F489658
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1079 | 615 | 2158 | 327 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8019648815|8019649372 |
| Length | 358 |
| Sequence | ELSRSVQRWCPGATGVTGAAKLSGGASQETWCFDITHPDGPIGAILRRSPKGYGAAPTRAAGLAAEAQLMQLAYEAGVPSPRVMHVLTPDEDLGTGFIMQRVEGETIARKILRDDEFAAARPLLARQIGGVLAGLHRLPQDKLPELRSRNATQEISEFDRDYRSLNWPKPVFELALRWLRDHDPGPSDETTLVHGDFRNGNLIIGADGVRAVLDWELAHLGDPMEDLGWVCVNSWRFGEIDKPVGGFGSREELFAGYEAAGRKIDPSRVKFWEVMGTLRWGIMCGGMMQRFREGPDHSMERAMIGRRASETEIDLLCGCSRRGEVRHAGRTDTDRADQGGRRFPPQRHHAADLRPPGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 64 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 93 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 94 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 95 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 96 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 186 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 187 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 188 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 221 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 345 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 352 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 355 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 356 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 357 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 359 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 360 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 363 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 364 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 365 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 367 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 369 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 370 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 374 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 375 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 377 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 379 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 380 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 381 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 382 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 386 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 387 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 388 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 389 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 390 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 391 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 392 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 393 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 394 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 395 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 396 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 397 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 398 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 399 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 400 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 401 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 402 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 403 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 404 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 405 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 406 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 407 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 408 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 409 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 410 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 411 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 412 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 413 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 414 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 415 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 416 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 417 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 418 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 419 | 2791355199 | |||
| 420 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 421 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 422 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 423 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 424 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 425 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 426 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 427 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 428 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 429 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 430 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 431 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 432 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 433 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 434 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 435 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 436 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 437 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 438 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 439 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 440 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 441 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 442 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 443 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 444 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 445 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 446 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 447 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 448 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 449 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 450 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 451 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 452 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 453 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 454 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 455 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 456 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 457 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 458 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 459 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 460 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 461 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 462 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 463 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 464 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 465 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 466 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 467 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 468 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 469 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 470 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 471 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 472 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 473 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 474 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 475 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 476 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 477 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 478 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 479 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 480 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 481 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 482 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 483 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 484 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 485 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 486 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 487 | 2904699407 | |||
| 488 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 489 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 490 | 2906610324 | |||
| 491 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 492 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 493 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 494 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 495 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 496 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 497 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 498 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 499 | 2922368715 | |||
| 500 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 501 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 502 | 2922425934 | |||
| 503 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 504 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 505 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 506 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 507 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 508 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 509 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 510 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 511 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 512 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 513 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 514 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 515 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 516 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 517 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 518 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 519 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 520 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 521 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 522 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 523 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 524 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 525 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 526 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 527 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 528 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 529 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 530 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 531 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 532 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 533 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 534 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 535 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 536 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 537 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 538 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 539 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 540 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 541 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 542 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 543 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 544 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 545 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 546 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 547 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 548 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 549 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 550 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 551 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 552 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 553 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 554 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 555 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 556 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 557 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 558 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 559 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 560 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 561 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 562 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 563 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 564 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 565 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 566 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 567 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 568 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 569 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 570 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 571 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 572 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 573 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 574 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 575 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 576 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 577 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 578 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 579 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 580 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 581 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 582 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 583 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 584 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 585 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 586 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 587 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 588 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 589 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 590 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 591 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 592 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 593 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 594 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 595 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 596 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 597 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 598 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 599 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 600 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 601 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 602 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 603 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 604 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 605 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 606 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 607 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 608 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 609 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 610 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 611 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 612 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 613 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 614 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 615 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.86 |
| Metatranscriptomes | 0.09 |
| Isolates | 21.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.34 |
| Nodule | 16.96 |
| Rhizoplane | 6.21 |
| Rhizosphere | 57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C1662 | 2010549000 | Bacteria | 1244 |
| 2 | JGI25406J46586_10000202 | 3300003203 | Bacteria | 26430 |
| 3 | JGI25406J46586_10006725 | 3300003203 | Bacteria | 5283 |
| 4 | JGI25153J46596_10000656 | 3300003215 | Bacteria | 21151 |
| 5 | JGI25153J46596_10005271 | 3300003215 | Bacteria | 6797 |
| 6 | JGI25153J46596_10006410 | 3300003215 | Bacteria | 5956 |
| 7 | JGI25160J50197_1012923 | 3300003354 | Bacteria | 2870 |
| 8 | JGI25404J52841_10006565 | 3300003659 | Bacteria | 2441 |
| 9 | JGI25404J52841_10024028 | 3300003659 | Bacteria | 1314 |
| 10 | Ga0055539_1006447 | 3300003752 | Bacteria | 1499 |
| 11 | Ga0065165_1000926 | 3300005262 | Bacteria | 37690 |
| 12 | Ga0065165_1001447 | 3300005262 | Bacteria | 25731 |
| 13 | Ga0065715_10288260 | 3300005293 | Bacteria | 1069 |
| 14 | Ga0070658_10142763 | 3300005327 | Bacteria | 2001 |
| 15 | Ga0070683_100050018 | 3300005329 | Bacteria | 3867 |
| 16 | Ga0070683_100092275 | 3300005329 | Bacteria | 2844 |
| 17 | Ga0070683_100172892 | 3300005329 | Bacteria | 2051 |
| 18 | Ga0070680_100007389 | 3300005336 | Bacteria | 8386 |
| 19 | Ga0070680_100205070 | 3300005336 | Bacteria | 1663 |
| 20 | Ga0070660_100350511 | 3300005339 | Bacteria | 1216 |
| 21 | Ga0070661_100057205 | 3300005344 | Bacteria | 2858 |
| 22 | Ga0070668_100058827 | 3300005347 | Bacteria | 2974 |
| 23 | Ga0070668_100226390 | 3300005347 | Bacteria | 1544 |
| 24 | Ga0070669_100046134 | 3300005353 | Bacteria | 3177 |
| 25 | Ga0070671_100003878 | 3300005355 | Bacteria | 11754 |
| 26 | Ga0070674_100116870 | 3300005356 | Bacteria | 1968 |
| 27 | Ga0070673_100003986 | 3300005364 | Bacteria | 9291 |
| 28 | Ga0070688_100010670 | 3300005365 | Bacteria | 5073 |
| 29 | Ga0070709_10015754 | 3300005434 | Bacteria | 4305 |
| 30 | Ga0070709_10016067 | 3300005434 | Bacteria | 4266 |
| 31 | Ga0070709_10070318 | 3300005434 | Bacteria | 2255 |
| 32 | Ga0070709_10125683 | 3300005434 | Bacteria | 1744 |
| 33 | Ga0070714_100044060 | 3300005435 | Bacteria | 3776 |
| 34 | Ga0070714_100063197 | 3300005435 | Bacteria | 3183 |
| 35 | Ga0070714_100080070 | 3300005435 | Bacteria | 2842 |
| 36 | Ga0070713_100001443 | 3300005436 | Bacteria | 15239 |
| 37 | Ga0070713_100002226 | 3300005436 | Bacteria | 12577 |
| 38 | Ga0070713_100007690 | 3300005436 | Bacteria | 7584 |
| 39 | Ga0070713_100202384 | 3300005436 | Bacteria | 1794 |
| 40 | Ga0070710_10003994 | 3300005437 | Bacteria | 6994 |
| 41 | Ga0070710_10017245 | 3300005437 | Bacteria | 3691 |
| 42 | Ga0070710_10022746 | 3300005437 | Bacteria | 3284 |
| 43 | Ga0070701_10039619 | 3300005438 | Bacteria | 2391 |
| 44 | Ga0070711_100005992 | 3300005439 | Bacteria | 7297 |
| 45 | Ga0070711_100064294 | 3300005439 | Bacteria | 2563 |
| 46 | Ga0070711_100084168 | 3300005439 | Bacteria | 2275 |
| 47 | Ga0070711_100167189 | 3300005439 | Bacteria | 1673 |
| 48 | Ga0070663_100045576 | 3300005455 | Bacteria | 3098 |
| 49 | Ga0070663_100067261 | 3300005455 | Bacteria | 2598 |
| 50 | Ga0070663_100163655 | 3300005455 | Bacteria | 1714 |
| 51 | Ga0070663_100369269 | 3300005455 | Bacteria | 1166 |
| 52 | Ga0070678_100013689 | 3300005456 | Bacteria | 5097 |
| 53 | Ga0070678_100015766 | 3300005456 | Bacteria | 4813 |
| 54 | Ga0070678_100080228 | 3300005456 | Bacteria | 2470 |
| 55 | Ga0070678_100081184 | 3300005456 | Bacteria | 2457 |
| 56 | Ga0070678_100144901 | 3300005456 | Bacteria | 1905 |
| 57 | Ga0070678_100171511 | 3300005456 | Bacteria | 1767 |
| 58 | Ga0070681_10013908 | 3300005458 | Bacteria | 8008 |
| 59 | Ga0070681_10106713 | 3300005458 | Bacteria | 2742 |
| 60 | Ga0070681_10138999 | 3300005458 | Bacteria | 2359 |
| 61 | Ga0070681_10292834 | 3300005458 | Bacteria | 1538 |
| 62 | Ga0070681_10346582 | 3300005458 | Bacteria | 1396 |
| 63 | Ga0070707_100095241 | 3300005468 | Bacteria | 2883 |
| 64 | Ga0070698_100196336 | 3300005471 | Bacteria | 1955 |
| 65 | Ga0070679_100085294 | 3300005530 | Bacteria | 3145 |
| 66 | Ga0070679_100139562 | 3300005530 | Bacteria | 2404 |
| 67 | Ga0070679_100193859 | 3300005530 | Bacteria | 2000 |
| 68 | Ga0070684_100016541 | 3300005535 | Bacteria | 6030 |
| 69 | Ga0070684_100115656 | 3300005535 | Bacteria | 2409 |
| 70 | Ga0070697_100138279 | 3300005536 | Bacteria | 2047 |
| 71 | Ga0070697_100250047 | 3300005536 | Bacteria | 1516 |
| 72 | Ga0068853_100046546 | 3300005539 | Bacteria | 3720 |
| 73 | Ga0068853_100055730 | 3300005539 | Bacteria | 3407 |
| 74 | Ga0068853_100083735 | 3300005539 | Bacteria | 2795 |
| 75 | Ga0068853_100162127 | 3300005539 | Bacteria | 2019 |
| 76 | Ga0068853_100180025 | 3300005539 | Bacteria | 1917 |
| 77 | Ga0070672_100033812 | 3300005543 | Bacteria | 3875 |
| 78 | Ga0070693_100125260 | 3300005547 | Bacteria | 1599 |
| 79 | Ga0070665_100038548 | 3300005548 | Bacteria | 4804 |
| 80 | Ga0070665_100059464 | 3300005548 | Bacteria | 3831 |
| 81 | Ga0070665_100111668 | 3300005548 | Bacteria | 2736 |
| 82 | Ga0070665_100159559 | 3300005548 | Bacteria | 2257 |
| 83 | Ga0070665_100230192 | 3300005548 | Bacteria | 1853 |
| 84 | Ga0070665_100252717 | 3300005548 | Bacteria | 1763 |
| 85 | Ga0070665_100443474 | 3300005548 | Bacteria | 1307 |
| 86 | Ga0070665_100446056 | 3300005548 | Bacteria | 1303 |
| 87 | Ga0068855_100031944 | 3300005563 | Bacteria | 6285 |
| 88 | Ga0068855_100091476 | 3300005563 | Bacteria | 3509 |
| 89 | Ga0068855_100128442 | 3300005563 | Bacteria | 2896 |
| 90 | Ga0068855_100218316 | 3300005563 | Bacteria | 2139 |
| 91 | Ga0068855_100232775 | 3300005563 | Bacteria | 2062 |
| 92 | Ga0068855_100467869 | 3300005563 | Bacteria | 1374 |
| 93 | Ga0068857_100105694 | 3300005577 | Bacteria | 2528 |
| 94 | Ga0068857_100152274 | 3300005577 | Bacteria | 2096 |
| 95 | Ga0068857_100235326 | 3300005577 | Bacteria | 1676 |
| 96 | Ga0068854_100047530 | 3300005578 | Bacteria | 3059 |
| 97 | Ga0068854_100208899 | 3300005578 | Bacteria | 1539 |
| 98 | Ga0068852_100008038 | 3300005616 | Bacteria | 7738 |
| 99 | Ga0068859_100057641 | 3300005617 | Bacteria | 3912 |
| 100 | Ga0068859_100255810 | 3300005617 | Bacteria | 1842 |
| 101 | Ga0068864_100161963 | 3300005618 | Bacteria | 2034 |
| 102 | Ga0068866_10035166 | 3300005718 | Bacteria | 2445 |
| 103 | Ga0068866_10046557 | 3300005718 | Bacteria | 2182 |
| 104 | Ga0068861_100113676 | 3300005719 | Bacteria | 2172 |
| 105 | Ga0068861_100435358 | 3300005719 | Bacteria | 1171 |
| 106 | Ga0068858_100128143 | 3300005842 | Bacteria | 2378 |
| 107 | Ga0068860_100000081 | 3300005843 | Bacteria | 170066 |
| 108 | Ga0068862_100024472 | 3300005844 | Bacteria | 5066 |
| 109 | Ga0081455_10008418 | 3300005937 | Bacteria | 10729 |
| 110 | Ga0081455_10029336 | 3300005937 | Bacteria | 5016 |
| 111 | Ga0081455_10125796 | 3300005937 | Bacteria | 2012 |
| 112 | Ga0081540_1001682 | 3300005983 | Bacteria | 18799 |
| 113 | Ga0081540_1003361 | 3300005983 | Bacteria | 12678 |
| 114 | Ga0081540_1013327 | 3300005983 | Bacteria | 5351 |
| 115 | Ga0081540_1015125 | 3300005983 | Bacteria | 4897 |
| 116 | Ga0081540_1019809 | 3300005983 | Bacteria | 4073 |
| 117 | Ga0081540_1030166 | 3300005983 | Bacteria | 3008 |
| 118 | Ga0081540_1031210 | 3300005983 | Bacteria | 2934 |
| 119 | Ga0081540_1035542 | 3300005983 | Bacteria | 2670 |
| 120 | Ga0081540_1035686 | 3300005983 | Bacteria | 2663 |
| 121 | Ga0081540_1069505 | 3300005983 | Bacteria | 1636 |
| 122 | Ga0081540_1092560 | 3300005983 | Bacteria | 1326 |
| 123 | Ga0081539_10000768 | 3300005985 | Bacteria | 63055 |
| 124 | Ga0081539_10001470 | 3300005985 | Bacteria | 39952 |
| 125 | Ga0081539_10148442 | 3300005985 | Bacteria | 1131 |
| 126 | Ga0070717_10002220 | 3300006028 | Bacteria | 13629 |
| 127 | Ga0070717_10027436 | 3300006028 | Bacteria | 4552 |
| 128 | Ga0070717_10396747 | 3300006028 | Bacteria | 1239 |
| 129 | Ga0075365_10008851 | 3300006038 | Bacteria | 5745 |
| 130 | Ga0070712_100023933 | 3300006175 | Bacteria | 4040 |
| 131 | Ga0070712_100365819 | 3300006175 | Bacteria | 1184 |
| 132 | Ga0075367_10101986 | 3300006178 | Bacteria | 1755 |
| 133 | Ga0075369_10034323 | 3300006186 | Bacteria | 2152 |
| 134 | Ga0075369_10037242 | 3300006186 | Bacteria | 2071 |
| 135 | Ga0075369_10124082 | 3300006186 | Bacteria | 1170 |
| 136 | Ga0075366_10054711 | 3300006195 | Bacteria | 2370 |
| 137 | Ga0097621_100025839 | 3300006237 | Bacteria | 4599 |
| 138 | Ga0075370_10186455 | 3300006353 | Bacteria | 1221 |
| 139 | Ga0075434_100176723 | 3300006871 | Bacteria | 2155 |
| 140 | Ga0075434_100465547 | 3300006871 | Bacteria | 1285 |
| 141 | Ga0068865_100121416 | 3300006881 | Bacteria | 1943 |
| 142 | Ga0097620_100057642 | 3300006931 | Bacteria | 3912 |
| 143 | Ga0097620_100255803 | 3300006931 | Bacteria | 1842 |
| 144 | Ga0099824_1016570 | 3300006942 | Bacteria | 6643 |
| 145 | Ga0099824_1020870 | 3300006942 | Bacteria | 4701 |
| 146 | Ga0099822_1009095 | 3300006943 | Bacteria | 12590 |
| 147 | Ga0099794_10051835 | 3300007265 | Bacteria | 1977 |
| 148 | Ga0105240_10007310 | 3300009093 | Bacteria | 16070 |
| 149 | Ga0105240_10034676 | 3300009093 | Bacteria | 6507 |
| 150 | Ga0105240_10364428 | 3300009093 | Bacteria | 1636 |
| 151 | Ga0105240_10397933 | 3300009093 | Bacteria | 1552 |
| 152 | Ga0105240_10403439 | 3300009093 | Bacteria | 1539 |
| 153 | Ga0111539_10088037 | 3300009094 | Bacteria | 3648 |
| 154 | Ga0105245_10069475 | 3300009098 | Bacteria | 3194 |
| 155 | Ga0105245_10193858 | 3300009098 | Bacteria | 1948 |
| 156 | Ga0105247_10213455 | 3300009101 | Bacteria | 1303 |
| 157 | Ga0105243_10265591 | 3300009148 | Bacteria | 1539 |
| 158 | Ga0105241_10032018 | 3300009174 | Bacteria | 3938 |
| 159 | Ga0105241_10103601 | 3300009174 | Bacteria | 2266 |
| 160 | Ga0105241_10181436 | 3300009174 | Bacteria | 1747 |
| 161 | Ga0105241_10285971 | 3300009174 | Bacteria | 1410 |
| 162 | Ga0105248_10137251 | 3300009177 | Bacteria | 2759 |
| 163 | Ga0105237_10065725 | 3300009545 | Bacteria | 3622 |
| 164 | Ga0105237_10084021 | 3300009545 | Bacteria | 3174 |
| 165 | Ga0105237_10092782 | 3300009545 | Bacteria | 3009 |
| 166 | Ga0105237_10372534 | 3300009545 | Bacteria | 1433 |
| 167 | Ga0105238_10053335 | 3300009551 | Bacteria | 4063 |
| 168 | Ga0105238_10100152 | 3300009551 | Bacteria | 2881 |
| 169 | Ga0105238_10173286 | 3300009551 | Bacteria | 2134 |
| 170 | Ga0105238_10273591 | 3300009551 | Bacteria | 1669 |
| 171 | Ga0105249_10130613 | 3300009553 | Bacteria | 2398 |
| 172 | Ga0105249_10567893 | 3300009553 | Bacteria | 1186 |
| 173 | Ga0099796_10037812 | 3300010159 | Bacteria | 1616 |
| 174 | Ga0105239_10041049 | 3300010375 | Bacteria | 5071 |
| 175 | Ga0105239_10081303 | 3300010375 | Bacteria | 3566 |
| 176 | Ga0105239_10083629 | 3300010375 | Bacteria | 3515 |
| 177 | Ga0105239_10101891 | 3300010375 | Bacteria | 3177 |
| 178 | Ga0105239_10118317 | 3300010375 | Bacteria | 2940 |
| 179 | Ga0105239_10537119 | 3300010375 | Bacteria | 1331 |
| 180 | Ga0105246_10021360 | 3300011119 | Bacteria | 4166 |
| 181 | Ga0105246_10071388 | 3300011119 | Bacteria | 2445 |
| 182 | Ga0105246_10125489 | 3300011119 | Bacteria | 1909 |
| 183 | Ga0105246_10129453 | 3300011119 | Bacteria | 1883 |
| 184 | Ga0157370_10230389 | 3300013104 | Bacteria | 1715 |
| 185 | Ga0157369_10003327 | 3300013105 | Bacteria | 19098 |
| 186 | Ga0157369_10008098 | 3300013105 | Bacteria | 12049 |
| 187 | Ga0157369_10023406 | 3300013105 | Bacteria | 6879 |
| 188 | Ga0157369_10078457 | 3300013105 | Bacteria | 3538 |
| 189 | Ga0157374_10186319 | 3300013296 | Bacteria | 2029 |
| 190 | Ga0157374_10277995 | 3300013296 | Bacteria | 1652 |
| 191 | Ga0157378_10109720 | 3300013297 | Bacteria | 2528 |
| 192 | Ga0157378_10207045 | 3300013297 | Bacteria | 1858 |
| 193 | Ga0163162_10130979 | 3300013306 | Bacteria | 2617 |
| 194 | Ga0163162_10132636 | 3300013306 | Bacteria | 2600 |
| 195 | Ga0163162_10142857 | 3300013306 | Bacteria | 2508 |
| 196 | Ga0163162_10453854 | 3300013306 | Bacteria | 1414 |
| 197 | Ga0157372_10117900 | 3300013307 | Bacteria | 3045 |
| 198 | Ga0157375_10186110 | 3300013308 | Bacteria | 2230 |
| 199 | Ga0157375_10233150 | 3300013308 | Bacteria | 2000 |
| 200 | Ga0157375_10332871 | 3300013308 | Bacteria | 1683 |
| 201 | Ga0157375_10388145 | 3300013308 | Bacteria | 1563 |
| 202 | Ga0163163_10014242 | 3300014325 | Bacteria | 7308 |
| 203 | Ga0163163_10031900 | 3300014325 | Bacteria | 5088 |
| 204 | Ga0163163_10084549 | 3300014325 | Bacteria | 3179 |
| 205 | Ga0163163_10101104 | 3300014325 | Bacteria | 2905 |
| 206 | Ga0157380_10386182 | 3300014326 | Bacteria | 1323 |
| 207 | Ga0182008_10159533 | 3300014497 | Bacteria | 1134 |
| 208 | Ga0157379_10164090 | 3300014968 | Bacteria | 2005 |
| 209 | Ga0157379_10229450 | 3300014968 | Bacteria | 1683 |
| 210 | Ga0157376_10072336 | 3300014969 | Bacteria | 2933 |
| 211 | Ga0157376_10341712 | 3300014969 | Bacteria | 1430 |
| 212 | Ga0157376_10495273 | 3300014969 | Bacteria | 1200 |
| 213 | Ga0197907_11341050 | 3300020069 | Bacteria | 1939 |
| 214 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 215 | Ga0214542_1000037 | 3300021321 | Bacteria | 159256 |
| 216 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 217 | Ga0214543_1003164 | 3300021327 | Bacteria | 32141 |
| 218 | Ga0213873_10002609 | 3300021358 | Bacteria | 3142 |
| 219 | Ga0213874_10038363 | 3300021377 | Bacteria | 1422 |
| 220 | Ga0213876_10001294 | 3300021384 | Bacteria | 15771 |
| 221 | Ga0213876_10036588 | 3300021384 | Bacteria | 2589 |
| 222 | Ga0209677_100141 | 3300025253 | Bacteria | 66656 |
| 223 | Ga0209677_104763 | 3300025253 | Bacteria | 3785 |
| 224 | Ga0209148_1001050 | 3300025254 | Bacteria | 17092 |
| 225 | Ga0209233_1001911 | 3300025261 | Bacteria | 7979 |
| 226 | Ga0209233_1002619 | 3300025261 | Bacteria | 6538 |
| 227 | Ga0209233_1003041 | 3300025261 | Bacteria | 5971 |
| 228 | Ga0209233_1012666 | 3300025261 | Bacteria | 2436 |
| 229 | Ga0209233_1024056 | 3300025261 | Bacteria | 1530 |
| 230 | Ga0209455_1002697 | 3300025272 | Bacteria | 6678 |
| 231 | Ga0209455_1008072 | 3300025272 | Bacteria | 2898 |
| 232 | Ga0209758_1000133 | 3300025297 | Bacteria | 182442 |
| 233 | Ga0209758_1001210 | 3300025297 | Bacteria | 32486 |
| 234 | Ga0209758_1001389 | 3300025297 | Bacteria | 28787 |
| 235 | Ga0209758_1001858 | 3300025297 | Bacteria | 23145 |
| 236 | Ga0209758_1030965 | 3300025297 | Bacteria | 2204 |
| 237 | Ga0209758_1036288 | 3300025297 | Bacteria | 1927 |
| 238 | Ga0209758_1041696 | 3300025297 | Bacteria | 1712 |
| 239 | Ga0209256_1008955 | 3300025299 | Bacteria | 4501 |
| 240 | Ga0207426_1000572 | 3300025302 | Bacteria | 49561 |
| 241 | Ga0207426_1000922 | 3300025302 | Bacteria | 29405 |
| 242 | Ga0207656_10009794 | 3300025321 | Bacteria | 3565 |
| 243 | Ga0207653_10065577 | 3300025885 | Bacteria | 1233 |
| 244 | Ga0207692_10003529 | 3300025898 | Bacteria | 6118 |
| 245 | Ga0207692_10008098 | 3300025898 | Bacteria | 4338 |
| 246 | Ga0207642_10032263 | 3300025899 | Bacteria | 2203 |
| 247 | Ga0207688_10064606 | 3300025901 | Bacteria | 2067 |
| 248 | Ga0207688_10111212 | 3300025901 | Bacteria | 1590 |
| 249 | Ga0207680_10209407 | 3300025903 | Bacteria | 1332 |
| 250 | Ga0207647_10028454 | 3300025904 | Bacteria | 3629 |
| 251 | Ga0207699_10015638 | 3300025906 | Bacteria | 3947 |
| 252 | Ga0207699_10028697 | 3300025906 | Bacteria | 3095 |
| 253 | Ga0207699_10055362 | 3300025906 | Bacteria | 2360 |
| 254 | Ga0207699_10094082 | 3300025906 | Bacteria | 1887 |
| 255 | Ga0207645_10025563 | 3300025907 | Bacteria | 3820 |
| 256 | Ga0207705_10062712 | 3300025909 | Bacteria | 2685 |
| 257 | Ga0207705_10224785 | 3300025909 | Bacteria | 1427 |
| 258 | Ga0207707_10000378 | 3300025912 | Bacteria | 46582 |
| 259 | Ga0207707_10003914 | 3300025912 | Bacteria | 13215 |
| 260 | Ga0207707_10015104 | 3300025912 | Bacteria | 6722 |
| 261 | Ga0207707_10040154 | 3300025912 | Bacteria | 4088 |
| 262 | Ga0207707_10145220 | 3300025912 | Bacteria | 2074 |
| 263 | Ga0207707_10241373 | 3300025912 | Bacteria | 1571 |
| 264 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 265 | Ga0207695_10101630 | 3300025913 | Bacteria | 2869 |
| 266 | Ga0207695_10140228 | 3300025913 | Bacteria | 2366 |
| 267 | Ga0207695_10290030 | 3300025913 | Bacteria | 1529 |
| 268 | Ga0207671_10007497 | 3300025914 | Bacteria | 9463 |
| 269 | Ga0207671_10059694 | 3300025914 | Bacteria | 2829 |
| 270 | Ga0207671_10087252 | 3300025914 | Bacteria | 2346 |
| 271 | Ga0207671_10148976 | 3300025914 | Bacteria | 1807 |
| 272 | Ga0207693_10036084 | 3300025915 | Bacteria | 3896 |
| 273 | Ga0207693_10037567 | 3300025915 | Bacteria | 3817 |
| 274 | Ga0207693_10098994 | 3300025915 | Bacteria | 2286 |
| 275 | Ga0207693_10211903 | 3300025915 | Bacteria | 1523 |
| 276 | Ga0207663_10013512 | 3300025916 | Bacteria | 4440 |
| 277 | Ga0207663_10014254 | 3300025916 | Bacteria | 4346 |
| 278 | Ga0207663_10091012 | 3300025916 | Bacteria | 2024 |
| 279 | Ga0207663_10097555 | 3300025916 | Bacteria | 1966 |
| 280 | Ga0207663_10124488 | 3300025916 | Bacteria | 1771 |
| 281 | Ga0207660_10007130 | 3300025917 | Bacteria | 7239 |
| 282 | Ga0207660_10127243 | 3300025917 | Bacteria | 1936 |
| 283 | Ga0207657_10001107 | 3300025919 | Bacteria | 28599 |
| 284 | Ga0207657_10003265 | 3300025919 | Bacteria | 17354 |
| 285 | Ga0207657_10113495 | 3300025919 | Bacteria | 2235 |
| 286 | Ga0207649_10026045 | 3300025920 | Bacteria | 3417 |
| 287 | Ga0207649_10131180 | 3300025920 | Bacteria | 1702 |
| 288 | Ga0207649_10269050 | 3300025920 | Bacteria | 1234 |
| 289 | Ga0207652_10006801 | 3300025921 | Bacteria | 9217 |
| 290 | Ga0207652_10107372 | 3300025921 | Bacteria | 2472 |
| 291 | Ga0207652_10222297 | 3300025921 | Bacteria | 1701 |
| 292 | Ga0207652_10239816 | 3300025921 | Bacteria | 1634 |
| 293 | Ga0207646_10091694 | 3300025922 | Bacteria | 2719 |
| 294 | Ga0207681_10029279 | 3300025923 | Bacteria | 3575 |
| 295 | Ga0207650_10130461 | 3300025925 | Bacteria | 1966 |
| 296 | Ga0207687_10041702 | 3300025927 | Bacteria | 3153 |
| 297 | Ga0207687_10052723 | 3300025927 | Bacteria | 2839 |
| 298 | Ga0207700_10002327 | 3300025928 | Bacteria | 10893 |
| 299 | Ga0207700_10065839 | 3300025928 | Bacteria | 2766 |
| 300 | Ga0207700_10139930 | 3300025928 | Bacteria | 1987 |
| 301 | Ga0207700_10154298 | 3300025928 | Bacteria | 1901 |
| 302 | Ga0207664_10020316 | 3300025929 | Bacteria | 4920 |
| 303 | Ga0207664_10174642 | 3300025929 | Bacteria | 1841 |
| 304 | Ga0207644_10018273 | 3300025931 | Bacteria | 4741 |
| 305 | Ga0207706_10068509 | 3300025933 | Bacteria | 3122 |
| 306 | Ga0207706_10167217 | 3300025933 | Bacteria | 1933 |
| 307 | Ga0207665_10000599 | 3300025939 | Bacteria | 24202 |
| 308 | Ga0207665_10000989 | 3300025939 | Bacteria | 19216 |
| 309 | Ga0207665_10009005 | 3300025939 | Bacteria | 6551 |
| 310 | Ga0207665_10159629 | 3300025939 | Bacteria | 1621 |
| 311 | Ga0207711_10270876 | 3300025941 | Bacteria | 1562 |
| 312 | Ga0207689_10098727 | 3300025942 | Bacteria | 2399 |
| 313 | Ga0207661_10004542 | 3300025944 | Bacteria | 9725 |
| 314 | Ga0207661_10011383 | 3300025944 | Bacteria | 6443 |
| 315 | Ga0207679_10090200 | 3300025945 | Bacteria | 2369 |
| 316 | Ga0207667_10006765 | 3300025949 | Bacteria | 13842 |
| 317 | Ga0207667_10057259 | 3300025949 | Bacteria | 4092 |
| 318 | Ga0207667_10133086 | 3300025949 | Bacteria | 2561 |
| 319 | Ga0207667_10264579 | 3300025949 | Bacteria | 1759 |
| 320 | Ga0207667_10637164 | 3300025949 | Bacteria | 1072 |
| 321 | Ga0207651_10019867 | 3300025960 | Bacteria | 4038 |
| 322 | Ga0207668_10073062 | 3300025972 | Bacteria | 2456 |
| 323 | Ga0207668_10297551 | 3300025972 | Bacteria | 1330 |
| 324 | Ga0207668_10310918 | 3300025972 | Bacteria | 1304 |
| 325 | Ga0207640_10149049 | 3300025981 | Bacteria | 1716 |
| 326 | Ga0207640_10192060 | 3300025981 | Bacteria | 1540 |
| 327 | Ga0207677_10092314 | 3300026023 | Bacteria | 2204 |
| 328 | Ga0207703_10145131 | 3300026035 | Bacteria | 2063 |
| 329 | Ga0207639_10064595 | 3300026041 | Bacteria | 2838 |
| 330 | Ga0207639_10097565 | 3300026041 | Bacteria | 2367 |
| 331 | Ga0207678_10015836 | 3300026067 | Bacteria | 6627 |
| 332 | Ga0207678_10039984 | 3300026067 | Bacteria | 4068 |
| 333 | Ga0207678_10087807 | 3300026067 | Bacteria | 2657 |
| 334 | Ga0207678_10198595 | 3300026067 | Bacteria | 1714 |
| 335 | Ga0207678_10298558 | 3300026067 | Bacteria | 1384 |
| 336 | Ga0207708_10020945 | 3300026075 | Bacteria | 4933 |
| 337 | Ga0207702_10000779 | 3300026078 | Bacteria | 33703 |
| 338 | Ga0207648_10424675 | 3300026089 | Bacteria | 1207 |
| 339 | Ga0207674_10026227 | 3300026116 | Bacteria | 6196 |
| 340 | Ga0207674_10053367 | 3300026116 | Bacteria | 4121 |
| 341 | Ga0207674_10110411 | 3300026116 | Bacteria | 2725 |
| 342 | Ga0207674_10306423 | 3300026116 | Bacteria | 1537 |
| 343 | Ga0207675_100054504 | 3300026118 | Bacteria | 3730 |
| 344 | Ga0207675_100214219 | 3300026118 | Bacteria | 1854 |
| 345 | Ga0207683_10091726 | 3300026121 | Bacteria | 2706 |
| 346 | Ga0207683_10093548 | 3300026121 | Bacteria | 2679 |
| 347 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 348 | Ga0209389_1000115 | 3300027296 | Bacteria | 71798 |
| 349 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 350 | Ga0209589_1000033 | 3300027357 | Bacteria | 140561 |
| 351 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 352 | Ga0209489_100040 | 3300027361 | Bacteria | 164986 |
| 353 | Ga0209489_100612 | 3300027361 | Bacteria | 69168 |
| 354 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 355 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 356 | Ga0209588_1004503 | 3300027671 | Bacteria | 3936 |
| 357 | Ga0209813_10031470 | 3300027866 | Bacteria | 1566 |
| 358 | Ga0268266_10009754 | 3300028379 | Bacteria | 8446 |
| 359 | Ga0268266_10033753 | 3300028379 | Bacteria | 4350 |
| 360 | Ga0268266_10105551 | 3300028379 | Bacteria | 2489 |
| 361 | Ga0268265_10021705 | 3300028380 | Bacteria | 4502 |
| 362 | Ga0268265_10033146 | 3300028380 | Bacteria | 3752 |
| 363 | Ga0268265_10042573 | 3300028380 | Bacteria | 3370 |
| 364 | Ga0268265_10057495 | 3300028380 | Bacteria | 2965 |
| 365 | Ga0268265_10251507 | 3300028380 | Bacteria | 1565 |
| 366 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 367 | Ga0265337_1004222 | 3300028556 | Bacteria | 6011 |
| 368 | Ga0265326_10001217 | 3300028558 | Bacteria | 9204 |
| 369 | Ga0265334_10001564 | 3300028573 | Bacteria | 11023 |
| 370 | Ga0265334_10016758 | 3300028573 | Bacteria | 3030 |
| 371 | Ga0265323_10003591 | 3300028653 | Bacteria | 6810 |
| 372 | Ga0265336_10000135 | 3300028666 | Bacteria | 52478 |
| 373 | Ga0307517_10000634 | 3300028786 | Bacteria | 60194 |
| 374 | Ga0307515_10023148 | 3300028794 | Bacteria | 10904 |
| 375 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 376 | Ga0265324_10001038 | 3300029957 | Bacteria | 17045 |
| 377 | Ga0265330_10038253 | 3300031235 | Bacteria | 2133 |
| 378 | Ga0265332_10017916 | 3300031238 | Bacteria | 3122 |
| 379 | Ga0265328_10076070 | 3300031239 | Bacteria | 1235 |
| 380 | Ga0265325_10005682 | 3300031241 | Bacteria | 7666 |
| 381 | Ga0265339_10005528 | 3300031249 | Bacteria | 8406 |
| 382 | Ga0265339_10061435 | 3300031249 | Bacteria | 2022 |
| 383 | Ga0265331_10074106 | 3300031250 | Bacteria | 1589 |
| 384 | Ga0307509_10005003 | 3300031507 | Bacteria | 18702 |
| 385 | Ga0265313_10092749 | 3300031595 | Bacteria | 1352 |
| 386 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 387 | Ga0265314_10003829 | 3300031711 | Bacteria | 14364 |
| 388 | Ga0307516_10014729 | 3300031730 | Bacteria | 8261 |
| 389 | Ga0307516_10015757 | 3300031730 | Bacteria | 7942 |
| 390 | Ga0307516_10060750 | 3300031730 | Bacteria | 3670 |
| 391 | Ga0307410_10173310 | 3300031852 | Bacteria | 1628 |
| 392 | Ga0307409_100060585 | 3300031995 | Bacteria | 2952 |
| 393 | Ga0307411_10048097 | 3300032005 | Bacteria | 2762 |
| 394 | Ga0307415_100207491 | 3300032126 | Bacteria | 1560 |
| 395 | Ga0307510_10019976 | 3300033180 | Bacteria | 7845 |
| 396 | Ga0307510_10023227 | 3300033180 | Bacteria | 7192 |
| 397 | Ga0307510_10039297 | 3300033180 | Bacteria | 5216 |
| 398 | Ga0307510_10160585 | 3300033180 | Bacteria | 1845 |
| 399 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 400 | Ga0373926_0022117 | 3300035083 | Bacteria | 2206 |
| 401 | Ga0373934_0008656 | 3300035086 | Bacteria | 3796 |
| 402 | Ga0373934_0021398 | 3300035086 | Bacteria | 2490 |
| 403 | Ga0373934_0060792 | 3300035086 | Bacteria | 1505 |
| 404 | Ga0373923_0006710 | 3300035111 | Bacteria | 4000 |
| 405 | Ga0373923_0024439 | 3300035111 | Bacteria | 2385 |
| 406 | Ga0373953_0001202 | 3300035117 | Bacteria | 7375 |
| 407 | Ga0373956_0079419 | 3300035119 | Bacteria | 1504 |
| 408 | Ga0373956_0112321 | 3300035119 | Bacteria | 1269 |
| 409 | Ga0373943_0022074 | 3300035170 | Bacteria | 2945 |
| 410 | Ga0373943_0032461 | 3300035170 | Bacteria | 2483 |
| 411 | Ga0373946_0029415 | 3300035171 | Bacteria | 2186 |
| 412 | Ga0373961_0029300 | 3300035241 | Bacteria | 1524 |
| 413 | Ga0373924_0077438 | 3300035410 | Bacteria | 1410 |
| 414 | Ga0373931_0025233 | 3300035691 | Bacteria | 3018 |
| 415 | Ga0373935_0004267 | 3300035692 | Bacteria | 8382 |
| 416 | Ga0373935_0038394 | 3300035692 | Bacteria | 2998 |
| 417 | Ga0373935_0043463 | 3300035692 | Bacteria | 2828 |
| 418 | Ga0373935_0185748 | 3300035692 | Bacteria | 1429 |
| 419 | Ga0373935_0303875 | 3300035692 | Bacteria | 1128 |
| 420 | Ga0373927_0001468 | 3300035695 | Bacteria | 17747 |
| 421 | Ga0373927_0004710 | 3300035695 | Bacteria | 9507 |
| 422 | Ga0373927_0014398 | 3300035695 | Bacteria | 5236 |
| 423 | Ga0373927_0018761 | 3300035695 | Bacteria | 4538 |
| 424 | Ga0373927_0147927 | 3300035695 | Bacteria | 1538 |
| 425 | Ga0373933_0000468 | 3300035724 | Bacteria | 25246 |
| 426 | Ga0373933_0011609 | 3300035724 | Bacteria | 4860 |
| 427 | Ga0373947_0000755 | 3300035725 | Bacteria | 19381 |
| 428 | Ga0373947_0009037 | 3300035725 | Bacteria | 5729 |
| 429 | Ga0373947_0028170 | 3300035725 | Bacteria | 3291 |
| 430 | Ga0373937_0065466 | 3300036401 | Bacteria | 3345 |
| 431 | Ga0373937_0141690 | 3300036401 | Bacteria | 2249 |
| 432 | Ga0373925_0002143 | 3300037068 | Bacteria | 16126 |
| 433 | Ga0373925_0023873 | 3300037068 | Bacteria | 4460 |
| 434 | Ga0373925_0126935 | 3300037068 | Bacteria | 1985 |
| 435 | Ga0395900_0018596 | 3300037418 | Bacteria | 7086 |
| 436 | Ga0395900_0024838 | 3300037418 | Bacteria | 6133 |
| 437 | Ga0395898_0121342 | 3300037466 | Bacteria | 2504 |
| 438 | Ga0395905_0004426 | 3300037471 | Bacteria | 14603 |
| 439 | Ga0395905_0539340 | 3300037471 | Bacteria | 1068 |
| 440 | Ga0436364_0657610 | 3300037853 | Bacteria | 1094 |
| 441 | Ga0436364_1050353 | 3300037853 | Bacteria | 1156 |
| 442 | Ga0395901_0173274 | 3300038443 | Bacteria | 2264 |
| 443 | Ga0436365_0243105 | 3300039437 | Bacteria | 13839 |
| 444 | Ga0436365_0747294 | 3300039437 | Bacteria | 2559 |
| 445 | Ga0436361_1058286 | 3300039447 | Bacteria | 2398 |
| 446 | Ga0436363_0182376 | 3300039450 | Bacteria | 2587 |
| 447 | Ga0436363_0350177 | 3300039450 | Bacteria | 1445 |
| 448 | Ga0436363_1367285 | 3300039450 | Bacteria | 1430 |
| 449 | Ga0436362_0407438 | 3300039453 | Bacteria | 6183 |
| 450 | Ga0436362_0927305 | 3300039453 | Bacteria | 8543 |
| 451 | Ga0439465_0106631 | 3300041413 | Bacteria | 972 |
| 452 | Ga0451789_1039392 | 3300041443 | Bacteria | 1498 |
| 453 | Ga0466969_0014273 | 3300044656 | Bacteria | 4177 |
| 454 | Ga0466972_0005057 | 3300044658 | Bacteria | 6608 |
| 455 | Ga0466972_0007791 | 3300044658 | Bacteria | 5374 |
| 456 | Ga0466966_0002686 | 3300044684 | Bacteria | 11650 |
| 457 | Ga0466961_0013054 | 3300044693 | Bacteria | 5314 |
| 458 | Ga0466963_0006089 | 3300044694 | Bacteria | 7115 |
| 459 | Ga0466964_0022688 | 3300044706 | Bacteria | 2437 |
| 460 | Ga0466964_0153800 | 3300044706 | Bacteria | 1069 |
| 461 | Ga0466968_0137217 | 3300044735 | Bacteria | 1116 |
| 462 | Ga0466970_0180042 | 3300044765 | Bacteria | 1173 |
| 463 | Ga0466960_0016867 | 3300044901 | Bacteria | 3175 |
| 464 | Ga0466960_0019583 | 3300044901 | Bacteria | 2985 |
| 465 | Ga0466959_0000295 | 3300045049 | Bacteria | 29676 |
| 466 | Ga0466959_0008200 | 3300045049 | Bacteria | 7372 |
| 467 | Ga0466967_0022428 | 3300045976 | Bacteria | 5151 |
| 468 | Ga0466967_0052094 | 3300045976 | Bacteria | 3590 |
| 469 | Ga0466967_0155879 | 3300045976 | Bacteria | 2139 |
| 470 | Ga0495617_007067 | 3300046452 | Bacteria | 3915 |
| 471 | Ga0495592_0011034 | 3300046454 | Bacteria | 6817 |
| 472 | Ga0495592_0038923 | 3300046454 | Bacteria | 3574 |
| 473 | Ga0495592_0066492 | 3300046454 | Bacteria | 2637 |
| 474 | Ga0495592_0074803 | 3300046454 | Bacteria | 2460 |
| 475 | Ga0495592_0156236 | 3300046454 | Bacteria | 1573 |
| 476 | Ga0495603_0000217 | 3300046455 | Bacteria | 29788 |
| 477 | Ga0495603_0038110 | 3300046455 | Bacteria | 2883 |
| 478 | Ga0495603_0131508 | 3300046455 | Bacteria | 1457 |
| 479 | Ga0495629_0000188 | 3300046459 | Bacteria | 56009 |
| 480 | Ga0495629_0002216 | 3300046459 | Bacteria | 14992 |
| 481 | Ga0495629_0034036 | 3300046459 | Bacteria | 3602 |
| 482 | Ga0495629_0042622 | 3300046459 | Bacteria | 3188 |
| 483 | Ga0495629_0043445 | 3300046459 | Bacteria | 3155 |
| 484 | Ga0495638_0025061 | 3300046460 | Bacteria | 3881 |
| 485 | Ga0495641_0003739 | 3300046461 | Bacteria | 11192 |
| 486 | Ga0495653_0002239 | 3300046463 | Bacteria | 15294 |
| 487 | Ga0495653_0288583 | 3300046463 | Bacteria | 1074 |
| 488 | Ga0495580_0003058 | 3300046472 | Bacteria | 14329 |
| 489 | Ga0495580_0014052 | 3300046472 | Bacteria | 6089 |
| 490 | Ga0495582_0002016 | 3300046473 | Bacteria | 11377 |
| 491 | Ga0495582_0075786 | 3300046473 | Bacteria | 1863 |
| 492 | Ga0495639_0000011 | 3300046475 | Bacteria | 92268 |
| 493 | Ga0495639_0168786 | 3300046475 | Bacteria | 1061 |
| 494 | Ga0495662_0004000 | 3300046476 | Bacteria | 7426 |
| 495 | Ga0495664_0017699 | 3300046477 | Bacteria | 4075 |
| 496 | Ga0495664_0025627 | 3300046477 | Bacteria | 3434 |
| 497 | Ga0495664_0045898 | 3300046477 | Bacteria | 2592 |
| 498 | Ga0495664_0054670 | 3300046477 | Bacteria | 2374 |
| 499 | Ga0495585_0058763 | 3300046492 | Bacteria | 2121 |
| 500 | Ga0495585_0087821 | 3300046492 | Bacteria | 1678 |
| 501 | Ga0495594_0000128 | 3300046499 | Bacteria | 35750 |
| 502 | Ga0495606_0001136 | 3300046507 | Bacteria | 37910 |
| 503 | Ga0495608_0002665 | 3300046511 | Bacteria | 12814 |
| 504 | Ga0495608_0044800 | 3300046511 | Bacteria | 2951 |
| 505 | Ga0495608_0085130 | 3300046511 | Bacteria | 2049 |
| 506 | Ga0495610_0095640 | 3300046512 | Bacteria | 1339 |
| 507 | Ga0495618_0035804 | 3300046514 | Bacteria | 3116 |
| 508 | Ga0495618_0093384 | 3300046514 | Bacteria | 1924 |
| 509 | Ga0495618_0133925 | 3300046514 | Bacteria | 1585 |
| 510 | Ga0495618_0178193 | 3300046514 | Bacteria | 1351 |
| 511 | Ga0495628_0019364 | 3300046516 | Bacteria | 5628 |
| 512 | Ga0495628_0030475 | 3300046516 | Bacteria | 4367 |
| 513 | Ga0495630_0020303 | 3300046517 | Bacteria | 4898 |
| 514 | Ga0495648_0001581 | 3300046524 | Bacteria | 22185 |
| 515 | Ga0495648_0071179 | 3300046524 | Bacteria | 2017 |
| 516 | Ga0495652_0036486 | 3300046529 | Bacteria | 4274 |
| 517 | Ga0495652_0052453 | 3300046529 | Bacteria | 3478 |
| 518 | Ga0495652_0060264 | 3300046529 | Bacteria | 3208 |
| 519 | Ga0495652_0142127 | 3300046529 | Bacteria | 1886 |
| 520 | Ga0495652_0226984 | 3300046529 | Bacteria | 1399 |
| 521 | Ga0495665_0000133 | 3300046531 | Bacteria | 35771 |
| 522 | Ga0495665_0072816 | 3300046531 | Bacteria | 1809 |
| 523 | Ga0495640_0021557 | 3300046533 | Bacteria | 4727 |
| 524 | Ga0495640_0061522 | 3300046533 | Bacteria | 2550 |
| 525 | Ga0495587_0003196 | 3300046536 | Bacteria | 10943 |
| 526 | Ga0495587_0049352 | 3300046536 | Bacteria | 2491 |
| 527 | Ga0495609_0053074 | 3300046538 | Bacteria | 1803 |
| 528 | Ga0495645_0019327 | 3300046543 | Bacteria | 4905 |
| 529 | Ga0495645_0066950 | 3300046543 | Bacteria | 2594 |
| 530 | Ga0495622_0038041 | 3300046557 | Bacteria | 2240 |
| 531 | Ga0495622_0039111 | 3300046557 | Bacteria | 2208 |
| 532 | Ga0495622_0045787 | 3300046557 | Bacteria | 2032 |
| 533 | Ga0495633_0066753 | 3300046558 | Bacteria | 1680 |
| 534 | Ga0495667_0002279 | 3300046559 | Bacteria | 12857 |
| 535 | Ga0495667_0195449 | 3300046559 | Bacteria | 1296 |
| 536 | Ga0495656_0026754 | 3300046615 | Bacteria | 2299 |
| 537 | Ga0495656_0062936 | 3300046615 | Bacteria | 1624 |
| 538 | Ga0495656_0070150 | 3300046615 | Bacteria | 1554 |
| 539 | Ga0495656_0082803 | 3300046615 | Bacteria | 1451 |
| 540 | Ga0495668_0093215 | 3300046616 | Bacteria | 1649 |
| 541 | Ga0495668_0111429 | 3300046616 | Bacteria | 1497 |
| 542 | Ga0495634_0000402 | 3300046642 | Bacteria | 42617 |
| 543 | Ga0495634_0016628 | 3300046642 | Bacteria | 5257 |
| 544 | Ga0495634_0021616 | 3300046642 | Bacteria | 4545 |
| 545 | Ga0495634_0063858 | 3300046642 | Bacteria | 2443 |
| 546 | Ga0495634_0075246 | 3300046642 | Bacteria | 2218 |
| 547 | Ga0495625_0198917 | 3300046660 | Bacteria | 1324 |
| 548 | Ga0495635_0002969 | 3300046663 | Bacteria | 11639 |
| 549 | Ga0495635_0011589 | 3300046663 | Bacteria | 6180 |
| 550 | Ga0495635_0088433 | 3300046663 | Bacteria | 2120 |
| 551 | Ga0495635_0120049 | 3300046663 | Bacteria | 1793 |
| 552 | Ga0495659_0072713 | 3300046664 | Bacteria | 1291 |
| 553 | Ga0495588_0011114 | 3300046674 | Bacteria | 4214 |
| 554 | Ga0495588_0166697 | 3300046674 | Bacteria | 1165 |
| 555 | Ga0495657_0003836 | 3300046675 | Bacteria | 12140 |
| 556 | Ga0495657_0041808 | 3300046675 | Bacteria | 3134 |
| 557 | Ga0495657_0046542 | 3300046675 | Bacteria | 2936 |
| 558 | Ga0495657_0123855 | 3300046675 | Bacteria | 1626 |
| 559 | Ga0495599_0016305 | 3300046678 | Bacteria | 4613 |
| 560 | Ga0495623_0018366 | 3300046679 | Bacteria | 4515 |
| 561 | Ga0495623_0045273 | 3300046679 | Bacteria | 2795 |
| 562 | Ga0495646_0007865 | 3300046680 | Bacteria | 6769 |
| 563 | Ga0495646_0021019 | 3300046680 | Bacteria | 4126 |
| 564 | Ga0495646_0093719 | 3300046680 | Bacteria | 1730 |
| 565 | Ga0495646_0130805 | 3300046680 | Bacteria | 1413 |
| 566 | Ga0495647_0000726 | 3300046681 | Bacteria | 9746 |
| 567 | Ga0495647_0056327 | 3300046681 | Bacteria | 1541 |
| 568 | Ga0495658_0003384 | 3300046683 | Bacteria | 7902 |
| 569 | Ga0495658_0035090 | 3300046683 | Bacteria | 2757 |
| 570 | Ga0495658_0043614 | 3300046683 | Bacteria | 2510 |
| 571 | Ga0495669_0002591 | 3300046684 | Bacteria | 7392 |
| 572 | Ga0495613_0011524 | 3300046689 | Bacteria | 6576 |
| 573 | Ga0495613_0055930 | 3300046689 | Bacteria | 2898 |
| 574 | Ga0495613_0199905 | 3300046689 | Bacteria | 1409 |
| 575 | Ga0495624_0004589 | 3300046690 | Bacteria | 10084 |
| 576 | Ga0495624_0074296 | 3300046690 | Bacteria | 2112 |
| 577 | Ga0495624_0095893 | 3300046690 | Bacteria | 1828 |
| 578 | Ga0495649_0030744 | 3300046694 | Bacteria | 2964 |
| 579 | Ga0495600_0001564 | 3300046809 | Bacteria | 12736 |
| 580 | Ga0495600_0017101 | 3300046809 | Bacteria | 4610 |
| 581 | Ga0495600_0126167 | 3300046809 | Bacteria | 1665 |
| 582 | Ga0495581_0000293 | 3300047315 | Bacteria | 24244 |
| 583 | Ga0495581_0066555 | 3300047315 | Bacteria | 2083 |
| 584 | Ga0495604_0023177 | 3300047317 | Bacteria | 4954 |
| 585 | Ga0495604_0032809 | 3300047317 | Bacteria | 4113 |
| 586 | Ga0495604_0058794 | 3300047317 | Bacteria | 2951 |
| 587 | Ga0495604_0157206 | 3300047317 | Bacteria | 1609 |
| 588 | Ga0495604_0243647 | 3300047317 | Bacteria | 1228 |
| 589 | Ga0495674_0034247 | 3300047319 | Bacteria | 4594 |
| 590 | Ga0495674_0083876 | 3300047319 | Bacteria | 2731 |
| 591 | Ga0495674_0108900 | 3300047319 | Bacteria | 2350 |
| 592 | Ga0495674_0129124 | 3300047319 | Bacteria | 2130 |
| 593 | Ga0495674_0222055 | 3300047319 | Bacteria | 1562 |
| 594 | Ga0495676_0034309 | 3300047321 | Bacteria | 4260 |
| 595 | Ga0495676_0071194 | 3300047321 | Bacteria | 2673 |
| 596 | Ga0495676_0097427 | 3300047321 | Bacteria | 2184 |
| 597 | Ga0495676_0208289 | 3300047321 | Bacteria | 1354 |
| 598 | Ga0495680_0006108 | 3300047322 | Bacteria | 11246 |
| 599 | Ga0495680_0008575 | 3300047322 | Bacteria | 9281 |
| 600 | Ga0495683_0046041 | 3300047323 | Bacteria | 2190 |
| 601 | Ga0495687_018229 | 3300047443 | Bacteria | 3474 |
| 602 | Ga0495675_0000992 | 3300047444 | Bacteria | 17254 |
| 603 | Ga0495675_0011731 | 3300047444 | Bacteria | 5505 |
| 604 | Ga0495675_0194360 | 3300047444 | Bacteria | 1237 |
| 605 | Ga0495677_0028610 | 3300047445 | Bacteria | 2025 |
| 606 | Ga0495673_0024109 | 3300047469 | Bacteria | 2947 |
| 607 | Ga0495681_0103321 | 3300047470 | Bacteria | 1243 |
| 608 | Ga0495684_0007190 | 3300047471 | Bacteria | 8642 |
| 609 | Ga0495684_0116894 | 3300047471 | Bacteria | 2010 |
| 610 | Ga0495593_0002447 | 3300047673 | Bacteria | 11168 |
| 611 | Ga0495593_0009337 | 3300047673 | Bacteria | 5694 |
| 612 | Ga0495593_0012613 | 3300047673 | Bacteria | 4826 |
| 613 | Ga0495593_0045765 | 3300047673 | Bacteria | 2334 |
| 614 | Ga0495602_0005521 | 3300048088 | Bacteria | 13266 |
| 615 | Ga0495602_0015003 | 3300048088 | Bacteria | 7836 |
| 616 | Ga0495602_0049263 | 3300048088 | Bacteria | 3775 |
| 617 | Ga0495602_0137328 | 3300048088 | Bacteria | 1940 |
| 618 | Ga0495602_0201633 | 3300048088 | Bacteria | 1517 |
| 619 | Ga0495602_0289264 | 3300048088 | Bacteria | 1204 |
| 620 | Ga0495614_0101681 | 3300048089 | Bacteria | 1257 |
| 621 | Ga0496100_0034795 | 3300048903 | Bacteria | 3164 |
| 622 | Ga0496100_0124209 | 3300048903 | Bacteria | 1810 |
| 623 | Ga0496100_0126437 | 3300048903 | Bacteria | 1795 |
| 624 | Ga0496100_0223971 | 3300048903 | Bacteria | 1381 |
| 625 | Ga0496101_0036213 | 3300048904 | Bacteria | 3495 |
| 626 | Ga0496101_0123816 | 3300048904 | Bacteria | 1957 |
| 627 | Ga0496101_0202452 | 3300048904 | Bacteria | 1535 |
| 628 | Ga0496101_0377778 | 3300048904 | Bacteria | 1115 |
| 629 | Ga0496101_0398907 | 3300048904 | Bacteria | 1083 |
| 630 | Ga0496102_0007134 | 3300048905 | Bacteria | 9543 |
| 631 | Ga0496102_0276272 | 3300048905 | Bacteria | 1583 |
| 632 | Ga0496102_0369009 | 3300048905 | Bacteria | 1351 |
| 633 | Ga0496103_0008518 | 3300048906 | Bacteria | 6092 |
| 634 | Ga0496103_0016956 | 3300048906 | Bacteria | 4351 |
| 635 | Ga0496104_0005863 | 3300048907 | Bacteria | 10763 |
| 636 | Ga0496104_0023259 | 3300048907 | Bacteria | 5697 |
| 637 | Ga0496104_0062966 | 3300048907 | Bacteria | 3517 |
| 638 | Ga0496104_0219259 | 3300048907 | Bacteria | 1814 |
| 639 | Ga0496104_0221824 | 3300048907 | Bacteria | 1803 |
| 640 | Ga0496104_0349954 | 3300048907 | Bacteria | 1390 |
| 641 | Ga0496104_0496952 | 3300048907 | Bacteria | 1131 |
| 642 | Ga0496105_0004094 | 3300048908 | Bacteria | 10925 |
| 643 | Ga0496105_0006944 | 3300048908 | Bacteria | 8721 |
| 644 | Ga0496105_0040042 | 3300048908 | Bacteria | 3863 |
| 645 | Ga0496105_0040322 | 3300048908 | Bacteria | 3850 |
| 646 | Ga0496105_0135740 | 3300048908 | Bacteria | 2027 |
| 647 | Ga0496105_0166849 | 3300048908 | Bacteria | 1806 |
| 648 | Ga0496106_0062278 | 3300048909 | Bacteria | 2832 |
| 649 | Ga0496106_0155379 | 3300048909 | Bacteria | 1806 |
| 650 | Ga0496106_0204293 | 3300048909 | Bacteria | 1573 |
| 651 | Ga0496106_0296122 | 3300048909 | Bacteria | 1297 |
| 652 | Ga0496106_0424758 | 3300048909 | Bacteria | 1068 |
| 653 | Ga0496107_0001167 | 3300048910 | Bacteria | 15918 |
| 654 | Ga0496107_0155030 | 3300048910 | Bacteria | 1695 |
| 655 | Ga0496108_0011742 | 3300048911 | Bacteria | 7124 |
| 656 | Ga0496108_0019121 | 3300048911 | Bacteria | 5621 |
| 657 | Ga0496108_0056020 | 3300048911 | Bacteria | 3311 |
| 658 | Ga0496108_0125095 | 3300048911 | Bacteria | 2207 |
| 659 | Ga0496108_0409151 | 3300048911 | Bacteria | 1185 |
| 660 | Ga0496109_0047215 | 3300048912 | Bacteria | 3915 |
| 661 | Ga0496109_0193893 | 3300048912 | Bacteria | 1909 |
| 662 | Ga0496109_0194499 | 3300048912 | Bacteria | 1906 |
| 663 | Ga0496109_0332428 | 3300048912 | Bacteria | 1435 |
| 664 | Ga0496109_0530604 | 3300048912 | Bacteria | 1111 |
| 665 | Ga0496110_0006530 | 3300048913 | Bacteria | 9254 |
| 666 | Ga0496110_0052942 | 3300048913 | Bacteria | 3567 |
| 667 | Ga0496111_0017721 | 3300048914 | Bacteria | 4925 |
| 668 | Ga0496111_0075559 | 3300048914 | Bacteria | 2455 |
| 669 | Ga0496111_0255979 | 3300048914 | Bacteria | 1299 |
| 670 | Ga0496112_0014473 | 3300048915 | Bacteria | 7322 |
| 671 | Ga0496112_0018995 | 3300048915 | Bacteria | 6478 |
| 672 | Ga0496112_0041488 | 3300048915 | Bacteria | 4503 |
| 673 | Ga0496112_0110064 | 3300048915 | Bacteria | 2725 |
| 674 | Ga0496113_0004386 | 3300048916 | Bacteria | 8655 |
| 675 | Ga0496113_0034043 | 3300048916 | Bacteria | 3714 |
| 676 | Ga0496113_0080775 | 3300048916 | Bacteria | 2491 |
| 677 | Ga0496113_0228541 | 3300048916 | Bacteria | 1483 |
| 678 | Ga0496114_0017028 | 3300048917 | Bacteria | 5862 |
| 679 | Ga0496114_0054141 | 3300048917 | Bacteria | 3346 |
| 680 | Ga0496115_0001479 | 3300048918 | Bacteria | 16884 |
| 681 | Ga0496115_0032780 | 3300048918 | Bacteria | 4100 |
| 682 | Ga0496115_0073406 | 3300048918 | Bacteria | 2777 |
| 683 | Ga0496115_0098802 | 3300048918 | Bacteria | 2391 |
| 684 | Ga0496115_0144422 | 3300048918 | Bacteria | 1963 |
| 685 | Ga0496115_0191408 | 3300048918 | Bacteria | 1690 |
| 686 | Ga0496116_0040178 | 3300048919 | Bacteria | 3224 |
| 687 | Ga0496117_0020747 | 3300048920 | Bacteria | 5347 |
| 688 | Ga0496118_0001892 | 3300048921 | Bacteria | 29856 |
| 689 | Ga0496118_0023504 | 3300048921 | Bacteria | 5351 |
| 690 | Ga0496118_0060741 | 3300048921 | Bacteria | 2805 |
| 691 | Ga0496118_0131089 | 3300048921 | Bacteria | 1610 |
| 692 | Ga0496119_0053496 | 3300048922 | Bacteria | 2466 |
| 693 | Ga0496119_0104269 | 3300048922 | Bacteria | 1586 |
| 694 | Ga0496120_0025458 | 3300048923 | Bacteria | 3671 |
| 695 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 696 | Ga0496121_0000230 | 3300048924 | Bacteria | 120616 |
| 697 | Ga0496121_0004531 | 3300048924 | Bacteria | 18595 |
| 698 | Ga0496121_0008731 | 3300048924 | Bacteria | 11827 |
| 699 | Ga0496121_0017726 | 3300048924 | Bacteria | 7247 |
| 700 | Ga0496121_0019668 | 3300048924 | Bacteria | 6738 |
| 701 | Ga0496121_0059253 | 3300048924 | Bacteria | 3158 |
| 702 | Ga0496121_0072905 | 3300048924 | Bacteria | 2754 |
| 703 | Ga0496121_0117823 | 3300048924 | Bacteria | 2011 |
| 704 | Ga0496121_0131720 | 3300048924 | Bacteria | 1870 |
| 705 | Ga0496121_0184469 | 3300048924 | Bacteria | 1502 |
| 706 | Ga0496123_0047221 | 3300048926 | Bacteria | 2912 |
| 707 | Ga0496124_0034797 | 3300048927 | Bacteria | 4414 |
| 708 | Ga0496124_0040460 | 3300048927 | Bacteria | 4031 |
| 709 | Ga0496124_0126098 | 3300048927 | Bacteria | 2039 |
| 710 | Ga0496125_0000252 | 3300048928 | Bacteria | 109988 |
| 711 | Ga0496125_0035547 | 3300048928 | Bacteria | 4367 |
| 712 | Ga0496125_0057410 | 3300048928 | Bacteria | 3152 |
| 713 | Ga0496125_0066686 | 3300048928 | Bacteria | 2842 |
| 714 | Ga0496125_0098739 | 3300048928 | Bacteria | 2160 |
| 715 | Ga0496125_0105909 | 3300048928 | Bacteria | 2054 |
| 716 | Ga0496126_0002010 | 3300048929 | Bacteria | 28750 |
| 717 | Ga0496126_0008238 | 3300048929 | Bacteria | 11260 |
| 718 | Ga0496126_0010504 | 3300048929 | Bacteria | 9695 |
| 719 | Ga0496126_0018510 | 3300048929 | Bacteria | 6897 |
| 720 | Ga0496126_0038161 | 3300048929 | Bacteria | 4472 |
| 721 | Ga0496126_0039667 | 3300048929 | Bacteria | 4367 |
| 722 | Ga0496126_0053315 | 3300048929 | Bacteria | 3670 |
| 723 | Ga0496126_0069195 | 3300048929 | Bacteria | 3149 |
| 724 | Ga0496126_0138746 | 3300048929 | Bacteria | 2095 |
| 725 | Ga0496126_0310637 | 3300048929 | Bacteria | 1298 |
| 726 | Ga0496126_0338835 | 3300048929 | Bacteria | 1232 |
| 727 | Ga0495682_0024062 | 3300049460 | Bacteria | 2273 |
| 728 | Ga0501031_0001416 | 3300049568 | Bacteria | 14844 |
| 729 | Ga0501031_0006220 | 3300049568 | Bacteria | 7790 |
| 730 | Ga0501032_0000392 | 3300049569 | Bacteria | 36103 |
| 731 | Ga0501032_0001535 | 3300049569 | Bacteria | 18415 |
| 732 | Ga0501033_0000144 | 3300049570 | Bacteria | 68553 |
| 733 | Ga0501033_0000311 | 3300049570 | Bacteria | 46039 |
| 734 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 735 | Ga0501034_0000412 | 3300049571 | Bacteria | 71925 |
| 736 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 737 | Ga0501036_0000127 | 3300049572 | Bacteria | 48559 |
| 738 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 739 | Ga0501037_0000066 | 3300049573 | Bacteria | 96723 |
| 740 | Ga0501038_0000026 | 3300049574 | Bacteria | 146493 |
| 741 | Ga0501038_0000168 | 3300049574 | Bacteria | 55496 |
| 742 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 743 | Ga0501039_0001738 | 3300049575 | Bacteria | 16057 |
| 744 | Ga0501043_0000036 | 3300049579 | Bacteria | 132959 |
| 745 | Ga0501043_0000120 | 3300049579 | Bacteria | 72670 |
| 746 | Ga0501046_0000147 | 3300049580 | Bacteria | 74186 |
| 747 | Ga0501046_0000359 | 3300049580 | Bacteria | 45929 |
| 748 | Ga0501047_0000209 | 3300049581 | Bacteria | 70658 |
| 749 | Ga0501047_0000379 | 3300049581 | Bacteria | 50147 |
| 750 | Ga0501047_0291951 | 3300049581 | Bacteria | 1474 |
| 751 | Ga0501047_0309509 | 3300049581 | Bacteria | 1420 |
| 752 | Ga0501048_0000460 | 3300049582 | Bacteria | 28509 |
| 753 | Ga0501048_0005136 | 3300049582 | Bacteria | 9969 |
| 754 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 755 | Ga0501067_0016819 | 3300049583 | Bacteria | 4040 |
| 756 | Ga0501068_0017473 | 3300049584 | Bacteria | 4148 |
| 757 | Ga0501069_0002392 | 3300049585 | Bacteria | 9524 |
| 758 | Ga0501069_0006075 | 3300049585 | Bacteria | 6302 |
| 759 | Ga0501070_0000163 | 3300049586 | Bacteria | 60911 |
| 760 | Ga0501070_0000966 | 3300049586 | Bacteria | 25809 |
| 761 | Ga0501070_0178694 | 3300049586 | Bacteria | 1747 |
| 762 | Ga0501071_0063196 | 3300049587 | Bacteria | 2684 |
| 763 | Ga0501072_0002586 | 3300049588 | Bacteria | 13564 |
| 764 | Ga0501072_0061545 | 3300049588 | Bacteria | 2961 |
| 765 | Ga0501073_0000070 | 3300049589 | Bacteria | 63026 |
| 766 | Ga0501073_0001352 | 3300049589 | Bacteria | 18086 |
| 767 | Ga0501073_0054892 | 3300049589 | Bacteria | 2789 |
| 768 | Ga0501074_0001814 | 3300049590 | Bacteria | 14619 |
| 769 | Ga0501079_0005974 | 3300049741 | Bacteria | 9114 |
| 770 | Ga0501080_0000137 | 3300049742 | Bacteria | 51355 |
| 771 | Ga0501080_0002456 | 3300049742 | Bacteria | 16216 |
| 772 | Ga0501080_0091267 | 3300049742 | Bacteria | 2829 |
| 773 | Ga0501083_0028039 | 3300049744 | Bacteria | 3882 |
| 774 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 775 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 776 | Ga0501044_0000383 | 3300049823 | Bacteria | 54973 |
| 777 | Ga0501044_0002732 | 3300049823 | Bacteria | 20068 |
| 778 | Ga0501044_0156218 | 3300049823 | Bacteria | 2260 |
| 779 | Ga0501044_0413306 | 3300049823 | Bacteria | 1260 |
| 780 | Ga0501045_0082994 | 3300049824 | Bacteria | 2364 |
| 781 | nmdc:mga00v17_113642_c1 | 3300050491 | Bacteria | 1719 |
| 782 | nmdc:mga00v17_39454_c1 | 3300050491 | Bacteria | 2828 |
| 783 | nmdc:mga0yw44_243563_c1 | 3300050492 | Bacteria | 1196 |
| 784 | nmdc:mga0yw44_26866_c1 | 3300050492 | Bacteria | 2655 |
| 785 | nmdc:mga0yw44_34076_c1 | 3300050492 | Bacteria | 2981 |
| 786 | nmdc:mga0yw44_3647_c2 | 3300050492 | Bacteria | 3933 |
| 787 | nmdc:mga06z11_9769_c1 | 3300050494 | Bacteria | 4055 |
| 788 | nmdc:mga04h51_37502_c1 | 3300050495 | Bacteria | 1565 |
| 789 | nmdc:mga07m45_128445_c1 | 3300050496 | Bacteria | 1466 |
| 790 | nmdc:mga08y16_61139_c1 | 3300050511 | Bacteria | 3933 |
| 791 | nmdc:mga0n895_103606_c1 | 3300050512 | Bacteria | 2857 |
| 792 | nmdc:mga0sz30_67328_c1 | 3300050516 | Bacteria | 1538 |
| 793 | Ga0495601_0013794 | 3300053077 | Bacteria | 4864 |
| 794 | Ga0495601_0020668 | 3300053077 | Bacteria | 4023 |
| 795 | Ga0495601_0031051 | 3300053077 | Bacteria | 3320 |
| 796 | Ga0495601_0076982 | 3300053077 | Bacteria | 2136 |
| 797 | Ga0495601_0138207 | 3300053077 | Bacteria | 1589 |
| 798 | Ga0495612_0137178 | 3300053078 | Bacteria | 1060 |
| 799 | Ga0500635_0007600 | 3300053080 | Bacteria | 2945 |
| 800 | Ga0500635_0015481 | 3300053080 | Bacteria | 2253 |
| 801 | Ga0495595_0149588 | 3300053084 | Bacteria | 1148 |
| 802 | Ga0495619_0002521 | 3300053085 | Bacteria | 11978 |
| 803 | Ga0495619_0056084 | 3300053085 | Bacteria | 2611 |
| 804 | Ga0495619_0253750 | 3300053085 | Bacteria | 1219 |
| 805 | Ga0500643_000069 | 3300053087 | Bacteria | 116366 |
| 806 | Ga0500647_0001622 | 3300053091 | Bacteria | 7863 |
| 807 | Ga0500651_0007198 | 3300053093 | Bacteria | 6478 |
| 808 | Ga0500566_0000043 | 3300053094 | Bacteria | 62755 |
| 809 | Ga0500566_0000734 | 3300053094 | Bacteria | 18419 |
| 810 | Ga0500566_0068961 | 3300053094 | Bacteria | 1987 |
| 811 | Ga0500641_0012688 | 3300053096 | Bacteria | 3084 |
| 812 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 813 | Ga0500562_003178 | 3300053108 | Bacteria | 4097 |
| 814 | Ga0500572_000024 | 3300053111 | Bacteria | 47391 |
| 815 | Ga0500572_001373 | 3300053111 | Bacteria | 6718 |
| 816 | Ga0500591_035119 | 3300053115 | Bacteria | 2407 |
| 817 | Ga0500595_000722 | 3300053119 | Bacteria | 19637 |
| 818 | Ga0500595_001932 | 3300053119 | Bacteria | 10667 |
| 819 | Ga0500595_003276 | 3300053119 | Bacteria | 7647 |
| 820 | Ga0500595_004221 | 3300053119 | Bacteria | 6497 |
| 821 | Ga0500614_001183 | 3300053123 | Bacteria | 6393 |
| 822 | Ga0500614_006252 | 3300053123 | Bacteria | 2499 |
| 823 | Ga0500618_021887 | 3300053125 | Bacteria | 1558 |
| 824 | Ga0500642_0000114 | 3300053130 | Bacteria | 37434 |
| 825 | Ga0500642_0002387 | 3300053130 | Bacteria | 5502 |
| 826 | Ga0500642_0065236 | 3300053130 | Bacteria | 1645 |
| 827 | Ga0500559_0000773 | 3300053136 | Bacteria | 20950 |
| 828 | Ga0500559_0001628 | 3300053136 | Bacteria | 12476 |
| 829 | Ga0500559_0034228 | 3300053136 | Bacteria | 2190 |
| 830 | Ga0500577_0005371 | 3300053142 | Bacteria | 3446 |
| 831 | Ga0500589_099062 | 3300053147 | Bacteria | 1269 |
| 832 | Ga0500603_000451 | 3300053150 | Bacteria | 10617 |
| 833 | Ga0500603_002245 | 3300053150 | Bacteria | 4251 |
| 834 | Ga0500616_0042944 | 3300053153 | Bacteria | 2419 |
| 835 | Ga0500619_008894 | 3300053154 | Bacteria | 2465 |
| 836 | Ga0500620_002958 | 3300053155 | Bacteria | 3548 |
| 837 | Ga0500630_000056 | 3300053159 | Bacteria | 34094 |
| 838 | Ga0500638_000489 | 3300053162 | Bacteria | 9729 |
| 839 | Ga0500639_000099 | 3300053163 | Bacteria | 40200 |
| 840 | Ga0500636_0003063 | 3300053177 | Bacteria | 9362 |
| 841 | Ga0500637_0000042 | 3300053178 | Bacteria | 46215 |
| 842 | Ga0500637_0022819 | 3300053178 | Bacteria | 3414 |
| 843 | Ga0500645_025118 | 3300053730 | Bacteria | 1819 |
| 844 | Ga0500596_007111 | 3300053735 | Bacteria | 1850 |
| 845 | Ga0500601_000081 | 3300053737 | Bacteria | 19759 |
| 846 | Ga0501084_0003876 | 3300054114 | Bacteria | 12173 |
| 847 | Ga0500661_009657 | 3300055283 | Bacteria | 1763 |
| 848 | Ga0501082_0005063 | 3300060353 | Bacteria | 11489 |
| 849 | 8019649372 | 8019648815 | Bacteria | 10014479 |
| 850 | 2507507656 | 2507262055 | Bacteria | 8048963 |
| 851 | 2508541772 | 2508501009 | Bacteria | 7784016 |
| 852 | 2508692684 | 2508501042 | Bacteria | 8719808 |
| 853 | 2511398203 | 2511231028 | Bacteria | 8046582 |
| 854 | 2513621858 | 2513237092 | Bacteria | 8341956 |
| 855 | 2513642988 | 2513237094 | Bacteria | 8789602 |
| 856 | 2513647520 | 2513237095 | Bacteria | 8976980 |
| 857 | 2513654098 | 2513237096 | Bacteria | 8722461 |
| 858 | 2513674794 | 2513237098 | Bacteria | 9902361 |
| 859 | 2513698108 | 2513237101 | Bacteria | 7952346 |
| 860 | 2513701474 | 2513237102 | Bacteria | 7703324 |
| 861 | 2513721283 | 2513237104 | Bacteria | 10034502 |
| 862 | 2513856850 | 2513237137 | Bacteria | 9558895 |
| 863 | 2513878530 | 2513237139 | Bacteria | 8737671 |
| 864 | 2513891242 | 2513237141 | Bacteria | 8496279 |
| 865 | 2513918438 | 2513237145 | Bacteria | 8979722 |
| 866 | 2514009424 | 2513237161 | Bacteria | 8871253 |
| 867 | 2515626083 | 2515154112 | Bacteria | 8294334 |
| 868 | 2517104163 | 2517093001 | Bacteria | 9002274 |
| 869 | 2517891328 | 2517572143 | Bacteria | 9484767 |
| 870 | 2524436274 | 2524023205 | Bacteria | 8918781 |
| 871 | 2524468481 | 2524023210 | Bacteria | 9029266 |
| 872 | 2524540865 | 2524023228 | Bacteria | 10118060 |
| 873 | 2528848975 | 2528768022 | Bacteria | 10457665 |
| 874 | 2617346804 | 2617270735 | Bacteria | 9163226 |
| 875 | 2617372735 | 2617270741 | Bacteria | 8201522 |
| 876 | 2644287469 | 2643221651 | Bacteria | 4798932 |
| 877 | 2671123858 | 2667528175 | Bacteria | 7532676 |
| 878 | 2723843681 | 2721755755 | Bacteria | 8322773 |
| 879 | 2728750040 | 2728368998 | Bacteria | 8720350 |
| 880 | 2745080771 | 2744054633 | Bacteria | 8678936 |
| 881 | 2793065202 | 2791355196 | Bacteria | 7323613 |
| 882 | 2793066696 | 2791355197 | Bacteria | 8420563 |
| 883 | 2793083790 | |||
| 884 | 2805919046 | 2802429603 | Bacteria | 8777136 |
| 885 | 2818236557 | 2816332527 | Bacteria | 8933356 |
| 886 | 2824606530 | 2824600985 | Bacteria | 8488197 |
| 887 | 2824613053 | 2824609381 | Bacteria | 8672835 |
| 888 | 2824620429 | 2824617872 | Bacteria | 8814715 |
| 889 | 2824628523 | 2824626560 | Bacteria | 8813858 |
| 890 | 2824637223 | 2824635225 | Bacteria | 8785348 |
| 891 | 2824650836 | 2824644064 | Bacteria | 8743947 |
| 892 | 2824658546 | 2824653114 | Bacteria | 8493680 |
| 893 | 2824666494 | 2824661429 | Bacteria | 9877870 |
| 894 | 2824674112 | 2824671348 | Bacteria | 8369588 |
| 895 | 2824684940 | 2824679649 | Bacteria | 8248951 |
| 896 | 2824694399 | 2824687955 | Bacteria | 8360029 |
| 897 | 2824703216 | 2824696289 | Bacteria | 8335049 |
| 898 | 2824708905 | 2824704595 | Bacteria | 9667483 |
| 899 | 2824721338 | 2824714736 | Bacteria | 8717648 |
| 900 | 2824725616 | 2824723954 | Bacteria | 8758240 |
| 901 | 2824739488 | 2824732956 | Bacteria | 7810675 |
| 902 | 2824750112 | 2824746037 | Bacteria | 7911610 |
| 903 | 2824755986 | 2824753945 | Bacteria | 9787441 |
| 904 | 2824767524 | 2824763712 | Bacteria | 9792355 |
| 905 | 2824775119 | 2824773399 | Bacteria | 8360218 |
| 906 | 2838130472 | 2838122688 | Bacteria | 8803140 |
| 907 | 2841948120 | 2841941048 | Bacteria | 8688029 |
| 908 | 2841953485 | 2841949485 | Bacteria | 8680857 |
| 909 | 2841962917 | 2841957949 | Bacteria | 8652217 |
| 910 | 2841972038 | 2841966195 | Bacteria | 8673214 |
| 911 | 2841978214 | 2841974524 | Bacteria | 8931498 |
| 912 | 2841990984 | 2841983080 | Bacteria | 8395090 |
| 913 | 2842040654 | 2842038055 | Bacteria | 8002051 |
| 914 | 2842046400 | 2842045827 | Bacteria | 8006841 |
| 915 | 2844320031 | 2844315083 | Bacteria | 8138177 |
| 916 | 2847937329 | 2847930680 | Bacteria | 9342022 |
| 917 | 2847947749 | 2847939898 | Bacteria | 8606328 |
| 918 | 2849078391 | 2849076700 | Bacteria | 7039503 |
| 919 | 2857512766 | 2857509624 | Bacteria | 7472071 |
| 920 | 2874598769 | 2874590934 | Bacteria | 8299676 |
| 921 | 2874607411 | 2874604998 | Bacteria | 7834745 |
| 922 | 2874614565 | 2874612657 | Bacteria | 8252029 |
| 923 | 2874628087 | 2874620515 | Bacteria | 8290088 |
| 924 | 2874635001 | 2874628541 | Bacteria | 8630250 |
| 925 | 2874652225 | 2874645413 | Bacteria | 8214782 |
| 926 | 2876771040 | 2876761206 | Bacteria | 10111113 |
| 927 | 2876778808 | 2876771140 | Bacteria | 8287509 |
| 928 | 2876817705 | 2876808645 | Bacteria | 8824342 |
| 929 | 2876824297 | 2876818435 | Bacteria | 8274608 |
| 930 | 2879082601 | 2879074833 | Bacteria | 8279565 |
| 931 | 2879086629 | 2879083081 | Bacteria | 8587928 |
| 932 | 2879107139 | 2879099564 | Bacteria | 10442239 |
| 933 | 2879111868 | 2879110137 | Bacteria | 8907982 |
| 934 | 2879131518 | 2879127579 | Bacteria | 8294491 |
| 935 | 2879147964 | 2879142872 | Bacteria | 8267021 |
| 936 | 2881371455 | 2881364244 | Bacteria | 7710352 |
| 937 | 2881666585 | 2881665667 | Bacteria | 8175609 |
| 938 | 2885369974 | 2885366525 | Bacteria | 8326213 |
| 939 | 2885377033 | 2885374607 | Bacteria | 8927485 |
| 940 | 2885391393 | 2885383462 | Bacteria | 9473874 |
| 941 | 2885417890 | 2885409591 | Bacteria | 9235467 |
| 942 | 2888385457 | 2888378607 | Bacteria | 9652610 |
| 943 | 2888392774 | 2888388044 | Bacteria | 7304136 |
| 944 | 2888425589 | 2888419890 | Bacteria | 7857137 |
| 945 | 2889038010 | 2889033259 | Bacteria | 9099371 |
| 946 | 2903730295 | 2903727486 | Bacteria | 8281579 |
| 947 | 2903755289 | 2903748898 | Bacteria | 9972761 |
| 948 | 2903769729 | 2903768456 | Bacteria | 9749579 |
| 949 | 2904674295 | 2904666416 | Bacteria | 8226587 |
| 950 | 2904694501 | 2904690495 | Bacteria | 9412302 |
| 951 | 2904701275 | |||
| 952 | 2904711969 | 2904711408 | Bacteria | 9771557 |
| 953 | 2906609856 | 2906602504 | Bacteria | 8295279 |
| 954 | 2906616514 | |||
| 955 | 2906627348 | 2906626472 | Bacteria | 8826946 |
| 956 | 2906635285 | 2906635258 | Bacteria | 8601019 |
| 957 | 2906643954 | 2906643746 | Bacteria | 8722424 |
| 958 | 2906663011 | 2906660503 | Bacteria | 8595048 |
| 959 | 2908741682 | 2908739725 | Bacteria | 8628932 |
| 960 | 2908759157 | 2908756301 | Bacteria | 8864324 |
| 961 | 2908781177 | 2908775508 | Bacteria | 8092255 |
| 962 | 2922366012 | 2922361189 | Bacteria | 7436256 |
| 963 | 2922372401 | |||
| 964 | 2922386826 | 2922386360 | Bacteria | 7017218 |
| 965 | 2922397068 | 2922393267 | Bacteria | 8285685 |
| 966 | 2922431467 | |||
| 967 | 2928104462 | 2928100450 | Bacteria | 4837635 |
| 968 | 2929621029 | 2929615660 | Bacteria | 9193770 |
| 969 | 2929626140 | 2929624759 | Bacteria | 9339455 |
| 970 | 2932784980 | 2932784394 | Bacteria | 9704911 |
| 971 | 2932795145 | 2932794094 | Bacteria | 7915132 |
| 972 | 2932805673 | 2932801729 | Bacteria | 7987968 |
| 973 | 2932810014 | 2932809354 | Bacteria | 9135765 |
| 974 | 2932827011 | 2932818245 | Bacteria | 9955613 |
| 975 | 2932828817 | 2932828146 | Bacteria | 9745859 |
| 976 | 2933583101 | 2933577622 | Bacteria | 9116884 |
| 977 | 2935609836 | 2935608549 | Bacteria | 8203142 |
| 978 | 2935619763 | 2935616580 | Bacteria | 9032984 |
| 979 | 2935636227 | 2935630451 | Bacteria | 8169952 |
| 980 | 2935638744 | 2935638405 | Bacteria | 10015038 |
| 981 | 2935652134 | 2935648319 | Bacteria | 8801166 |
| 982 | 2935659893 | 2935656913 | Bacteria | 8965014 |
| 983 | 2935666405 | 2935665750 | Bacteria | 9571747 |
| 984 | 2935676548 | 2935675223 | Bacteria | 9928132 |
| 985 | 2935690780 | 2935684952 | Bacteria | 9590419 |
| 986 | 2935694629 | 2935694250 | Bacteria | 9291695 |
| 987 | 2935703750 | 2935703347 | Bacteria | 10242284 |
| 988 | 2935718161 | 2935713505 | Bacteria | 9608509 |
| 989 | 2935727858 | 2935722832 | Bacteria | 9608746 |
| 990 | 2935736562 | 2935732158 | Bacteria | 9706831 |
| 991 | 2935745941 | 2935741537 | Bacteria | 9707219 |
| 992 | 2935756322 | 2935750917 | Bacteria | 9590372 |
| 993 | 2935760574 | 2935760218 | Bacteria | 9817913 |
| 994 | 2935776992 | 2935769743 | Bacteria | 7878163 |
| 995 | 2935783547 | 2935777560 | Bacteria | 8077691 |
| 996 | 2935792807 | 2935785616 | Bacteria | 7962367 |
| 997 | 2935800845 | 2935793552 | Bacteria | 8012592 |
| 998 | 2935801887 | 2935801545 | Bacteria | 9301974 |
| 999 | 2935814703 | 2935810662 | Bacteria | 9401221 |
| 1000 | 2935822997 | 2935819856 | Bacteria | 8261050 |
| 1001 | 2935828238 | 2935827899 | Bacteria | 10038562 |
| 1002 | 2935842442 | 2935837841 | Bacteria | 9454360 |
| 1003 | 2935848579 | 2935847175 | Bacteria | 8228321 |
| 1004 | 2935857922 | 2935855204 | Bacteria | 9035059 |
| 1005 | 2935868736 | 2935864058 | Bacteria | 9784707 |
| 1006 | 2935874151 | 2935873716 | Bacteria | 9632195 |
| 1007 | 2935883957 | 2935883170 | Bacteria | 7964738 |
| 1008 | 2935909614 | 2935908558 | Bacteria | 8568796 |
| 1009 | 2935917339 | 2935916978 | Bacteria | 9113783 |
| 1010 | 2935927095 | 2935926038 | Bacteria | 8601059 |
| 1011 | 2935937061 | 2935934488 | Bacteria | 8602579 |
| 1012 | 2935944636 | 2935942939 | Bacteria | 8599779 |
| 1013 | 2935953073 | 2935951376 | Bacteria | 8602333 |
| 1014 | 2935966573 | 2935959822 | Bacteria | 7869783 |
| 1015 | 2935969913 | 2935967501 | Bacteria | 8603075 |
| 1016 | 2935976509 | 2935975950 | Bacteria | 8347125 |
| 1017 | 2935987037 | 2935984226 | Bacteria | 8302647 |
| 1018 | 2935992924 | 2935992306 | Bacteria | 9802711 |
| 1019 | 2936002837 | 2936002035 | Bacteria | 9362176 |
| 1020 | 2936014309 | 2936011229 | Bacteria | 8801034 |
| 1021 | 2936023851 | 2936019824 | Bacteria | 8804134 |
| 1022 | 2936031494 | 2936028420 | Bacteria | 8965941 |
| 1023 | 2936040654 | 2936037263 | Bacteria | 9446081 |
| 1024 | 2936049415 | 2936046547 | Bacteria | 8903709 |
| 1025 | 2936062165 | 2936055302 | Bacteria | 8785755 |
| 1026 | 2940561703 | 2940556831 | Bacteria | 9590747 |
| 1027 | 2941512858 | 2941507105 | Bacteria | 8166816 |
| 1028 | 2941520575 | 2941515067 | Bacteria | 8166720 |
| 1029 | 2941528589 | 2941523033 | Bacteria | 8169134 |
| 1030 | 2941531216 | 2941531003 | Bacteria | 7653939 |
| 1031 | 2941542491 | 2941538514 | Bacteria | 9402094 |
| 1032 | 3005481260 | 3005474847 | Bacteria | 9259049 |
| 1033 | 3005484785 | 3005483717 | Bacteria | 7877331 |
| 1034 | 3005508428 | 3005506211 | Bacteria | 6943378 |
| 1035 | 3005588073 | 3005587118 | Bacteria | 7794411 |
| 1036 | 3005600322 | 3005594810 | Bacteria | 8716512 |
| 1037 | 3005715812 | 3005710791 | Bacteria | 7622528 |
| 1038 | 3005723168 | 3005718088 | Bacteria | 8283608 |
| 1039 | 8006928387 | 8006926726 | Bacteria | 6749210 |
| 1040 | 8006939450 | 8006933436 | Bacteria | 10410654 |
| 1041 | 8006972113 | 8006964411 | Bacteria | 8966052 |
| 1042 | 8006979200 | 8006973647 | Bacteria | 10679141 |
| 1043 | 8006984433 | 8006984368 | Bacteria | 9651211 |
| 1044 | 8007001367 | 8006994254 | Bacteria | 8309700 |
| 1045 | 8016520652 | 8016511872 | Bacteria | 9921665 |
| 1046 | 8016528682 | 8016522445 | Bacteria | 8156687 |
| 1047 | 8016533857 | 8016530956 | Bacteria | 8155261 |
| 1048 | 8016547081 | 8016539877 | Bacteria | 8155419 |
| 1049 | 8016555042 | 8016548790 | Bacteria | 8155074 |
| 1050 | 8016563407 | 8016557553 | Bacteria | 8154380 |
| 1051 | 8016572190 | 8016566248 | Bacteria | 8158151 |
| 1052 | 8016576386 | 8016575299 | Bacteria | 8154085 |
| 1053 | 8016594346 | 8016583857 | Bacteria | 10421953 |
| 1054 | 8016601156 | 8016595262 | Bacteria | 8149947 |
| 1055 | 8016609288 | 8016603502 | Bacteria | 8731218 |
| 1056 | 8016625607 | 8016622563 | Bacteria | 7999408 |
| 1057 | 8016639167 | 8016630954 | Bacteria | 9217207 |
| 1058 | 8017064927 | 8017057580 | Bacteria | 10023680 |
| 1059 | 8019533628 | 8019530166 | Bacteria | 8155624 |
| 1060 | 8019546036 | 8019538911 | Bacteria | 7872763 |
| 1061 | 8019552686 | 8019547302 | Bacteria | 7996444 |
| 1062 | 8019565325 | 8019555841 | Bacteria | 9642137 |
| 1063 | 8019575425 | 8019565922 | Bacteria | 9639779 |
| 1064 | 8019584304 | 8019576017 | Bacteria | 10049540 |
| 1065 | 8019592074 | 8019586578 | Bacteria | 10212056 |
| 1066 | 8019599211 | 8019597564 | Bacteria | 10041141 |
| 1067 | 8019609148 | 8019608314 | Bacteria | 10042931 |
| 1068 | 8019619818 | 8019619141 | Bacteria | 9218857 |
| 1069 | 8019633297 | 8019629233 | Bacteria | 8687553 |
| 1070 | 8019646604 | 8019638758 | Bacteria | 9062356 |
| 1071 | 8019661171 | 8019659431 | Bacteria | 8577854 |
| 1072 | 8019670722 | 8019668869 | Bacteria | 8791617 |
| 1073 | 8019685511 | 8019678201 | Bacteria | 8863603 |
| 1074 | 8019691077 | 8019687851 | Bacteria | 8712826 |
| 1075 | 8055745108 | 8055742211 | Bacteria | 9226248 |
| 1076 | 8056679830 | 8056673599 | Bacteria | 7871253 |
| 1077 | 8056684753 | 8056681323 | Bacteria | 8472857 |
| 1078 | 8056693053 | 8056689827 | Bacteria | 6712655 |
| 1079 | 8056975061 | 8056967851 | Bacteria | 9038162 |
| 1080 | RicEn_C1662 | |||
| 1081 | JGI25406J46586_10000202 | |||
| 1082 | JGI25406J46586_10006725 | |||
| 1083 | JGI25153J46596_10000656 | |||
| 1084 | JGI25153J46596_10005271 | |||
| 1085 | JGI25153J46596_10006410 | |||
| 1086 | JGI25160J50197_1012923 | |||
| 1087 | JGI25404J52841_10006565 | |||
| 1088 | JGI25404J52841_10024028 | |||
| 1089 | Ga0055539_1006447 | |||
| 1090 | Ga0065165_1000926 | |||
| 1091 | Ga0065165_1001447 | |||
| 1092 | Ga0065715_10288260 | |||
| 1093 | Ga0070658_10142763 | |||
| 1094 | Ga0070683_100050018 | |||
| 1095 | Ga0070683_100092275 | |||
| 1096 | Ga0070683_100172892 | |||
| 1097 | Ga0070680_100007389 | |||
| 1098 | Ga0070680_100205070 | |||
| 1099 | Ga0070660_100350511 | |||
| 1100 | Ga0070661_100057205 | |||
| 1101 | Ga0070668_100058827 | |||
| 1102 | Ga0070668_100226390 | |||
| 1103 | Ga0070669_100046134 | |||
| 1104 | Ga0070671_100003878 | |||
| 1105 | Ga0070674_100116870 | |||
| 1106 | Ga0070673_100003986 | |||
| 1107 | Ga0070688_100010670 | |||
| 1108 | Ga0070709_10015754 | |||
| 1109 | Ga0070709_10016067 | |||
| 1110 | Ga0070709_10070318 | |||
| 1111 | Ga0070709_10125683 | |||
| 1112 | Ga0070714_100044060 | |||
| 1113 | Ga0070714_100063197 | |||
| 1114 | Ga0070714_100080070 | |||
| 1115 | Ga0070713_100001443 | |||
| 1116 | Ga0070713_100002226 | |||
| 1117 | Ga0070713_100007690 | |||
| 1118 | Ga0070713_100202384 | |||
| 1119 | Ga0070710_10003994 | |||
| 1120 | Ga0070710_10017245 | |||
| 1121 | Ga0070710_10022746 | |||
| 1122 | Ga0070701_10039619 | |||
| 1123 | Ga0070711_100005992 | |||
| 1124 | Ga0070711_100064294 | |||
| 1125 | Ga0070711_100084168 | |||
| 1126 | Ga0070711_100167189 | |||
| 1127 | Ga0070663_100045576 | |||
| 1128 | Ga0070663_100067261 | |||
| 1129 | Ga0070663_100163655 | |||
| 1130 | Ga0070663_100369269 | |||
| 1131 | Ga0070678_100013689 | |||
| 1132 | Ga0070678_100015766 | |||
| 1133 | Ga0070678_100080228 | |||
| 1134 | Ga0070678_100081184 | |||
| 1135 | Ga0070678_100144901 | |||
| 1136 | Ga0070678_100171511 | |||
| 1137 | Ga0070681_10013908 | |||
| 1138 | Ga0070681_10106713 | |||
| 1139 | Ga0070681_10138999 | |||
| 1140 | Ga0070681_10292834 | |||
| 1141 | Ga0070681_10346582 | |||
| 1142 | Ga0070707_100095241 | |||
| 1143 | Ga0070698_100196336 | |||
| 1144 | Ga0070679_100085294 | |||
| 1145 | Ga0070679_100139562 | |||
| 1146 | Ga0070679_100193859 | |||
| 1147 | Ga0070684_100016541 | |||
| 1148 | Ga0070684_100115656 | |||
| 1149 | Ga0070697_100138279 | |||
| 1150 | Ga0070697_100250047 | |||
| 1151 | Ga0068853_100046546 | |||
| 1152 | Ga0068853_100055730 | |||
| 1153 | Ga0068853_100083735 | |||
| 1154 | Ga0068853_100162127 | |||
| 1155 | Ga0068853_100180025 | |||
| 1156 | Ga0070672_100033812 | |||
| 1157 | Ga0070693_100125260 | |||
| 1158 | Ga0070665_100038548 | |||
| 1159 | Ga0070665_100059464 | |||
| 1160 | Ga0070665_100111668 | |||
| 1161 | Ga0070665_100159559 | |||
| 1162 | Ga0070665_100230192 | |||
| 1163 | Ga0070665_100252717 | |||
| 1164 | Ga0070665_100443474 | |||
| 1165 | Ga0070665_100446056 | |||
| 1166 | Ga0068855_100031944 | |||
| 1167 | Ga0068855_100091476 | |||
| 1168 | Ga0068855_100128442 | |||
| 1169 | Ga0068855_100218316 | |||
| 1170 | Ga0068855_100232775 | |||
| 1171 | Ga0068855_100467869 | |||
| 1172 | Ga0068857_100105694 | |||
| 1173 | Ga0068857_100152274 | |||
| 1174 | Ga0068857_100235326 | |||
| 1175 | Ga0068854_100047530 | |||
| 1176 | Ga0068854_100208899 | |||
| 1177 | Ga0068852_100008038 | |||
| 1178 | Ga0068859_100057641 | |||
| 1179 | Ga0068859_100255810 | |||
| 1180 | Ga0068864_100161963 | |||
| 1181 | Ga0068866_10035166 | |||
| 1182 | Ga0068866_10046557 | |||
| 1183 | Ga0068861_100113676 | |||
| 1184 | Ga0068861_100435358 | |||
| 1185 | Ga0068858_100128143 | |||
| 1186 | Ga0068860_100000081 | |||
| 1187 | Ga0068862_100024472 | |||
| 1188 | Ga0081455_10008418 | |||
| 1189 | Ga0081455_10029336 | |||
| 1190 | Ga0081455_10125796 | |||
| 1191 | Ga0081540_1001682 | |||
| 1192 | Ga0081540_1003361 | |||
| 1193 | Ga0081540_1013327 | |||
| 1194 | Ga0081540_1015125 | |||
| 1195 | Ga0081540_1019809 | |||
| 1196 | Ga0081540_1030166 | |||
| 1197 | Ga0081540_1031210 | |||
| 1198 | Ga0081540_1035542 | |||
| 1199 | Ga0081540_1035686 | |||
| 1200 | Ga0081540_1069505 | |||
| 1201 | Ga0081540_1092560 | |||
| 1202 | Ga0081539_10000768 | |||
| 1203 | Ga0081539_10001470 | |||
| 1204 | Ga0081539_10148442 | |||
| 1205 | Ga0070717_10002220 | |||
| 1206 | Ga0070717_10027436 | |||
| 1207 | Ga0070717_10396747 | |||
| 1208 | Ga0075365_10008851 | |||
| 1209 | Ga0070712_100023933 | |||
| 1210 | Ga0070712_100365819 | |||
| 1211 | Ga0075367_10101986 | |||
| 1212 | Ga0075369_10034323 | |||
| 1213 | Ga0075369_10037242 | |||
| 1214 | Ga0075369_10124082 | |||
| 1215 | Ga0075366_10054711 | |||
| 1216 | Ga0097621_100025839 | |||
| 1217 | Ga0075370_10186455 | |||
| 1218 | Ga0075434_100176723 | |||
| 1219 | Ga0075434_100465547 | |||
| 1220 | Ga0068865_100121416 | |||
| 1221 | Ga0097620_100057642 | |||
| 1222 | Ga0097620_100255803 | |||
| 1223 | Ga0099824_1016570 | |||
| 1224 | Ga0099824_1020870 | |||
| 1225 | Ga0099822_1009095 | |||
| 1226 | Ga0099794_10051835 | |||
| 1227 | Ga0105240_10007310 | |||
| 1228 | Ga0105240_10034676 | |||
| 1229 | Ga0105240_10364428 | |||
| 1230 | Ga0105240_10397933 | |||
| 1231 | Ga0105240_10403439 | |||
| 1232 | Ga0111539_10088037 | |||
| 1233 | Ga0105245_10069475 | |||
| 1234 | Ga0105245_10193858 | |||
| 1235 | Ga0105247_10213455 | |||
| 1236 | Ga0105243_10265591 | |||
| 1237 | Ga0105241_10032018 | |||
| 1238 | Ga0105241_10103601 | |||
| 1239 | Ga0105241_10181436 | |||
| 1240 | Ga0105241_10285971 | |||
| 1241 | Ga0105248_10137251 | |||
| 1242 | Ga0105237_10065725 | |||
| 1243 | Ga0105237_10084021 | |||
| 1244 | Ga0105237_10092782 | |||
| 1245 | Ga0105237_10372534 | |||
| 1246 | Ga0105238_10053335 | |||
| 1247 | Ga0105238_10100152 | |||
| 1248 | Ga0105238_10173286 | |||
| 1249 | Ga0105238_10273591 | |||
| 1250 | Ga0105249_10130613 | |||
| 1251 | Ga0105249_10567893 | |||
| 1252 | Ga0099796_10037812 | |||
| 1253 | Ga0105239_10041049 | |||
| 1254 | Ga0105239_10081303 | |||
| 1255 | Ga0105239_10083629 | |||
| 1256 | Ga0105239_10101891 | |||
| 1257 | Ga0105239_10118317 | |||
| 1258 | Ga0105239_10537119 | |||
| 1259 | Ga0105246_10021360 | |||
| 1260 | Ga0105246_10071388 | |||
| 1261 | Ga0105246_10125489 | |||
| 1262 | Ga0105246_10129453 | |||
| 1263 | Ga0157370_10230389 | |||
| 1264 | Ga0157369_10003327 | |||
| 1265 | Ga0157369_10008098 | |||
| 1266 | Ga0157369_10023406 | |||
| 1267 | Ga0157369_10078457 | |||
| 1268 | Ga0157374_10186319 | |||
| 1269 | Ga0157374_10277995 | |||
| 1270 | Ga0157378_10109720 | |||
| 1271 | Ga0157378_10207045 | |||
| 1272 | Ga0163162_10130979 | |||
| 1273 | Ga0163162_10132636 | |||
| 1274 | Ga0163162_10142857 | |||
| 1275 | Ga0163162_10453854 | |||
| 1276 | Ga0157372_10117900 | |||
| 1277 | Ga0157375_10186110 | |||
| 1278 | Ga0157375_10233150 | |||
| 1279 | Ga0157375_10332871 | |||
| 1280 | Ga0157375_10388145 | |||
| 1281 | Ga0163163_10014242 | |||
| 1282 | Ga0163163_10031900 | |||
| 1283 | Ga0163163_10084549 | |||
| 1284 | Ga0163163_10101104 | |||
| 1285 | Ga0157380_10386182 | |||
| 1286 | Ga0182008_10159533 | |||
| 1287 | Ga0157379_10164090 | |||
| 1288 | Ga0157379_10229450 | |||
| 1289 | Ga0157376_10072336 | |||
| 1290 | Ga0157376_10341712 | |||
| 1291 | Ga0157376_10495273 | |||
| 1292 | Ga0197907_11341050 | |||
| 1293 | Ga0214544_1000001 | |||
| 1294 | Ga0214542_1000037 | |||
| 1295 | Ga0214545_1000003 | |||
| 1296 | Ga0214543_1003164 | |||
| 1297 | Ga0213873_10002609 | |||
| 1298 | Ga0213874_10038363 | |||
| 1299 | Ga0213876_10001294 | |||
| 1300 | Ga0213876_10036588 | |||
| 1301 | Ga0209677_100141 | |||
| 1302 | Ga0209677_104763 | |||
| 1303 | Ga0209148_1001050 | |||
| 1304 | Ga0209233_1001911 | |||
| 1305 | Ga0209233_1002619 | |||
| 1306 | Ga0209233_1003041 | |||
| 1307 | Ga0209233_1012666 | |||
| 1308 | Ga0209233_1024056 | |||
| 1309 | Ga0209455_1002697 | |||
| 1310 | Ga0209455_1008072 | |||
| 1311 | Ga0209758_1000133 | |||
| 1312 | Ga0209758_1001210 | |||
| 1313 | Ga0209758_1001389 | |||
| 1314 | Ga0209758_1001858 | |||
| 1315 | Ga0209758_1030965 | |||
| 1316 | Ga0209758_1036288 | |||
| 1317 | Ga0209758_1041696 | |||
| 1318 | Ga0209256_1008955 | |||
| 1319 | Ga0207426_1000572 | |||
| 1320 | Ga0207426_1000922 | |||
| 1321 | Ga0207656_10009794 | |||
| 1322 | Ga0207653_10065577 | |||
| 1323 | Ga0207692_10003529 | |||
| 1324 | Ga0207692_10008098 | |||
| 1325 | Ga0207642_10032263 | |||
| 1326 | Ga0207688_10064606 | |||
| 1327 | Ga0207688_10111212 | |||
| 1328 | Ga0207680_10209407 | |||
| 1329 | Ga0207647_10028454 | |||
| 1330 | Ga0207699_10015638 | |||
| 1331 | Ga0207699_10028697 | |||
| 1332 | Ga0207699_10055362 | |||
| 1333 | Ga0207699_10094082 | |||
| 1334 | Ga0207645_10025563 | |||
| 1335 | Ga0207705_10062712 | |||
| 1336 | Ga0207705_10224785 | |||
| 1337 | Ga0207707_10000378 | |||
| 1338 | Ga0207707_10003914 | |||
| 1339 | Ga0207707_10015104 | |||
| 1340 | Ga0207707_10040154 | |||
| 1341 | Ga0207707_10145220 | |||
| 1342 | Ga0207707_10241373 | |||
| 1343 | Ga0207695_10000008 | |||
| 1344 | Ga0207695_10101630 | |||
| 1345 | Ga0207695_10140228 | |||
| 1346 | Ga0207695_10290030 | |||
| 1347 | Ga0207671_10007497 | |||
| 1348 | Ga0207671_10059694 | |||
| 1349 | Ga0207671_10087252 | |||
| 1350 | Ga0207671_10148976 | |||
| 1351 | Ga0207693_10036084 | |||
| 1352 | Ga0207693_10037567 | |||
| 1353 | Ga0207693_10098994 | |||
| 1354 | Ga0207693_10211903 | |||
| 1355 | Ga0207663_10013512 | |||
| 1356 | Ga0207663_10014254 | |||
| 1357 | Ga0207663_10091012 | |||
| 1358 | Ga0207663_10097555 | |||
| 1359 | Ga0207663_10124488 | |||
| 1360 | Ga0207660_10007130 | |||
| 1361 | Ga0207660_10127243 | |||
| 1362 | Ga0207657_10001107 | |||
| 1363 | Ga0207657_10003265 | |||
| 1364 | Ga0207657_10113495 | |||
| 1365 | Ga0207649_10026045 | |||
| 1366 | Ga0207649_10131180 | |||
| 1367 | Ga0207649_10269050 | |||
| 1368 | Ga0207652_10006801 | |||
| 1369 | Ga0207652_10107372 | |||
| 1370 | Ga0207652_10222297 | |||
| 1371 | Ga0207652_10239816 | |||
| 1372 | Ga0207646_10091694 | |||
| 1373 | Ga0207681_10029279 | |||
| 1374 | Ga0207650_10130461 | |||
| 1375 | Ga0207687_10041702 | |||
| 1376 | Ga0207687_10052723 | |||
| 1377 | Ga0207700_10002327 | |||
| 1378 | Ga0207700_10065839 | |||
| 1379 | Ga0207700_10139930 | |||
| 1380 | Ga0207700_10154298 | |||
| 1381 | Ga0207664_10020316 | |||
| 1382 | Ga0207664_10174642 | |||
| 1383 | Ga0207644_10018273 | |||
| 1384 | Ga0207706_10068509 | |||
| 1385 | Ga0207706_10167217 | |||
| 1386 | Ga0207665_10000599 | |||
| 1387 | Ga0207665_10000989 | |||
| 1388 | Ga0207665_10009005 | |||
| 1389 | Ga0207665_10159629 | |||
| 1390 | Ga0207711_10270876 | |||
| 1391 | Ga0207689_10098727 | |||
| 1392 | Ga0207661_10004542 | |||
| 1393 | Ga0207661_10011383 | |||
| 1394 | Ga0207679_10090200 | |||
| 1395 | Ga0207667_10006765 | |||
| 1396 | Ga0207667_10057259 | |||
| 1397 | Ga0207667_10133086 | |||
| 1398 | Ga0207667_10264579 | |||
| 1399 | Ga0207667_10637164 | |||
| 1400 | Ga0207651_10019867 | |||
| 1401 | Ga0207668_10073062 | |||
| 1402 | Ga0207668_10297551 | |||
| 1403 | Ga0207668_10310918 | |||
| 1404 | Ga0207640_10149049 | |||
| 1405 | Ga0207640_10192060 | |||
| 1406 | Ga0207677_10092314 | |||
| 1407 | Ga0207703_10145131 | |||
| 1408 | Ga0207639_10064595 | |||
| 1409 | Ga0207639_10097565 | |||
| 1410 | Ga0207678_10015836 | |||
| 1411 | Ga0207678_10039984 | |||
| 1412 | Ga0207678_10087807 | |||
| 1413 | Ga0207678_10198595 | |||
| 1414 | Ga0207678_10298558 | |||
| 1415 | Ga0207708_10020945 | |||
| 1416 | Ga0207702_10000779 | |||
| 1417 | Ga0207648_10424675 | |||
| 1418 | Ga0207674_10026227 | |||
| 1419 | Ga0207674_10053367 | |||
| 1420 | Ga0207674_10110411 | |||
| 1421 | Ga0207674_10306423 | |||
| 1422 | Ga0207675_100054504 | |||
| 1423 | Ga0207675_100214219 | |||
| 1424 | Ga0207683_10091726 | |||
| 1425 | Ga0207683_10093548 | |||
| 1426 | Ga0209389_1000001 | |||
| 1427 | Ga0209389_1000115 | |||
| 1428 | Ga0209589_1000014 | |||
| 1429 | Ga0209589_1000033 | |||
| 1430 | Ga0209489_100014 | |||
| 1431 | Ga0209489_100040 | |||
| 1432 | Ga0209489_100612 | |||
| 1433 | Ga0209700_100007 | |||
| 1434 | Ga0209700_100024 | |||
| 1435 | Ga0209588_1004503 | |||
| 1436 | Ga0209813_10031470 | |||
| 1437 | Ga0268266_10009754 | |||
| 1438 | Ga0268266_10033753 | |||
| 1439 | Ga0268266_10105551 | |||
| 1440 | Ga0268265_10021705 | |||
| 1441 | Ga0268265_10033146 | |||
| 1442 | Ga0268265_10042573 | |||
| 1443 | Ga0268265_10057495 | |||
| 1444 | Ga0268265_10251507 | |||
| 1445 | Ga0268264_10000048 | |||
| 1446 | Ga0265337_1004222 | |||
| 1447 | Ga0265326_10001217 | |||
| 1448 | Ga0265334_10001564 | |||
| 1449 | Ga0265334_10016758 | |||
| 1450 | Ga0265323_10003591 | |||
| 1451 | Ga0265336_10000135 | |||
| 1452 | Ga0307517_10000634 | |||
| 1453 | Ga0307515_10023148 | |||
| 1454 | Ga0265338_10000034 | |||
| 1455 | Ga0265324_10001038 | |||
| 1456 | Ga0265330_10038253 | |||
| 1457 | Ga0265332_10017916 | |||
| 1458 | Ga0265328_10076070 | |||
| 1459 | Ga0265325_10005682 | |||
| 1460 | Ga0265339_10005528 | |||
| 1461 | Ga0265339_10061435 | |||
| 1462 | Ga0265331_10074106 | |||
| 1463 | Ga0307509_10005003 | |||
| 1464 | Ga0265313_10092749 | |||
| 1465 | Ga0307508_10000032 | |||
| 1466 | Ga0265314_10003829 | |||
| 1467 | Ga0307516_10014729 | |||
| 1468 | Ga0307516_10015757 | |||
| 1469 | Ga0307516_10060750 | |||
| 1470 | Ga0307410_10173310 | |||
| 1471 | Ga0307409_100060585 | |||
| 1472 | Ga0307411_10048097 | |||
| 1473 | Ga0307415_100207491 | |||
| 1474 | Ga0307510_10019976 | |||
| 1475 | Ga0307510_10023227 | |||
| 1476 | Ga0307510_10039297 | |||
| 1477 | Ga0307510_10160585 | |||
| 1478 | Ga0315911_1000002 | |||
| 1479 | Ga0373926_0022117 | |||
| 1480 | Ga0373934_0008656 | |||
| 1481 | Ga0373934_0021398 | |||
| 1482 | Ga0373934_0060792 | |||
| 1483 | Ga0373923_0006710 | |||
| 1484 | Ga0373923_0024439 | |||
| 1485 | Ga0373953_0001202 | |||
| 1486 | Ga0373956_0079419 | |||
| 1487 | Ga0373956_0112321 | |||
| 1488 | Ga0373943_0022074 | |||
| 1489 | Ga0373943_0032461 | |||
| 1490 | Ga0373946_0029415 | |||
| 1491 | Ga0373961_0029300 | |||
| 1492 | Ga0373924_0077438 | |||
| 1493 | Ga0373931_0025233 | |||
| 1494 | Ga0373935_0004267 | |||
| 1495 | Ga0373935_0038394 | |||
| 1496 | Ga0373935_0043463 | |||
| 1497 | Ga0373935_0185748 | |||
| 1498 | Ga0373935_0303875 | |||
| 1499 | Ga0373927_0001468 | |||
| 1500 | Ga0373927_0004710 | |||
| 1501 | Ga0373927_0014398 | |||
| 1502 | Ga0373927_0018761 | |||
| 1503 | Ga0373927_0147927 | |||
| 1504 | Ga0373933_0000468 | |||
| 1505 | Ga0373933_0011609 | |||
| 1506 | Ga0373947_0000755 | |||
| 1507 | Ga0373947_0009037 | |||
| 1508 | Ga0373947_0028170 | |||
| 1509 | Ga0373937_0065466 | |||
| 1510 | Ga0373937_0141690 | |||
| 1511 | Ga0373925_0002143 | |||
| 1512 | Ga0373925_0023873 | |||
| 1513 | Ga0373925_0126935 | |||
| 1514 | Ga0395900_0018596 | |||
| 1515 | Ga0395900_0024838 | |||
| 1516 | Ga0395898_0121342 | |||
| 1517 | Ga0395905_0004426 | |||
| 1518 | Ga0395905_0539340 | |||
| 1519 | Ga0436364_0657610 | |||
| 1520 | Ga0436364_1050353 | |||
| 1521 | Ga0395901_0173274 | |||
| 1522 | Ga0436365_0243105 | |||
| 1523 | Ga0436365_0747294 | |||
| 1524 | Ga0436361_1058286 | |||
| 1525 | Ga0436363_0182376 | |||
| 1526 | Ga0436363_0350177 | |||
| 1527 | Ga0436363_1367285 | |||
| 1528 | Ga0436362_0407438 | |||
| 1529 | Ga0436362_0927305 | |||
| 1530 | Ga0439465_0106631 | |||
| 1531 | Ga0451789_1039392 | |||
| 1532 | Ga0466969_0014273 | |||
| 1533 | Ga0466972_0005057 | |||
| 1534 | Ga0466972_0007791 | |||
| 1535 | Ga0466966_0002686 | |||
| 1536 | Ga0466961_0013054 | |||
| 1537 | Ga0466963_0006089 | |||
| 1538 | Ga0466964_0022688 | |||
| 1539 | Ga0466964_0153800 | |||
| 1540 | Ga0466968_0137217 | |||
| 1541 | Ga0466970_0180042 | |||
| 1542 | Ga0466960_0016867 | |||
| 1543 | Ga0466960_0019583 | |||
| 1544 | Ga0466959_0000295 | |||
| 1545 | Ga0466959_0008200 | |||
| 1546 | Ga0466967_0022428 | |||
| 1547 | Ga0466967_0052094 | |||
| 1548 | Ga0466967_0155879 | |||
| 1549 | Ga0495617_007067 | |||
| 1550 | Ga0495592_0011034 | |||
| 1551 | Ga0495592_0038923 | |||
| 1552 | Ga0495592_0066492 | |||
| 1553 | Ga0495592_0074803 | |||
| 1554 | Ga0495592_0156236 | |||
| 1555 | Ga0495603_0000217 | |||
| 1556 | Ga0495603_0038110 | |||
| 1557 | Ga0495603_0131508 | |||
| 1558 | Ga0495629_0000188 | |||
| 1559 | Ga0495629_0002216 | |||
| 1560 | Ga0495629_0034036 | |||
| 1561 | Ga0495629_0042622 | |||
| 1562 | Ga0495629_0043445 | |||
| 1563 | Ga0495638_0025061 | |||
| 1564 | Ga0495641_0003739 | |||
| 1565 | Ga0495653_0002239 | |||
| 1566 | Ga0495653_0288583 | |||
| 1567 | Ga0495580_0003058 | |||
| 1568 | Ga0495580_0014052 | |||
| 1569 | Ga0495582_0002016 | |||
| 1570 | Ga0495582_0075786 | |||
| 1571 | Ga0495639_0000011 | |||
| 1572 | Ga0495639_0168786 | |||
| 1573 | Ga0495662_0004000 | |||
| 1574 | Ga0495664_0017699 | |||
| 1575 | Ga0495664_0025627 | |||
| 1576 | Ga0495664_0045898 | |||
| 1577 | Ga0495664_0054670 | |||
| 1578 | Ga0495585_0058763 | |||
| 1579 | Ga0495585_0087821 | |||
| 1580 | Ga0495594_0000128 | |||
| 1581 | Ga0495606_0001136 | |||
| 1582 | Ga0495608_0002665 | |||
| 1583 | Ga0495608_0044800 | |||
| 1584 | Ga0495608_0085130 | |||
| 1585 | Ga0495610_0095640 | |||
| 1586 | Ga0495618_0035804 | |||
| 1587 | Ga0495618_0093384 | |||
| 1588 | Ga0495618_0133925 | |||
| 1589 | Ga0495618_0178193 | |||
| 1590 | Ga0495628_0019364 | |||
| 1591 | Ga0495628_0030475 | |||
| 1592 | Ga0495630_0020303 | |||
| 1593 | Ga0495648_0001581 | |||
| 1594 | Ga0495648_0071179 | |||
| 1595 | Ga0495652_0036486 | |||
| 1596 | Ga0495652_0052453 | |||
| 1597 | Ga0495652_0060264 | |||
| 1598 | Ga0495652_0142127 | |||
| 1599 | Ga0495652_0226984 | |||
| 1600 | Ga0495665_0000133 | |||
| 1601 | Ga0495665_0072816 | |||
| 1602 | Ga0495640_0021557 | |||
| 1603 | Ga0495640_0061522 | |||
| 1604 | Ga0495587_0003196 | |||
| 1605 | Ga0495587_0049352 | |||
| 1606 | Ga0495609_0053074 | |||
| 1607 | Ga0495645_0019327 | |||
| 1608 | Ga0495645_0066950 | |||
| 1609 | Ga0495622_0038041 | |||
| 1610 | Ga0495622_0039111 | |||
| 1611 | Ga0495622_0045787 | |||
| 1612 | Ga0495633_0066753 | |||
| 1613 | Ga0495667_0002279 | |||
| 1614 | Ga0495667_0195449 | |||
| 1615 | Ga0495656_0026754 | |||
| 1616 | Ga0495656_0062936 | |||
| 1617 | Ga0495656_0070150 | |||
| 1618 | Ga0495656_0082803 | |||
| 1619 | Ga0495668_0093215 | |||
| 1620 | Ga0495668_0111429 | |||
| 1621 | Ga0495634_0000402 | |||
| 1622 | Ga0495634_0016628 | |||
| 1623 | Ga0495634_0021616 | |||
| 1624 | Ga0495634_0063858 | |||
| 1625 | Ga0495634_0075246 | |||
| 1626 | Ga0495625_0198917 | |||
| 1627 | Ga0495635_0002969 | |||
| 1628 | Ga0495635_0011589 | |||
| 1629 | Ga0495635_0088433 | |||
| 1630 | Ga0495635_0120049 | |||
| 1631 | Ga0495659_0072713 | |||
| 1632 | Ga0495588_0011114 | |||
| 1633 | Ga0495588_0166697 | |||
| 1634 | Ga0495657_0003836 | |||
| 1635 | Ga0495657_0041808 | |||
| 1636 | Ga0495657_0046542 | |||
| 1637 | Ga0495657_0123855 | |||
| 1638 | Ga0495599_0016305 | |||
| 1639 | Ga0495623_0018366 | |||
| 1640 | Ga0495623_0045273 | |||
| 1641 | Ga0495646_0007865 | |||
| 1642 | Ga0495646_0021019 | |||
| 1643 | Ga0495646_0093719 | |||
| 1644 | Ga0495646_0130805 | |||
| 1645 | Ga0495647_0000726 | |||
| 1646 | Ga0495647_0056327 | |||
| 1647 | Ga0495658_0003384 | |||
| 1648 | Ga0495658_0035090 | |||
| 1649 | Ga0495658_0043614 | |||
| 1650 | Ga0495669_0002591 | |||
| 1651 | Ga0495613_0011524 | |||
| 1652 | Ga0495613_0055930 | |||
| 1653 | Ga0495613_0199905 | |||
| 1654 | Ga0495624_0004589 | |||
| 1655 | Ga0495624_0074296 | |||
| 1656 | Ga0495624_0095893 | |||
| 1657 | Ga0495649_0030744 | |||
| 1658 | Ga0495600_0001564 | |||
| 1659 | Ga0495600_0017101 | |||
| 1660 | Ga0495600_0126167 | |||
| 1661 | Ga0495581_0000293 | |||
| 1662 | Ga0495581_0066555 | |||
| 1663 | Ga0495604_0023177 | |||
| 1664 | Ga0495604_0032809 | |||
| 1665 | Ga0495604_0058794 | |||
| 1666 | Ga0495604_0157206 | |||
| 1667 | Ga0495604_0243647 | |||
| 1668 | Ga0495674_0034247 | |||
| 1669 | Ga0495674_0083876 | |||
| 1670 | Ga0495674_0108900 | |||
| 1671 | Ga0495674_0129124 | |||
| 1672 | Ga0495674_0222055 | |||
| 1673 | Ga0495676_0034309 | |||
| 1674 | Ga0495676_0071194 | |||
| 1675 | Ga0495676_0097427 | |||
| 1676 | Ga0495676_0208289 | |||
| 1677 | Ga0495680_0006108 | |||
| 1678 | Ga0495680_0008575 | |||
| 1679 | Ga0495683_0046041 | |||
| 1680 | Ga0495687_018229 | |||
| 1681 | Ga0495675_0000992 | |||
| 1682 | Ga0495675_0011731 | |||
| 1683 | Ga0495675_0194360 | |||
| 1684 | Ga0495677_0028610 | |||
| 1685 | Ga0495673_0024109 | |||
| 1686 | Ga0495681_0103321 | |||
| 1687 | Ga0495684_0007190 | |||
| 1688 | Ga0495684_0116894 | |||
| 1689 | Ga0495593_0002447 | |||
| 1690 | Ga0495593_0009337 | |||
| 1691 | Ga0495593_0012613 | |||
| 1692 | Ga0495593_0045765 | |||
| 1693 | Ga0495602_0005521 | |||
| 1694 | Ga0495602_0015003 | |||
| 1695 | Ga0495602_0049263 | |||
| 1696 | Ga0495602_0137328 | |||
| 1697 | Ga0495602_0201633 | |||
| 1698 | Ga0495602_0289264 | |||
| 1699 | Ga0495614_0101681 | |||
| 1700 | Ga0496100_0034795 | |||
| 1701 | Ga0496100_0124209 | |||
| 1702 | Ga0496100_0126437 | |||
| 1703 | Ga0496100_0223971 | |||
| 1704 | Ga0496101_0036213 | |||
| 1705 | Ga0496101_0123816 | |||
| 1706 | Ga0496101_0202452 | |||
| 1707 | Ga0496101_0377778 | |||
| 1708 | Ga0496101_0398907 | |||
| 1709 | Ga0496102_0007134 | |||
| 1710 | Ga0496102_0276272 | |||
| 1711 | Ga0496102_0369009 | |||
| 1712 | Ga0496103_0008518 | |||
| 1713 | Ga0496103_0016956 | |||
| 1714 | Ga0496104_0005863 | |||
| 1715 | Ga0496104_0023259 | |||
| 1716 | Ga0496104_0062966 | |||
| 1717 | Ga0496104_0219259 | |||
| 1718 | Ga0496104_0221824 | |||
| 1719 | Ga0496104_0349954 | |||
| 1720 | Ga0496104_0496952 | |||
| 1721 | Ga0496105_0004094 | |||
| 1722 | Ga0496105_0006944 | |||
| 1723 | Ga0496105_0040042 | |||
| 1724 | Ga0496105_0040322 | |||
| 1725 | Ga0496105_0135740 | |||
| 1726 | Ga0496105_0166849 | |||
| 1727 | Ga0496106_0062278 | |||
| 1728 | Ga0496106_0155379 | |||
| 1729 | Ga0496106_0204293 | |||
| 1730 | Ga0496106_0296122 | |||
| 1731 | Ga0496106_0424758 | |||
| 1732 | Ga0496107_0001167 | |||
| 1733 | Ga0496107_0155030 | |||
| 1734 | Ga0496108_0011742 | |||
| 1735 | Ga0496108_0019121 | |||
| 1736 | Ga0496108_0056020 | |||
| 1737 | Ga0496108_0125095 | |||
| 1738 | Ga0496108_0409151 | |||
| 1739 | Ga0496109_0047215 | |||
| 1740 | Ga0496109_0193893 | |||
| 1741 | Ga0496109_0194499 | |||
| 1742 | Ga0496109_0332428 | |||
| 1743 | Ga0496109_0530604 | |||
| 1744 | Ga0496110_0006530 | |||
| 1745 | Ga0496110_0052942 | |||
| 1746 | Ga0496111_0017721 | |||
| 1747 | Ga0496111_0075559 | |||
| 1748 | Ga0496111_0255979 | |||
| 1749 | Ga0496112_0014473 | |||
| 1750 | Ga0496112_0018995 | |||
| 1751 | Ga0496112_0041488 | |||
| 1752 | Ga0496112_0110064 | |||
| 1753 | Ga0496113_0004386 | |||
| 1754 | Ga0496113_0034043 | |||
| 1755 | Ga0496113_0080775 | |||
| 1756 | Ga0496113_0228541 | |||
| 1757 | Ga0496114_0017028 | |||
| 1758 | Ga0496114_0054141 | |||
| 1759 | Ga0496115_0001479 | |||
| 1760 | Ga0496115_0032780 | |||
| 1761 | Ga0496115_0073406 | |||
| 1762 | Ga0496115_0098802 | |||
| 1763 | Ga0496115_0144422 | |||
| 1764 | Ga0496115_0191408 | |||
| 1765 | Ga0496116_0040178 | |||
| 1766 | Ga0496117_0020747 | |||
| 1767 | Ga0496118_0001892 | |||
| 1768 | Ga0496118_0023504 | |||
| 1769 | Ga0496118_0060741 | |||
| 1770 | Ga0496118_0131089 | |||
| 1771 | Ga0496119_0053496 | |||
| 1772 | Ga0496119_0104269 | |||
| 1773 | Ga0496120_0025458 | |||
| 1774 | Ga0496121_0000041 | |||
| 1775 | Ga0496121_0000230 | |||
| 1776 | Ga0496121_0004531 | |||
| 1777 | Ga0496121_0008731 | |||
| 1778 | Ga0496121_0017726 | |||
| 1779 | Ga0496121_0019668 | |||
| 1780 | Ga0496121_0059253 | |||
| 1781 | Ga0496121_0072905 | |||
| 1782 | Ga0496121_0117823 | |||
| 1783 | Ga0496121_0131720 | |||
| 1784 | Ga0496121_0184469 | |||
| 1785 | Ga0496123_0047221 | |||
| 1786 | Ga0496124_0034797 | |||
| 1787 | Ga0496124_0040460 | |||
| 1788 | Ga0496124_0126098 | |||
| 1789 | Ga0496125_0000252 | |||
| 1790 | Ga0496125_0035547 | |||
| 1791 | Ga0496125_0057410 | |||
| 1792 | Ga0496125_0066686 | |||
| 1793 | Ga0496125_0098739 | |||
| 1794 | Ga0496125_0105909 | |||
| 1795 | Ga0496126_0002010 | |||
| 1796 | Ga0496126_0008238 | |||
| 1797 | Ga0496126_0010504 | |||
| 1798 | Ga0496126_0018510 | |||
| 1799 | Ga0496126_0038161 | |||
| 1800 | Ga0496126_0039667 | |||
| 1801 | Ga0496126_0053315 | |||
| 1802 | Ga0496126_0069195 | |||
| 1803 | Ga0496126_0138746 | |||
| 1804 | Ga0496126_0310637 | |||
| 1805 | Ga0496126_0338835 | |||
| 1806 | Ga0495682_0024062 | |||
| 1807 | Ga0501031_0001416 | |||
| 1808 | Ga0501031_0006220 | |||
| 1809 | Ga0501032_0000392 | |||
| 1810 | Ga0501032_0001535 | |||
| 1811 | Ga0501033_0000144 | |||
| 1812 | Ga0501033_0000311 | |||
| 1813 | Ga0501034_0000039 | |||
| 1814 | Ga0501034_0000412 | |||
| 1815 | Ga0501036_0000007 | |||
| 1816 | Ga0501036_0000127 | |||
| 1817 | Ga0501037_0000025 | |||
| 1818 | Ga0501037_0000066 | |||
| 1819 | Ga0501038_0000026 | |||
| 1820 | Ga0501038_0000168 | |||
| 1821 | Ga0501039_0000005 | |||
| 1822 | Ga0501039_0001738 | |||
| 1823 | Ga0501043_0000036 | |||
| 1824 | Ga0501043_0000120 | |||
| 1825 | Ga0501046_0000147 | |||
| 1826 | Ga0501046_0000359 | |||
| 1827 | Ga0501047_0000209 | |||
| 1828 | Ga0501047_0000379 | |||
| 1829 | Ga0501047_0291951 | |||
| 1830 | Ga0501047_0309509 | |||
| 1831 | Ga0501048_0000460 | |||
| 1832 | Ga0501048_0005136 | |||
| 1833 | Ga0501067_0000025 | |||
| 1834 | Ga0501067_0016819 | |||
| 1835 | Ga0501068_0017473 | |||
| 1836 | Ga0501069_0002392 | |||
| 1837 | Ga0501069_0006075 | |||
| 1838 | Ga0501070_0000163 | |||
| 1839 | Ga0501070_0000966 | |||
| 1840 | Ga0501070_0178694 | |||
| 1841 | Ga0501071_0063196 | |||
| 1842 | Ga0501072_0002586 | |||
| 1843 | Ga0501072_0061545 | |||
| 1844 | Ga0501073_0000070 | |||
| 1845 | Ga0501073_0001352 | |||
| 1846 | Ga0501073_0054892 | |||
| 1847 | Ga0501074_0001814 | |||
| 1848 | Ga0501079_0005974 | |||
| 1849 | Ga0501080_0000137 | |||
| 1850 | Ga0501080_0002456 | |||
| 1851 | Ga0501080_0091267 | |||
| 1852 | Ga0501083_0028039 | |||
| 1853 | Ga0501035_0000016 | |||
| 1854 | Ga0501035_0000052 | |||
| 1855 | Ga0501044_0000383 | |||
| 1856 | Ga0501044_0002732 | |||
| 1857 | Ga0501044_0156218 | |||
| 1858 | Ga0501044_0413306 | |||
| 1859 | Ga0501045_0082994 | |||
| 1860 | nmdc:mga00v17_113642_c1 | |||
| 1861 | nmdc:mga00v17_39454_c1 | |||
| 1862 | nmdc:mga0yw44_243563_c1 | |||
| 1863 | nmdc:mga0yw44_26866_c1 | |||
| 1864 | nmdc:mga0yw44_34076_c1 | |||
| 1865 | nmdc:mga0yw44_3647_c2 | |||
| 1866 | nmdc:mga06z11_9769_c1 | |||
| 1867 | nmdc:mga04h51_37502_c1 | |||
| 1868 | nmdc:mga07m45_128445_c1 | |||
| 1869 | nmdc:mga08y16_61139_c1 | |||
| 1870 | nmdc:mga0n895_103606_c1 | |||
| 1871 | nmdc:mga0sz30_67328_c1 | |||
| 1872 | Ga0495601_0013794 | |||
| 1873 | Ga0495601_0020668 | |||
| 1874 | Ga0495601_0031051 | |||
| 1875 | Ga0495601_0076982 | |||
| 1876 | Ga0495601_0138207 | |||
| 1877 | Ga0495612_0137178 | |||
| 1878 | Ga0500635_0007600 | |||
| 1879 | Ga0500635_0015481 | |||
| 1880 | Ga0495595_0149588 | |||
| 1881 | Ga0495619_0002521 | |||
| 1882 | Ga0495619_0056084 | |||
| 1883 | Ga0495619_0253750 | |||
| 1884 | Ga0500643_000069 | |||
| 1885 | Ga0500647_0001622 | |||
| 1886 | Ga0500651_0007198 | |||
| 1887 | Ga0500566_0000043 | |||
| 1888 | Ga0500566_0000734 | |||
| 1889 | Ga0500566_0068961 | |||
| 1890 | Ga0500641_0012688 | |||
| 1891 | Ga0500557_000003 | |||
| 1892 | Ga0500562_003178 | |||
| 1893 | Ga0500572_000024 | |||
| 1894 | Ga0500572_001373 | |||
| 1895 | Ga0500591_035119 | |||
| 1896 | Ga0500595_000722 | |||
| 1897 | Ga0500595_001932 | |||
| 1898 | Ga0500595_003276 | |||
| 1899 | Ga0500595_004221 | |||
| 1900 | Ga0500614_001183 | |||
| 1901 | Ga0500614_006252 | |||
| 1902 | Ga0500618_021887 | |||
| 1903 | Ga0500642_0000114 | |||
| 1904 | Ga0500642_0002387 | |||
| 1905 | Ga0500642_0065236 | |||
| 1906 | Ga0500559_0000773 | |||
| 1907 | Ga0500559_0001628 | |||
| 1908 | Ga0500559_0034228 | |||
| 1909 | Ga0500577_0005371 | |||
| 1910 | Ga0500589_099062 | |||
| 1911 | Ga0500603_000451 | |||
| 1912 | Ga0500603_002245 | |||
| 1913 | Ga0500616_0042944 | |||
| 1914 | Ga0500619_008894 | |||
| 1915 | Ga0500620_002958 | |||
| 1916 | Ga0500630_000056 | |||
| 1917 | Ga0500638_000489 | |||
| 1918 | Ga0500639_000099 | |||
| 1919 | Ga0500636_0003063 | |||
| 1920 | Ga0500637_0000042 | |||
| 1921 | Ga0500637_0022819 | |||
| 1922 | Ga0500645_025118 | |||
| 1923 | Ga0500596_007111 | |||
| 1924 | Ga0500601_000081 | |||
| 1925 | Ga0501084_0003876 | |||
| 1926 | Ga0500661_009657 | |||
| 1927 | Ga0501082_0005063 | |||
| 1928 | 8019649372 | |||
| 1929 | 2507507656 | |||
| 1930 | 2508541772 | |||
| 1931 | 2508692684 | |||
| 1932 | 2511398203 | |||
| 1933 | 2513621858 | |||
| 1934 | 2513642988 | |||
| 1935 | 2513647520 | |||
| 1936 | 2513654098 | |||
| 1937 | 2513674794 | |||
| 1938 | 2513698108 | |||
| 1939 | 2513701474 | |||
| 1940 | 2513721283 | |||
| 1941 | 2513856850 | |||
| 1942 | 2513878530 | |||
| 1943 | 2513891242 | |||
| 1944 | 2513918438 | |||
| 1945 | 2514009424 | |||
| 1946 | 2515626083 | |||
| 1947 | 2517104163 | |||
| 1948 | 2517891328 | |||
| 1949 | 2524436274 | |||
| 1950 | 2524468481 | |||
| 1951 | 2524540865 | |||
| 1952 | 2528848975 | |||
| 1953 | 2617346804 | |||
| 1954 | 2617372735 | |||
| 1955 | 2644287469 | |||
| 1956 | 2671123858 | |||
| 1957 | 2723843681 | |||
| 1958 | 2728750040 | |||
| 1959 | 2745080771 | |||
| 1960 | 2793065202 | |||
| 1961 | 2793066696 | |||
| 1962 | 2793083790 | |||
| 1963 | 2805919046 | |||
| 1964 | 2818236557 | |||
| 1965 | 2824606530 | |||
| 1966 | 2824613053 | |||
| 1967 | 2824620429 | |||
| 1968 | 2824628523 | |||
| 1969 | 2824637223 | |||
| 1970 | 2824650836 | |||
| 1971 | 2824658546 | |||
| 1972 | 2824666494 | |||
| 1973 | 2824674112 | |||
| 1974 | 2824684940 | |||
| 1975 | 2824694399 | |||
| 1976 | 2824703216 | |||
| 1977 | 2824708905 | |||
| 1978 | 2824721338 | |||
| 1979 | 2824725616 | |||
| 1980 | 2824739488 | |||
| 1981 | 2824750112 | |||
| 1982 | 2824755986 | |||
| 1983 | 2824767524 | |||
| 1984 | 2824775119 | |||
| 1985 | 2838130472 | |||
| 1986 | 2841948120 | |||
| 1987 | 2841953485 | |||
| 1988 | 2841962917 | |||
| 1989 | 2841972038 | |||
| 1990 | 2841978214 | |||
| 1991 | 2841990984 | |||
| 1992 | 2842040654 | |||
| 1993 | 2842046400 | |||
| 1994 | 2844320031 | |||
| 1995 | 2847937329 | |||
| 1996 | 2847947749 | |||
| 1997 | 2849078391 | |||
| 1998 | 2857512766 | |||
| 1999 | 2874598769 | |||
| 2000 | 2874607411 | |||
| 2001 | 2874614565 | |||
| 2002 | 2874628087 | |||
| 2003 | 2874635001 | |||
| 2004 | 2874652225 | |||
| 2005 | 2876771040 | |||
| 2006 | 2876778808 | |||
| 2007 | 2876817705 | |||
| 2008 | 2876824297 | |||
| 2009 | 2879082601 | |||
| 2010 | 2879086629 | |||
| 2011 | 2879107139 | |||
| 2012 | 2879111868 | |||
| 2013 | 2879131518 | |||
| 2014 | 2879147964 | |||
| 2015 | 2881371455 | |||
| 2016 | 2881666585 | |||
| 2017 | 2885369974 | |||
| 2018 | 2885377033 | |||
| 2019 | 2885391393 | |||
| 2020 | 2885417890 | |||
| 2021 | 2888385457 | |||
| 2022 | 2888392774 | |||
| 2023 | 2888425589 | |||
| 2024 | 2889038010 | |||
| 2025 | 2903730295 | |||
| 2026 | 2903755289 | |||
| 2027 | 2903769729 | |||
| 2028 | 2904674295 | |||
| 2029 | 2904694501 | |||
| 2030 | 2904701275 | |||
| 2031 | 2904711969 | |||
| 2032 | 2906609856 | |||
| 2033 | 2906616514 | |||
| 2034 | 2906627348 | |||
| 2035 | 2906635285 | |||
| 2036 | 2906643954 | |||
| 2037 | 2906663011 | |||
| 2038 | 2908741682 | |||
| 2039 | 2908759157 | |||
| 2040 | 2908781177 | |||
| 2041 | 2922366012 | |||
| 2042 | 2922372401 | |||
| 2043 | 2922386826 | |||
| 2044 | 2922397068 | |||
| 2045 | 2922431467 | |||
| 2046 | 2928104462 | |||
| 2047 | 2929621029 | |||
| 2048 | 2929626140 | |||
| 2049 | 2932784980 | |||
| 2050 | 2932795145 | |||
| 2051 | 2932805673 | |||
| 2052 | 2932810014 | |||
| 2053 | 2932827011 | |||
| 2054 | 2932828817 | |||
| 2055 | 2933583101 | |||
| 2056 | 2935609836 | |||
| 2057 | 2935619763 | |||
| 2058 | 2935636227 | |||
| 2059 | 2935638744 | |||
| 2060 | 2935652134 | |||
| 2061 | 2935659893 | |||
| 2062 | 2935666405 | |||
| 2063 | 2935676548 | |||
| 2064 | 2935690780 | |||
| 2065 | 2935694629 | |||
| 2066 | 2935703750 | |||
| 2067 | 2935718161 | |||
| 2068 | 2935727858 | |||
| 2069 | 2935736562 | |||
| 2070 | 2935745941 | |||
| 2071 | 2935756322 | |||
| 2072 | 2935760574 | |||
| 2073 | 2935776992 | |||
| 2074 | 2935783547 | |||
| 2075 | 2935792807 | |||
| 2076 | 2935800845 | |||
| 2077 | 2935801887 | |||
| 2078 | 2935814703 | |||
| 2079 | 2935822997 | |||
| 2080 | 2935828238 | |||
| 2081 | 2935842442 | |||
| 2082 | 2935848579 | |||
| 2083 | 2935857922 | |||
| 2084 | 2935868736 | |||
| 2085 | 2935874151 | |||
| 2086 | 2935883957 | |||
| 2087 | 2935909614 | |||
| 2088 | 2935917339 | |||
| 2089 | 2935927095 | |||
| 2090 | 2935937061 | |||
| 2091 | 2935944636 | |||
| 2092 | 2935953073 | |||
| 2093 | 2935966573 | |||
| 2094 | 2935969913 | |||
| 2095 | 2935976509 | |||
| 2096 | 2935987037 | |||
| 2097 | 2935992924 | |||
| 2098 | 2936002837 | |||
| 2099 | 2936014309 | |||
| 2100 | 2936023851 | |||
| 2101 | 2936031494 | |||
| 2102 | 2936040654 | |||
| 2103 | 2936049415 | |||
| 2104 | 2936062165 | |||
| 2105 | 2940561703 | |||
| 2106 | 2941512858 | |||
| 2107 | 2941520575 | |||
| 2108 | 2941528589 | |||
| 2109 | 2941531216 | |||
| 2110 | 2941542491 | |||
| 2111 | 3005481260 | |||
| 2112 | 3005484785 | |||
| 2113 | 3005508428 | |||
| 2114 | 3005588073 | |||
| 2115 | 3005600322 | |||
| 2116 | 3005715812 | |||
| 2117 | 3005723168 | |||
| 2118 | 8006928387 | |||
| 2119 | 8006939450 | |||
| 2120 | 8006972113 | |||
| 2121 | 8006979200 | |||
| 2122 | 8006984433 | |||
| 2123 | 8007001367 | |||
| 2124 | 8016520652 | |||
| 2125 | 8016528682 | |||
| 2126 | 8016533857 | |||
| 2127 | 8016547081 | |||
| 2128 | 8016555042 | |||
| 2129 | 8016563407 | |||
| 2130 | 8016572190 | |||
| 2131 | 8016576386 | |||
| 2132 | 8016594346 | |||
| 2133 | 8016601156 | |||
| 2134 | 8016609288 | |||
| 2135 | 8016625607 | |||
| 2136 | 8016639167 | |||
| 2137 | 8017064927 | |||
| 2138 | 8019533628 | |||
| 2139 | 8019546036 | |||
| 2140 | 8019552686 | |||
| 2141 | 8019565325 | |||
| 2142 | 8019575425 | |||
| 2143 | 8019584304 | |||
| 2144 | 8019592074 | |||
| 2145 | 8019599211 | |||
| 2146 | 8019609148 | |||
| 2147 | 8019619818 | |||
| 2148 | 8019633297 | |||
| 2149 | 8019646604 | |||
| 2150 | 8019661171 | |||
| 2151 | 8019670722 | |||
| 2152 | 8019685511 | |||
| 2153 | 8019691077 | |||
| 2154 | 8055745108 | |||
| 2155 | 8056679830 | |||
| 2156 | 8056684753 | |||
| 2157 | 8056693053 | |||
| 2158 | 8056975061 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5a7v-assembly2.cif.gz_B | the gh130 family of mannoside phosphorylases contains glycoside hydrolases that target beta-1,2 mannosidic linkages in candida mannan | 0.7672 | 18 | 51 |
| 3qc2-assembly2.cif.gz_B | crystal structure of a glycosyl hydrolase (bacova_03624) from bacteroides ovatus at 2.30 a resolution | 0.7667 | 19 | 51 |
| 3dxp-assembly1.cif.gz_A-2 | crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution | 0.7573 | 4 | 322 |
| 3qc2-assembly1.cif.gz_A | crystal structure of a glycosyl hydrolase (bacova_03624) from bacteroides ovatus at 2.30 a resolution | 0.7451 | 18 | 51 |
| 3dxp-assembly1.cif.gz_A-2 | crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution | 0.7368 | 4 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8RWZ3_128_373_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8017 | 116 | 327 | 3.90.1200.10 |
| af_Q709F0_125_359_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.7967 | 107 | 328 | 3.90.1200.10 |
| af_O01590_328_568_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.7915 | 107 | 324 | 3.90.1200.10 |
| af_O01590_229_326_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7868 | 1 | 105 | 3.30.200.20 |
| af_O01590_229_326_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7799 | 1 | 105 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A109JZ67-F1-model_v4 | Tyrosine protein kinase | 0.9721 | 1 | 327 |
GO:0016301
|
| AF-A0A109JZ67-F1-model_v4 | Tyrosine protein kinase | 0.9692 | 1 | 327 |
GO:0016301
|
| AF-A0A1G6W9Y5-F1-model_v4 | Predicted kinase, aminoglycoside phosphotransferase (APT) family | 0.967 | 73 | 327 |
GO:0016301
|
| AF-N1MNU0-F1-model_v4 | Aminoglycoside phosphotransferase | 0.9643 | 91 | 323 |
GO:0016740
|
| AF-A0A2N3EIB2-F1-model_v4 | Phosphotransferase family protein | 0.9601 | 2 | 311 |
GO:0016301
|