F489658

General Info

Members Datasets Scaffolds Average Seq Length
1079 615 2158 327

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8019648815|8019649372
Length 358
Sequence ELSRSVQRWCPGATGVTGAAKLSGGASQETWCFDITHPDGPIGAILRRSPKGYGAAPTRAAGLAAEAQLMQLAYEAGVPSPRVMHVLTPDEDLGTGFIMQRVEGETIARKILRDDEFAAARPLLARQIGGVLAGLHRLPQDKLPELRSRNATQEISEFDRDYRSLNWPKPVFELALRWLRDHDPGPSDETTLVHGDFRNGNLIIGADGVRAVLDWELAHLGDPMEDLGWVCVNSWRFGEIDKPVGGFGSREELFAGYEAAGRKIDPSRVKFWEVMGTLRWGIMCGGMMQRFREGPDHSMERAMIGRRASETEIDLLCGCSRRGEVRHAGRTDTDRADQGGRRFPPQRHHAADLRPPGF

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
64 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
93 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
94 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
95 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
356 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
357 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
358 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
359 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
360 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
361 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
362 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
363 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
364 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
365 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
369 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
370 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
373 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
374 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
375 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
376 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
377 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
378 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
379 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
380 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
381 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
382 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
383 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
386 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
387 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
388 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
389 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
390 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
391 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
392 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
393 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
394 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
395 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
396 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
397 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
398 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
399 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
400 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
401 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
402 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
403 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
404 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
405 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
406 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
407 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
408 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
409 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
410 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
411 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
412 2643221651 Afipia sp. Root123D2 Isolate Unclassified
413 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
414 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
415 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
416 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
417 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
418 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
419 2791355199
420 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
421 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
422 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
423 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
424 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
425 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
426 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
427 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
428 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
429 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
430 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
431 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
432 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
433 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
434 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
435 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
436 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
437 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
438 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
439 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
440 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
441 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
442 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
443 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
444 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
445 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
446 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
447 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
448 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
449 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
450 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
451 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
452 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
453 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
454 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
455 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
456 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
457 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
458 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
459 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
460 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
461 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
462 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
463 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
464 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
465 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
466 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
467 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
468 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
469 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
470 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
471 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
472 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
473 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
474 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
475 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
476 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
477 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
478 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
479 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
480 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
481 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
482 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
483 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
484 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
485 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
486 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
487 2904699407
488 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
489 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
490 2906610324
491 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
492 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
493 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
494 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
495 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
496 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
497 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
498 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
499 2922368715
500 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
501 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
502 2922425934
503 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
504 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
505 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
506 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
507 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
508 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
509 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
510 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
511 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
512 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
513 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
514 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
515 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
516 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
517 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
518 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
519 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
520 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
521 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
522 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
523 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
524 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
525 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
526 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
527 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
528 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
529 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
530 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
531 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
532 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
533 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
534 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
535 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
536 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
537 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
538 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
539 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
540 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
541 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
542 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
543 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
544 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
545 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
546 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
547 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
548 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
549 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
550 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
551 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
552 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
553 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
554 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
555 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
556 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
557 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
558 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
559 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
560 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
561 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
562 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
563 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
564 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
565 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
566 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
567 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
568 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
569 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
570 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
571 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
572 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
573 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
574 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
575 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
576 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
577 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
578 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
579 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
580 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
581 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
582 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
583 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
584 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
585 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
586 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
587 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
588 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
589 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
590 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
591 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
592 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
593 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
594 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
595 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
596 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
597 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
598 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
599 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
600 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
601 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
602 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
603 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
604 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
605 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
606 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
607 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
608 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
609 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
610 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
611 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
612 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
613 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
614 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
615 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.86
Metatranscriptomes 0.09
Isolates 21.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.34
Nodule 16.96
Rhizoplane 6.21
Rhizosphere 57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C1662 2010549000 Bacteria 1244
2 JGI25406J46586_10000202 3300003203 Bacteria 26430
3 JGI25406J46586_10006725 3300003203 Bacteria 5283
4 JGI25153J46596_10000656 3300003215 Bacteria 21151
5 JGI25153J46596_10005271 3300003215 Bacteria 6797
6 JGI25153J46596_10006410 3300003215 Bacteria 5956
7 JGI25160J50197_1012923 3300003354 Bacteria 2870
8 JGI25404J52841_10006565 3300003659 Bacteria 2441
9 JGI25404J52841_10024028 3300003659 Bacteria 1314
10 Ga0055539_1006447 3300003752 Bacteria 1499
11 Ga0065165_1000926 3300005262 Bacteria 37690
12 Ga0065165_1001447 3300005262 Bacteria 25731
13 Ga0065715_10288260 3300005293 Bacteria 1069
14 Ga0070658_10142763 3300005327 Bacteria 2001
15 Ga0070683_100050018 3300005329 Bacteria 3867
16 Ga0070683_100092275 3300005329 Bacteria 2844
17 Ga0070683_100172892 3300005329 Bacteria 2051
18 Ga0070680_100007389 3300005336 Bacteria 8386
19 Ga0070680_100205070 3300005336 Bacteria 1663
20 Ga0070660_100350511 3300005339 Bacteria 1216
21 Ga0070661_100057205 3300005344 Bacteria 2858
22 Ga0070668_100058827 3300005347 Bacteria 2974
23 Ga0070668_100226390 3300005347 Bacteria 1544
24 Ga0070669_100046134 3300005353 Bacteria 3177
25 Ga0070671_100003878 3300005355 Bacteria 11754
26 Ga0070674_100116870 3300005356 Bacteria 1968
27 Ga0070673_100003986 3300005364 Bacteria 9291
28 Ga0070688_100010670 3300005365 Bacteria 5073
29 Ga0070709_10015754 3300005434 Bacteria 4305
30 Ga0070709_10016067 3300005434 Bacteria 4266
31 Ga0070709_10070318 3300005434 Bacteria 2255
32 Ga0070709_10125683 3300005434 Bacteria 1744
33 Ga0070714_100044060 3300005435 Bacteria 3776
34 Ga0070714_100063197 3300005435 Bacteria 3183
35 Ga0070714_100080070 3300005435 Bacteria 2842
36 Ga0070713_100001443 3300005436 Bacteria 15239
37 Ga0070713_100002226 3300005436 Bacteria 12577
38 Ga0070713_100007690 3300005436 Bacteria 7584
39 Ga0070713_100202384 3300005436 Bacteria 1794
40 Ga0070710_10003994 3300005437 Bacteria 6994
41 Ga0070710_10017245 3300005437 Bacteria 3691
42 Ga0070710_10022746 3300005437 Bacteria 3284
43 Ga0070701_10039619 3300005438 Bacteria 2391
44 Ga0070711_100005992 3300005439 Bacteria 7297
45 Ga0070711_100064294 3300005439 Bacteria 2563
46 Ga0070711_100084168 3300005439 Bacteria 2275
47 Ga0070711_100167189 3300005439 Bacteria 1673
48 Ga0070663_100045576 3300005455 Bacteria 3098
49 Ga0070663_100067261 3300005455 Bacteria 2598
50 Ga0070663_100163655 3300005455 Bacteria 1714
51 Ga0070663_100369269 3300005455 Bacteria 1166
52 Ga0070678_100013689 3300005456 Bacteria 5097
53 Ga0070678_100015766 3300005456 Bacteria 4813
54 Ga0070678_100080228 3300005456 Bacteria 2470
55 Ga0070678_100081184 3300005456 Bacteria 2457
56 Ga0070678_100144901 3300005456 Bacteria 1905
57 Ga0070678_100171511 3300005456 Bacteria 1767
58 Ga0070681_10013908 3300005458 Bacteria 8008
59 Ga0070681_10106713 3300005458 Bacteria 2742
60 Ga0070681_10138999 3300005458 Bacteria 2359
61 Ga0070681_10292834 3300005458 Bacteria 1538
62 Ga0070681_10346582 3300005458 Bacteria 1396
63 Ga0070707_100095241 3300005468 Bacteria 2883
64 Ga0070698_100196336 3300005471 Bacteria 1955
65 Ga0070679_100085294 3300005530 Bacteria 3145
66 Ga0070679_100139562 3300005530 Bacteria 2404
67 Ga0070679_100193859 3300005530 Bacteria 2000
68 Ga0070684_100016541 3300005535 Bacteria 6030
69 Ga0070684_100115656 3300005535 Bacteria 2409
70 Ga0070697_100138279 3300005536 Bacteria 2047
71 Ga0070697_100250047 3300005536 Bacteria 1516
72 Ga0068853_100046546 3300005539 Bacteria 3720
73 Ga0068853_100055730 3300005539 Bacteria 3407
74 Ga0068853_100083735 3300005539 Bacteria 2795
75 Ga0068853_100162127 3300005539 Bacteria 2019
76 Ga0068853_100180025 3300005539 Bacteria 1917
77 Ga0070672_100033812 3300005543 Bacteria 3875
78 Ga0070693_100125260 3300005547 Bacteria 1599
79 Ga0070665_100038548 3300005548 Bacteria 4804
80 Ga0070665_100059464 3300005548 Bacteria 3831
81 Ga0070665_100111668 3300005548 Bacteria 2736
82 Ga0070665_100159559 3300005548 Bacteria 2257
83 Ga0070665_100230192 3300005548 Bacteria 1853
84 Ga0070665_100252717 3300005548 Bacteria 1763
85 Ga0070665_100443474 3300005548 Bacteria 1307
86 Ga0070665_100446056 3300005548 Bacteria 1303
87 Ga0068855_100031944 3300005563 Bacteria 6285
88 Ga0068855_100091476 3300005563 Bacteria 3509
89 Ga0068855_100128442 3300005563 Bacteria 2896
90 Ga0068855_100218316 3300005563 Bacteria 2139
91 Ga0068855_100232775 3300005563 Bacteria 2062
92 Ga0068855_100467869 3300005563 Bacteria 1374
93 Ga0068857_100105694 3300005577 Bacteria 2528
94 Ga0068857_100152274 3300005577 Bacteria 2096
95 Ga0068857_100235326 3300005577 Bacteria 1676
96 Ga0068854_100047530 3300005578 Bacteria 3059
97 Ga0068854_100208899 3300005578 Bacteria 1539
98 Ga0068852_100008038 3300005616 Bacteria 7738
99 Ga0068859_100057641 3300005617 Bacteria 3912
100 Ga0068859_100255810 3300005617 Bacteria 1842
101 Ga0068864_100161963 3300005618 Bacteria 2034
102 Ga0068866_10035166 3300005718 Bacteria 2445
103 Ga0068866_10046557 3300005718 Bacteria 2182
104 Ga0068861_100113676 3300005719 Bacteria 2172
105 Ga0068861_100435358 3300005719 Bacteria 1171
106 Ga0068858_100128143 3300005842 Bacteria 2378
107 Ga0068860_100000081 3300005843 Bacteria 170066
108 Ga0068862_100024472 3300005844 Bacteria 5066
109 Ga0081455_10008418 3300005937 Bacteria 10729
110 Ga0081455_10029336 3300005937 Bacteria 5016
111 Ga0081455_10125796 3300005937 Bacteria 2012
112 Ga0081540_1001682 3300005983 Bacteria 18799
113 Ga0081540_1003361 3300005983 Bacteria 12678
114 Ga0081540_1013327 3300005983 Bacteria 5351
115 Ga0081540_1015125 3300005983 Bacteria 4897
116 Ga0081540_1019809 3300005983 Bacteria 4073
117 Ga0081540_1030166 3300005983 Bacteria 3008
118 Ga0081540_1031210 3300005983 Bacteria 2934
119 Ga0081540_1035542 3300005983 Bacteria 2670
120 Ga0081540_1035686 3300005983 Bacteria 2663
121 Ga0081540_1069505 3300005983 Bacteria 1636
122 Ga0081540_1092560 3300005983 Bacteria 1326
123 Ga0081539_10000768 3300005985 Bacteria 63055
124 Ga0081539_10001470 3300005985 Bacteria 39952
125 Ga0081539_10148442 3300005985 Bacteria 1131
126 Ga0070717_10002220 3300006028 Bacteria 13629
127 Ga0070717_10027436 3300006028 Bacteria 4552
128 Ga0070717_10396747 3300006028 Bacteria 1239
129 Ga0075365_10008851 3300006038 Bacteria 5745
130 Ga0070712_100023933 3300006175 Bacteria 4040
131 Ga0070712_100365819 3300006175 Bacteria 1184
132 Ga0075367_10101986 3300006178 Bacteria 1755
133 Ga0075369_10034323 3300006186 Bacteria 2152
134 Ga0075369_10037242 3300006186 Bacteria 2071
135 Ga0075369_10124082 3300006186 Bacteria 1170
136 Ga0075366_10054711 3300006195 Bacteria 2370
137 Ga0097621_100025839 3300006237 Bacteria 4599
138 Ga0075370_10186455 3300006353 Bacteria 1221
139 Ga0075434_100176723 3300006871 Bacteria 2155
140 Ga0075434_100465547 3300006871 Bacteria 1285
141 Ga0068865_100121416 3300006881 Bacteria 1943
142 Ga0097620_100057642 3300006931 Bacteria 3912
143 Ga0097620_100255803 3300006931 Bacteria 1842
144 Ga0099824_1016570 3300006942 Bacteria 6643
145 Ga0099824_1020870 3300006942 Bacteria 4701
146 Ga0099822_1009095 3300006943 Bacteria 12590
147 Ga0099794_10051835 3300007265 Bacteria 1977
148 Ga0105240_10007310 3300009093 Bacteria 16070
149 Ga0105240_10034676 3300009093 Bacteria 6507
150 Ga0105240_10364428 3300009093 Bacteria 1636
151 Ga0105240_10397933 3300009093 Bacteria 1552
152 Ga0105240_10403439 3300009093 Bacteria 1539
153 Ga0111539_10088037 3300009094 Bacteria 3648
154 Ga0105245_10069475 3300009098 Bacteria 3194
155 Ga0105245_10193858 3300009098 Bacteria 1948
156 Ga0105247_10213455 3300009101 Bacteria 1303
157 Ga0105243_10265591 3300009148 Bacteria 1539
158 Ga0105241_10032018 3300009174 Bacteria 3938
159 Ga0105241_10103601 3300009174 Bacteria 2266
160 Ga0105241_10181436 3300009174 Bacteria 1747
161 Ga0105241_10285971 3300009174 Bacteria 1410
162 Ga0105248_10137251 3300009177 Bacteria 2759
163 Ga0105237_10065725 3300009545 Bacteria 3622
164 Ga0105237_10084021 3300009545 Bacteria 3174
165 Ga0105237_10092782 3300009545 Bacteria 3009
166 Ga0105237_10372534 3300009545 Bacteria 1433
167 Ga0105238_10053335 3300009551 Bacteria 4063
168 Ga0105238_10100152 3300009551 Bacteria 2881
169 Ga0105238_10173286 3300009551 Bacteria 2134
170 Ga0105238_10273591 3300009551 Bacteria 1669
171 Ga0105249_10130613 3300009553 Bacteria 2398
172 Ga0105249_10567893 3300009553 Bacteria 1186
173 Ga0099796_10037812 3300010159 Bacteria 1616
174 Ga0105239_10041049 3300010375 Bacteria 5071
175 Ga0105239_10081303 3300010375 Bacteria 3566
176 Ga0105239_10083629 3300010375 Bacteria 3515
177 Ga0105239_10101891 3300010375 Bacteria 3177
178 Ga0105239_10118317 3300010375 Bacteria 2940
179 Ga0105239_10537119 3300010375 Bacteria 1331
180 Ga0105246_10021360 3300011119 Bacteria 4166
181 Ga0105246_10071388 3300011119 Bacteria 2445
182 Ga0105246_10125489 3300011119 Bacteria 1909
183 Ga0105246_10129453 3300011119 Bacteria 1883
184 Ga0157370_10230389 3300013104 Bacteria 1715
185 Ga0157369_10003327 3300013105 Bacteria 19098
186 Ga0157369_10008098 3300013105 Bacteria 12049
187 Ga0157369_10023406 3300013105 Bacteria 6879
188 Ga0157369_10078457 3300013105 Bacteria 3538
189 Ga0157374_10186319 3300013296 Bacteria 2029
190 Ga0157374_10277995 3300013296 Bacteria 1652
191 Ga0157378_10109720 3300013297 Bacteria 2528
192 Ga0157378_10207045 3300013297 Bacteria 1858
193 Ga0163162_10130979 3300013306 Bacteria 2617
194 Ga0163162_10132636 3300013306 Bacteria 2600
195 Ga0163162_10142857 3300013306 Bacteria 2508
196 Ga0163162_10453854 3300013306 Bacteria 1414
197 Ga0157372_10117900 3300013307 Bacteria 3045
198 Ga0157375_10186110 3300013308 Bacteria 2230
199 Ga0157375_10233150 3300013308 Bacteria 2000
200 Ga0157375_10332871 3300013308 Bacteria 1683
201 Ga0157375_10388145 3300013308 Bacteria 1563
202 Ga0163163_10014242 3300014325 Bacteria 7308
203 Ga0163163_10031900 3300014325 Bacteria 5088
204 Ga0163163_10084549 3300014325 Bacteria 3179
205 Ga0163163_10101104 3300014325 Bacteria 2905
206 Ga0157380_10386182 3300014326 Bacteria 1323
207 Ga0182008_10159533 3300014497 Bacteria 1134
208 Ga0157379_10164090 3300014968 Bacteria 2005
209 Ga0157379_10229450 3300014968 Bacteria 1683
210 Ga0157376_10072336 3300014969 Bacteria 2933
211 Ga0157376_10341712 3300014969 Bacteria 1430
212 Ga0157376_10495273 3300014969 Bacteria 1200
213 Ga0197907_11341050 3300020069 Bacteria 1939
214 Ga0214544_1000001 3300021320 Bacteria 783667
215 Ga0214542_1000037 3300021321 Bacteria 159256
216 Ga0214545_1000003 3300021324 Bacteria 720274
217 Ga0214543_1003164 3300021327 Bacteria 32141
218 Ga0213873_10002609 3300021358 Bacteria 3142
219 Ga0213874_10038363 3300021377 Bacteria 1422
220 Ga0213876_10001294 3300021384 Bacteria 15771
221 Ga0213876_10036588 3300021384 Bacteria 2589
222 Ga0209677_100141 3300025253 Bacteria 66656
223 Ga0209677_104763 3300025253 Bacteria 3785
224 Ga0209148_1001050 3300025254 Bacteria 17092
225 Ga0209233_1001911 3300025261 Bacteria 7979
226 Ga0209233_1002619 3300025261 Bacteria 6538
227 Ga0209233_1003041 3300025261 Bacteria 5971
228 Ga0209233_1012666 3300025261 Bacteria 2436
229 Ga0209233_1024056 3300025261 Bacteria 1530
230 Ga0209455_1002697 3300025272 Bacteria 6678
231 Ga0209455_1008072 3300025272 Bacteria 2898
232 Ga0209758_1000133 3300025297 Bacteria 182442
233 Ga0209758_1001210 3300025297 Bacteria 32486
234 Ga0209758_1001389 3300025297 Bacteria 28787
235 Ga0209758_1001858 3300025297 Bacteria 23145
236 Ga0209758_1030965 3300025297 Bacteria 2204
237 Ga0209758_1036288 3300025297 Bacteria 1927
238 Ga0209758_1041696 3300025297 Bacteria 1712
239 Ga0209256_1008955 3300025299 Bacteria 4501
240 Ga0207426_1000572 3300025302 Bacteria 49561
241 Ga0207426_1000922 3300025302 Bacteria 29405
242 Ga0207656_10009794 3300025321 Bacteria 3565
243 Ga0207653_10065577 3300025885 Bacteria 1233
244 Ga0207692_10003529 3300025898 Bacteria 6118
245 Ga0207692_10008098 3300025898 Bacteria 4338
246 Ga0207642_10032263 3300025899 Bacteria 2203
247 Ga0207688_10064606 3300025901 Bacteria 2067
248 Ga0207688_10111212 3300025901 Bacteria 1590
249 Ga0207680_10209407 3300025903 Bacteria 1332
250 Ga0207647_10028454 3300025904 Bacteria 3629
251 Ga0207699_10015638 3300025906 Bacteria 3947
252 Ga0207699_10028697 3300025906 Bacteria 3095
253 Ga0207699_10055362 3300025906 Bacteria 2360
254 Ga0207699_10094082 3300025906 Bacteria 1887
255 Ga0207645_10025563 3300025907 Bacteria 3820
256 Ga0207705_10062712 3300025909 Bacteria 2685
257 Ga0207705_10224785 3300025909 Bacteria 1427
258 Ga0207707_10000378 3300025912 Bacteria 46582
259 Ga0207707_10003914 3300025912 Bacteria 13215
260 Ga0207707_10015104 3300025912 Bacteria 6722
261 Ga0207707_10040154 3300025912 Bacteria 4088
262 Ga0207707_10145220 3300025912 Bacteria 2074
263 Ga0207707_10241373 3300025912 Bacteria 1571
264 Ga0207695_10000008 3300025913 Bacteria 1058268
265 Ga0207695_10101630 3300025913 Bacteria 2869
266 Ga0207695_10140228 3300025913 Bacteria 2366
267 Ga0207695_10290030 3300025913 Bacteria 1529
268 Ga0207671_10007497 3300025914 Bacteria 9463
269 Ga0207671_10059694 3300025914 Bacteria 2829
270 Ga0207671_10087252 3300025914 Bacteria 2346
271 Ga0207671_10148976 3300025914 Bacteria 1807
272 Ga0207693_10036084 3300025915 Bacteria 3896
273 Ga0207693_10037567 3300025915 Bacteria 3817
274 Ga0207693_10098994 3300025915 Bacteria 2286
275 Ga0207693_10211903 3300025915 Bacteria 1523
276 Ga0207663_10013512 3300025916 Bacteria 4440
277 Ga0207663_10014254 3300025916 Bacteria 4346
278 Ga0207663_10091012 3300025916 Bacteria 2024
279 Ga0207663_10097555 3300025916 Bacteria 1966
280 Ga0207663_10124488 3300025916 Bacteria 1771
281 Ga0207660_10007130 3300025917 Bacteria 7239
282 Ga0207660_10127243 3300025917 Bacteria 1936
283 Ga0207657_10001107 3300025919 Bacteria 28599
284 Ga0207657_10003265 3300025919 Bacteria 17354
285 Ga0207657_10113495 3300025919 Bacteria 2235
286 Ga0207649_10026045 3300025920 Bacteria 3417
287 Ga0207649_10131180 3300025920 Bacteria 1702
288 Ga0207649_10269050 3300025920 Bacteria 1234
289 Ga0207652_10006801 3300025921 Bacteria 9217
290 Ga0207652_10107372 3300025921 Bacteria 2472
291 Ga0207652_10222297 3300025921 Bacteria 1701
292 Ga0207652_10239816 3300025921 Bacteria 1634
293 Ga0207646_10091694 3300025922 Bacteria 2719
294 Ga0207681_10029279 3300025923 Bacteria 3575
295 Ga0207650_10130461 3300025925 Bacteria 1966
296 Ga0207687_10041702 3300025927 Bacteria 3153
297 Ga0207687_10052723 3300025927 Bacteria 2839
298 Ga0207700_10002327 3300025928 Bacteria 10893
299 Ga0207700_10065839 3300025928 Bacteria 2766
300 Ga0207700_10139930 3300025928 Bacteria 1987
301 Ga0207700_10154298 3300025928 Bacteria 1901
302 Ga0207664_10020316 3300025929 Bacteria 4920
303 Ga0207664_10174642 3300025929 Bacteria 1841
304 Ga0207644_10018273 3300025931 Bacteria 4741
305 Ga0207706_10068509 3300025933 Bacteria 3122
306 Ga0207706_10167217 3300025933 Bacteria 1933
307 Ga0207665_10000599 3300025939 Bacteria 24202
308 Ga0207665_10000989 3300025939 Bacteria 19216
309 Ga0207665_10009005 3300025939 Bacteria 6551
310 Ga0207665_10159629 3300025939 Bacteria 1621
311 Ga0207711_10270876 3300025941 Bacteria 1562
312 Ga0207689_10098727 3300025942 Bacteria 2399
313 Ga0207661_10004542 3300025944 Bacteria 9725
314 Ga0207661_10011383 3300025944 Bacteria 6443
315 Ga0207679_10090200 3300025945 Bacteria 2369
316 Ga0207667_10006765 3300025949 Bacteria 13842
317 Ga0207667_10057259 3300025949 Bacteria 4092
318 Ga0207667_10133086 3300025949 Bacteria 2561
319 Ga0207667_10264579 3300025949 Bacteria 1759
320 Ga0207667_10637164 3300025949 Bacteria 1072
321 Ga0207651_10019867 3300025960 Bacteria 4038
322 Ga0207668_10073062 3300025972 Bacteria 2456
323 Ga0207668_10297551 3300025972 Bacteria 1330
324 Ga0207668_10310918 3300025972 Bacteria 1304
325 Ga0207640_10149049 3300025981 Bacteria 1716
326 Ga0207640_10192060 3300025981 Bacteria 1540
327 Ga0207677_10092314 3300026023 Bacteria 2204
328 Ga0207703_10145131 3300026035 Bacteria 2063
329 Ga0207639_10064595 3300026041 Bacteria 2838
330 Ga0207639_10097565 3300026041 Bacteria 2367
331 Ga0207678_10015836 3300026067 Bacteria 6627
332 Ga0207678_10039984 3300026067 Bacteria 4068
333 Ga0207678_10087807 3300026067 Bacteria 2657
334 Ga0207678_10198595 3300026067 Bacteria 1714
335 Ga0207678_10298558 3300026067 Bacteria 1384
336 Ga0207708_10020945 3300026075 Bacteria 4933
337 Ga0207702_10000779 3300026078 Bacteria 33703
338 Ga0207648_10424675 3300026089 Bacteria 1207
339 Ga0207674_10026227 3300026116 Bacteria 6196
340 Ga0207674_10053367 3300026116 Bacteria 4121
341 Ga0207674_10110411 3300026116 Bacteria 2725
342 Ga0207674_10306423 3300026116 Bacteria 1537
343 Ga0207675_100054504 3300026118 Bacteria 3730
344 Ga0207675_100214219 3300026118 Bacteria 1854
345 Ga0207683_10091726 3300026121 Bacteria 2706
346 Ga0207683_10093548 3300026121 Bacteria 2679
347 Ga0209389_1000001 3300027296 Bacteria 463799
348 Ga0209389_1000115 3300027296 Bacteria 71798
349 Ga0209589_1000014 3300027357 Bacteria 227996
350 Ga0209589_1000033 3300027357 Bacteria 140561
351 Ga0209489_100014 3300027361 Bacteria 227996
352 Ga0209489_100040 3300027361 Bacteria 164986
353 Ga0209489_100612 3300027361 Bacteria 69168
354 Ga0209700_100007 3300027363 Bacteria 454608
355 Ga0209700_100024 3300027363 Bacteria 227996
356 Ga0209588_1004503 3300027671 Bacteria 3936
357 Ga0209813_10031470 3300027866 Bacteria 1566
358 Ga0268266_10009754 3300028379 Bacteria 8446
359 Ga0268266_10033753 3300028379 Bacteria 4350
360 Ga0268266_10105551 3300028379 Bacteria 2489
361 Ga0268265_10021705 3300028380 Bacteria 4502
362 Ga0268265_10033146 3300028380 Bacteria 3752
363 Ga0268265_10042573 3300028380 Bacteria 3370
364 Ga0268265_10057495 3300028380 Bacteria 2965
365 Ga0268265_10251507 3300028380 Bacteria 1565
366 Ga0268264_10000048 3300028381 Bacteria 334457
367 Ga0265337_1004222 3300028556 Bacteria 6011
368 Ga0265326_10001217 3300028558 Bacteria 9204
369 Ga0265334_10001564 3300028573 Bacteria 11023
370 Ga0265334_10016758 3300028573 Bacteria 3030
371 Ga0265323_10003591 3300028653 Bacteria 6810
372 Ga0265336_10000135 3300028666 Bacteria 52478
373 Ga0307517_10000634 3300028786 Bacteria 60194
374 Ga0307515_10023148 3300028794 Bacteria 10904
375 Ga0265338_10000034 3300028800 Bacteria 244623
376 Ga0265324_10001038 3300029957 Bacteria 17045
377 Ga0265330_10038253 3300031235 Bacteria 2133
378 Ga0265332_10017916 3300031238 Bacteria 3122
379 Ga0265328_10076070 3300031239 Bacteria 1235
380 Ga0265325_10005682 3300031241 Bacteria 7666
381 Ga0265339_10005528 3300031249 Bacteria 8406
382 Ga0265339_10061435 3300031249 Bacteria 2022
383 Ga0265331_10074106 3300031250 Bacteria 1589
384 Ga0307509_10005003 3300031507 Bacteria 18702
385 Ga0265313_10092749 3300031595 Bacteria 1352
386 Ga0307508_10000032 3300031616 Bacteria 163293
387 Ga0265314_10003829 3300031711 Bacteria 14364
388 Ga0307516_10014729 3300031730 Bacteria 8261
389 Ga0307516_10015757 3300031730 Bacteria 7942
390 Ga0307516_10060750 3300031730 Bacteria 3670
391 Ga0307410_10173310 3300031852 Bacteria 1628
392 Ga0307409_100060585 3300031995 Bacteria 2952
393 Ga0307411_10048097 3300032005 Bacteria 2762
394 Ga0307415_100207491 3300032126 Bacteria 1560
395 Ga0307510_10019976 3300033180 Bacteria 7845
396 Ga0307510_10023227 3300033180 Bacteria 7192
397 Ga0307510_10039297 3300033180 Bacteria 5216
398 Ga0307510_10160585 3300033180 Bacteria 1845
399 Ga0315911_1000002 3300033442 Bacteria 926833
400 Ga0373926_0022117 3300035083 Bacteria 2206
401 Ga0373934_0008656 3300035086 Bacteria 3796
402 Ga0373934_0021398 3300035086 Bacteria 2490
403 Ga0373934_0060792 3300035086 Bacteria 1505
404 Ga0373923_0006710 3300035111 Bacteria 4000
405 Ga0373923_0024439 3300035111 Bacteria 2385
406 Ga0373953_0001202 3300035117 Bacteria 7375
407 Ga0373956_0079419 3300035119 Bacteria 1504
408 Ga0373956_0112321 3300035119 Bacteria 1269
409 Ga0373943_0022074 3300035170 Bacteria 2945
410 Ga0373943_0032461 3300035170 Bacteria 2483
411 Ga0373946_0029415 3300035171 Bacteria 2186
412 Ga0373961_0029300 3300035241 Bacteria 1524
413 Ga0373924_0077438 3300035410 Bacteria 1410
414 Ga0373931_0025233 3300035691 Bacteria 3018
415 Ga0373935_0004267 3300035692 Bacteria 8382
416 Ga0373935_0038394 3300035692 Bacteria 2998
417 Ga0373935_0043463 3300035692 Bacteria 2828
418 Ga0373935_0185748 3300035692 Bacteria 1429
419 Ga0373935_0303875 3300035692 Bacteria 1128
420 Ga0373927_0001468 3300035695 Bacteria 17747
421 Ga0373927_0004710 3300035695 Bacteria 9507
422 Ga0373927_0014398 3300035695 Bacteria 5236
423 Ga0373927_0018761 3300035695 Bacteria 4538
424 Ga0373927_0147927 3300035695 Bacteria 1538
425 Ga0373933_0000468 3300035724 Bacteria 25246
426 Ga0373933_0011609 3300035724 Bacteria 4860
427 Ga0373947_0000755 3300035725 Bacteria 19381
428 Ga0373947_0009037 3300035725 Bacteria 5729
429 Ga0373947_0028170 3300035725 Bacteria 3291
430 Ga0373937_0065466 3300036401 Bacteria 3345
431 Ga0373937_0141690 3300036401 Bacteria 2249
432 Ga0373925_0002143 3300037068 Bacteria 16126
433 Ga0373925_0023873 3300037068 Bacteria 4460
434 Ga0373925_0126935 3300037068 Bacteria 1985
435 Ga0395900_0018596 3300037418 Bacteria 7086
436 Ga0395900_0024838 3300037418 Bacteria 6133
437 Ga0395898_0121342 3300037466 Bacteria 2504
438 Ga0395905_0004426 3300037471 Bacteria 14603
439 Ga0395905_0539340 3300037471 Bacteria 1068
440 Ga0436364_0657610 3300037853 Bacteria 1094
441 Ga0436364_1050353 3300037853 Bacteria 1156
442 Ga0395901_0173274 3300038443 Bacteria 2264
443 Ga0436365_0243105 3300039437 Bacteria 13839
444 Ga0436365_0747294 3300039437 Bacteria 2559
445 Ga0436361_1058286 3300039447 Bacteria 2398
446 Ga0436363_0182376 3300039450 Bacteria 2587
447 Ga0436363_0350177 3300039450 Bacteria 1445
448 Ga0436363_1367285 3300039450 Bacteria 1430
449 Ga0436362_0407438 3300039453 Bacteria 6183
450 Ga0436362_0927305 3300039453 Bacteria 8543
451 Ga0439465_0106631 3300041413 Bacteria 972
452 Ga0451789_1039392 3300041443 Bacteria 1498
453 Ga0466969_0014273 3300044656 Bacteria 4177
454 Ga0466972_0005057 3300044658 Bacteria 6608
455 Ga0466972_0007791 3300044658 Bacteria 5374
456 Ga0466966_0002686 3300044684 Bacteria 11650
457 Ga0466961_0013054 3300044693 Bacteria 5314
458 Ga0466963_0006089 3300044694 Bacteria 7115
459 Ga0466964_0022688 3300044706 Bacteria 2437
460 Ga0466964_0153800 3300044706 Bacteria 1069
461 Ga0466968_0137217 3300044735 Bacteria 1116
462 Ga0466970_0180042 3300044765 Bacteria 1173
463 Ga0466960_0016867 3300044901 Bacteria 3175
464 Ga0466960_0019583 3300044901 Bacteria 2985
465 Ga0466959_0000295 3300045049 Bacteria 29676
466 Ga0466959_0008200 3300045049 Bacteria 7372
467 Ga0466967_0022428 3300045976 Bacteria 5151
468 Ga0466967_0052094 3300045976 Bacteria 3590
469 Ga0466967_0155879 3300045976 Bacteria 2139
470 Ga0495617_007067 3300046452 Bacteria 3915
471 Ga0495592_0011034 3300046454 Bacteria 6817
472 Ga0495592_0038923 3300046454 Bacteria 3574
473 Ga0495592_0066492 3300046454 Bacteria 2637
474 Ga0495592_0074803 3300046454 Bacteria 2460
475 Ga0495592_0156236 3300046454 Bacteria 1573
476 Ga0495603_0000217 3300046455 Bacteria 29788
477 Ga0495603_0038110 3300046455 Bacteria 2883
478 Ga0495603_0131508 3300046455 Bacteria 1457
479 Ga0495629_0000188 3300046459 Bacteria 56009
480 Ga0495629_0002216 3300046459 Bacteria 14992
481 Ga0495629_0034036 3300046459 Bacteria 3602
482 Ga0495629_0042622 3300046459 Bacteria 3188
483 Ga0495629_0043445 3300046459 Bacteria 3155
484 Ga0495638_0025061 3300046460 Bacteria 3881
485 Ga0495641_0003739 3300046461 Bacteria 11192
486 Ga0495653_0002239 3300046463 Bacteria 15294
487 Ga0495653_0288583 3300046463 Bacteria 1074
488 Ga0495580_0003058 3300046472 Bacteria 14329
489 Ga0495580_0014052 3300046472 Bacteria 6089
490 Ga0495582_0002016 3300046473 Bacteria 11377
491 Ga0495582_0075786 3300046473 Bacteria 1863
492 Ga0495639_0000011 3300046475 Bacteria 92268
493 Ga0495639_0168786 3300046475 Bacteria 1061
494 Ga0495662_0004000 3300046476 Bacteria 7426
495 Ga0495664_0017699 3300046477 Bacteria 4075
496 Ga0495664_0025627 3300046477 Bacteria 3434
497 Ga0495664_0045898 3300046477 Bacteria 2592
498 Ga0495664_0054670 3300046477 Bacteria 2374
499 Ga0495585_0058763 3300046492 Bacteria 2121
500 Ga0495585_0087821 3300046492 Bacteria 1678
501 Ga0495594_0000128 3300046499 Bacteria 35750
502 Ga0495606_0001136 3300046507 Bacteria 37910
503 Ga0495608_0002665 3300046511 Bacteria 12814
504 Ga0495608_0044800 3300046511 Bacteria 2951
505 Ga0495608_0085130 3300046511 Bacteria 2049
506 Ga0495610_0095640 3300046512 Bacteria 1339
507 Ga0495618_0035804 3300046514 Bacteria 3116
508 Ga0495618_0093384 3300046514 Bacteria 1924
509 Ga0495618_0133925 3300046514 Bacteria 1585
510 Ga0495618_0178193 3300046514 Bacteria 1351
511 Ga0495628_0019364 3300046516 Bacteria 5628
512 Ga0495628_0030475 3300046516 Bacteria 4367
513 Ga0495630_0020303 3300046517 Bacteria 4898
514 Ga0495648_0001581 3300046524 Bacteria 22185
515 Ga0495648_0071179 3300046524 Bacteria 2017
516 Ga0495652_0036486 3300046529 Bacteria 4274
517 Ga0495652_0052453 3300046529 Bacteria 3478
518 Ga0495652_0060264 3300046529 Bacteria 3208
519 Ga0495652_0142127 3300046529 Bacteria 1886
520 Ga0495652_0226984 3300046529 Bacteria 1399
521 Ga0495665_0000133 3300046531 Bacteria 35771
522 Ga0495665_0072816 3300046531 Bacteria 1809
523 Ga0495640_0021557 3300046533 Bacteria 4727
524 Ga0495640_0061522 3300046533 Bacteria 2550
525 Ga0495587_0003196 3300046536 Bacteria 10943
526 Ga0495587_0049352 3300046536 Bacteria 2491
527 Ga0495609_0053074 3300046538 Bacteria 1803
528 Ga0495645_0019327 3300046543 Bacteria 4905
529 Ga0495645_0066950 3300046543 Bacteria 2594
530 Ga0495622_0038041 3300046557 Bacteria 2240
531 Ga0495622_0039111 3300046557 Bacteria 2208
532 Ga0495622_0045787 3300046557 Bacteria 2032
533 Ga0495633_0066753 3300046558 Bacteria 1680
534 Ga0495667_0002279 3300046559 Bacteria 12857
535 Ga0495667_0195449 3300046559 Bacteria 1296
536 Ga0495656_0026754 3300046615 Bacteria 2299
537 Ga0495656_0062936 3300046615 Bacteria 1624
538 Ga0495656_0070150 3300046615 Bacteria 1554
539 Ga0495656_0082803 3300046615 Bacteria 1451
540 Ga0495668_0093215 3300046616 Bacteria 1649
541 Ga0495668_0111429 3300046616 Bacteria 1497
542 Ga0495634_0000402 3300046642 Bacteria 42617
543 Ga0495634_0016628 3300046642 Bacteria 5257
544 Ga0495634_0021616 3300046642 Bacteria 4545
545 Ga0495634_0063858 3300046642 Bacteria 2443
546 Ga0495634_0075246 3300046642 Bacteria 2218
547 Ga0495625_0198917 3300046660 Bacteria 1324
548 Ga0495635_0002969 3300046663 Bacteria 11639
549 Ga0495635_0011589 3300046663 Bacteria 6180
550 Ga0495635_0088433 3300046663 Bacteria 2120
551 Ga0495635_0120049 3300046663 Bacteria 1793
552 Ga0495659_0072713 3300046664 Bacteria 1291
553 Ga0495588_0011114 3300046674 Bacteria 4214
554 Ga0495588_0166697 3300046674 Bacteria 1165
555 Ga0495657_0003836 3300046675 Bacteria 12140
556 Ga0495657_0041808 3300046675 Bacteria 3134
557 Ga0495657_0046542 3300046675 Bacteria 2936
558 Ga0495657_0123855 3300046675 Bacteria 1626
559 Ga0495599_0016305 3300046678 Bacteria 4613
560 Ga0495623_0018366 3300046679 Bacteria 4515
561 Ga0495623_0045273 3300046679 Bacteria 2795
562 Ga0495646_0007865 3300046680 Bacteria 6769
563 Ga0495646_0021019 3300046680 Bacteria 4126
564 Ga0495646_0093719 3300046680 Bacteria 1730
565 Ga0495646_0130805 3300046680 Bacteria 1413
566 Ga0495647_0000726 3300046681 Bacteria 9746
567 Ga0495647_0056327 3300046681 Bacteria 1541
568 Ga0495658_0003384 3300046683 Bacteria 7902
569 Ga0495658_0035090 3300046683 Bacteria 2757
570 Ga0495658_0043614 3300046683 Bacteria 2510
571 Ga0495669_0002591 3300046684 Bacteria 7392
572 Ga0495613_0011524 3300046689 Bacteria 6576
573 Ga0495613_0055930 3300046689 Bacteria 2898
574 Ga0495613_0199905 3300046689 Bacteria 1409
575 Ga0495624_0004589 3300046690 Bacteria 10084
576 Ga0495624_0074296 3300046690 Bacteria 2112
577 Ga0495624_0095893 3300046690 Bacteria 1828
578 Ga0495649_0030744 3300046694 Bacteria 2964
579 Ga0495600_0001564 3300046809 Bacteria 12736
580 Ga0495600_0017101 3300046809 Bacteria 4610
581 Ga0495600_0126167 3300046809 Bacteria 1665
582 Ga0495581_0000293 3300047315 Bacteria 24244
583 Ga0495581_0066555 3300047315 Bacteria 2083
584 Ga0495604_0023177 3300047317 Bacteria 4954
585 Ga0495604_0032809 3300047317 Bacteria 4113
586 Ga0495604_0058794 3300047317 Bacteria 2951
587 Ga0495604_0157206 3300047317 Bacteria 1609
588 Ga0495604_0243647 3300047317 Bacteria 1228
589 Ga0495674_0034247 3300047319 Bacteria 4594
590 Ga0495674_0083876 3300047319 Bacteria 2731
591 Ga0495674_0108900 3300047319 Bacteria 2350
592 Ga0495674_0129124 3300047319 Bacteria 2130
593 Ga0495674_0222055 3300047319 Bacteria 1562
594 Ga0495676_0034309 3300047321 Bacteria 4260
595 Ga0495676_0071194 3300047321 Bacteria 2673
596 Ga0495676_0097427 3300047321 Bacteria 2184
597 Ga0495676_0208289 3300047321 Bacteria 1354
598 Ga0495680_0006108 3300047322 Bacteria 11246
599 Ga0495680_0008575 3300047322 Bacteria 9281
600 Ga0495683_0046041 3300047323 Bacteria 2190
601 Ga0495687_018229 3300047443 Bacteria 3474
602 Ga0495675_0000992 3300047444 Bacteria 17254
603 Ga0495675_0011731 3300047444 Bacteria 5505
604 Ga0495675_0194360 3300047444 Bacteria 1237
605 Ga0495677_0028610 3300047445 Bacteria 2025
606 Ga0495673_0024109 3300047469 Bacteria 2947
607 Ga0495681_0103321 3300047470 Bacteria 1243
608 Ga0495684_0007190 3300047471 Bacteria 8642
609 Ga0495684_0116894 3300047471 Bacteria 2010
610 Ga0495593_0002447 3300047673 Bacteria 11168
611 Ga0495593_0009337 3300047673 Bacteria 5694
612 Ga0495593_0012613 3300047673 Bacteria 4826
613 Ga0495593_0045765 3300047673 Bacteria 2334
614 Ga0495602_0005521 3300048088 Bacteria 13266
615 Ga0495602_0015003 3300048088 Bacteria 7836
616 Ga0495602_0049263 3300048088 Bacteria 3775
617 Ga0495602_0137328 3300048088 Bacteria 1940
618 Ga0495602_0201633 3300048088 Bacteria 1517
619 Ga0495602_0289264 3300048088 Bacteria 1204
620 Ga0495614_0101681 3300048089 Bacteria 1257
621 Ga0496100_0034795 3300048903 Bacteria 3164
622 Ga0496100_0124209 3300048903 Bacteria 1810
623 Ga0496100_0126437 3300048903 Bacteria 1795
624 Ga0496100_0223971 3300048903 Bacteria 1381
625 Ga0496101_0036213 3300048904 Bacteria 3495
626 Ga0496101_0123816 3300048904 Bacteria 1957
627 Ga0496101_0202452 3300048904 Bacteria 1535
628 Ga0496101_0377778 3300048904 Bacteria 1115
629 Ga0496101_0398907 3300048904 Bacteria 1083
630 Ga0496102_0007134 3300048905 Bacteria 9543
631 Ga0496102_0276272 3300048905 Bacteria 1583
632 Ga0496102_0369009 3300048905 Bacteria 1351
633 Ga0496103_0008518 3300048906 Bacteria 6092
634 Ga0496103_0016956 3300048906 Bacteria 4351
635 Ga0496104_0005863 3300048907 Bacteria 10763
636 Ga0496104_0023259 3300048907 Bacteria 5697
637 Ga0496104_0062966 3300048907 Bacteria 3517
638 Ga0496104_0219259 3300048907 Bacteria 1814
639 Ga0496104_0221824 3300048907 Bacteria 1803
640 Ga0496104_0349954 3300048907 Bacteria 1390
641 Ga0496104_0496952 3300048907 Bacteria 1131
642 Ga0496105_0004094 3300048908 Bacteria 10925
643 Ga0496105_0006944 3300048908 Bacteria 8721
644 Ga0496105_0040042 3300048908 Bacteria 3863
645 Ga0496105_0040322 3300048908 Bacteria 3850
646 Ga0496105_0135740 3300048908 Bacteria 2027
647 Ga0496105_0166849 3300048908 Bacteria 1806
648 Ga0496106_0062278 3300048909 Bacteria 2832
649 Ga0496106_0155379 3300048909 Bacteria 1806
650 Ga0496106_0204293 3300048909 Bacteria 1573
651 Ga0496106_0296122 3300048909 Bacteria 1297
652 Ga0496106_0424758 3300048909 Bacteria 1068
653 Ga0496107_0001167 3300048910 Bacteria 15918
654 Ga0496107_0155030 3300048910 Bacteria 1695
655 Ga0496108_0011742 3300048911 Bacteria 7124
656 Ga0496108_0019121 3300048911 Bacteria 5621
657 Ga0496108_0056020 3300048911 Bacteria 3311
658 Ga0496108_0125095 3300048911 Bacteria 2207
659 Ga0496108_0409151 3300048911 Bacteria 1185
660 Ga0496109_0047215 3300048912 Bacteria 3915
661 Ga0496109_0193893 3300048912 Bacteria 1909
662 Ga0496109_0194499 3300048912 Bacteria 1906
663 Ga0496109_0332428 3300048912 Bacteria 1435
664 Ga0496109_0530604 3300048912 Bacteria 1111
665 Ga0496110_0006530 3300048913 Bacteria 9254
666 Ga0496110_0052942 3300048913 Bacteria 3567
667 Ga0496111_0017721 3300048914 Bacteria 4925
668 Ga0496111_0075559 3300048914 Bacteria 2455
669 Ga0496111_0255979 3300048914 Bacteria 1299
670 Ga0496112_0014473 3300048915 Bacteria 7322
671 Ga0496112_0018995 3300048915 Bacteria 6478
672 Ga0496112_0041488 3300048915 Bacteria 4503
673 Ga0496112_0110064 3300048915 Bacteria 2725
674 Ga0496113_0004386 3300048916 Bacteria 8655
675 Ga0496113_0034043 3300048916 Bacteria 3714
676 Ga0496113_0080775 3300048916 Bacteria 2491
677 Ga0496113_0228541 3300048916 Bacteria 1483
678 Ga0496114_0017028 3300048917 Bacteria 5862
679 Ga0496114_0054141 3300048917 Bacteria 3346
680 Ga0496115_0001479 3300048918 Bacteria 16884
681 Ga0496115_0032780 3300048918 Bacteria 4100
682 Ga0496115_0073406 3300048918 Bacteria 2777
683 Ga0496115_0098802 3300048918 Bacteria 2391
684 Ga0496115_0144422 3300048918 Bacteria 1963
685 Ga0496115_0191408 3300048918 Bacteria 1690
686 Ga0496116_0040178 3300048919 Bacteria 3224
687 Ga0496117_0020747 3300048920 Bacteria 5347
688 Ga0496118_0001892 3300048921 Bacteria 29856
689 Ga0496118_0023504 3300048921 Bacteria 5351
690 Ga0496118_0060741 3300048921 Bacteria 2805
691 Ga0496118_0131089 3300048921 Bacteria 1610
692 Ga0496119_0053496 3300048922 Bacteria 2466
693 Ga0496119_0104269 3300048922 Bacteria 1586
694 Ga0496120_0025458 3300048923 Bacteria 3671
695 Ga0496121_0000041 3300048924 Bacteria 346686
696 Ga0496121_0000230 3300048924 Bacteria 120616
697 Ga0496121_0004531 3300048924 Bacteria 18595
698 Ga0496121_0008731 3300048924 Bacteria 11827
699 Ga0496121_0017726 3300048924 Bacteria 7247
700 Ga0496121_0019668 3300048924 Bacteria 6738
701 Ga0496121_0059253 3300048924 Bacteria 3158
702 Ga0496121_0072905 3300048924 Bacteria 2754
703 Ga0496121_0117823 3300048924 Bacteria 2011
704 Ga0496121_0131720 3300048924 Bacteria 1870
705 Ga0496121_0184469 3300048924 Bacteria 1502
706 Ga0496123_0047221 3300048926 Bacteria 2912
707 Ga0496124_0034797 3300048927 Bacteria 4414
708 Ga0496124_0040460 3300048927 Bacteria 4031
709 Ga0496124_0126098 3300048927 Bacteria 2039
710 Ga0496125_0000252 3300048928 Bacteria 109988
711 Ga0496125_0035547 3300048928 Bacteria 4367
712 Ga0496125_0057410 3300048928 Bacteria 3152
713 Ga0496125_0066686 3300048928 Bacteria 2842
714 Ga0496125_0098739 3300048928 Bacteria 2160
715 Ga0496125_0105909 3300048928 Bacteria 2054
716 Ga0496126_0002010 3300048929 Bacteria 28750
717 Ga0496126_0008238 3300048929 Bacteria 11260
718 Ga0496126_0010504 3300048929 Bacteria 9695
719 Ga0496126_0018510 3300048929 Bacteria 6897
720 Ga0496126_0038161 3300048929 Bacteria 4472
721 Ga0496126_0039667 3300048929 Bacteria 4367
722 Ga0496126_0053315 3300048929 Bacteria 3670
723 Ga0496126_0069195 3300048929 Bacteria 3149
724 Ga0496126_0138746 3300048929 Bacteria 2095
725 Ga0496126_0310637 3300048929 Bacteria 1298
726 Ga0496126_0338835 3300048929 Bacteria 1232
727 Ga0495682_0024062 3300049460 Bacteria 2273
728 Ga0501031_0001416 3300049568 Bacteria 14844
729 Ga0501031_0006220 3300049568 Bacteria 7790
730 Ga0501032_0000392 3300049569 Bacteria 36103
731 Ga0501032_0001535 3300049569 Bacteria 18415
732 Ga0501033_0000144 3300049570 Bacteria 68553
733 Ga0501033_0000311 3300049570 Bacteria 46039
734 Ga0501034_0000039 3300049571 Bacteria 237357
735 Ga0501034_0000412 3300049571 Bacteria 71925
736 Ga0501036_0000007 3300049572 Bacteria 240500
737 Ga0501036_0000127 3300049572 Bacteria 48559
738 Ga0501037_0000025 3300049573 Bacteria 143276
739 Ga0501037_0000066 3300049573 Bacteria 96723
740 Ga0501038_0000026 3300049574 Bacteria 146493
741 Ga0501038_0000168 3300049574 Bacteria 55496
742 Ga0501039_0000005 3300049575 Bacteria 295471
743 Ga0501039_0001738 3300049575 Bacteria 16057
744 Ga0501043_0000036 3300049579 Bacteria 132959
745 Ga0501043_0000120 3300049579 Bacteria 72670
746 Ga0501046_0000147 3300049580 Bacteria 74186
747 Ga0501046_0000359 3300049580 Bacteria 45929
748 Ga0501047_0000209 3300049581 Bacteria 70658
749 Ga0501047_0000379 3300049581 Bacteria 50147
750 Ga0501047_0291951 3300049581 Bacteria 1474
751 Ga0501047_0309509 3300049581 Bacteria 1420
752 Ga0501048_0000460 3300049582 Bacteria 28509
753 Ga0501048_0005136 3300049582 Bacteria 9969
754 Ga0501067_0000025 3300049583 Bacteria 91481
755 Ga0501067_0016819 3300049583 Bacteria 4040
756 Ga0501068_0017473 3300049584 Bacteria 4148
757 Ga0501069_0002392 3300049585 Bacteria 9524
758 Ga0501069_0006075 3300049585 Bacteria 6302
759 Ga0501070_0000163 3300049586 Bacteria 60911
760 Ga0501070_0000966 3300049586 Bacteria 25809
761 Ga0501070_0178694 3300049586 Bacteria 1747
762 Ga0501071_0063196 3300049587 Bacteria 2684
763 Ga0501072_0002586 3300049588 Bacteria 13564
764 Ga0501072_0061545 3300049588 Bacteria 2961
765 Ga0501073_0000070 3300049589 Bacteria 63026
766 Ga0501073_0001352 3300049589 Bacteria 18086
767 Ga0501073_0054892 3300049589 Bacteria 2789
768 Ga0501074_0001814 3300049590 Bacteria 14619
769 Ga0501079_0005974 3300049741 Bacteria 9114
770 Ga0501080_0000137 3300049742 Bacteria 51355
771 Ga0501080_0002456 3300049742 Bacteria 16216
772 Ga0501080_0091267 3300049742 Bacteria 2829
773 Ga0501083_0028039 3300049744 Bacteria 3882
774 Ga0501035_0000016 3300049822 Bacteria 243412
775 Ga0501035_0000052 3300049822 Bacteria 143038
776 Ga0501044_0000383 3300049823 Bacteria 54973
777 Ga0501044_0002732 3300049823 Bacteria 20068
778 Ga0501044_0156218 3300049823 Bacteria 2260
779 Ga0501044_0413306 3300049823 Bacteria 1260
780 Ga0501045_0082994 3300049824 Bacteria 2364
781 nmdc:mga00v17_113642_c1 3300050491 Bacteria 1719
782 nmdc:mga00v17_39454_c1 3300050491 Bacteria 2828
783 nmdc:mga0yw44_243563_c1 3300050492 Bacteria 1196
784 nmdc:mga0yw44_26866_c1 3300050492 Bacteria 2655
785 nmdc:mga0yw44_34076_c1 3300050492 Bacteria 2981
786 nmdc:mga0yw44_3647_c2 3300050492 Bacteria 3933
787 nmdc:mga06z11_9769_c1 3300050494 Bacteria 4055
788 nmdc:mga04h51_37502_c1 3300050495 Bacteria 1565
789 nmdc:mga07m45_128445_c1 3300050496 Bacteria 1466
790 nmdc:mga08y16_61139_c1 3300050511 Bacteria 3933
791 nmdc:mga0n895_103606_c1 3300050512 Bacteria 2857
792 nmdc:mga0sz30_67328_c1 3300050516 Bacteria 1538
793 Ga0495601_0013794 3300053077 Bacteria 4864
794 Ga0495601_0020668 3300053077 Bacteria 4023
795 Ga0495601_0031051 3300053077 Bacteria 3320
796 Ga0495601_0076982 3300053077 Bacteria 2136
797 Ga0495601_0138207 3300053077 Bacteria 1589
798 Ga0495612_0137178 3300053078 Bacteria 1060
799 Ga0500635_0007600 3300053080 Bacteria 2945
800 Ga0500635_0015481 3300053080 Bacteria 2253
801 Ga0495595_0149588 3300053084 Bacteria 1148
802 Ga0495619_0002521 3300053085 Bacteria 11978
803 Ga0495619_0056084 3300053085 Bacteria 2611
804 Ga0495619_0253750 3300053085 Bacteria 1219
805 Ga0500643_000069 3300053087 Bacteria 116366
806 Ga0500647_0001622 3300053091 Bacteria 7863
807 Ga0500651_0007198 3300053093 Bacteria 6478
808 Ga0500566_0000043 3300053094 Bacteria 62755
809 Ga0500566_0000734 3300053094 Bacteria 18419
810 Ga0500566_0068961 3300053094 Bacteria 1987
811 Ga0500641_0012688 3300053096 Bacteria 3084
812 Ga0500557_000003 3300053105 Bacteria 228429
813 Ga0500562_003178 3300053108 Bacteria 4097
814 Ga0500572_000024 3300053111 Bacteria 47391
815 Ga0500572_001373 3300053111 Bacteria 6718
816 Ga0500591_035119 3300053115 Bacteria 2407
817 Ga0500595_000722 3300053119 Bacteria 19637
818 Ga0500595_001932 3300053119 Bacteria 10667
819 Ga0500595_003276 3300053119 Bacteria 7647
820 Ga0500595_004221 3300053119 Bacteria 6497
821 Ga0500614_001183 3300053123 Bacteria 6393
822 Ga0500614_006252 3300053123 Bacteria 2499
823 Ga0500618_021887 3300053125 Bacteria 1558
824 Ga0500642_0000114 3300053130 Bacteria 37434
825 Ga0500642_0002387 3300053130 Bacteria 5502
826 Ga0500642_0065236 3300053130 Bacteria 1645
827 Ga0500559_0000773 3300053136 Bacteria 20950
828 Ga0500559_0001628 3300053136 Bacteria 12476
829 Ga0500559_0034228 3300053136 Bacteria 2190
830 Ga0500577_0005371 3300053142 Bacteria 3446
831 Ga0500589_099062 3300053147 Bacteria 1269
832 Ga0500603_000451 3300053150 Bacteria 10617
833 Ga0500603_002245 3300053150 Bacteria 4251
834 Ga0500616_0042944 3300053153 Bacteria 2419
835 Ga0500619_008894 3300053154 Bacteria 2465
836 Ga0500620_002958 3300053155 Bacteria 3548
837 Ga0500630_000056 3300053159 Bacteria 34094
838 Ga0500638_000489 3300053162 Bacteria 9729
839 Ga0500639_000099 3300053163 Bacteria 40200
840 Ga0500636_0003063 3300053177 Bacteria 9362
841 Ga0500637_0000042 3300053178 Bacteria 46215
842 Ga0500637_0022819 3300053178 Bacteria 3414
843 Ga0500645_025118 3300053730 Bacteria 1819
844 Ga0500596_007111 3300053735 Bacteria 1850
845 Ga0500601_000081 3300053737 Bacteria 19759
846 Ga0501084_0003876 3300054114 Bacteria 12173
847 Ga0500661_009657 3300055283 Bacteria 1763
848 Ga0501082_0005063 3300060353 Bacteria 11489
849 8019649372 8019648815 Bacteria 10014479
850 2507507656 2507262055 Bacteria 8048963
851 2508541772 2508501009 Bacteria 7784016
852 2508692684 2508501042 Bacteria 8719808
853 2511398203 2511231028 Bacteria 8046582
854 2513621858 2513237092 Bacteria 8341956
855 2513642988 2513237094 Bacteria 8789602
856 2513647520 2513237095 Bacteria 8976980
857 2513654098 2513237096 Bacteria 8722461
858 2513674794 2513237098 Bacteria 9902361
859 2513698108 2513237101 Bacteria 7952346
860 2513701474 2513237102 Bacteria 7703324
861 2513721283 2513237104 Bacteria 10034502
862 2513856850 2513237137 Bacteria 9558895
863 2513878530 2513237139 Bacteria 8737671
864 2513891242 2513237141 Bacteria 8496279
865 2513918438 2513237145 Bacteria 8979722
866 2514009424 2513237161 Bacteria 8871253
867 2515626083 2515154112 Bacteria 8294334
868 2517104163 2517093001 Bacteria 9002274
869 2517891328 2517572143 Bacteria 9484767
870 2524436274 2524023205 Bacteria 8918781
871 2524468481 2524023210 Bacteria 9029266
872 2524540865 2524023228 Bacteria 10118060
873 2528848975 2528768022 Bacteria 10457665
874 2617346804 2617270735 Bacteria 9163226
875 2617372735 2617270741 Bacteria 8201522
876 2644287469 2643221651 Bacteria 4798932
877 2671123858 2667528175 Bacteria 7532676
878 2723843681 2721755755 Bacteria 8322773
879 2728750040 2728368998 Bacteria 8720350
880 2745080771 2744054633 Bacteria 8678936
881 2793065202 2791355196 Bacteria 7323613
882 2793066696 2791355197 Bacteria 8420563
883 2793083790
884 2805919046 2802429603 Bacteria 8777136
885 2818236557 2816332527 Bacteria 8933356
886 2824606530 2824600985 Bacteria 8488197
887 2824613053 2824609381 Bacteria 8672835
888 2824620429 2824617872 Bacteria 8814715
889 2824628523 2824626560 Bacteria 8813858
890 2824637223 2824635225 Bacteria 8785348
891 2824650836 2824644064 Bacteria 8743947
892 2824658546 2824653114 Bacteria 8493680
893 2824666494 2824661429 Bacteria 9877870
894 2824674112 2824671348 Bacteria 8369588
895 2824684940 2824679649 Bacteria 8248951
896 2824694399 2824687955 Bacteria 8360029
897 2824703216 2824696289 Bacteria 8335049
898 2824708905 2824704595 Bacteria 9667483
899 2824721338 2824714736 Bacteria 8717648
900 2824725616 2824723954 Bacteria 8758240
901 2824739488 2824732956 Bacteria 7810675
902 2824750112 2824746037 Bacteria 7911610
903 2824755986 2824753945 Bacteria 9787441
904 2824767524 2824763712 Bacteria 9792355
905 2824775119 2824773399 Bacteria 8360218
906 2838130472 2838122688 Bacteria 8803140
907 2841948120 2841941048 Bacteria 8688029
908 2841953485 2841949485 Bacteria 8680857
909 2841962917 2841957949 Bacteria 8652217
910 2841972038 2841966195 Bacteria 8673214
911 2841978214 2841974524 Bacteria 8931498
912 2841990984 2841983080 Bacteria 8395090
913 2842040654 2842038055 Bacteria 8002051
914 2842046400 2842045827 Bacteria 8006841
915 2844320031 2844315083 Bacteria 8138177
916 2847937329 2847930680 Bacteria 9342022
917 2847947749 2847939898 Bacteria 8606328
918 2849078391 2849076700 Bacteria 7039503
919 2857512766 2857509624 Bacteria 7472071
920 2874598769 2874590934 Bacteria 8299676
921 2874607411 2874604998 Bacteria 7834745
922 2874614565 2874612657 Bacteria 8252029
923 2874628087 2874620515 Bacteria 8290088
924 2874635001 2874628541 Bacteria 8630250
925 2874652225 2874645413 Bacteria 8214782
926 2876771040 2876761206 Bacteria 10111113
927 2876778808 2876771140 Bacteria 8287509
928 2876817705 2876808645 Bacteria 8824342
929 2876824297 2876818435 Bacteria 8274608
930 2879082601 2879074833 Bacteria 8279565
931 2879086629 2879083081 Bacteria 8587928
932 2879107139 2879099564 Bacteria 10442239
933 2879111868 2879110137 Bacteria 8907982
934 2879131518 2879127579 Bacteria 8294491
935 2879147964 2879142872 Bacteria 8267021
936 2881371455 2881364244 Bacteria 7710352
937 2881666585 2881665667 Bacteria 8175609
938 2885369974 2885366525 Bacteria 8326213
939 2885377033 2885374607 Bacteria 8927485
940 2885391393 2885383462 Bacteria 9473874
941 2885417890 2885409591 Bacteria 9235467
942 2888385457 2888378607 Bacteria 9652610
943 2888392774 2888388044 Bacteria 7304136
944 2888425589 2888419890 Bacteria 7857137
945 2889038010 2889033259 Bacteria 9099371
946 2903730295 2903727486 Bacteria 8281579
947 2903755289 2903748898 Bacteria 9972761
948 2903769729 2903768456 Bacteria 9749579
949 2904674295 2904666416 Bacteria 8226587
950 2904694501 2904690495 Bacteria 9412302
951 2904701275
952 2904711969 2904711408 Bacteria 9771557
953 2906609856 2906602504 Bacteria 8295279
954 2906616514
955 2906627348 2906626472 Bacteria 8826946
956 2906635285 2906635258 Bacteria 8601019
957 2906643954 2906643746 Bacteria 8722424
958 2906663011 2906660503 Bacteria 8595048
959 2908741682 2908739725 Bacteria 8628932
960 2908759157 2908756301 Bacteria 8864324
961 2908781177 2908775508 Bacteria 8092255
962 2922366012 2922361189 Bacteria 7436256
963 2922372401
964 2922386826 2922386360 Bacteria 7017218
965 2922397068 2922393267 Bacteria 8285685
966 2922431467
967 2928104462 2928100450 Bacteria 4837635
968 2929621029 2929615660 Bacteria 9193770
969 2929626140 2929624759 Bacteria 9339455
970 2932784980 2932784394 Bacteria 9704911
971 2932795145 2932794094 Bacteria 7915132
972 2932805673 2932801729 Bacteria 7987968
973 2932810014 2932809354 Bacteria 9135765
974 2932827011 2932818245 Bacteria 9955613
975 2932828817 2932828146 Bacteria 9745859
976 2933583101 2933577622 Bacteria 9116884
977 2935609836 2935608549 Bacteria 8203142
978 2935619763 2935616580 Bacteria 9032984
979 2935636227 2935630451 Bacteria 8169952
980 2935638744 2935638405 Bacteria 10015038
981 2935652134 2935648319 Bacteria 8801166
982 2935659893 2935656913 Bacteria 8965014
983 2935666405 2935665750 Bacteria 9571747
984 2935676548 2935675223 Bacteria 9928132
985 2935690780 2935684952 Bacteria 9590419
986 2935694629 2935694250 Bacteria 9291695
987 2935703750 2935703347 Bacteria 10242284
988 2935718161 2935713505 Bacteria 9608509
989 2935727858 2935722832 Bacteria 9608746
990 2935736562 2935732158 Bacteria 9706831
991 2935745941 2935741537 Bacteria 9707219
992 2935756322 2935750917 Bacteria 9590372
993 2935760574 2935760218 Bacteria 9817913
994 2935776992 2935769743 Bacteria 7878163
995 2935783547 2935777560 Bacteria 8077691
996 2935792807 2935785616 Bacteria 7962367
997 2935800845 2935793552 Bacteria 8012592
998 2935801887 2935801545 Bacteria 9301974
999 2935814703 2935810662 Bacteria 9401221
1000 2935822997 2935819856 Bacteria 8261050
1001 2935828238 2935827899 Bacteria 10038562
1002 2935842442 2935837841 Bacteria 9454360
1003 2935848579 2935847175 Bacteria 8228321
1004 2935857922 2935855204 Bacteria 9035059
1005 2935868736 2935864058 Bacteria 9784707
1006 2935874151 2935873716 Bacteria 9632195
1007 2935883957 2935883170 Bacteria 7964738
1008 2935909614 2935908558 Bacteria 8568796
1009 2935917339 2935916978 Bacteria 9113783
1010 2935927095 2935926038 Bacteria 8601059
1011 2935937061 2935934488 Bacteria 8602579
1012 2935944636 2935942939 Bacteria 8599779
1013 2935953073 2935951376 Bacteria 8602333
1014 2935966573 2935959822 Bacteria 7869783
1015 2935969913 2935967501 Bacteria 8603075
1016 2935976509 2935975950 Bacteria 8347125
1017 2935987037 2935984226 Bacteria 8302647
1018 2935992924 2935992306 Bacteria 9802711
1019 2936002837 2936002035 Bacteria 9362176
1020 2936014309 2936011229 Bacteria 8801034
1021 2936023851 2936019824 Bacteria 8804134
1022 2936031494 2936028420 Bacteria 8965941
1023 2936040654 2936037263 Bacteria 9446081
1024 2936049415 2936046547 Bacteria 8903709
1025 2936062165 2936055302 Bacteria 8785755
1026 2940561703 2940556831 Bacteria 9590747
1027 2941512858 2941507105 Bacteria 8166816
1028 2941520575 2941515067 Bacteria 8166720
1029 2941528589 2941523033 Bacteria 8169134
1030 2941531216 2941531003 Bacteria 7653939
1031 2941542491 2941538514 Bacteria 9402094
1032 3005481260 3005474847 Bacteria 9259049
1033 3005484785 3005483717 Bacteria 7877331
1034 3005508428 3005506211 Bacteria 6943378
1035 3005588073 3005587118 Bacteria 7794411
1036 3005600322 3005594810 Bacteria 8716512
1037 3005715812 3005710791 Bacteria 7622528
1038 3005723168 3005718088 Bacteria 8283608
1039 8006928387 8006926726 Bacteria 6749210
1040 8006939450 8006933436 Bacteria 10410654
1041 8006972113 8006964411 Bacteria 8966052
1042 8006979200 8006973647 Bacteria 10679141
1043 8006984433 8006984368 Bacteria 9651211
1044 8007001367 8006994254 Bacteria 8309700
1045 8016520652 8016511872 Bacteria 9921665
1046 8016528682 8016522445 Bacteria 8156687
1047 8016533857 8016530956 Bacteria 8155261
1048 8016547081 8016539877 Bacteria 8155419
1049 8016555042 8016548790 Bacteria 8155074
1050 8016563407 8016557553 Bacteria 8154380
1051 8016572190 8016566248 Bacteria 8158151
1052 8016576386 8016575299 Bacteria 8154085
1053 8016594346 8016583857 Bacteria 10421953
1054 8016601156 8016595262 Bacteria 8149947
1055 8016609288 8016603502 Bacteria 8731218
1056 8016625607 8016622563 Bacteria 7999408
1057 8016639167 8016630954 Bacteria 9217207
1058 8017064927 8017057580 Bacteria 10023680
1059 8019533628 8019530166 Bacteria 8155624
1060 8019546036 8019538911 Bacteria 7872763
1061 8019552686 8019547302 Bacteria 7996444
1062 8019565325 8019555841 Bacteria 9642137
1063 8019575425 8019565922 Bacteria 9639779
1064 8019584304 8019576017 Bacteria 10049540
1065 8019592074 8019586578 Bacteria 10212056
1066 8019599211 8019597564 Bacteria 10041141
1067 8019609148 8019608314 Bacteria 10042931
1068 8019619818 8019619141 Bacteria 9218857
1069 8019633297 8019629233 Bacteria 8687553
1070 8019646604 8019638758 Bacteria 9062356
1071 8019661171 8019659431 Bacteria 8577854
1072 8019670722 8019668869 Bacteria 8791617
1073 8019685511 8019678201 Bacteria 8863603
1074 8019691077 8019687851 Bacteria 8712826
1075 8055745108 8055742211 Bacteria 9226248
1076 8056679830 8056673599 Bacteria 7871253
1077 8056684753 8056681323 Bacteria 8472857
1078 8056693053 8056689827 Bacteria 6712655
1079 8056975061 8056967851 Bacteria 9038162
1080 RicEn_C1662
1081 JGI25406J46586_10000202
1082 JGI25406J46586_10006725
1083 JGI25153J46596_10000656
1084 JGI25153J46596_10005271
1085 JGI25153J46596_10006410
1086 JGI25160J50197_1012923
1087 JGI25404J52841_10006565
1088 JGI25404J52841_10024028
1089 Ga0055539_1006447
1090 Ga0065165_1000926
1091 Ga0065165_1001447
1092 Ga0065715_10288260
1093 Ga0070658_10142763
1094 Ga0070683_100050018
1095 Ga0070683_100092275
1096 Ga0070683_100172892
1097 Ga0070680_100007389
1098 Ga0070680_100205070
1099 Ga0070660_100350511
1100 Ga0070661_100057205
1101 Ga0070668_100058827
1102 Ga0070668_100226390
1103 Ga0070669_100046134
1104 Ga0070671_100003878
1105 Ga0070674_100116870
1106 Ga0070673_100003986
1107 Ga0070688_100010670
1108 Ga0070709_10015754
1109 Ga0070709_10016067
1110 Ga0070709_10070318
1111 Ga0070709_10125683
1112 Ga0070714_100044060
1113 Ga0070714_100063197
1114 Ga0070714_100080070
1115 Ga0070713_100001443
1116 Ga0070713_100002226
1117 Ga0070713_100007690
1118 Ga0070713_100202384
1119 Ga0070710_10003994
1120 Ga0070710_10017245
1121 Ga0070710_10022746
1122 Ga0070701_10039619
1123 Ga0070711_100005992
1124 Ga0070711_100064294
1125 Ga0070711_100084168
1126 Ga0070711_100167189
1127 Ga0070663_100045576
1128 Ga0070663_100067261
1129 Ga0070663_100163655
1130 Ga0070663_100369269
1131 Ga0070678_100013689
1132 Ga0070678_100015766
1133 Ga0070678_100080228
1134 Ga0070678_100081184
1135 Ga0070678_100144901
1136 Ga0070678_100171511
1137 Ga0070681_10013908
1138 Ga0070681_10106713
1139 Ga0070681_10138999
1140 Ga0070681_10292834
1141 Ga0070681_10346582
1142 Ga0070707_100095241
1143 Ga0070698_100196336
1144 Ga0070679_100085294
1145 Ga0070679_100139562
1146 Ga0070679_100193859
1147 Ga0070684_100016541
1148 Ga0070684_100115656
1149 Ga0070697_100138279
1150 Ga0070697_100250047
1151 Ga0068853_100046546
1152 Ga0068853_100055730
1153 Ga0068853_100083735
1154 Ga0068853_100162127
1155 Ga0068853_100180025
1156 Ga0070672_100033812
1157 Ga0070693_100125260
1158 Ga0070665_100038548
1159 Ga0070665_100059464
1160 Ga0070665_100111668
1161 Ga0070665_100159559
1162 Ga0070665_100230192
1163 Ga0070665_100252717
1164 Ga0070665_100443474
1165 Ga0070665_100446056
1166 Ga0068855_100031944
1167 Ga0068855_100091476
1168 Ga0068855_100128442
1169 Ga0068855_100218316
1170 Ga0068855_100232775
1171 Ga0068855_100467869
1172 Ga0068857_100105694
1173 Ga0068857_100152274
1174 Ga0068857_100235326
1175 Ga0068854_100047530
1176 Ga0068854_100208899
1177 Ga0068852_100008038
1178 Ga0068859_100057641
1179 Ga0068859_100255810
1180 Ga0068864_100161963
1181 Ga0068866_10035166
1182 Ga0068866_10046557
1183 Ga0068861_100113676
1184 Ga0068861_100435358
1185 Ga0068858_100128143
1186 Ga0068860_100000081
1187 Ga0068862_100024472
1188 Ga0081455_10008418
1189 Ga0081455_10029336
1190 Ga0081455_10125796
1191 Ga0081540_1001682
1192 Ga0081540_1003361
1193 Ga0081540_1013327
1194 Ga0081540_1015125
1195 Ga0081540_1019809
1196 Ga0081540_1030166
1197 Ga0081540_1031210
1198 Ga0081540_1035542
1199 Ga0081540_1035686
1200 Ga0081540_1069505
1201 Ga0081540_1092560
1202 Ga0081539_10000768
1203 Ga0081539_10001470
1204 Ga0081539_10148442
1205 Ga0070717_10002220
1206 Ga0070717_10027436
1207 Ga0070717_10396747
1208 Ga0075365_10008851
1209 Ga0070712_100023933
1210 Ga0070712_100365819
1211 Ga0075367_10101986
1212 Ga0075369_10034323
1213 Ga0075369_10037242
1214 Ga0075369_10124082
1215 Ga0075366_10054711
1216 Ga0097621_100025839
1217 Ga0075370_10186455
1218 Ga0075434_100176723
1219 Ga0075434_100465547
1220 Ga0068865_100121416
1221 Ga0097620_100057642
1222 Ga0097620_100255803
1223 Ga0099824_1016570
1224 Ga0099824_1020870
1225 Ga0099822_1009095
1226 Ga0099794_10051835
1227 Ga0105240_10007310
1228 Ga0105240_10034676
1229 Ga0105240_10364428
1230 Ga0105240_10397933
1231 Ga0105240_10403439
1232 Ga0111539_10088037
1233 Ga0105245_10069475
1234 Ga0105245_10193858
1235 Ga0105247_10213455
1236 Ga0105243_10265591
1237 Ga0105241_10032018
1238 Ga0105241_10103601
1239 Ga0105241_10181436
1240 Ga0105241_10285971
1241 Ga0105248_10137251
1242 Ga0105237_10065725
1243 Ga0105237_10084021
1244 Ga0105237_10092782
1245 Ga0105237_10372534
1246 Ga0105238_10053335
1247 Ga0105238_10100152
1248 Ga0105238_10173286
1249 Ga0105238_10273591
1250 Ga0105249_10130613
1251 Ga0105249_10567893
1252 Ga0099796_10037812
1253 Ga0105239_10041049
1254 Ga0105239_10081303
1255 Ga0105239_10083629
1256 Ga0105239_10101891
1257 Ga0105239_10118317
1258 Ga0105239_10537119
1259 Ga0105246_10021360
1260 Ga0105246_10071388
1261 Ga0105246_10125489
1262 Ga0105246_10129453
1263 Ga0157370_10230389
1264 Ga0157369_10003327
1265 Ga0157369_10008098
1266 Ga0157369_10023406
1267 Ga0157369_10078457
1268 Ga0157374_10186319
1269 Ga0157374_10277995
1270 Ga0157378_10109720
1271 Ga0157378_10207045
1272 Ga0163162_10130979
1273 Ga0163162_10132636
1274 Ga0163162_10142857
1275 Ga0163162_10453854
1276 Ga0157372_10117900
1277 Ga0157375_10186110
1278 Ga0157375_10233150
1279 Ga0157375_10332871
1280 Ga0157375_10388145
1281 Ga0163163_10014242
1282 Ga0163163_10031900
1283 Ga0163163_10084549
1284 Ga0163163_10101104
1285 Ga0157380_10386182
1286 Ga0182008_10159533
1287 Ga0157379_10164090
1288 Ga0157379_10229450
1289 Ga0157376_10072336
1290 Ga0157376_10341712
1291 Ga0157376_10495273
1292 Ga0197907_11341050
1293 Ga0214544_1000001
1294 Ga0214542_1000037
1295 Ga0214545_1000003
1296 Ga0214543_1003164
1297 Ga0213873_10002609
1298 Ga0213874_10038363
1299 Ga0213876_10001294
1300 Ga0213876_10036588
1301 Ga0209677_100141
1302 Ga0209677_104763
1303 Ga0209148_1001050
1304 Ga0209233_1001911
1305 Ga0209233_1002619
1306 Ga0209233_1003041
1307 Ga0209233_1012666
1308 Ga0209233_1024056
1309 Ga0209455_1002697
1310 Ga0209455_1008072
1311 Ga0209758_1000133
1312 Ga0209758_1001210
1313 Ga0209758_1001389
1314 Ga0209758_1001858
1315 Ga0209758_1030965
1316 Ga0209758_1036288
1317 Ga0209758_1041696
1318 Ga0209256_1008955
1319 Ga0207426_1000572
1320 Ga0207426_1000922
1321 Ga0207656_10009794
1322 Ga0207653_10065577
1323 Ga0207692_10003529
1324 Ga0207692_10008098
1325 Ga0207642_10032263
1326 Ga0207688_10064606
1327 Ga0207688_10111212
1328 Ga0207680_10209407
1329 Ga0207647_10028454
1330 Ga0207699_10015638
1331 Ga0207699_10028697
1332 Ga0207699_10055362
1333 Ga0207699_10094082
1334 Ga0207645_10025563
1335 Ga0207705_10062712
1336 Ga0207705_10224785
1337 Ga0207707_10000378
1338 Ga0207707_10003914
1339 Ga0207707_10015104
1340 Ga0207707_10040154
1341 Ga0207707_10145220
1342 Ga0207707_10241373
1343 Ga0207695_10000008
1344 Ga0207695_10101630
1345 Ga0207695_10140228
1346 Ga0207695_10290030
1347 Ga0207671_10007497
1348 Ga0207671_10059694
1349 Ga0207671_10087252
1350 Ga0207671_10148976
1351 Ga0207693_10036084
1352 Ga0207693_10037567
1353 Ga0207693_10098994
1354 Ga0207693_10211903
1355 Ga0207663_10013512
1356 Ga0207663_10014254
1357 Ga0207663_10091012
1358 Ga0207663_10097555
1359 Ga0207663_10124488
1360 Ga0207660_10007130
1361 Ga0207660_10127243
1362 Ga0207657_10001107
1363 Ga0207657_10003265
1364 Ga0207657_10113495
1365 Ga0207649_10026045
1366 Ga0207649_10131180
1367 Ga0207649_10269050
1368 Ga0207652_10006801
1369 Ga0207652_10107372
1370 Ga0207652_10222297
1371 Ga0207652_10239816
1372 Ga0207646_10091694
1373 Ga0207681_10029279
1374 Ga0207650_10130461
1375 Ga0207687_10041702
1376 Ga0207687_10052723
1377 Ga0207700_10002327
1378 Ga0207700_10065839
1379 Ga0207700_10139930
1380 Ga0207700_10154298
1381 Ga0207664_10020316
1382 Ga0207664_10174642
1383 Ga0207644_10018273
1384 Ga0207706_10068509
1385 Ga0207706_10167217
1386 Ga0207665_10000599
1387 Ga0207665_10000989
1388 Ga0207665_10009005
1389 Ga0207665_10159629
1390 Ga0207711_10270876
1391 Ga0207689_10098727
1392 Ga0207661_10004542
1393 Ga0207661_10011383
1394 Ga0207679_10090200
1395 Ga0207667_10006765
1396 Ga0207667_10057259
1397 Ga0207667_10133086
1398 Ga0207667_10264579
1399 Ga0207667_10637164
1400 Ga0207651_10019867
1401 Ga0207668_10073062
1402 Ga0207668_10297551
1403 Ga0207668_10310918
1404 Ga0207640_10149049
1405 Ga0207640_10192060
1406 Ga0207677_10092314
1407 Ga0207703_10145131
1408 Ga0207639_10064595
1409 Ga0207639_10097565
1410 Ga0207678_10015836
1411 Ga0207678_10039984
1412 Ga0207678_10087807
1413 Ga0207678_10198595
1414 Ga0207678_10298558
1415 Ga0207708_10020945
1416 Ga0207702_10000779
1417 Ga0207648_10424675
1418 Ga0207674_10026227
1419 Ga0207674_10053367
1420 Ga0207674_10110411
1421 Ga0207674_10306423
1422 Ga0207675_100054504
1423 Ga0207675_100214219
1424 Ga0207683_10091726
1425 Ga0207683_10093548
1426 Ga0209389_1000001
1427 Ga0209389_1000115
1428 Ga0209589_1000014
1429 Ga0209589_1000033
1430 Ga0209489_100014
1431 Ga0209489_100040
1432 Ga0209489_100612
1433 Ga0209700_100007
1434 Ga0209700_100024
1435 Ga0209588_1004503
1436 Ga0209813_10031470
1437 Ga0268266_10009754
1438 Ga0268266_10033753
1439 Ga0268266_10105551
1440 Ga0268265_10021705
1441 Ga0268265_10033146
1442 Ga0268265_10042573
1443 Ga0268265_10057495
1444 Ga0268265_10251507
1445 Ga0268264_10000048
1446 Ga0265337_1004222
1447 Ga0265326_10001217
1448 Ga0265334_10001564
1449 Ga0265334_10016758
1450 Ga0265323_10003591
1451 Ga0265336_10000135
1452 Ga0307517_10000634
1453 Ga0307515_10023148
1454 Ga0265338_10000034
1455 Ga0265324_10001038
1456 Ga0265330_10038253
1457 Ga0265332_10017916
1458 Ga0265328_10076070
1459 Ga0265325_10005682
1460 Ga0265339_10005528
1461 Ga0265339_10061435
1462 Ga0265331_10074106
1463 Ga0307509_10005003
1464 Ga0265313_10092749
1465 Ga0307508_10000032
1466 Ga0265314_10003829
1467 Ga0307516_10014729
1468 Ga0307516_10015757
1469 Ga0307516_10060750
1470 Ga0307410_10173310
1471 Ga0307409_100060585
1472 Ga0307411_10048097
1473 Ga0307415_100207491
1474 Ga0307510_10019976
1475 Ga0307510_10023227
1476 Ga0307510_10039297
1477 Ga0307510_10160585
1478 Ga0315911_1000002
1479 Ga0373926_0022117
1480 Ga0373934_0008656
1481 Ga0373934_0021398
1482 Ga0373934_0060792
1483 Ga0373923_0006710
1484 Ga0373923_0024439
1485 Ga0373953_0001202
1486 Ga0373956_0079419
1487 Ga0373956_0112321
1488 Ga0373943_0022074
1489 Ga0373943_0032461
1490 Ga0373946_0029415
1491 Ga0373961_0029300
1492 Ga0373924_0077438
1493 Ga0373931_0025233
1494 Ga0373935_0004267
1495 Ga0373935_0038394
1496 Ga0373935_0043463
1497 Ga0373935_0185748
1498 Ga0373935_0303875
1499 Ga0373927_0001468
1500 Ga0373927_0004710
1501 Ga0373927_0014398
1502 Ga0373927_0018761
1503 Ga0373927_0147927
1504 Ga0373933_0000468
1505 Ga0373933_0011609
1506 Ga0373947_0000755
1507 Ga0373947_0009037
1508 Ga0373947_0028170
1509 Ga0373937_0065466
1510 Ga0373937_0141690
1511 Ga0373925_0002143
1512 Ga0373925_0023873
1513 Ga0373925_0126935
1514 Ga0395900_0018596
1515 Ga0395900_0024838
1516 Ga0395898_0121342
1517 Ga0395905_0004426
1518 Ga0395905_0539340
1519 Ga0436364_0657610
1520 Ga0436364_1050353
1521 Ga0395901_0173274
1522 Ga0436365_0243105
1523 Ga0436365_0747294
1524 Ga0436361_1058286
1525 Ga0436363_0182376
1526 Ga0436363_0350177
1527 Ga0436363_1367285
1528 Ga0436362_0407438
1529 Ga0436362_0927305
1530 Ga0439465_0106631
1531 Ga0451789_1039392
1532 Ga0466969_0014273
1533 Ga0466972_0005057
1534 Ga0466972_0007791
1535 Ga0466966_0002686
1536 Ga0466961_0013054
1537 Ga0466963_0006089
1538 Ga0466964_0022688
1539 Ga0466964_0153800
1540 Ga0466968_0137217
1541 Ga0466970_0180042
1542 Ga0466960_0016867
1543 Ga0466960_0019583
1544 Ga0466959_0000295
1545 Ga0466959_0008200
1546 Ga0466967_0022428
1547 Ga0466967_0052094
1548 Ga0466967_0155879
1549 Ga0495617_007067
1550 Ga0495592_0011034
1551 Ga0495592_0038923
1552 Ga0495592_0066492
1553 Ga0495592_0074803
1554 Ga0495592_0156236
1555 Ga0495603_0000217
1556 Ga0495603_0038110
1557 Ga0495603_0131508
1558 Ga0495629_0000188
1559 Ga0495629_0002216
1560 Ga0495629_0034036
1561 Ga0495629_0042622
1562 Ga0495629_0043445
1563 Ga0495638_0025061
1564 Ga0495641_0003739
1565 Ga0495653_0002239
1566 Ga0495653_0288583
1567 Ga0495580_0003058
1568 Ga0495580_0014052
1569 Ga0495582_0002016
1570 Ga0495582_0075786
1571 Ga0495639_0000011
1572 Ga0495639_0168786
1573 Ga0495662_0004000
1574 Ga0495664_0017699
1575 Ga0495664_0025627
1576 Ga0495664_0045898
1577 Ga0495664_0054670
1578 Ga0495585_0058763
1579 Ga0495585_0087821
1580 Ga0495594_0000128
1581 Ga0495606_0001136
1582 Ga0495608_0002665
1583 Ga0495608_0044800
1584 Ga0495608_0085130
1585 Ga0495610_0095640
1586 Ga0495618_0035804
1587 Ga0495618_0093384
1588 Ga0495618_0133925
1589 Ga0495618_0178193
1590 Ga0495628_0019364
1591 Ga0495628_0030475
1592 Ga0495630_0020303
1593 Ga0495648_0001581
1594 Ga0495648_0071179
1595 Ga0495652_0036486
1596 Ga0495652_0052453
1597 Ga0495652_0060264
1598 Ga0495652_0142127
1599 Ga0495652_0226984
1600 Ga0495665_0000133
1601 Ga0495665_0072816
1602 Ga0495640_0021557
1603 Ga0495640_0061522
1604 Ga0495587_0003196
1605 Ga0495587_0049352
1606 Ga0495609_0053074
1607 Ga0495645_0019327
1608 Ga0495645_0066950
1609 Ga0495622_0038041
1610 Ga0495622_0039111
1611 Ga0495622_0045787
1612 Ga0495633_0066753
1613 Ga0495667_0002279
1614 Ga0495667_0195449
1615 Ga0495656_0026754
1616 Ga0495656_0062936
1617 Ga0495656_0070150
1618 Ga0495656_0082803
1619 Ga0495668_0093215
1620 Ga0495668_0111429
1621 Ga0495634_0000402
1622 Ga0495634_0016628
1623 Ga0495634_0021616
1624 Ga0495634_0063858
1625 Ga0495634_0075246
1626 Ga0495625_0198917
1627 Ga0495635_0002969
1628 Ga0495635_0011589
1629 Ga0495635_0088433
1630 Ga0495635_0120049
1631 Ga0495659_0072713
1632 Ga0495588_0011114
1633 Ga0495588_0166697
1634 Ga0495657_0003836
1635 Ga0495657_0041808
1636 Ga0495657_0046542
1637 Ga0495657_0123855
1638 Ga0495599_0016305
1639 Ga0495623_0018366
1640 Ga0495623_0045273
1641 Ga0495646_0007865
1642 Ga0495646_0021019
1643 Ga0495646_0093719
1644 Ga0495646_0130805
1645 Ga0495647_0000726
1646 Ga0495647_0056327
1647 Ga0495658_0003384
1648 Ga0495658_0035090
1649 Ga0495658_0043614
1650 Ga0495669_0002591
1651 Ga0495613_0011524
1652 Ga0495613_0055930
1653 Ga0495613_0199905
1654 Ga0495624_0004589
1655 Ga0495624_0074296
1656 Ga0495624_0095893
1657 Ga0495649_0030744
1658 Ga0495600_0001564
1659 Ga0495600_0017101
1660 Ga0495600_0126167
1661 Ga0495581_0000293
1662 Ga0495581_0066555
1663 Ga0495604_0023177
1664 Ga0495604_0032809
1665 Ga0495604_0058794
1666 Ga0495604_0157206
1667 Ga0495604_0243647
1668 Ga0495674_0034247
1669 Ga0495674_0083876
1670 Ga0495674_0108900
1671 Ga0495674_0129124
1672 Ga0495674_0222055
1673 Ga0495676_0034309
1674 Ga0495676_0071194
1675 Ga0495676_0097427
1676 Ga0495676_0208289
1677 Ga0495680_0006108
1678 Ga0495680_0008575
1679 Ga0495683_0046041
1680 Ga0495687_018229
1681 Ga0495675_0000992
1682 Ga0495675_0011731
1683 Ga0495675_0194360
1684 Ga0495677_0028610
1685 Ga0495673_0024109
1686 Ga0495681_0103321
1687 Ga0495684_0007190
1688 Ga0495684_0116894
1689 Ga0495593_0002447
1690 Ga0495593_0009337
1691 Ga0495593_0012613
1692 Ga0495593_0045765
1693 Ga0495602_0005521
1694 Ga0495602_0015003
1695 Ga0495602_0049263
1696 Ga0495602_0137328
1697 Ga0495602_0201633
1698 Ga0495602_0289264
1699 Ga0495614_0101681
1700 Ga0496100_0034795
1701 Ga0496100_0124209
1702 Ga0496100_0126437
1703 Ga0496100_0223971
1704 Ga0496101_0036213
1705 Ga0496101_0123816
1706 Ga0496101_0202452
1707 Ga0496101_0377778
1708 Ga0496101_0398907
1709 Ga0496102_0007134
1710 Ga0496102_0276272
1711 Ga0496102_0369009
1712 Ga0496103_0008518
1713 Ga0496103_0016956
1714 Ga0496104_0005863
1715 Ga0496104_0023259
1716 Ga0496104_0062966
1717 Ga0496104_0219259
1718 Ga0496104_0221824
1719 Ga0496104_0349954
1720 Ga0496104_0496952
1721 Ga0496105_0004094
1722 Ga0496105_0006944
1723 Ga0496105_0040042
1724 Ga0496105_0040322
1725 Ga0496105_0135740
1726 Ga0496105_0166849
1727 Ga0496106_0062278
1728 Ga0496106_0155379
1729 Ga0496106_0204293
1730 Ga0496106_0296122
1731 Ga0496106_0424758
1732 Ga0496107_0001167
1733 Ga0496107_0155030
1734 Ga0496108_0011742
1735 Ga0496108_0019121
1736 Ga0496108_0056020
1737 Ga0496108_0125095
1738 Ga0496108_0409151
1739 Ga0496109_0047215
1740 Ga0496109_0193893
1741 Ga0496109_0194499
1742 Ga0496109_0332428
1743 Ga0496109_0530604
1744 Ga0496110_0006530
1745 Ga0496110_0052942
1746 Ga0496111_0017721
1747 Ga0496111_0075559
1748 Ga0496111_0255979
1749 Ga0496112_0014473
1750 Ga0496112_0018995
1751 Ga0496112_0041488
1752 Ga0496112_0110064
1753 Ga0496113_0004386
1754 Ga0496113_0034043
1755 Ga0496113_0080775
1756 Ga0496113_0228541
1757 Ga0496114_0017028
1758 Ga0496114_0054141
1759 Ga0496115_0001479
1760 Ga0496115_0032780
1761 Ga0496115_0073406
1762 Ga0496115_0098802
1763 Ga0496115_0144422
1764 Ga0496115_0191408
1765 Ga0496116_0040178
1766 Ga0496117_0020747
1767 Ga0496118_0001892
1768 Ga0496118_0023504
1769 Ga0496118_0060741
1770 Ga0496118_0131089
1771 Ga0496119_0053496
1772 Ga0496119_0104269
1773 Ga0496120_0025458
1774 Ga0496121_0000041
1775 Ga0496121_0000230
1776 Ga0496121_0004531
1777 Ga0496121_0008731
1778 Ga0496121_0017726
1779 Ga0496121_0019668
1780 Ga0496121_0059253
1781 Ga0496121_0072905
1782 Ga0496121_0117823
1783 Ga0496121_0131720
1784 Ga0496121_0184469
1785 Ga0496123_0047221
1786 Ga0496124_0034797
1787 Ga0496124_0040460
1788 Ga0496124_0126098
1789 Ga0496125_0000252
1790 Ga0496125_0035547
1791 Ga0496125_0057410
1792 Ga0496125_0066686
1793 Ga0496125_0098739
1794 Ga0496125_0105909
1795 Ga0496126_0002010
1796 Ga0496126_0008238
1797 Ga0496126_0010504
1798 Ga0496126_0018510
1799 Ga0496126_0038161
1800 Ga0496126_0039667
1801 Ga0496126_0053315
1802 Ga0496126_0069195
1803 Ga0496126_0138746
1804 Ga0496126_0310637
1805 Ga0496126_0338835
1806 Ga0495682_0024062
1807 Ga0501031_0001416
1808 Ga0501031_0006220
1809 Ga0501032_0000392
1810 Ga0501032_0001535
1811 Ga0501033_0000144
1812 Ga0501033_0000311
1813 Ga0501034_0000039
1814 Ga0501034_0000412
1815 Ga0501036_0000007
1816 Ga0501036_0000127
1817 Ga0501037_0000025
1818 Ga0501037_0000066
1819 Ga0501038_0000026
1820 Ga0501038_0000168
1821 Ga0501039_0000005
1822 Ga0501039_0001738
1823 Ga0501043_0000036
1824 Ga0501043_0000120
1825 Ga0501046_0000147
1826 Ga0501046_0000359
1827 Ga0501047_0000209
1828 Ga0501047_0000379
1829 Ga0501047_0291951
1830 Ga0501047_0309509
1831 Ga0501048_0000460
1832 Ga0501048_0005136
1833 Ga0501067_0000025
1834 Ga0501067_0016819
1835 Ga0501068_0017473
1836 Ga0501069_0002392
1837 Ga0501069_0006075
1838 Ga0501070_0000163
1839 Ga0501070_0000966
1840 Ga0501070_0178694
1841 Ga0501071_0063196
1842 Ga0501072_0002586
1843 Ga0501072_0061545
1844 Ga0501073_0000070
1845 Ga0501073_0001352
1846 Ga0501073_0054892
1847 Ga0501074_0001814
1848 Ga0501079_0005974
1849 Ga0501080_0000137
1850 Ga0501080_0002456
1851 Ga0501080_0091267
1852 Ga0501083_0028039
1853 Ga0501035_0000016
1854 Ga0501035_0000052
1855 Ga0501044_0000383
1856 Ga0501044_0002732
1857 Ga0501044_0156218
1858 Ga0501044_0413306
1859 Ga0501045_0082994
1860 nmdc:mga00v17_113642_c1
1861 nmdc:mga00v17_39454_c1
1862 nmdc:mga0yw44_243563_c1
1863 nmdc:mga0yw44_26866_c1
1864 nmdc:mga0yw44_34076_c1
1865 nmdc:mga0yw44_3647_c2
1866 nmdc:mga06z11_9769_c1
1867 nmdc:mga04h51_37502_c1
1868 nmdc:mga07m45_128445_c1
1869 nmdc:mga08y16_61139_c1
1870 nmdc:mga0n895_103606_c1
1871 nmdc:mga0sz30_67328_c1
1872 Ga0495601_0013794
1873 Ga0495601_0020668
1874 Ga0495601_0031051
1875 Ga0495601_0076982
1876 Ga0495601_0138207
1877 Ga0495612_0137178
1878 Ga0500635_0007600
1879 Ga0500635_0015481
1880 Ga0495595_0149588
1881 Ga0495619_0002521
1882 Ga0495619_0056084
1883 Ga0495619_0253750
1884 Ga0500643_000069
1885 Ga0500647_0001622
1886 Ga0500651_0007198
1887 Ga0500566_0000043
1888 Ga0500566_0000734
1889 Ga0500566_0068961
1890 Ga0500641_0012688
1891 Ga0500557_000003
1892 Ga0500562_003178
1893 Ga0500572_000024
1894 Ga0500572_001373
1895 Ga0500591_035119
1896 Ga0500595_000722
1897 Ga0500595_001932
1898 Ga0500595_003276
1899 Ga0500595_004221
1900 Ga0500614_001183
1901 Ga0500614_006252
1902 Ga0500618_021887
1903 Ga0500642_0000114
1904 Ga0500642_0002387
1905 Ga0500642_0065236
1906 Ga0500559_0000773
1907 Ga0500559_0001628
1908 Ga0500559_0034228
1909 Ga0500577_0005371
1910 Ga0500589_099062
1911 Ga0500603_000451
1912 Ga0500603_002245
1913 Ga0500616_0042944
1914 Ga0500619_008894
1915 Ga0500620_002958
1916 Ga0500630_000056
1917 Ga0500638_000489
1918 Ga0500639_000099
1919 Ga0500636_0003063
1920 Ga0500637_0000042
1921 Ga0500637_0022819
1922 Ga0500645_025118
1923 Ga0500596_007111
1924 Ga0500601_000081
1925 Ga0501084_0003876
1926 Ga0500661_009657
1927 Ga0501082_0005063
1928 8019649372
1929 2507507656
1930 2508541772
1931 2508692684
1932 2511398203
1933 2513621858
1934 2513642988
1935 2513647520
1936 2513654098
1937 2513674794
1938 2513698108
1939 2513701474
1940 2513721283
1941 2513856850
1942 2513878530
1943 2513891242
1944 2513918438
1945 2514009424
1946 2515626083
1947 2517104163
1948 2517891328
1949 2524436274
1950 2524468481
1951 2524540865
1952 2528848975
1953 2617346804
1954 2617372735
1955 2644287469
1956 2671123858
1957 2723843681
1958 2728750040
1959 2745080771
1960 2793065202
1961 2793066696
1962 2793083790
1963 2805919046
1964 2818236557
1965 2824606530
1966 2824613053
1967 2824620429
1968 2824628523
1969 2824637223
1970 2824650836
1971 2824658546
1972 2824666494
1973 2824674112
1974 2824684940
1975 2824694399
1976 2824703216
1977 2824708905
1978 2824721338
1979 2824725616
1980 2824739488
1981 2824750112
1982 2824755986
1983 2824767524
1984 2824775119
1985 2838130472
1986 2841948120
1987 2841953485
1988 2841962917
1989 2841972038
1990 2841978214
1991 2841990984
1992 2842040654
1993 2842046400
1994 2844320031
1995 2847937329
1996 2847947749
1997 2849078391
1998 2857512766
1999 2874598769
2000 2874607411
2001 2874614565
2002 2874628087
2003 2874635001
2004 2874652225
2005 2876771040
2006 2876778808
2007 2876817705
2008 2876824297
2009 2879082601
2010 2879086629
2011 2879107139
2012 2879111868
2013 2879131518
2014 2879147964
2015 2881371455
2016 2881666585
2017 2885369974
2018 2885377033
2019 2885391393
2020 2885417890
2021 2888385457
2022 2888392774
2023 2888425589
2024 2889038010
2025 2903730295
2026 2903755289
2027 2903769729
2028 2904674295
2029 2904694501
2030 2904701275
2031 2904711969
2032 2906609856
2033 2906616514
2034 2906627348
2035 2906635285
2036 2906643954
2037 2906663011
2038 2908741682
2039 2908759157
2040 2908781177
2041 2922366012
2042 2922372401
2043 2922386826
2044 2922397068
2045 2922431467
2046 2928104462
2047 2929621029
2048 2929626140
2049 2932784980
2050 2932795145
2051 2932805673
2052 2932810014
2053 2932827011
2054 2932828817
2055 2933583101
2056 2935609836
2057 2935619763
2058 2935636227
2059 2935638744
2060 2935652134
2061 2935659893
2062 2935666405
2063 2935676548
2064 2935690780
2065 2935694629
2066 2935703750
2067 2935718161
2068 2935727858
2069 2935736562
2070 2935745941
2071 2935756322
2072 2935760574
2073 2935776992
2074 2935783547
2075 2935792807
2076 2935800845
2077 2935801887
2078 2935814703
2079 2935822997
2080 2935828238
2081 2935842442
2082 2935848579
2083 2935857922
2084 2935868736
2085 2935874151
2086 2935883957
2087 2935909614
2088 2935917339
2089 2935927095
2090 2935937061
2091 2935944636
2092 2935953073
2093 2935966573
2094 2935969913
2095 2935976509
2096 2935987037
2097 2935992924
2098 2936002837
2099 2936014309
2100 2936023851
2101 2936031494
2102 2936040654
2103 2936049415
2104 2936062165
2105 2940561703
2106 2941512858
2107 2941520575
2108 2941528589
2109 2941531216
2110 2941542491
2111 3005481260
2112 3005484785
2113 3005508428
2114 3005588073
2115 3005600322
2116 3005715812
2117 3005723168
2118 8006928387
2119 8006939450
2120 8006972113
2121 8006979200
2122 8006984433
2123 8007001367
2124 8016520652
2125 8016528682
2126 8016533857
2127 8016547081
2128 8016555042
2129 8016563407
2130 8016572190
2131 8016576386
2132 8016594346
2133 8016601156
2134 8016609288
2135 8016625607
2136 8016639167
2137 8017064927
2138 8019533628
2139 8019546036
2140 8019552686
2141 8019565325
2142 8019575425
2143 8019584304
2144 8019592074
2145 8019599211
2146 8019609148
2147 8019619818
2148 8019633297
2149 8019646604
2150 8019661171
2151 8019670722
2152 8019685511
2153 8019691077
2154 8055745108
2155 8056679830
2156 8056684753
2157 8056693053
2158 8056975061

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

18

272

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a7v-assembly2.cif.gz_B the gh130 family of mannoside phosphorylases contains glycoside hydrolases that target beta-1,2 mannosidic linkages in candida mannan 0.7672 18 51
3qc2-assembly2.cif.gz_B crystal structure of a glycosyl hydrolase (bacova_03624) from bacteroides ovatus at 2.30 a resolution 0.7667 19 51
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.7573 4 322
3qc2-assembly1.cif.gz_A crystal structure of a glycosyl hydrolase (bacova_03624) from bacteroides ovatus at 2.30 a resolution 0.7451 18 51
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.7368 4 322
ID Description Score Start End Superfamily
af_Q8RWZ3_128_373_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8017 116 327 3.90.1200.10
af_Q709F0_125_359_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.7967 107 328 3.90.1200.10
af_O01590_328_568_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.7915 107 324 3.90.1200.10
af_O01590_229_326_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7868 1 105 3.30.200.20
af_O01590_229_326_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7799 1 105 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A109JZ67-F1-model_v4 Tyrosine protein kinase 0.9721 1 327 GO:0016301
AF-A0A109JZ67-F1-model_v4 Tyrosine protein kinase 0.9692 1 327 GO:0016301
AF-A0A1G6W9Y5-F1-model_v4 Predicted kinase, aminoglycoside phosphotransferase (APT) family 0.967 73 327 GO:0016301
AF-N1MNU0-F1-model_v4 Aminoglycoside phosphotransferase 0.9643 91 323 GO:0016740
AF-A0A2N3EIB2-F1-model_v4 Phosphotransferase family protein 0.9601 2 311 GO:0016301

Map