9818
193 Ga0209050_1000028 3300025298 Bacteria 477133
194 Ga0209050_1000301 3300025298 Bacteria 103314
195 Ga0209050_1000356 3300025298 Bacteria 88117
196 Ga0209050_1001464 3300025298 Bacteria 25257
197 Ga0209051_1000089 3300025303 Bacteria 175572
198 Ga0209051_1000225 3300025303 Bacteria 95205
199 Ga0209051_1000467 3300025303 Bacteria 52965
200 Ga0209051_1025890 3300025303 Bacteria 2377
201 Ga0209257_1000034 3300025304 Bacteria 662719
202 Ga0209257_1002752 3300025304 Bacteria 16635
203 Ga0207696_1000065 3300025711 Bacteria 231818
204 Ga0207696_1000085 3300025711 Bacteria 195968
205 Ga0207696_1000122 3300025711 Bacteria 143543
206 Ga0207696_1000941 3300025711 Bacteria 17813
207 Ga0207696_1002508 3300025711 Bacteria 8969
208 Ga0207696_1007215 3300025711 Bacteria 4373
209 Ga0207696_1019119 3300025711 Bacteria 2237
210 Ga0207696_1052541 3300025711 Bacteria 1162
211 Ga0207655_1000394 3300025728 Bacteria 60812
212 Ga0207655_1002445 3300025728 Bacteria 15089
213 Ga0207655_1004333 3300025728 Bacteria 10118
214 Ga0207655_1006051 3300025728 Bacteria 8085
215 Ga0207655_1008544 3300025728 Bacteria 6481
216 Ga0207655_1020270 3300025728 Bacteria 3425
217 Ga0207655_1024776 3300025728 Bacteria 2931
218 Ga0207655_1038771 3300025728 Bacteria 2078
219 Ga0207655_1076442 3300025728 Bacteria 1225
220 Ga0207655_1089243 3300025728 Bacteria 1089
221 Ga0207655_1093670 3300025728 Bacteria 1051
222 Ga0207655_1172640 3300025728 Bacteria 666
223 Ga0207713_1000094 3300025735 Bacteria 146176
224 Ga0207713_1002036 3300025735 Bacteria 15131
225 Ga0207713_1004076 3300025735 Bacteria 9632
226 Ga0207713_1004450 3300025735 Bacteria 9075
227 Ga0207713_1005201 3300025735 Bacteria 8212
228 Ga0207713_1005328 3300025735 Bacteria 8082
229 Ga0207713_1006372 3300025735 Bacteria 7201
230 Ga0207713_1008122 3300025735 Bacteria 6085
231 Ga0207713_1008210 3300025735 Bacteria 6042
232 Ga0207713_1012779 3300025735 Bacteria 4466
233 Ga0207713_1028190 3300025735 Bacteria 2537
234 Ga0207713_1031572 3300025735 Bacteria 2339
235 Ga0207713_1080780 3300025735 Bacteria 1171
236 Ga0207681_10000917 3300025923 Bacteria 19251
237 Ga0207681_10621091 3300025923 Bacteria 894
238 Ga0207706_10006144 3300025933 Bacteria 11153
239 Ga0207686_10009573 3300025934 Bacteria 5258
240 Ga0207709_10000022 3300025935 Bacteria 383573
241 Ga0207709_10000252 3300025935 Bacteria 64225
242 Ga0207709_10008422 3300025935 Bacteria 5704
243 Ga0207709_10043054 3300025935 Bacteria 2720
244 Ga0207709_10612451 3300025935 Bacteria 863
245 Ga0207670_10570637 3300025936 Bacteria 926
246 Ga0207665_10215714 3300025939 Bacteria 1404
247 Ga0207689_10489952 3300025942 Bacteria 1029
248 Ga0207712_10093998 3300025961 Bacteria 2213
249 Ga0207703_10335273 3300026035 Bacteria 1389
250 Ga0207641_11171646 3300026088 Bacteria 768
251 Ga0207676_10101076 3300026095 Bacteria 2390
252 Ga0207674_10421042 3300026116 Bacteria 1290
253 Ga0209281_1000033 3300027111 Bacteria 383539
254 Ga0209281_1000159 3300027111 Bacteria 161872
255 Ga0209281_1006627 3300027111 Bacteria 2998
256 Ga0209281_1024782 3300027111 Bacteria 1124
257 Ga0209389_1000298 3300027296 Bacteria 30991
258 Ga0209371_1002187 3300027312 Bacteria 11404
259 Ga0209981_1006882 3300027378 Bacteria 1527
260 Ga0207428_10067474 3300027907 Bacteria 2816
261 Ga0207428_10101146 3300027907 Bacteria 2228
262 Ga0207428_10144231 3300027907 Bacteria 1816
263 Ga0207428_10166442 3300027907 Bacteria 1671
264 Ga0207428_10179985 3300027907 Bacteria 1598
265 Ga0268266_10006145 3300028379 Bacteria 11053
266 Ga0268264_10229265 3300028381 Bacteria 1714
267 Ga0307517_10131827 3300028786 Bacteria 1796
268 Ga0307517_10371744 3300028786 Bacteria 768
269 Ga0268256_1001923 3300030500 Bacteria 11404
270 Ga0314311_1080024 3300030733 Bacteria 4633
271 Ga0316178_1013428 3300030735 Bacteria 34501
272 Ga0316183_1055787 3300030742 Bacteria 2488
273 Ga0265332_10000069 3300031238 Bacteria 88113
274 Ga0265331_10063038 3300031250 Bacteria 1747
275 Ga0265327_10000166 3300031251 Bacteria 141539
276 Ga0307408_100000002 3300031548 Bacteria 827227
277 Ga0307408_100005151 3300031548 Bacteria 8765
278 Ga0307408_100174084 3300031548 Bacteria 1720
279 Ga0307408_100363187 3300031548 Bacteria 1232
280 Ga0307408_100540778 3300031548 Bacteria 1026
281 Ga0307408_100595389 3300031548 Bacteria 981
282 Ga0307408_101296173 3300031548 Bacteria 682
283 Ga0307516_10050897 3300031730 Bacteria 4062
284 Ga0307405_10006452 3300031731 Bacteria 5771
285 Ga0307413_10458199 3300031824 Bacteria 1014
286 Ga0307406_10726120 3300031901 Bacteria 832
287 Ga0307407_10155338 3300031903 Bacteria 1491
288 Ga0307412_10012425 3300031911 Bacteria 4965
289 Ga0307412_10345454 3300031911 Bacteria 1192
290 Ga0307412_10359717 3300031911 Bacteria 1171
291 Ga0307412_10386717 3300031911 Bacteria 1134
292 Ga0307412_10640123 3300031911 Bacteria 905
293 Ga0307416_100708533 3300032002 Bacteria 1096
294 Ga0307414_10050535 3300032004 Bacteria 2880
295 Ga0307414_10330832 3300032004 Bacteria 1300
296 Ga0307414_10478868 3300032004 Bacteria 1097
297 Ga0307414_11057194 3300032004 Bacteria 748
298 Ga0307411_10346032 3300032005 Bacteria 1210
299 Ga0307510_10019083 3300033180 Bacteria 8045
300 Ga0373928_0015934 3300035084 Bacteria 1534
301 Ga0373940_0026620 3300035088 Bacteria 1514
302 Ga0373931_0078429 3300035691 Bacteria 1817
303 Ga0373931_0220739 3300035691 Bacteria 1141
304 Ga0237819_12707 3300038705 Bacteria 1034
305 Ga0439436_0000458 3300041404 Bacteria 10453
306 Ga0439438_000954 3300041405 Bacteria 12906
307 Ga0439438_001498 3300041405 Bacteria 10295
308 Ga0439438_002086 3300041405 Bacteria 8655
309 Ga0439438_002651 3300041405 Bacteria 7550
310 Ga0439438_003029 3300041405 Bacteria 6922
311 Ga0439438_005181 3300041405 Bacteria 4840
312 Ga0439438_012977 3300041405 Bacteria 2532
313 Ga0439438_016750 3300041405 Bacteria 2125
314 Ga0439438_025491 3300041405 Bacteria 1610
315 Ga0439447_000310 3300041407 Bacteria 17421
316 Ga0439447_000501 3300041407 Bacteria 14560
317 Ga0439447_000663 3300041407 Bacteria 12765
318 Ga0439447_001475 3300041407 Bacteria 8615
319 Ga0439466_0000334 3300041411 Bacteria 18158
320 Ga0439466_0000620 3300041411 Bacteria 13368
321 Ga0439466_0000760 3300041411 Bacteria 12194
322 Ga0439466_0001782 3300041411 Bacteria 8420
323 Ga0439466_0016057 3300041411 Bacteria 2710
324 Ga0439466_0016062 3300041411 Bacteria 2710
325 Ga0439466_0018107 3300041411 Bacteria 2529
326 Ga0439466_0037859 3300041411 Bacteria 1622
327 Ga0439466_0098917 3300041411 Bacteria 910
328 Ga0439466_0139737 3300041411 Bacteria 743
329 Ga0439431_0008113 3300041997 Bacteria 2354
330 Ga0439431_0167279 3300041997 Bacteria 630
331 Ga0439437_000115 3300042000 Bacteria 6227
332 Ga0439432_001620 3300042006 Bacteria 8420
333 Ga0439432_002572 3300042006 Bacteria 6836
334 Ga0439432_030244 3300042006 Bacteria 1756
335 Ga0439432_060316 3300042006 Bacteria 1170
336 Ga0439432_062351 3300042006 Bacteria 1147
337 Ga0439451_001646 3300042009 Bacteria 4434
338 Ga0439451_005348 3300042009 Bacteria 2615
339 Ga0439452_000570 3300042010 Bacteria 19237
340 Ga0439452_000628 3300042010 Bacteria 17817
341 Ga0439452_001241 3300042010 Bacteria 10847
342 Ga0439452_001308 3300042010 Bacteria 10474
343 Ga0439452_001398 3300042010 Bacteria 9926
344 Ga0439452_002762 3300042010 Bacteria 6341
345 Ga0439452_007140 3300042010 Bacteria 3440
346 Ga0439452_009153 3300042010 Bacteria 2934
347 Ga0439452_050851 3300042010 Bacteria 949
348 Ga0439454_041528 3300042011 Bacteria 753
349 Ga0439456_000115 3300042013 Bacteria 25406
350 Ga0439456_001126 3300042013 Bacteria 5286
351 Ga0439456_004058 3300042013 Bacteria 2971
352 Ga0439456_004723 3300042013 Bacteria 2755
353 Ga0439456_005418 3300042013 Bacteria 2588
354 Ga0439456_012044 3300042013 Bacteria 1792
355 Ga0439463_002768 3300042016 Bacteria 4446
356 Ga0439463_044927 3300042016 Bacteria 1125
357 Ga0450911_000006 3300042115 Bacteria 222143
358 Ga0450911_000320 3300042115 Bacteria 17307
359 Ga0450911_001728 3300042115 Bacteria 4748
360 Ga0450919_002700 3300042121 Bacteria 2284
361 Ga0450920_000248 3300042122 Bacteria 8070
362 Ga0450922_005091 3300042124 Bacteria 1213
363 Ga0450923_020079 3300042125 Bacteria 1292
364 Ga0450923_020280 3300042125 Bacteria 1287
365 Ga0450890_002225 3300042127 Bacteria 2695
366 Ga0450902_000293 3300042137 Bacteria 5973
367 Ga0450903_004291 3300042138 Bacteria 2440
368 Ga0450903_004968 3300042138 Bacteria 2240
369 Ga0450903_011263 3300042138 Bacteria 1442
370 Ga0450904_000006 3300042139 Bacteria 59554
371 Ga0450904_004966 3300042139 Bacteria 1365
372 Ga0450905_006406 3300042142 Bacteria 1592
373 Ga0450905_006408 3300042142 Bacteria 1592
374 Ga0450905_027742 3300042142 Bacteria 862
375 Ga0450907_000201 3300042146 Bacteria 21621
376 Ga0450907_014392 3300042146 Bacteria 1320
377 Ga0450910_000798 3300042147 Bacteria 3796
378 Ga0450910_001658 3300042147 Bacteria 2851
379 Ga0439446_0000905 3300042156 Bacteria 6391
380 Ga0439446_0001535 3300042156 Bacteria 5297
381 Ga0439446_0013529 3300042156 Bacteria 2240
382 Ga0450908_029334 3300042184 Bacteria 956
383 Ga0450909_000467 3300042185 Bacteria 5207
384 Ga0450909_002351 3300042185 Bacteria 2681
385 Ga0450909_003836 3300042185 Bacteria 2137
386 Ga0439434_0000490 3300042435 Bacteria 11248
387 Ga0439434_0000535 3300042435 Bacteria 10847
388 Ga0439434_0040768 3300042435 Bacteria 1426
389 Ga0439464_0000840 3300042439 Bacteria 6793
390 Ga0439464_0002527 3300042439 Bacteria 4517
391 Ga0439460_0000323 3300042461 Bacteria 10047
392 Ga0439460_0009959 3300042461 Bacteria 2423
393 Ga0439460_0013675 3300042461 Bacteria 2126
394 Ga0450916_000103 3300042530 Bacteria 5499
395 Ga0450918_030447 3300042531 Bacteria 953
396 Ga0450901_000364 3300042533 Bacteria 5498
397 Ga0450901_005029 3300042533 Bacteria 1360
398 Ga0439440_0002562 3300042993 Bacteria 3442
399 Ga0439440_0005864 3300042993 Bacteria 2450
400 Ga0439440_0007439 3300042993 Bacteria 2225
401 Ga0466963_0278436 3300044694 Bacteria 1175
402 Ga0466959_0305715 3300045049 Bacteria 1089
403 Ga0451576_0404201 3300045051 Bacteria 1432
404 Ga0451576_0519155 3300045051 Bacteria 1251
405 Ga0451576_1008408 3300045051 Bacteria 872
406 Ga0451576_1042742 3300045051 Bacteria 857
407 Ga0495617_000668 3300046452 Bacteria 17128
408 Ga0495617_025418 3300046452 Bacteria 1996
409 Ga0495617_083022 3300046452 Bacteria 1049
410 Ga0495617_097017 3300046452 Bacteria 959
411 Ga0495617_102326 3300046452 Bacteria 930
412 Ga0495627_001495 3300046453 Bacteria 13521
413 Ga0495627_002107 3300046453 Bacteria 10072
414 Ga0495627_002824 3300046453 Bacteria 8046
415 Ga0495627_002904 3300046453 Bacteria 7888
416 Ga0495627_006008 3300046453 Bacteria 4815
417 Ga0495627_014321 3300046453 Bacteria 2770
418 Ga0495592_0061075 3300046454 Bacteria 2770
419 Ga0495603_0004020 3300046455 Bacteria 8752
420 Ga0495603_0010701 3300046455 Bacteria 5563
421 Ga0495590_0000657 3300046457 Bacteria 16002
422 Ga0495590_0000861 3300046457 Bacteria 13659
423 Ga0495590_0005018 3300046457 Bacteria 5278
424 Ga0495590_0005991 3300046457 Bacteria 4767
425 Ga0495591_001018 3300046458 Bacteria 18940
426 Ga0495591_002638 3300046458 Bacteria 9813
427 Ga0495591_003243 3300046458 Bacteria 8542
428 Ga0495591_003488 3300046458 Bacteria 8091
429 Ga0495591_003947 3300046458 Bacteria 7438
430 Ga0495591_005377 3300046458 Bacteria 5946
431 Ga0495591_034913 3300046458 Bacteria 1476
432 Ga0495591_042080 3300046458 Bacteria 1293
433 Ga0495638_0003250 3300046460 Bacteria 12822
434 Ga0495638_0007939 3300046460 Bacteria 7568
435 Ga0495638_0013231 3300046460 Bacteria 5628
436 Ga0495638_0041352 3300046460 Bacteria 2916
437 Ga0495638_0046070 3300046460 Bacteria 2741
438 Ga0495638_0084701 3300046460 Bacteria 1918
439 Ga0495638_0096838 3300046460 Bacteria 1770
440 Ga0495638_0189369 3300046460 Bacteria 1168
441 Ga0495653_0037770 3300046463 Bacteria 3791
442 Ga0495653_0074615 3300046463 Bacteria 2526
443 Ga0495653_0197759 3300046463 Bacteria 1366
444 Ga0495650_0002040 3300046471 Bacteria 17653
445 Ga0495650_0003893 3300046471 Bacteria 10559
446 Ga0495650_0019901 3300046471 Bacteria 3287
447 Ga0495650_0021187 3300046471 Bacteria 3149
448 Ga0495650_0084602 3300046471 Bacteria 1216
449 Ga0495582_0073431 3300046473 Bacteria 1893
450 Ga0495605_0001491 3300046474 Bacteria 15279
451 Ga0495605_0001568 3300046474 Bacteria 14862
452 Ga0495605_0005079 3300046474 Bacteria 7676
453 Ga0495605_0015409 3300046474 Bacteria 4161
454 Ga0495605_0021295 3300046474 Bacteria 3435
455 Ga0495605_0072459 3300046474 Bacteria 1624
456 Ga0495639_0000459 3300046475 Bacteria 19327
457 Ga0495639_0059801 3300046475 Bacteria 1744
458 Ga0495584_0003293 3300046491 Bacteria 8946
459 Ga0495584_0006584 3300046491 Bacteria 6069
460 Ga0495584_0009654 3300046491 Bacteria 4967
461 Ga0495584_0015210 3300046491 Bacteria 3919
462 Ga0495584_0015852 3300046491 Bacteria 3844
463 Ga0495584_0032600 3300046491 Bacteria 2636
464 Ga0495584_0378959 3300046491 Bacteria 718
465 Ga0495585_0001600 3300046492 Bacteria 17498
466 Ga0495585_0003756 3300046492 Bacteria 10137
467 Ga0495585_0004425 3300046492 Bacteria 9115
468 Ga0495585_0012821 3300046492 Bacteria 4930
469 Ga0495585_0021387 3300046492 Bacteria 3715
470 Ga0495585_0042304 3300046492 Bacteria 2552
471 Ga0495585_0138747 3300046492 Bacteria 1274
472 Ga0495585_0145104 3300046492 Bacteria 1241
473 Ga0495594_0016430 3300046499 Bacteria 3899
474 Ga0495596_0000810 3300046500 Bacteria 18926
475 Ga0495596_0078628 3300046500 Bacteria 1281
476 Ga0495607_0002501 3300046501 Bacteria 14896
477 Ga0495607_0005610 3300046501 Bacteria 8950
478 Ga0495607_0006757 3300046501 Bacteria 8020
479 Ga0495607_0010753 3300046501 Bacteria 6128
480 Ga0495607_0013661 3300046501 Bacteria 5310
481 Ga0495607_0017489 3300046501 Bacteria 4598
482 Ga0495607_0051336 3300046501 Bacteria 2395
483 Ga0495607_0064907 3300046501 Bacteria 2060
484 Ga0495583_0004611 3300046506 Bacteria 9744
485 Ga0495583_0005527 3300046506 Bacteria 8558
486 Ga0495606_0000613 3300046507 Bacteria 56133
487 Ga0495606_0003599 3300046507 Bacteria 16310
488 Ga0495606_0009739 3300046507 Bacteria 8083
489 Ga0495606_0009990 3300046507 Bacteria 7937
490 Ga0495606_0014067 3300046507 Bacteria 6268
491 Ga0495606_0014214 3300046507 Bacteria 6229
492 Ga0495606_0018106 3300046507 Bacteria 5295
493 Ga0495606_0026817 3300046507 Bacteria 4098
494 Ga0495606_0253278 3300046507 Bacteria 975
495 Ga0495610_0004876 3300046512 Bacteria 9753
496 Ga0495610_0009061 3300046512 Bacteria 6344
497 Ga0495610_0024811 3300046512 Bacteria 3229
498 Ga0495610_0028656 3300046512 Bacteria 2941
499 Ga0495610_0088869 3300046512 Bacteria 1403
500 Ga0495610_0135665 3300046512 Bacteria 1064
501 Ga0495616_0001743 3300046513 Bacteria 14809
502 Ga0495616_0002218 3300046513 Bacteria 12984
503 Ga0495616_0002439 3300046513 Bacteria 12358
504 Ga0495616_0003301 3300046513 Bacteria 10373
505 Ga0495616_0007195 3300046513 Bacteria 6670
506 Ga0495616_0018775 3300046513 Bacteria 3787
507 Ga0495616_0091464 3300046513 Bacteria 1439
508 Ga0495616_0156050 3300046513 Bacteria 1029
509 Ga0495620_0001683 3300046515 Bacteria 13041
510 Ga0495620_0007508 3300046515 Bacteria 5911
511 Ga0495620_0008596 3300046515 Bacteria 5477
512 Ga0495620_0008957 3300046515 Bacteria 5347
513 Ga0495620_0021811 3300046515 Bacteria 3101
514 Ga0495620_0043970 3300046515 Bacteria 1943
515 Ga0495620_0095358 3300046515 Bacteria 1190
516 Ga0495620_0102536 3300046515 Bacteria 1139
517 Ga0495628_0129876 3300046516 Bacteria 1928
518 Ga0495630_0082181 3300046517 Bacteria 2431
519 Ga0495631_0000110 3300046518 Bacteria 54728
520 Ga0495631_0003550 3300046518 Bacteria 8527
521 Ga0495631_0012696 3300046518 Bacteria 4106
522 Ga0495631_0034690 3300046518 Bacteria 2260
523 Ga0495632_0001736 3300046519 Bacteria 17674
524 Ga0495632_0004067 3300046519 Bacteria 10098
525 Ga0495632_0006881 3300046519 Bacteria 7235
526 Ga0495632_0008448 3300046519 Bacteria 6320
527 Ga0495632_0009156 3300046519 Bacteria 5985
528 Ga0495632_0019359 3300046519 Bacteria 3710
529 Ga0495632_0027411 3300046519 Bacteria 2985
530 Ga0495632_0067705 3300046519 Bacteria 1721
531 Ga0495632_0166526 3300046519 Bacteria 1013
532 Ga0495632_0174411 3300046519 Bacteria 986
533 Ga0495632_0205749 3300046519 Bacteria 894
534 Ga0495632_0235075 3300046519 Bacteria 825
535 Ga0495637_0001645 3300046520 Bacteria 12919
536 Ga0495637_0004763 3300046520 Bacteria 6998
537 Ga0495637_0006267 3300046520 Bacteria 5984
538 Ga0495637_0006296 3300046520 Bacteria 5973
539 Ga0495637_0023311 3300046520 Bacteria 2815
540 Ga0495637_0059827 3300046520 Bacteria 1566
541 Ga0495637_0076171 3300046520 Bacteria 1344
542 Ga0495637_0102271 3300046520 Bacteria 1118
543 Ga0495643_0000585 3300046522 Bacteria 44407
544 Ga0495643_0002726 3300046522 Bacteria 13592
545 Ga0495643_0009165 3300046522 Bacteria 6180
546 Ga0495643_0013916 3300046522 Bacteria 4797
547 Ga0495643_0020785 3300046522 Bacteria 3777
548 Ga0495643_0041612 3300046522 Bacteria 2504
549 Ga0495643_0059553 3300046522 Bacteria 2029
550 Ga0495643_0072191 3300046522 Bacteria 1810
551 Ga0495643_0081585 3300046522 Bacteria 1681
552 Ga0495643_0088947 3300046522 Bacteria 1595
553 Ga0495643_0260537 3300046522 Bacteria 805
554 Ga0495644_0001407 3300046523 Bacteria 9825
555 Ga0495644_0026865 3300046523 Bacteria 2182
556 Ga0495644_0071001 3300046523 Bacteria 1308
557 Ga0495648_0001916 3300046524 Bacteria 19825
558 Ga0495648_0005960 3300046524 Bacteria 10026
559 Ga0495648_0007582 3300046524 Bacteria 8666
560 Ga0495648_0008479 3300046524 Bacteria 8085
561 Ga0495648_0008597 3300046524 Bacteria 8012
562 Ga0495648_0023677 3300046524 Bacteria 4198
563 Ga0495648_0036713 3300046524 Bacteria 3156
564 Ga0495648_0058186 3300046524 Bacteria 2312
565 Ga0495648_0145493 3300046524 Bacteria 1242
566 Ga0495648_0176131 3300046524 Bacteria 1091
567 Ga0495648_0194474 3300046524 Bacteria 1020
568 Ga0495648_0213590 3300046524 Bacteria 956
569 Ga0495666_0085078 3300046526 Bacteria 1493
570 Ga0495666_0108392 3300046526 Bacteria 1305
571 Ga0495642_0000361 3300046528 Bacteria 24687
572 Ga0495642_0001257 3300046528 Bacteria 11551
573 Ga0495654_0003070 3300046530 Bacteria 10398
574 Ga0495654_0004441 3300046530 Bacteria 8320
575 Ga0495654_0006568 3300046530 Bacteria 6587
576 Ga0495654_0009334 3300046530 Bacteria 5377
577 Ga0495654_0013702 3300046530 Bacteria 4333
578 Ga0495654_0015758 3300046530 Bacteria 4009
579 Ga0495654_0052797 3300046530 Bacteria 1977
580 Ga0495654_0058010 3300046530 Bacteria 1869
581 Ga0495654_0085762 3300046530 Bacteria 1468
582 Ga0495654_0096665 3300046530 Bacteria 1364
583 Ga0495654_0186528 3300046530 Bacteria 895
584 Ga0495586_0003278 3300046535 Bacteria 8699
585 Ga0495587_0003724 3300046536 Bacteria 10116
586 Ga0495609_0001849 3300046538 Bacteria 13539
587 Ga0495609_0008959 3300046538 Bacteria 4867
588 Ga0495609_0055824 3300046538 Bacteria 1751
589 Ga0495609_0117183 3300046538 Bacteria 1146
590 Ga0495609_0122411 3300046538 Bacteria 1118
591 Ga0495597_0004275 3300046542 Bacteria 7898
592 Ga0495597_0007955 3300046542 Bacteria 5338
593 Ga0495597_0013099 3300046542 Bacteria 3980
594 Ga0495597_0033000 3300046542 Bacteria 2347
595 Ga0495597_0042324 3300046542 Bacteria 2031
596 Ga0495597_0133005 3300046542 Bacteria 1030
597 Ga0495597_0245075 3300046542 Bacteria 705
598 Ga0495622_0000577 3300046557 Bacteria 21933
599 Ga0495622_0001471 3300046557 Bacteria 11841
600 Ga0495622_0002243 3300046557 Bacteria 9406
601 Ga0495622_0027898 3300046557 Bacteria 2635
602 Ga0495622_0088702 3300046557 Bacteria 1421
603 Ga0495633_0005304 3300046558 Bacteria 7924
604 Ga0495633_0007007 3300046558 Bacteria 6580
605 Ga0495633_0122898 3300046558 Bacteria 1202
606 Ga0495656_0027017 3300046615 Bacteria 2289
607 Ga0495656_0425093 3300046615 Bacteria 697
608 Ga0495668_0001865 3300046616 Bacteria 18894
609 Ga0495668_0012565 3300046616 Bacteria 5020
610 Ga0495668_0012589 3300046616 Bacteria 5016
611 Ga0495634_0001928 3300046642 Bacteria 17757
612 Ga0495611_0001980 3300046648 Bacteria 9721
613 Ga0495611_0097198 3300046648 Bacteria 1364
614 Ga0495625_0005099 3300046660 Bacteria 12154
615 Ga0495625_0007226 3300046660 Bacteria 9721
616 Ga0495625_0044114 3300046660 Bacteria 3229
617 Ga0495625_0051234 3300046660 Bacteria 2960
618 Ga0495625_0074631 3300046660 Bacteria 2375
619 Ga0495625_0083435 3300046660 Bacteria 2221
620 Ga0495625_0089501 3300046660 Bacteria 2131
621 Ga0495625_0261919 3300046660 Bacteria 1118
622 Ga0495659_0001180 3300046664 Bacteria 9066
623 Ga0495661_0002985 3300046665 Bacteria 12754
624 Ga0495661_0022020 3300046665 Bacteria 4147
625 Ga0495661_0038947 3300046665 Bacteria 2956
626 Ga0495661_0068627 3300046665 Bacteria 2079
627 Ga0495661_0124116 3300046665 Bacteria 1422
628 Ga0495661_0169089 3300046665 Bacteria 1167
629 Ga0495661_0205269 3300046665 Bacteria 1029
630 Ga0495661_0299483 3300046665 Bacteria 805
631 Ga0495623_0002535 3300046679 Bacteria 12081
632 Ga0495646_0008586 3300046680 Bacteria 6488
633 Ga0495646_0072841 3300046680 Bacteria 2019
634 Ga0495669_0024336 3300046684 Bacteria 2637
635 Ga0495613_0454496 3300046689 Bacteria 867
636 Ga0495624_0003400 3300046690 Bacteria 11809
637 Ga0495670_0002414 3300046691 Bacteria 9220
638 Ga0495670_0004092 3300046691 Bacteria 7153
639 Ga0495670_0005057 3300046691 Bacteria 6488
640 Ga0495670_0007462 3300046691 Bacteria 5370
641 Ga0495670_0217870 3300046691 Bacteria 1014
642 Ga0495671_0000943 3300046692 Bacteria 20502
643 Ga0495671_0002975 3300046692 Bacteria 10536
644 Ga0495671_0003620 3300046692 Bacteria 9418
645 Ga0495671_0011268 3300046692 Bacteria 4930
646 Ga0495671_0015392 3300046692 Bacteria 4097
647 Ga0495671_0023399 3300046692 Bacteria 3227
648 Ga0495671_0025739 3300046692 Bacteria 3054
649 Ga0495671_0048226 3300046692 Bacteria 2125
650 Ga0495671_0134268 3300046692 Bacteria 1206
651 Ga0495671_0158726 3300046692 Bacteria 1100
652 Ga0495671_0164313 3300046692 Bacteria 1079
653 Ga0495649_0002770 3300046694 Bacteria 12201
654 Ga0495649_0003922 3300046694 Bacteria 9841
655 Ga0495649_0005421 3300046694 Bacteria 8117
656 Ga0495649_0005797 3300046694 Bacteria 7780
657 Ga0495649_0011662 3300046694 Bacteria 5148
658 Ga0495649_0014694 3300046694 Bacteria 4476
659 Ga0495649_0018225 3300046694 Bacteria 3953
660 Ga0495649_0044591 3300046694 Bacteria 2421
661 Ga0495649_0048069 3300046694 Bacteria 2318
662 Ga0495649_0051525 3300046694 Bacteria 2231
663 Ga0495649_0061987 3300046694 Bacteria 2010
664 Ga0495649_0242532 3300046694 Bacteria 928
665 Ga0495649_0332084 3300046694 Bacteria 770
666 Ga0495589_0000961 3300046794 Bacteria 17600
667 Ga0495589_0003344 3300046794 Bacteria 8704
668 Ga0495589_0007493 3300046794 Bacteria 5720
669 Ga0495589_0008105 3300046794 Bacteria 5493
670 Ga0495589_0012571 3300046794 Bacteria 4381
671 Ga0495589_0013470 3300046794 Bacteria 4218
672 Ga0495589_0020948 3300046794 Bacteria 3341
673 Ga0495589_0186623 3300046794 Bacteria 982
674 Ga0495600_0045725 3300046809 Bacteria 2856
675 Ga0495660_0003064 3300046810 Bacteria 10424
676 Ga0495660_0005058 3300046810 Bacteria 7922
677 Ga0495660_0011565 3300046810 Bacteria 5118
678 Ga0495660_0017700 3300046810 Bacteria 4099
679 Ga0495660_0019909 3300046810 Bacteria 3848
680 Ga0495660_0051192 3300046810 Bacteria 2247
681 Ga0495660_0057198 3300046810 Bacteria 2104
682 Ga0495660_0070591 3300046810 Bacteria 1853
683 Ga0495660_0116040 3300046810 Bacteria 1360
684 Ga0495604_0015251 3300047317 Bacteria 6134
685 Ga0495604_0053180 3300047317 Bacteria 3132
686 Ga0495604_0070234 3300047317 Bacteria 2652
687 Ga0495604_0435473 3300047317 Bacteria 858
688 Ga0495636_0004968 3300047318 Bacteria 5215
689 Ga0495636_0010098 3300047318 Bacteria 3724
690 Ga0495674_0014222 3300047319 Bacteria 7452
691 Ga0495672_0002687 3300047320 Bacteria 16004
692 Ga0495672_0005742 3300047320 Bacteria 9772
693 Ga0495672_0005781 3300047320 Bacteria 9718
694 Ga0495672_0007067 3300047320 Bacteria 8517
695 Ga0495672_0026348 3300047320 Bacteria 3711
696 Ga0495672_0036401 3300047320 Bacteria 3022
697 Ga0495672_0052005 3300047320 Bacteria 2408
698 Ga0495672_0080212 3300047320 Bacteria 1821
699 Ga0495672_0098275 3300047320 Bacteria 1592
700 Ga0495676_0026237 3300047321 Bacteria 5018
701 Ga0495680_0031314 3300047322 Bacteria 4331
702 Ga0495680_0039032 3300047322 Bacteria 3791
703 Ga0495680_0099451 3300047322 Bacteria 2168
704 Ga0495680_0235056 3300047322 Bacteria 1303
705 Ga0495683_0002172 3300047323 Bacteria 12046
706 Ga0495683_0003296 3300047323 Bacteria 9436
707 Ga0495683_0035595 3300047323 Bacteria 2530
708 Ga0495683_0077593 3300047323 Bacteria 1624
709 Ga0495683_0173493 3300047323 Bacteria 989
710 Ga0495687_004739 3300047443 Bacteria 9004
711 Ga0495687_006813 3300047443 Bacteria 6897
712 Ga0495687_099346 3300047443 Bacteria 1095
713 Ga0495687_112356 3300047443 Bacteria 998
714 Ga0495675_0052871 3300047444 Bacteria 2578
715 Ga0495677_0002688 3300047445 Bacteria 6945
716 Ga0495679_003285 3300047446 Bacteria 7835
717 Ga0495679_004017 3300047446 Bacteria 6916
718 Ga0495679_030734 3300047446 Bacteria 1740
719 Ga0495685_071350 3300047447 Bacteria 1163
720 Ga0495673_0000935 3300047469 Bacteria 26484
721 Ga0495673_0002710 3300047469 Bacteria 12172
722 Ga0495673_0002867 3300047469 Bacteria 11731
723 Ga0495673_0003838 3300047469 Bacteria 9700
724 Ga0495673_0005439 3300047469 Bacteria 7697
725 Ga0495673_0007537 3300047469 Bacteria 6235
726 Ga0495673_0015486 3300047469 Bacteria 3927
727 Ga0495673_0017402 3300047469 Bacteria 3653
728 Ga0495673_0094650 3300047469 Bacteria 1216
729 Ga0495673_0098333 3300047469 Bacteria 1186
730 Ga0495681_0002418 3300047470 Bacteria 13352
731 Ga0495681_0003202 3300047470 Bacteria 11426
732 Ga0495681_0003508 3300047470 Bacteria 10899
733 Ga0495681_0003692 3300047470 Bacteria 10629
734 Ga0495681_0003721 3300047470 Bacteria 10566
735 Ga0495681_0004082 3300047470 Bacteria 10043
736 Ga0495681_0008432 3300047470 Bacteria 6467
737 Ga0495681_0010741 3300047470 Bacteria 5516
738 Ga0495681_0011238 3300047470 Bacteria 5351
739 Ga0495681_0024579 3300047470 Bacteria 3169
740 Ga0495681_0029000 3300047470 Bacteria 2838
741 Ga0495684_0456709 3300047471 Bacteria 886
742 Ga0495686_0008077 3300047472 Bacteria 7788
743 Ga0495686_0037949 3300047472 Bacteria 3084
744 Ga0495686_0039456 3300047472 Bacteria 3015
745 Ga0495686_0103541 3300047472 Bacteria 1715
746 Ga0495686_0192103 3300047472 Bacteria 1176
747 Ga0495686_0195468 3300047472 Bacteria 1163
748 Ga0495593_0006784 3300047673 Bacteria 6702
749 Ga0495593_0008472 3300047673 Bacteria 5978
750 Ga0495593_0025981 3300047673 Bacteria 3238
751 Ga0495602_0013623 3300048088 Bacteria 8296
752 Ga0495626_0001629 3300048091 Bacteria 17429
753 Ga0495626_0001739 3300048091 Bacteria 16606
754 Ga0495626_0004676 3300048091 Bacteria 8309
755 Ga0495626_0005055 3300048091 Bacteria 7869
756 Ga0495626_0008827 3300048091 Bacteria 5481
757 Ga0495626_0014326 3300048091 Bacteria 4094
758 Ga0495626_0044054 3300048091 Bacteria 2090
759 Ga0495626_0056819 3300048091 Bacteria 1790
760 Ga0495626_0106098 3300048091 Bacteria 1220
761 Ga0496102_0001561 3300048905 Bacteria 20220
762 Ga0496103_0008656 3300048906 Bacteria 6042
763 Ga0496104_0014763 3300048907 Bacteria 7058
764 Ga0496104_0044426 3300048907 Bacteria 4175
765 Ga0496106_0176455 3300048909 Bacteria 1695
766 Ga0496106_0560397 3300048909 Bacteria 917
767 Ga0496107_0299512 3300048910 Bacteria 1197
768 Ga0496107_0302854 3300048910 Bacteria 1190
769 Ga0496108_0001080 3300048911 Bacteria 21256
770 Ga0496108_0029167 3300048911 Bacteria 4568
771 Ga0496109_0003793 3300048912 Bacteria 12619
772 Ga0496109_0107600 3300048912 Bacteria 2590
773 Ga0496110_0312048 3300048913 Bacteria 1432
774 Ga0496111_0053151 3300048914 Bacteria 2926
775 Ga0496111_0420772 3300048914 Bacteria 987
776 Ga0496112_0004358 3300048915 Bacteria 11973
777 Ga0496112_0013335 3300048915 Bacteria 7586
778 Ga0496112_0081616 3300048915 Bacteria 3198
779 Ga0496113_0000556 3300048916 Bacteria 18514
780 Ga0496113_0001353 3300048916 Bacteria 13569
781 Ga0496116_0000234 3300048919 Bacteria 101720
782 Ga0496116_0000960 3300048919 Bacteria 35604
783 Ga0496116_0002607 3300048919 Bacteria 18730
784 Ga0496116_0012873 3300048919 Bacteria 6794
785 Ga0496116_0016057 3300048919 Bacteria 5881
786 Ga0496116_0082989 3300048919 Bacteria 1980
787 Ga0496117_0001930 3300048920 Bacteria 27662
788 Ga0496117_0004181 3300048920 Bacteria 16143
789 Ga0496117_0006118 3300048920 Bacteria 12317
790 Ga0496117_0011127 3300048920 Bacteria 8090
791 Ga0496117_0015032 3300048920 Bacteria 6631
792 Ga0496117_0015867 3300048920 Bacteria 6387
793 Ga0496118_0004537 3300048921 Bacteria 16390
794 Ga0496118_0010603 3300048921 Bacteria 9101
795 Ga0496118_0018405 3300048921 Bacteria 6306
796 Ga0496118_0029366 3300048921 Bacteria 4611
797 Ga0496118_0117643 3300048921 Bacteria 1742
798 Ga0496119_0021643 3300048922 Bacteria 4636
799 Ga0496119_0165321 3300048922 Bacteria 1172
800 Ga0496120_0004433 3300048923 Bacteria 11775
801 Ga0496121_0000346 3300048924 Bacteria 96825
802 Ga0496121_0031595 3300048924 Bacteria 4833
803 Ga0496121_0077102 3300048924 Bacteria 2655
804 Ga0496121_0131702 3300048924 Bacteria 1870
805 Ga0496122_0007280 3300048925 Bacteria 12366
806 Ga0496122_0008343 3300048925 Bacteria 11208
807 Ga0496122_0025979 3300048925 Bacteria 5067
808 Ga0496122_0143958 3300048925 Bacteria 1485
809 Ga0496122_0230870 3300048925 Bacteria 1052
810 Ga0496122_0335079 3300048925 Bacteria 797
811 Ga0496123_0014130 3300048926 Bacteria 6639
812 Ga0496123_0063332 3300048926 Bacteria 2363
813 Ga0496123_0081030 3300048926 Bacteria 1974
814 Ga0496123_0081997 3300048926 Bacteria 1957
815 Ga0496123_0118784 3300048926 Bacteria 1492
816 Ga0496123_0303290 3300048926 Bacteria 761
817 Ga0496123_0332063 3300048926 Bacteria 713
818 Ga0496124_0000151 3300048927 Bacteria 142761
819 Ga0496124_0004227 3300048927 Bacteria 16903
820 Ga0496124_0006364 3300048927 Bacteria 12884
821 Ga0496124_0013516 3300048927 Bacteria 7964
822 Ga0496124_0017790 3300048927 Bacteria 6685
823 Ga0496124_0026034 3300048927 Bacteria 5282
824 Ga0496124_0038026 3300048927 Bacteria 4180
825 Ga0496124_0041851 3300048927 Bacteria 3948
826 Ga0496124_0048295 3300048927 Bacteria 3638
827 Ga0496124_0107451 3300048927 Bacteria 2251
828 Ga0496124_0201190 3300048927 Bacteria 1514
829 Ga0496124_0269090 3300048927 Bacteria 1249
830 Ga0496124_0442663 3300048927 Bacteria 888
831 Ga0496125_0006506 3300048928 Bacteria 12604
832 Ga0496125_0007308 3300048928 Bacteria 11761
833 Ga0496125_0008984 3300048928 Bacteria 10362
834 Ga0496125_0015094 3300048928 Bacteria 7493
835 Ga0496125_0119152 3300048928 Bacteria 1888
836 Ga0496125_0218506 3300048928 Bacteria 1230
837 Ga0496126_0015959 3300048929 Bacteria 7532
838 Ga0496126_0020765 3300048929 Bacteria 6429
839 Ga0496126_0482943 3300048929 Bacteria 992
840 Ga0495678_000328 3300049459 Bacteria 50414
841 Ga0495678_001561 3300049459 Bacteria 17597
842 Ga0495678_007885 3300049459 Bacteria 5468
843 Ga0495678_010925 3300049459 Bacteria 4374
844 Ga0495678_024761 3300049459 Bacteria 2586
845 Ga0495678_035275 3300049459 Bacteria 2051
846 Ga0495678_065470 3300049459 Bacteria 1349
847 Ga0495678_078622 3300049459 Bacteria 1190
848 Ga0495678_159371 3300049459 Bacteria 722
849 Ga0495682_0033185 3300049460 Bacteria 1905
850 Ga0495682_0118371 3300049460 Bacteria 948
851 Ga0501032_0012424 3300049569 Bacteria 6084
852 Ga0501034_0059481 3300049571 Bacteria 3838
853 Ga0501034_0111107 3300049571 Bacteria 2731
854 Ga0501036_1062014 3300049572 Bacteria 662
855 Ga0501037_0414262 3300049573 Bacteria 923
856 Ga0501039_0179010 3300049575 Bacteria 1667
857 Ga0501241_000445 3300049758 Bacteria 8996
858 Ga0501035_0136461 3300049822 Bacteria 2136
859 Ga0501226_000004 3300049853 Bacteria 284656
860 Ga0501226_002197 3300049853 Bacteria 2409
861 nmdc:mga08y16_38962_c1 3300050511 Bacteria 4988
862 nmdc:mga0n895_15523_c1 3300050512 Bacteria 6948
863 nmdc:mga0rr50_357181_c1 3300050513 Bacteria 1230
864 nmdc:mga08x19_1280_c1 3300050514 Bacteria 15609
865 nmdc:mga0a205_2190_c1 3300050515 Bacteria 17194
866 nmdc:mga0sz30_80283_c1 3300050516 Bacteria 1062
867 Ga0500572_001243 3300053111 Bacteria 7191
868 Ga0500595_003668 3300053119 Bacteria 7101
869 Ga0500616_0000885 3300053153 Bacteria 33029
870 2883578382 2883577096 Bacteria 4709178
871 2510284235 2510065053 Bacteria 5005518
872 2510293081 2510065055 Bacteria 5037935
873 2510312582 2510065058 Bacteria 5005894
874 2511256186 2511231004 Bacteria 6669789
875 2511263411 2511231006 Bacteria 6794709
876 2511272280 2511231007 Bacteria 6306603
877 2511279331 2511231008 Bacteria 6624100
878 2511287559 2511231010 Bacteria 6373152
879 2511297464 2511231011 Bacteria 6149768
880 2511300954 2511231012 Bacteria 6738011
881 2511311571 2511231014 Bacteria 6462302
882 2511322632 2511231015 Bacteria 6598026
883 2511326405 2511231016 Bacteria 6704427
884 2511330882 2511231017 Bacteria 6503007
885 2511341471 2511231018 Bacteria 6436256
886 2511346513 2511231019 Bacteria 6520662
887 2511349225 2511231020 Bacteria 6115223
888 2511361485 2511231022 Bacteria 6719296
889 2511367173 2511231023 Bacteria 6808468
890 2511377662 2511231024 Bacteria 5835885
891 2511414412 2511231031 Bacteria 6558529
892 2511822572 2511231156 Bacteria 6845832
893 2512326066 2512047018 Bacteria 6663241
894 2548846535 2547132512 Bacteria 3416496
895 2555247476 2554235231 Bacteria 5215788
896 2555667539 2554235341 Bacteria 6867980
897 2583789696 2582580891 Bacteria 6800976
898 2597855768 2597489887 Bacteria 6666321
899 2599356760 2599185160 Bacteria 6844013
900 2599363210 2599185161 Bacteria 6960462
901 2599369838 2599185162 Bacteria 6957254
902 2599376319 2599185163 Bacteria 6995158
903 2599381865 2599185164 Bacteria 6841688
904 2599387991 2599185165 Bacteria 6843250
905 2599395483 2599185166 Bacteria 6959206
906 2599407248 2599185168 Bacteria 6997636
907 2599463593 2599185181 Bacteria 6844519
908 2599469059 2599185182 Bacteria 6883168
909 2599485670 2599185185 Bacteria 6652270
910 2599492612 2599185186 Bacteria 6831633
911 2599499991 2599185188 Bacteria 6164180
912 2599616704 2599185212 Bacteria 6765997
913 2599769532 2599185248 Bacteria 6696816
914 2599806800 2599185257 Bacteria 6492581
915 2599886953 2599185289 Bacteria 6778765
916 2599898282 2599185291 Bacteria 6775623
917 2599931013 2599185300 Bacteria 6062622
918 2599944606 2599185302 Bacteria 5954930
919 2599956051 2599185304 Bacteria 5951361
920 2599961224 2599185305 Bacteria 6748700
921 2599964669 2599185306 Bacteria 6637356
922 2599977399 2599185308 Bacteria 6621546
923 2599983182 2599185309 Bacteria 5969593
924 2599991115 2599185310 Bacteria 6014457
925 2599997768 2599185311 Bacteria 6354990
926 2600001013 2599185312 Bacteria 5912071
927 2600007062 2599185313 Bacteria 6658188
928 2600011568 2599185314 Bacteria 6621749
929 2600019200 2599185315 Bacteria 6771107
930 2600026424 2599185316 Bacteria 6320029
931 2600031984 2599185317 Bacteria 6435722
932 2600036832 2599185318 Bacteria 6961590
933 2600043272 2599185319 Bacteria 6637840
934 2600048186 2599185320 Bacteria 5963263
935 2600055792 2599185321 Bacteria 6764560
936 2600061177 2599185322 Bacteria 6763055
937 2600068421 2599185323 Bacteria 6688755
938 2600072457 2599185324 Bacteria 6590677
939 2600078427 2599185325 Bacteria 6324919
940 2600216222 2599185356 Bacteria 6843884
941 2600360263 2600254930 Bacteria 6431253
942 2600364770 2600254931 Bacteria 6734225
943 2600443782 2600254954 Bacteria 5100516
944 2601776389 2600255313 Bacteria 6842543
945 2601797953 2600255318 Bacteria 6383414
946 2602008762 2600255389 Bacteria 5275336
947 2606076564 2603880185 Bacteria 6379190
948 2606129022 2603880199 Bacteria 6377649
949 2608380735 2606217733 Bacteria 6360972
950 2624478339 2623620443 Bacteria 6427864
951 2624489886 2623620446 Bacteria 6500345
952 2643841105 2643221565 Bacteria 6216018
953 2643954785 2643221589 Bacteria 6250934
954 2644000440 2643221598 Bacteria 4578346
955 2644024425 2643221602 Bacteria 6249926
956 2644084782 2643221614 Bacteria 4260023
957 2644190118 2643221633 Bacteria 6733554
958 2644281383 2643221650 Bacteria 7029547
959 2644342334 2643221661 Bacteria 4267604
960 2644365634 2643221666 Bacteria 4265935
961 2652547082 2651869719 Bacteria 6047974
962 2671090679 2667528170 Bacteria 6786960
963 2671099852 2667528171 Bacteria 6900659
964 2671129219 2667528176 Bacteria 6724917
965 2671695637 2671180139 Bacteria 4196045
966 2671772451 2671180172 Bacteria 6495783
967 2678261112 2675903515 Bacteria 6580491
968 2715749329 2713897148 Bacteria 5883533
969 2715755595 2713897149 Bacteria 6506249
970 2718632281 2718217725 Bacteria 5758958
971 2729146024 2728369097 Bacteria 4333476
972 2739200577 2738543004 Bacteria 6381073
973 2739259945 2738543015 Bacteria 6750701
974 2739288626 2738543020 Bacteria 5718238
975 2739293938 2738543021 Bacteria 5718241
976 2739311407 2738543025 Bacteria 6600348
977 2743735187 2740892503 Bacteria 6855563
978 2745006423 2744054620 Bacteria 6551379
979 2765581720 2765235841 Bacteria 6137024
980 2774119434 2773857670 Bacteria 6407454
981 2774131450 2773857672 Bacteria 4993178
982 2774134854 2773857673 Bacteria 6513460
983 2784260926 2784132063 Bacteria 6262788
984 2784316357 2784132072 Bacteria 6596533
985 2794594149 2791355520 Bacteria 5948615
986 2807454700 2806310745 Bacteria 5742165
987 2808856225 2808606361 Bacteria 6136259
988 2808906719 2808606373 Bacteria 4423627
989 2808922623 2808606376 Bacteria 6248667
990 2808932661 2808606377 Bacteria 6646337
991 2808936269 2808606378 Bacteria 6177535
992 2808940148 2808606379 Bacteria 5022697
993 2808944310 2808606380 Bacteria 6248705
994 2808954782 2808606381 Bacteria 6646461
995 2808955989 2808606382 Bacteria 6841132
996 2808965622 2808606383 Bacteria 6138645
997 2808999618 2808606389 Bacteria 6138126
998 2809218095 2808606445 Bacteria 6057339
999 2812370334 2811994881 Bacteria 6298475
1000 2819657348 2818991456 Bacteria 6123676
1001 2819705332 2818991464 Bacteria 6907494
1002 2823425369 2823421272 Bacteria 5372474
1003 2825654146 2825651385 Bacteria 6715909
1004 2842807146 2842805378 Bacteria 5385175
1005 2842834285 2842832357 Bacteria 5959113
1006 2842846238 2842843487 Bacteria 6004777
1007 2842859961 2842854478 Bacteria 6143501
1008 2844668013 2844665904 Bacteria 6817974
1009 2852660332 2852657418 Bacteria 6472974
1010 2860343521 2860339153 Bacteria 6846989
1011 2878030284 2878029506 Bacteria 6418441
1012 2880231232 2880230671 Bacteria 6140320
1013 2904519688 2904518522 Bacteria 6068986
1014 2904553921 2904550169 Bacteria 6221258
1015 2912964296 2912963787 Bacteria 5646108
1016 2913037404 2913036834 Bacteria 6704877
1017 2917071290 2917070673 Bacteria 6868303
1018 2917836290 2917832318 Bacteria 5346010
1019 2919066031 2919063839 Bacteria 6302690
1020 2919127588 2919125081 Bacteria 5385106
1021 2919389648 2919385768 Bacteria 5897293
1022 2919460104 2919456309 Bacteria 6586567
1023 2919486547 2919481497 Bacteria 6907839
1024 2919488576 2919487758 Bacteria 5929766
1025 2919502112 2919501602 Bacteria 5286340
1026 2919698836 2919697872 Bacteria 6553725
1027 2923154183 2923153595 Bacteria 6870622
1028 2923524422 2923519811 Bacteria 6298479
1029 2923591638 2923586266 Bacteria 6565975
1030 2926063785 2926063275 Bacteria 5285848
1031 2929144936 2929144301 Bacteria 6622272
1032 2931371727 2931369376 Bacteria 6847892
1033 2931398962 2931396565 Bacteria 7251677
1034 2935359118 2935353572 Unclassified 6955622
1035 2939641224 2939636861 Bacteria 6297853
1036 2939655903 2939651529 Bacteria 5895393
1037 2945967706 2945961074 Bacteria 7342064
1038 2969305080 2969304461 Bacteria 6601805
1039 2974293226 2974289157 Bacteria 6080362
1040 2974301652 2974298342 Bacteria 4840922
1041 2984291875 2984286254 Bacteria 6702062
1042 2984500774 2984499530 Bacteria 5020881
1043 2984507311 2984504281 Bacteria 5262371
1044 2988732327 2988728565 Bacteria 6124362
1045 2990198675 2990196909 Bacteria 4054280
1046 2998140590 2998139840 Bacteria 6073514
1047 3007399738 3007395558 Bacteria 6755444
1048 3007518036 3007511990 Bacteria 6481491
1049 3007614976 3007614139 Bacteria 6053559
1050 3007622279 3007619802 Bacteria 6411688
1051 3007720383 3007718800 Bacteria 5971527
1052 3007808894 3007803356 Bacteria 5931491
1053 3007859817 3007855910 Bacteria 5637581
1054 3007864204 3007861166 Bacteria 6045338
1055 3007870824 3007866637 Bacteria 5899198
1056 3007872887 3007872151 Bacteria 5268868
1057 637317934 637000220 Bacteria 7074893
1058 640487056 640427133 Bacteria 4567418
1059 651174929 651053060 Bacteria 4689946
1060 8011352773 8011350971 Bacteria 6158957
1061 8015688433 8015687852 Bacteria 6613826
1062 8016730582 8016728285 Bacteria 5263933
1063 8019770414 8019769354 Bacteria 6924660
1064 8019777460 8019775933 Bacteria 6858656
1065 8030000150 8029995093 Bacteria 5990776
1066 8034963359 8034962539 Bacteria 4884839
1067 8052495160 8052494512 Bacteria 5765634
1068 8054930813 8054929484 Bacteria 5599761
1069 8055771533 8055770955 Bacteria 6827675
1070 8056116843 8056115690 Bacteria 5527654
1071 8056125358 8056120720 Bacteria 5758328
1072 8056126588 8056125926 Bacteria 6228218
1073 8056143868 8056143049 Bacteria 6307666
1074 8056158631 8056155041 Bacteria 6486948
1075 8056170461 8056166840 Bacteria 5820959
1076 8056176591 8056172158 Bacteria 6133900
1077 8056182923 8056177738 Bacteria 6748268
1078 8056573413 8056569372 Bacteria 5997322
1079 8057802817 8057798959 Bacteria 6713499
1080 MRS2a_Contig_17
1081 MRS2a_Contig_743
1082 SwRhRL2b_contig_1875519
1083 SwRhRL2b_contig_1906178
1084 SwRhRL2b_contig_802536
1085 JGI25162J39368_1000096
1086 JGI25162J39368_1001687
1087 JGI25163J39215_1000085
1088 JGI25163J39215_1000575
1089 JGI25164J39214_1000074
1090 JGI25164J39214_1000819
1091 JGI25165J46597_1000177
1092 JGI25165J46597_1001612
1093 rootH1_10233992
1094 Ga0006562J51391_1097134
1095 Ga0055536_1000101
1096 Ga0055536_1000841
1097 Ga0055536_1003159
1098 Ga0055536_1050526
1099 Ga0055530_10000097
1100 Ga0055530_10000216
1101 Ga0055530_10001211
1102 Ga0055530_10011795
1103 Ga0055540_1000108
1104 Ga0055540_1000232
1105 Ga0055540_1000837
1106 Ga0055531_10000811
1107 Ga0055531_10001535
1108 Ga0065714_10000496
1109 Ga0065714_10002602
1110 Ga0065714_10004617
1111 Ga0065714_10017343
1112 Ga0065714_10018028
1113 Ga0065714_10019951
1114 Ga0065714_10020229
1115 Ga0065714_10034541
1116 Ga0065714_10038529
1117 Ga0065714_10068262
1118 Ga0065714_10071110
1119 Ga0065704_10000569
1120 Ga0065704_10101832
1121 Ga0065704_10107570
1122 Ga0065704_10142007
1123 Ga0065704_10228549
1124 Ga0065712_10069536
1125 Ga0065715_10093817
1126 Ga0068868_100921531
1127 Ga0070689_100659285
1128 Ga0070669_100000691
1129 Ga0070669_100641340
1130 Ga0070688_100240307
1131 Ga0070694_100304069
1132 Ga0070662_100032515
1133 Ga0070685_10506884
1134 Ga0070665_100036433
1135 Ga0070665_100367655
1136 Ga0068864_100050860
1137 Ga0068858_100123910
1138 Ga0068862_100790518
1139 Ga0075364_10068367
1140 Ga0075364_10133161
1141 Ga0075364_10147421
1142 Ga0075364_10282461
1143 Ga0075432_10000430
1144 Ga0075432_10006793
1145 Ga0075432_10023232
1146 Ga0075432_10042013
1147 Ga0075362_10132803
1148 Ga0075362_10325196
1149 Ga0075369_10135861
1150 Ga0075369_10140083
1151 Ga0075433_10076424
1152 Ga0075434_100000779
1153 Ga0075436_100003752
1154 Ga0075436_100107858
1155 Ga0075436_100224477
1156 Ga0079104_1000164
1157 Ga0079104_1001028
1158 Ga0079104_1038108
1159 Ga0099826_10036309
1160 Ga0075435_100004009
1161 Ga0105251_10000320
1162 Ga0105251_10005626
1163 Ga0105251_10007499
1164 Ga0105251_10012167
1165 Ga0105251_10024286
1166 Ga0105251_10038780
1167 Ga0105251_10043537
1168 Ga0105251_10056512
1169 Ga0105244_10004406
1170 Ga0105244_10020379
1171 Ga0105244_10020778
1172 Ga0105244_10023123
1173 Ga0105244_10026438
1174 Ga0105244_10033813
1175 Ga0105244_10038610
1176 Ga0105244_10042166
1177 Ga0105244_10057672
1178 Ga0105244_10079310
1179 Ga0105244_10149715
1180 Ga0105244_10153929
1181 Ga0105244_10156944
1182 Ga0105244_10330101
1183 Ga0105250_10000907
1184 Ga0105250_10002683
1185 Ga0105250_10002966
1186 Ga0105250_10030607
1187 Ga0105250_10036444
1188 Ga0105250_10037704
1189 Ga0105250_10040685
1190 Ga0105250_10051361
1191 Ga0105250_10119559
1192 Ga0105250_10259505
1193 Ga0111539_10033070
1194 Ga0105243_10000100
1195 Ga0105243_10000639
1196 Ga0105243_10009698
1197 Ga0105243_10145665
1198 Ga0105243_10612730
1199 Ga0105242_10434640
1200 Ga0105238_10553262
1201 Ga0105249_10039074
1202 Ga0105246_10025027
1203 Ga0105246_10093520
1204 Ga0105246_10352640
1205 Ga0157345_1000159
1206 Ga0157345_1000564
1207 Ga0157373_10002803
1208 Ga0157373_10007800
1209 Ga0157373_10013328
1210 Ga0157373_10201409
1211 Ga0157373_10313477
1212 Ga0157371_10001083
1213 Ga0157371_10004015
1214 Ga0157371_10004573
1215 Ga0157371_10357800
1216 Ga0157370_10000150
1217 Ga0157370_10016733
1218 Ga0157370_10026170
1219 Ga0157370_10087214
1220 Ga0157370_10122194
1221 Ga0157369_10014391
1222 Ga0157369_10016760
1223 Ga0157369_10689704
1224 Ga0163162_10000507
1225 Ga0163162_10809629
1226 Ga0157372_10070287
1227 Ga0157372_10216848
1228 Ga0157372_10654244
1229 Ga0157375_10607916
1230 Ga0157375_10979220
1231 Ga0157375_11614519
1232 Ga0182008_10001110
1233 Ga0182008_10002539
1234 Ga0182008_10022623
1235 Ga0182008_10159554
1236 Ga0182008_10189527
1237 Ga0157377_10541053
1238 Ga0182006_1001690
1239 Ga0182006_1003213
1240 Ga0182006_1003327
1241 Ga0182006_1007654
1242 Ga0182006_1050776
1243 Ga0182006_1129432
1244 Ga0182007_10001779
1245 Ga0182007_10064498
1246 Ga0182005_1002100
1247 Ga0182005_1006665
1248 Ga0182005_1011115
1249 Ga0182005_1014857
1250 Ga0163161_10006460
1251 Ga0163161_10015968
1252 Ga0163161_10022443
1253 Ga0163161_10307810
1254 Ga0163161_10518696
1255 Ga0209760_100031
1256 Ga0209760_100056
1257 Ga0209760_100139
1258 Ga0209563_101468
1259 Ga0207427_100016
1260 Ga0207427_100067
1261 Ga0209437_100011
1262 Ga0209437_100016
1263 Ga0209233_1000019
1264 Ga0209233_1000156
1265 Ga0209675_1003821
1266 Ga0209676_1000025
1267 Ga0209676_1000096
1268 Ga0209676_1000266
1269 Ga0209676_1000722
1270 Ga0209676_1002706
1271 Ga0209676_1003411
1272 Ga0209050_1000028
1273 Ga0209050_1000301
1274 Ga0209050_1000356
1275 Ga0209050_1001464
1276 Ga0209051_1000089
1277 Ga0209051_1000225
1278 Ga0209051_1000467
1279 Ga0209051_1025890
1280 Ga0209257_1000034
1281 Ga0209257_1002752
1282 Ga0207696_1000065
1283 Ga0207696_1000085
1284 Ga0207696_1000122
1285 Ga0207696_1000941
1286 Ga0207696_1002508
1287 Ga0207696_1007215
1288 Ga0207696_1019119
1289 Ga0207696_1052541
1290 Ga0207655_1000394
1291 Ga0207655_1002445
1292 Ga0207655_1004333
1293 Ga0207655_1006051
1294 Ga0207655_1008544
1295 Ga0207655_1020270
1296 Ga0207655_1024776
1297 Ga0207655_1038771
1298 Ga0207655_1076442
1299 Ga0207655_1089243
1300 Ga0207655_1093670
1301 Ga0207655_1172640
1302 Ga0207713_1000094
1303 Ga0207713_1002036
1304 Ga0207713_1004076
1305 Ga0207713_1004450
1306 Ga0207713_1005201
1307 Ga0207713_1005328
1308 Ga0207713_1006372
1309 Ga0207713_1008122
1310 Ga0207713_1008210
1311 Ga0207713_1012779
1312 Ga0207713_1028190
1313 Ga0207713_1031572
1314 Ga0207713_1080780
1315 Ga0207681_10000917
1316 Ga0207681_10621091
1317 Ga0207706_10006144
1318 Ga0207686_10009573
1319 Ga0207709_10000022
1320 Ga0207709_10000252
1321 Ga0207709_10008422
1322 Ga0207709_10043054
1323 Ga0207709_10612451
1324 Ga0207670_10570637
1325 Ga0207665_10215714
1326 Ga0207689_10489952
1327 Ga0207712_10093998
1328 Ga0207703_10335273
1329 Ga0207641_11171646
1330 Ga0207676_10101076
1331 Ga0207674_10421042
1332 Ga0209281_1000033
1333 Ga0209281_1000159
1334 Ga0209281_1006627
1335 Ga0209281_1024782
1336 Ga0209389_1000298
1337 Ga0209371_1002187
1338 Ga0209981_1006882
1339 Ga0207428_10067474
1340 Ga0207428_10101146
1341 Ga0207428_10144231
1342 Ga0207428_10166442
1343 Ga0207428_10179985
1344 Ga0268266_10006145
1345 Ga0268264_10229265
1346 Ga0307517_10131827
1347 Ga0307517_10371744
1348 Ga0268256_1001923
1349 Ga0314311_1080024
1350 Ga0316178_1013428
1351 Ga0316183_1055787
1352 Ga0265332_10000069
1353 Ga0265331_10063038
1354 Ga0265327_10000166
1355 Ga0307408_100000002
1356 Ga0307408_100005151
1357 Ga0307408_100174084
1358 Ga0307408_100363187
1359 Ga0307408_100540778
1360 Ga0307408_100595389
1361 Ga0307408_101296173
1362 Ga0307516_10050897
1363 Ga0307405_10006452
1364 Ga0307413_10458199
1365 Ga0307406_10726120
1366 Ga0307407_10155338
1367 Ga0307412_10012425
1368 Ga0307412_10345454
1369 Ga0307412_10359717
1370 Ga0307412_10386717
1371 Ga0307412_10640123
1372 Ga0307416_100708533
1373 Ga0307414_10050535
1374 Ga0307414_10330832
1375 Ga0307414_10478868
1376 Ga0307414_11057194
1377 Ga0307411_10346032
1378 Ga0307510_10019083
1379 Ga0373928_0015934
1380 Ga0373940_0026620
1381 Ga0373931_0078429
1382 Ga0373931_0220739
1383 Ga0237819_12707
1384 Ga0439436_0000458
1385 Ga0439438_000954
1386 Ga0439438_001498
1387 Ga0439438_002086
1388 Ga0439438_002651
1389 Ga0439438_003029
1390 Ga0439438_005181
1391 Ga0439438_012977
1392 Ga0439438_016750
1393 Ga0439438_025491
1394 Ga0439447_000310
1395 Ga0439447_000501
1396 Ga0439447_000663
1397 Ga0439447_001475
1398 Ga0439466_0000334
1399 Ga0439466_0000620
1400 Ga0439466_0000760
1401 Ga0439466_0001782
1402 Ga0439466_0016057
1403 Ga0439466_0016062
1404 Ga0439466_0018107
1405 Ga0439466_0037859
1406 Ga0439466_0098917
1407 Ga0439466_0139737
1408 Ga0439431_0008113
1409 Ga0439431_0167279
1410 Ga0439437_000115
1411 Ga0439432_001620
1412 Ga0439432_002572
1413 Ga0439432_030244
1414 Ga0439432_060316
1415 Ga0439432_062351
1416 Ga0439451_001646
1417 Ga0439451_005348
1418 Ga0439452_000570
1419 Ga0439452_000628
1420 Ga0439452_001241
1421 Ga0439452_001308
1422 Ga0439452_001398
1423 Ga0439452_002762
1424 Ga0439452_007140
1425 Ga0439452_009153
1426 Ga0439452_050851
1427 Ga0439454_041528
1428 Ga0439456_000115
1429 Ga0439456_001126
1430 Ga0439456_004058
1431 Ga0439456_004723
1432 Ga0439456_005418
1433 Ga0439456_012044
1434 Ga0439463_002768
1435 Ga0439463_044927
1436 Ga0450911_000006
1437 Ga0450911_000320
1438 Ga0450911_001728
1439 Ga0450919_002700
1440 Ga0450920_000248
1441 Ga0450922_005091
1442 Ga0450923_020079
1443 Ga0450923_020280
1444 Ga0450890_002225
1445 Ga0450902_000293
1446 Ga0450903_004291
1447 Ga0450903_004968
1448 Ga0450903_011263
1449 Ga0450904_000006
1450 Ga0450904_004966
1451 Ga0450905_006406
1452 Ga0450905_006408
1453 Ga0450905_027742
1454 Ga0450907_000201
1455 Ga0450907_014392
1456 Ga0450910_000798
1457 Ga0450910_001658
1458 Ga0439446_0000905
1459 Ga0439446_0001535
1460 Ga0439446_0013529
1461 Ga0450908_029334
1462 Ga0450909_000467
1463 Ga0450909_002351
1464 Ga0450909_003836
1465 Ga0439434_0000490
1466 Ga0439434_0000535
1467 Ga0439434_0040768
1468 Ga0439464_0000840
1469 Ga0439464_0002527
1470 Ga0439460_0000323
1471 Ga0439460_0009959
1472 Ga0439460_0013675
1473 Ga0450916_000103
1474 Ga0450918_030447
1475 Ga0450901_000364
1476 Ga0450901_005029
1477 Ga0439440_0002562
1478 Ga0439440_0005864
1479 Ga0439440_0007439
1480 Ga0466963_0278436
1481 Ga0466959_0305715
1482 Ga0451576_0404201
1483 Ga0451576_0519155
1484 Ga0451576_1008408
1485 Ga0451576_1042742
1486 Ga0495617_000668
1487 Ga0495617_025418
1488 Ga0495617_083022
1489 Ga0495617_097017
1490 Ga0495617_102326
1491 Ga0495627_001495
1492 Ga0495627_002107
1493 Ga0495627_002824
1494 Ga0495627_002904
1495 Ga0495627_006008
1496 Ga0495627_014321
1497 Ga0495592_0061075
1498 Ga0495603_0004020
1499 Ga0495603_0010701
1500 Ga0495590_0000657
1501 Ga0495590_0000861
1502 Ga0495590_0005018
1503 Ga0495590_0005991
1504 Ga0495591_001018
1505 Ga0495591_002638
1506 Ga0495591_003243
1507 Ga0495591_003488
1508 Ga0495591_003947
1509 Ga0495591_005377
1510 Ga0495591_034913
1511 Ga0495591_042080
1512 Ga0495638_0003250
1513 Ga0495638_0007939
1514 Ga0495638_0013231
1515 Ga0495638_0041352
1516 Ga0495638_0046070
1517 Ga0495638_0084701
1518 Ga0495638_0096838
1519 Ga0495638_0189369
1520 Ga0495653_0037770
1521 Ga0495653_0074615
1522 Ga0495653_0197759
1523 Ga0495650_0002040
1524 Ga0495650_0003893
1525 Ga0495650_0019901
1526 Ga0495650_0021187
1527 Ga0495650_0084602
1528 Ga0495582_0073431
1529 Ga0495605_0001491
1530 Ga0495605_0001568
1531 Ga0495605_0005079
1532 Ga0495605_0015409
1533 Ga0495605_0021295
1534 Ga0495605_0072459
1535 Ga0495639_0000459
1536 Ga0495639_0059801
1537 Ga0495584_0003293
1538 Ga0495584_0006584
1539 Ga0495584_0009654
1540 Ga0495584_0015210
1541 Ga0495584_0015852
1542 Ga0495584_0032600
1543 Ga0495584_0378959
1544 Ga0495585_0001600
1545 Ga0495585_0003756
1546 Ga0495585_0004425
1547 Ga0495585_0012821
1548 Ga0495585_0021387
1549 Ga0495585_0042304
1550 Ga0495585_0138747
1551 Ga0495585_0145104
1552 Ga0495594_0016430
1553 Ga0495596_0000810
1554 Ga0495596_0078628
1555 Ga0495607_0002501
1556 Ga0495607_0005610
1557 Ga0495607_0006757
1558 Ga0495607_0010753
1559 Ga0495607_0013661
1560 Ga0495607_0017489
1561 Ga0495607_0051336
1562 Ga0495607_0064907
1563 Ga0495583_0004611
1564 Ga0495583_0005527
1565 Ga0495606_0000613
1566 Ga0495606_0003599
1567 Ga0495606_0009739
1568 Ga0495606_0009990
1569 Ga0495606_0014067
1570 Ga0495606_0014214
1571 Ga0495606_0018106
1572 Ga0495606_0026817
1573 Ga0495606_0253278
1574 Ga0495610_0004876
1575 Ga0495610_0009061
1576 Ga0495610_0024811
1577 Ga0495610_0028656
1578 Ga0495610_0088869
1579 Ga0495610_0135665
1580 Ga0495616_0001743
1581 Ga0495616_0002218
1582 Ga0495616_0002439
1583 Ga0495616_0003301
1584 Ga0495616_0007195
1585 Ga0495616_0018775
1586 Ga0495616_0091464
1587 Ga0495616_0156050
1588 Ga0495620_0001683
1589 Ga0495620_0007508
1590 Ga0495620_0008596
1591 Ga0495620_0008957
1592 Ga0495620_0021811
1593 Ga0495620_0043970
1594 Ga0495620_0095358
1595 Ga0495620_0102536
1596 Ga0495628_0129876
1597 Ga0495630_0082181
1598 Ga0495631_0000110
1599 Ga0495631_0003550
1600 Ga0495631_0012696
1601 Ga0495631_0034690
1602 Ga0495632_0001736
1603 Ga0495632_0004067
1604 Ga0495632_0006881
1605 Ga0495632_0008448
1606 Ga0495632_0009156
1607 Ga0495632_0019359
1608 Ga0495632_0027411
1609 Ga0495632_0067705
1610 Ga0495632_0166526
1611 Ga0495632_0174411
1612 Ga0495632_0205749
1613 Ga0495632_0235075
1614 Ga0495637_0001645
1615 Ga0495637_0004763
1616 Ga0495637_0006267
1617 Ga0495637_0006296
1618 Ga0495637_0023311
1619 Ga0495637_0059827
1620 Ga0495637_0076171
1621 Ga0495637_0102271
1622 Ga0495643_0000585
1623 Ga0495643_0002726
1624 Ga0495643_0009165
1625 Ga0495643_0013916
1626 Ga0495643_0020785
1627 Ga0495643_0041612
1628 Ga0495643_0059553
1629 Ga0495643_0072191
1630 Ga0495643_0081585
1631 Ga0495643_0088947
1632 Ga0495643_0260537
1633 Ga0495644_0001407
1634 Ga0495644_0026865
1635 Ga0495644_0071001
1636 Ga0495648_0001916
1637 Ga0495648_0005960
1638 Ga0495648_0007582
1639 Ga0495648_0008479
1640 Ga0495648_0008597
1641 Ga0495648_0023677
1642 Ga0495648_0036713
1643 Ga0495648_0058186
1644 Ga0495648_0145493
1645 Ga0495648_0176131
1646 Ga0495648_0194474
1647 Ga0495648_0213590
1648 Ga0495666_0085078
1649 Ga0495666_0108392
1650 Ga0495642_0000361
1651 Ga0495642_0001257
1652 Ga0495654_0003070
1653 Ga0495654_0004441
1654 Ga0495654_0006568
1655 Ga0495654_0009334
1656 Ga0495654_0013702
1657 Ga0495654_0015758
1658 Ga0495654_0052797
1659 Ga0495654_0058010
1660 Ga0495654_0085762
1661 Ga0495654_0096665
1662 Ga0495654_0186528
1663 Ga0495586_0003278
1664 Ga0495587_0003724
1665 Ga0495609_0001849
1666 Ga0495609_0008959
1667 Ga0495609_0055824
1668 Ga0495609_0117183
1669 Ga0495609_0122411
1670 Ga0495597_0004275
1671 Ga0495597_0007955
1672 Ga0495597_0013099
1673 Ga0495597_0033000
1674 Ga0495597_0042324
1675 Ga0495597_0133005
1676 Ga0495597_0245075
1677 Ga0495622_0000577
1678 Ga0495622_0001471
1679 Ga0495622_0002243
1680 Ga0495622_0027898
1681 Ga0495622_0088702
1682 Ga0495633_0005304
1683 Ga0495633_0007007
1684 Ga0495633_0122898
1685 Ga0495656_0027017
1686 Ga0495656_0425093
1687 Ga0495668_0001865
1688 Ga0495668_0012565
1689 Ga0495668_0012589
1690 Ga0495634_0001928
1691 Ga0495611_0001980
1692 Ga0495611_0097198
1693 Ga0495625_0005099
1694 Ga0495625_0007226
1695 Ga0495625_0044114
1696 Ga0495625_0051234
1697 Ga0495625_0074631
1698 Ga0495625_0083435
1699 Ga0495625_0089501
1700 Ga0495625_0261919
1701 Ga0495659_0001180
1702 Ga0495661_0002985
1703 Ga0495661_0022020
1704 Ga0495661_0038947
1705 Ga0495661_0068627
1706 Ga0495661_0124116
1707 Ga0495661_0169089
1708 Ga0495661_0205269
1709 Ga0495661_0299483
1710 Ga0495623_0002535
1711 Ga0495646_0008586
1712 Ga0495646_0072841
1713 Ga0495669_0024336
1714 Ga0495613_0454496
1715 Ga0495624_0003400
1716 Ga0495670_0002414
1717 Ga0495670_0004092
1718 Ga0495670_0005057
1719 Ga0495670_0007462
1720 Ga0495670_0217870
1721 Ga0495671_0000943
1722 Ga0495671_0002975
1723 Ga0495671_0003620
1724 Ga0495671_0011268
1725 Ga0495671_0015392
1726 Ga0495671_0023399
1727 Ga0495671_0025739
1728 Ga0495671_0048226
1729 Ga0495671_0134268
1730 Ga0495671_0158726
1731 Ga0495671_0164313
1732 Ga0495649_0002770
1733 Ga0495649_0003922
1734 Ga0495649_0005421
1735 Ga0495649_0005797
1736 Ga0495649_0011662
1737 Ga0495649_0014694
1738 Ga0495649_0018225
1739 Ga0495649_0044591
1740 Ga0495649_0048069
1741 Ga0495649_0051525
1742 Ga0495649_0061987
1743 Ga0495649_0242532
1744 Ga0495649_0332084
1745 Ga0495589_0000961
1746 Ga0495589_0003344
1747 Ga0495589_0007493
1748 Ga0495589_0008105
1749 Ga0495589_0012571
1750 Ga0495589_0013470
1751 Ga0495589_0020948
1752 Ga0495589_0186623
1753 Ga0495600_0045725
1754 Ga0495660_0003064
1755 Ga0495660_0005058
1756 Ga0495660_0011565
1757 Ga0495660_0017700
1758 Ga0495660_0019909
1759 Ga0495660_0051192
1760 Ga0495660_0057198
1761 Ga0495660_0070591
1762 Ga0495660_0116040
1763 Ga0495604_0015251
1764 Ga0495604_0053180
1765 Ga0495604_0070234
1766 Ga0495604_0435473
1767 Ga0495636_0004968
1768 Ga0495636_0010098
1769 Ga0495674_0014222
1770 Ga0495672_0002687
1771 Ga0495672_0005742
1772 Ga0495672_0005781
1773 Ga0495672_0007067
1774 Ga0495672_0026348
1775 Ga0495672_0036401
1776 Ga0495672_0052005
1777 Ga0495672_0080212
1778 Ga0495672_0098275
1779 Ga0495676_0026237
1780 Ga0495680_0031314
1781 Ga0495680_0039032
1782 Ga0495680_0099451
1783 Ga0495680_0235056
1784 Ga0495683_0002172
1785 Ga0495683_0003296
1786 Ga0495683_0035595
1787 Ga0495683_0077593
1788 Ga0495683_0173493
1789 Ga0495687_004739
1790 Ga0495687_006813
1791 Ga0495687_099346
1792 Ga0495687_112356
1793 Ga0495675_0052871
1794 Ga0495677_0002688
1795 Ga0495679_003285
1796 Ga0495679_004017
1797 Ga0495679_030734
1798 Ga0495685_071350
1799 Ga0495673_0000935
1800 Ga0495673_0002710
1801 Ga0495673_0002867
1802 Ga0495673_0003838
1803 Ga0495673_0005439
1804 Ga0495673_0007537
1805 Ga0495673_0015486
1806 Ga0495673_0017402
1807 Ga0495673_0094650
1808 Ga0495673_0098333
1809 Ga0495681_0002418
1810 Ga0495681_0003202
1811 Ga0495681_0003508
1812 Ga0495681_0003692
1813 Ga0495681_0003721
1814 Ga0495681_0004082
1815 Ga0495681_0008432
1816 Ga0495681_0010741
1817 Ga0495681_0011238
1818 Ga0495681_0024579
1819 Ga0495681_0029000
1820 Ga0495684_0456709
1821 Ga0495686_0008077
1822 Ga0495686_0037949
1823 Ga0495686_0039456
1824 Ga0495686_0103541
1825 Ga0495686_0192103
1826 Ga0495686_0195468
1827 Ga0495593_0006784
1828 Ga0495593_0008472
1829 Ga0495593_0025981
1830 Ga0495602_0013623
1831 Ga0495626_0001629
1832 Ga0495626_0001739
1833 Ga0495626_0004676
1834 Ga0495626_0005055
1835 Ga0495626_0008827
1836 Ga0495626_0014326
1837 Ga0495626_0044054
1838 Ga0495626_0056819
1839 Ga0495626_0106098
1840 Ga0496102_0001561
1841 Ga0496103_0008656
1842 Ga0496104_0014763
1843 Ga0496104_0044426
1844 Ga0496106_0176455
1845 Ga0496106_0560397
1846 Ga0496107_0299512
1847 Ga0496107_0302854
1848 Ga0496108_0001080
1849 Ga0496108_0029167
1850 Ga0496109_0003793
1851 Ga0496109_0107600
1852 Ga0496110_0312048
1853 Ga0496111_0053151
1854 Ga0496111_0420772
1855 Ga0496112_0004358
1856 Ga0496112_0013335
1857 Ga0496112_0081616
1858 Ga0496113_0000556
1859 Ga0496113_0001353
1860 Ga0496116_0000234
1861 Ga0496116_0000960
1862 Ga0496116_0002607
1863 Ga0496116_0012873
1864 Ga0496116_0016057
1865 Ga0496116_0082989
1866 Ga0496117_0001930
1867 Ga0496117_0004181
1868 Ga0496117_0006118
1869 Ga0496117_0011127
1870 Ga0496117_0015032
1871 Ga0496117_0015867
1872 Ga0496118_0004537
1873 Ga0496118_0010603
1874 Ga0496118_0018405
1875 Ga0496118_0029366
1876 Ga0496118_0117643
1877 Ga0496119_0021643
1878 Ga0496119_0165321
1879 Ga0496120_0004433
1880 Ga0496121_0000346
1881 Ga0496121_0031595
1882 Ga0496121_0077102
1883 Ga0496121_0131702
1884 Ga0496122_0007280
1885 Ga0496122_0008343
1886 Ga0496122_0025979
1887 Ga0496122_0143958
1888 Ga0496122_0230870
1889 Ga0496122_0335079
1890 Ga0496123_0014130
1891 Ga0496123_0063332
1892 Ga0496123_0081030
1893 Ga0496123_0081997
1894 Ga0496123_0118784
1895 Ga0496123_0303290
1896 Ga0496123_0332063
1897 Ga0496124_0000151
1898 Ga0496124_0004227
1899 Ga0496124_0006364
1900 Ga0496124_0013516
1901 Ga0496124_0017790
1902 Ga0496124_0026034
1903 Ga0496124_0038026
1904 Ga0496124_0041851
1905 Ga0496124_0048295
1906 Ga0496124_0107451
1907 Ga0496124_0201190
1908 Ga0496124_0269090
1909 Ga0496124_0442663
1910 Ga0496125_0006506
1911 Ga0496125_0007308
1912 Ga0496125_0008984
1913 Ga0496125_0015094
1914 Ga0496125_0119152
1915 Ga0496125_0218506
1916 Ga0496126_0015959
1917 Ga0496126_0020765
1918 Ga0496126_0482943
1919 Ga0495678_000328
1920 Ga0495678_001561
1921 Ga0495678_007885
1922 Ga0495678_010925
1923 Ga0495678_024761
1924 Ga0495678_035275
1925 Ga0495678_065470
1926 Ga0495678_078622
1927 Ga0495678_159371
1928 Ga0495682_0033185
1929 Ga0495682_0118371
1930 Ga0501032_0012424
1931 Ga0501034_0059481
1932 Ga0501034_0111107
1933 Ga0501036_1062014
1934 Ga0501037_0414262
1935 Ga0501039_0179010
1936 Ga0501241_000445
1937 Ga0501035_0136461
1938 Ga0501226_000004
1939 Ga0501226_002197
1940 nmdc:mga08y16_38962_c1
1941 nmdc:mga0n895_15523_c1
1942 nmdc:mga0rr50_357181_c1
1943 nmdc:mga08x19_1280_c1
1944 nmdc:mga0a205_2190_c1
1945 nmdc:mga0sz30_80283_c1
1946 Ga0500572_001243
1947 Ga0500595_003668
1948 Ga0500616_0000885
1949 2883578382
1950 2510284235
1951 2510293081
1952 2510312582
1953 2511256186
1954 2511263411
1955 2511272280
1956 2511279331
1957 2511287559
1958 2511297464
1959 2511300954
1960 2511311571
1961 2511322632
1962 2511326405
1963 2511330882
1964 2511341471
1965 2511346513
1966 2511349225
1967 2511361485
1968 2511367173
1969 2511377662
1970 2511414412
1971 2511822572
1972 2512326066
1973 2548846535
1974 2555247476
1975 2555667539
1976 2583789696
1977 2597855768
1978 2599356760
1979 2599363210
1980 2599369838
1981 2599376319
1982 2599381865
1983 2599387991
1984 2599395483
1985 2599407248
1986 2599463593
1987 2599469059
1988 2599485670
1989 2599492612
1990 2599499991
1991 2599616704
1992 2599769532
1993 2599806800
1994 2599886953
1995 2599898282
1996 2599931013
1997 2599944606
1998 2599956051
1999 2599961224
2000 2599964669
2001 2599977399
2002 2599983182
2003 2599991115
2004 2599997768
2005 2600001013
2006 2600007062
2007 2600011568
2008 2600019200
2009 2600026424
2010 2600031984
2011 2600036832
2012 2600043272
2013 2600048186
2014 2600055792
2015 2600061177
2016 2600068421
2017 2600072457
2018 2600078427
2019 2600216222
2020 2600360263
2021 2600364770
2022 2600443782
2023 2601776389
2024 2601797953
2025 2602008762
2026 2606076564
2027 2606129022
2028 2608380735
2029 2624478339
2030 2624489886
2031 2643841105
2032 2643954785
2033 2644000440
2034 2644024425
2035 2644084782
2036 2644190118
2037 2644281383
2038 2644342334
2039 2644365634
2040 2652547082
2041 2671090679
2042 2671099852
2043 2671129219
2044 2671695637
2045 2671772451
2046 2678261112
2047 2715749329
2048 2715755595
2049 2718632281
2050 2729146024
2051 2739200577
2052 2739259945
2053 2739288626
2054 2739293938
2055 2739311407
2056 2743735187
2057 2745006423
2058 2765581720
2059 2774119434
2060 2774131450
2061 2774134854
2062 2784260926
2063 2784316357
2064 2794594149
2065 2807454700
2066 2808856225
2067 2808906719
2068 2808922623
2069 2808932661
2070 2808936269
2071 2808940148
2072 2808944310
2073 2808954782
2074 2808955989
2075 2808965622
2076 2808999618
2077 2809218095
2078 2812370334
2079 2819657348
2080 2819705332
2081 2823425369
2082 2825654146
2083 2842807146
2084 2842834285
2085 2842846238
2086 2842859961
2087 2844668013
2088 2852660332
2089 2860343521
2090 2878030284
2091 2880231232
2092 2904519688
2093 2904553921
2094 2912964296
2095 2913037404
2096 2917071290
2097 2917836290
2098 2919066031
2099 2919127588
2100 2919389648
2101 2919460104
2102 2919486547
2103 2919488576
2104 2919502112
2105 2919698836
2106 2923154183
2107 2923524422
2108 2923591638
2109 2926063785
2110 2929144936
2111 2931371727
2112 2931398962
2113 2935359118
2114 2939641224
2115 2939655903
2116 2945967706
2117 2969305080
2118 2974293226
2119 2974301652
2120 2984291875
2121 2984500774
2122 2984507311
2123 2988732327
2124 2990198675
2125 2998140590
2126 3007399738
2127 3007518036
2128 3007614976
2129 3007622279
2130 3007720383
2131 3007808894
2132 3007859817
2133 3007864204
2134 3007870824
2135 3007872887
2136 637317934
2137 640487056
2138 651174929
2139 8011352773
2140 8015688433
2141 8016730582
2142 8019770414
2143 8019777460
2144 8030000150
2145 8034963359
2146 8052495160
2147 8054930813
2148 8055771533
2149 8056116843
2150 8056125358
2151 8056126588
2152 8056143868
2153 8056158631
2154 8056170461
2155 8056176591
2156 8056182923
2157 8056573413
2158 8057802817

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

42

172

0.98

PF18306

LDcluster4

SLOG cluster4 family

2

118

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zbk-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp 0.9897 2 182
5zbj-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 0.9799 2 185
5zbk-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp 0.9789 2 182
5zbl-assembly2.cif.gz_D crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.9753 2 182
5zbl-assembly2.cif.gz_C crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.9752 2 182
ID Description Score Start End Superfamily
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.971 4 185 3.40.50.450
af_A0A1D6K2U3_1_187_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9513 3 178 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9456 4 185 3.40.50.450
5zblB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9455 1 189 3.40.50.450
3sbxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9436 4 180 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A7V8VYP7-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9851 2 176 GO:0005829
GO:0009691
GO:0016799
AF-A0A7U8GRU3-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.984 4 184 GO:0005829
GO:0009691
GO:0016799
AF-A0A7Z0LKD0-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.983 4 178 GO:0005829
GO:0009691
GO:0016799
AF-A0A084IPJ1-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9829 4 179 GO:0005829
GO:0008714
GO:0009691
AF-A0A7J5F5Z5-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9824 4 178 GO:0005829
GO:0009691
GO:0016799

Map