F489672

General Info

Members Datasets Scaffolds Average Seq Length
1080 470 2160 416

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0024566|Ga0501080_0024566_1773_3080
Length 421
Sequence LETAFNRKFTTWFLCNNCVSPNPLWQSLMDLASIGATPKGGVCRLALSDLDREGRDRVCSWLRAAGCKVEVDGIGNIFARRRGRNDSLPPVVAGSHIDTQPSGGKFDGNYGVMAALEVVRTLNDHRIETEHPFEVAIWTNEEGTRFTPVMMGSGVFAGAFTLQHALAQSDIDGKTVGAELGRIGYAGTAPIPRPMAAYFEAHIEQGPILEDTNKVIGVVQGALGLRWYDVAVTGQDAHAGPTPMRLRKDAMLGAARIVEAVNGIAAGHQPDGRGTVGFMQVKPNSRNVIPGSVRLSVDLRHADKASLDSMERQLREACRMIAEAGGVGIDLKCVTDYAPLSFDTALVNGVRQAASELGYPSLDIVSGAGHDACYVARVAPAAMIFVPCESGISHNEIENAKPSDLEAGGNVLLRSVLQAAG

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
149 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
150 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
216 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
223 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
249 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
250 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
251 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
252 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
295 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
296 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
304 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
318 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
340 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
341 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
342 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
343 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
374 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
377 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
380 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
386 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
389 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
390 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
391 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
392 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
395 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
396 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
397 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
398 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
399 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
400 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
401 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
402 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
403 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
404 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
405 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
406 2643221556 Massilia sp. Root1485 Isolate Unclassified
407 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
408 2643221638 Duganella sp. Root336D2 Isolate Unclassified
409 2643221645 Massilia sp. Root351 Isolate Unclassified
410 2643221658 Variovorax sp. Root411 Isolate Unclassified
411 2643221664 Massilia sp. Root418 Isolate Unclassified
412 2643221684 Massilia sp. Root133 Isolate Unclassified
413 2738541280 Massilia sp. GV090 Isolate Unclassified
414 2738541297 Duganella sp. GV083 Isolate Unclassified
415 2738541300 Massilia sp. GV016 Isolate Unclassified
416 2738541307 Variovorax sp. GV008 Isolate Unclassified
417 2738541357 Duganella sp. GV053 Isolate Unclassified
418 2738543003 Duganella sp. GV066 Isolate Unclassified
419 2738543018 Massilia sp. GV045 Isolate Unclassified
420 2738543026 Duganella sp. GV089 Isolate Unclassified
421 2738543029 Duganella sp. GV039 Isolate Unclassified
422 2738543030 Massilia sp. GV097 Isolate Unclassified
423 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
424 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
425 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
426 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
427 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
428 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
429 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
430 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
431 2818991436 Collimonas arenae 515 Isolate Unclassified
432 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
433 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
434 2821131069 Duganella sp. 1224 Isolate Unclassified
435 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
436 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
437 2842711865 Duganella sp. R-73148 Isolate Unclassified
438 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
439 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
440 2857553236 Duganella sp. R-74557 Isolate Unclassified
441 2857558681 Duganella sp. R-74565 Isolate Unclassified
442 2857564685 Duganella sp. R-74599 Isolate Unclassified
443 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
444 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
445 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
446 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
447 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
448 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
449 2885198086 Variovorax sp. 679 Isolate Unclassified
450 2885211737 Variovorax sp. 553 Isolate Unclassified
451 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
452 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
453 2904424332 Duganella sp. 1411 Isolate Rhizosphere
454 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
455 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
456 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
457 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
458 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
459 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
460 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
461 2919476304 Duganella sp. 3397 Isolate Unclassified
462 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
463 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
464 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
465 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
466 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
467 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
468 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
469 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
470 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.87
Metatranscriptomes 0
Isolates 7.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.28
Nodule 0.74
Rhizoplane 2.78
Rhizosphere 77.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0024566 3300049742 Bacteria 5587
2 RicEn_C2987 2010549000 Bacteria 2825
3 JGI25155J39150_1000140 3300002704 Bacteria 34372
4 JGI25155J39150_1000562 3300002704 Bacteria 8330
5 JGI25156J39149_1000120 3300002705 Bacteria 56713
6 JGI25156J39149_1000370 3300002705 Bacteria 28936
7 JGI25154J39366_1000372 3300002738 Bacteria 24998
8 JGI25154J39366_1001022 3300002738 Bacteria 11253
9 JGI25154J39366_1001082 3300002738 Bacteria 10702
10 JGI25158J39367_1001790 3300002739 Bacteria 3659
11 JGI25157J39369_1000294 3300002741 Bacteria 36390
12 JGI25152J39213_1000487 3300002773 Bacteria 22528
13 JGI25150J39212_1000644 3300002774 Bacteria 13137
14 JGI25150J39212_1001243 3300002774 Bacteria 7377
15 JGI25159J45721_1000989 3300002987 Bacteria 12278
16 JGI25159J45721_1003515 3300002987 Bacteria 5520
17 JGI25151J46595_10000568 3300003187 Bacteria 33251
18 rootL2_10156471 3300003322 Bacteria 6470
19 JGI25161J50226_1001985 3300003374 Bacteria 5611
20 Ga0055538_1000024 3300003751 Bacteria 241526
21 Ga0055539_1000031 3300003752 Bacteria 241526
22 Ga0055533_1000041 3300003756 Bacteria 241526
23 Ga0055532_1000074 3300003758 Bacteria 125513
24 Ga0055525_1000006 3300003759 Bacteria 642912
25 Ga0055525_1000049 3300003759 Bacteria 241526
26 Ga0055529_1000537 3300003763 Bacteria 32520
27 Ga0055526_1000035 3300003771 Bacteria 135873
28 Ga0055526_1000047 3300003771 Bacteria 120080
29 Ga0055526_1000729 3300003771 Bacteria 24835
30 Ga0055526_1006694 3300003771 Bacteria 6180
31 Ga0055537_1000078 3300003773 Bacteria 70140
32 Ga0055537_1007096 3300003773 Bacteria 2750
33 Ga0055524_1000053 3300003775 Bacteria 144892
34 Ga0055524_1003340 3300003775 Bacteria 7824
35 Ga0055524_1005701 3300003775 Bacteria 5519
36 Ga0055536_1000458 3300003781 Bacteria 28710
37 Ga0055536_1003852 3300003781 Bacteria 7892
38 Ga0055534_1000070 3300003784 Bacteria 80000
39 Ga0055534_1000105 3300003784 Bacteria 64494
40 Ga0055534_1003475 3300003784 Bacteria 4942
41 Ga0055528_1000224 3300003790 Bacteria 47488
42 Ga0055528_1012389 3300003790 Bacteria 3312
43 Ga0055530_10006363 3300003791 Bacteria 5296
44 Ga0055530_10007199 3300003791 Bacteria 4749
45 Ga0055530_10009880 3300003791 Bacteria 3598
46 Ga0055540_1000344 3300003792 Bacteria 39592
47 Ga0055531_10002512 3300003794 Bacteria 12231
48 Ga0055541_1000022 3300003841 Bacteria 241526
49 Ga0055543_1000889 3300004625 Bacteria 14193
50 Ga0055543_1010749 3300004625 Bacteria 1906
51 Ga0065165_1000287 3300005262 Bacteria 85987
52 Ga0065165_1000619 3300005262 Bacteria 51595
53 Ga0065165_1005746 3300005262 Bacteria 6812
54 Ga0070683_100010175 3300005329 Bacteria 8073
55 Ga0070690_100003772 3300005330 Bacteria 8345
56 Ga0070670_100005802 3300005331 Bacteria 10434
57 Ga0068869_100004897 3300005334 Bacteria 8377
58 Ga0068869_100005563 3300005334 Bacteria 7928
59 Ga0070666_10000254 3300005335 Bacteria 35480
60 Ga0070666_10100848 3300005335 Bacteria 1989
61 Ga0070680_100029945 3300005336 Bacteria 4371
62 Ga0070680_100110627 3300005336 Bacteria 2287
63 Ga0070680_100187264 3300005336 Bacteria 1744
64 Ga0068868_100000728 3300005338 Bacteria 22233
65 Ga0070660_100039822 3300005339 Bacteria 3573
66 Ga0070660_100131788 3300005339 Bacteria 2001
67 Ga0070689_100000500 3300005340 Bacteria 23117
68 Ga0070691_10089219 3300005341 Bacteria 1518
69 Ga0070661_100003517 3300005344 Bacteria 10795
70 Ga0070661_100004042 3300005344 Bacteria 10093
71 Ga0070668_100020780 3300005347 Bacteria 4958
72 Ga0070675_100066488 3300005354 Bacteria 2982
73 Ga0070675_100095596 3300005354 Bacteria 2495
74 Ga0070675_100139538 3300005354 Bacteria 2071
75 Ga0070675_100176484 3300005354 Bacteria 1845
76 Ga0070671_100002017 3300005355 Bacteria 15614
77 Ga0070673_100000114 3300005364 Bacteria 37125
78 Ga0070688_100000295 3300005365 Bacteria 25560
79 Ga0070659_100036274 3300005366 Bacteria 3843
80 Ga0070659_100172664 3300005366 Bacteria 1771
81 Ga0070667_100002145 3300005367 Bacteria 17371
82 Ga0070667_100150634 3300005367 Bacteria 2043
83 Ga0070709_10039550 3300005434 Bacteria 2894
84 Ga0070709_10055229 3300005434 Bacteria 2507
85 Ga0070714_100023965 3300005435 Bacteria 5020
86 Ga0070713_100000481 3300005436 Bacteria 25385
87 Ga0070713_100039530 3300005436 Bacteria 3829
88 Ga0070710_10041613 3300005437 Bacteria 2537
89 Ga0070701_10018158 3300005438 Bacteria 3302
90 Ga0070711_100000229 3300005439 Bacteria 29618
91 Ga0070705_100005810 3300005440 Bacteria 6033
92 Ga0070705_100028065 3300005440 Bacteria 3079
93 Ga0070700_100157561 3300005441 Bacteria 1560
94 Ga0070694_100014383 3300005444 Bacteria 4953
95 Ga0070663_100049429 3300005455 Bacteria 2986
96 Ga0070678_100009831 3300005456 Bacteria 5815
97 Ga0070662_100108400 3300005457 Bacteria 2112
98 Ga0070662_100185638 3300005457 Bacteria 1642
99 Ga0070681_10004639 3300005458 Bacteria 13124
100 Ga0068867_100086370 3300005459 Bacteria 2373
101 Ga0068867_100155712 3300005459 Bacteria 1798
102 Ga0070685_10000366 3300005466 Bacteria 27459
103 Ga0070706_100047663 3300005467 Bacteria 3955
104 Ga0070706_100247815 3300005467 Bacteria 1663
105 Ga0070698_100117086 3300005471 Bacteria 2627
106 Ga0070699_100024527 3300005518 Bacteria 5197
107 Ga0070679_100012768 3300005530 Bacteria 8036
108 Ga0070679_100030440 3300005530 Bacteria 5329
109 Ga0070697_100029882 3300005536 Bacteria 4374
110 Ga0068853_100087329 3300005539 Bacteria 2736
111 Ga0070672_100069229 3300005543 Bacteria 2801
112 Ga0070686_100054755 3300005544 Bacteria 2553
113 Ga0070695_100182951 3300005545 Bacteria 1486
114 Ga0070696_100021608 3300005546 Bacteria 4364
115 Ga0070693_100003420 3300005547 Bacteria 7401
116 Ga0070693_100014679 3300005547 Bacteria 4020
117 Ga0070693_100112889 3300005547 Bacteria 1674
118 Ga0070693_100126254 3300005547 Bacteria 1593
119 Ga0070665_100019741 3300005548 Bacteria 6765
120 Ga0070704_100003098 3300005549 Bacteria 9472
121 Ga0068855_100007024 3300005563 Bacteria 13665
122 Ga0068855_100009503 3300005563 Bacteria 11742
123 Ga0068855_100012256 3300005563 Bacteria 10362
124 Ga0068855_100038688 3300005563 Bacteria 5667
125 Ga0068855_100038842 3300005563 Bacteria 5654
126 Ga0068855_100082135 3300005563 Bacteria 3735
127 Ga0068855_100101430 3300005563 Bacteria 3313
128 Ga0068855_100138486 3300005563 Bacteria 2775
129 Ga0070664_100014240 3300005564 Bacteria 6486
130 Ga0070664_100021645 3300005564 Bacteria 5302
131 Ga0070664_100038530 3300005564 Bacteria 4024
132 Ga0070664_100051325 3300005564 Bacteria 3492
133 Ga0070664_100097425 3300005564 Bacteria 2553
134 Ga0070664_100106004 3300005564 Bacteria 2448
135 Ga0070664_100109195 3300005564 Bacteria 2413
136 Ga0068857_100002557 3300005577 Bacteria 14901
137 Ga0068857_100048800 3300005577 Bacteria 3757
138 Ga0068857_100060990 3300005577 Bacteria 3351
139 Ga0068856_100028149 3300005614 Bacteria 5485
140 Ga0068856_100029489 3300005614 Bacteria 5359
141 Ga0068856_100034020 3300005614 Bacteria 4991
142 Ga0068856_100292934 3300005614 Bacteria 1644
143 Ga0068852_100001512 3300005616 Bacteria 15724
144 Ga0068852_100022972 3300005616 Bacteria 5011
145 Ga0068852_100027407 3300005616 Bacteria 4644
146 Ga0068852_100079085 3300005616 Bacteria 2912
147 Ga0068859_100000495 3300005617 Bacteria 38804
148 Ga0068859_100051657 3300005617 Bacteria 4132
149 Ga0068859_100298336 3300005617 Bacteria 1705
150 Ga0068864_100000382 3300005618 Bacteria 38674
151 Ga0068864_100222740 3300005618 Bacteria 1741
152 Ga0068866_10002285 3300005718 Bacteria 7933
153 Ga0068866_10066970 3300005718 Bacteria 1884
154 Ga0068861_100032382 3300005719 Bacteria 3848
155 Ga0068861_100170603 3300005719 Bacteria 1803
156 Ga0068870_10005048 3300005840 Bacteria 5734
157 Ga0068863_100001883 3300005841 Bacteria 20830
158 Ga0068863_100043513 3300005841 Bacteria 4262
159 Ga0068863_100057576 3300005841 Bacteria 3678
160 Ga0068858_100001712 3300005842 Bacteria 22417
161 Ga0068858_100013087 3300005842 Bacteria 7824
162 Ga0068858_100103414 3300005842 Bacteria 2657
163 Ga0068860_100014249 3300005843 Bacteria 7795
164 Ga0081539_10007797 3300005985 Bacteria 9581
165 Ga0070716_100009960 3300006173 Bacteria 4754
166 Ga0070716_100028505 3300006173 Bacteria 3009
167 Ga0070712_100001035 3300006175 Bacteria 16771
168 Ga0070712_100118334 3300006175 Bacteria 1990
169 Ga0075362_10012450 3300006177 Bacteria 3380
170 Ga0075367_10008779 3300006178 Bacteria 5254
171 Ga0075366_10021485 3300006195 Bacteria 3751
172 Ga0097621_100003309 3300006237 Bacteria 11088
173 Ga0097621_100011313 3300006237 Bacteria 6568
174 Ga0097621_100020255 3300006237 Bacteria 5124
175 Ga0075370_10033041 3300006353 Bacteria 2895
176 Ga0068871_100011216 3300006358 Bacteria 6568
177 Ga0068871_100023303 3300006358 Bacteria 4786
178 Ga0068871_100195351 3300006358 Bacteria 1745
179 Ga0097620_100000495 3300006931 Bacteria 38804
180 Ga0097620_100051656 3300006931 Bacteria 4132
181 Ga0097620_100200818 3300006931 Bacteria 2078
182 Ga0097620_100298340 3300006931 Bacteria 1705
183 Ga0079104_1017630 3300006946 Bacteria 2047
184 Ga0099826_10000006 3300006948 Bacteria 432260
185 Ga0105244_10002483 3300009036 Bacteria 13891
186 Ga0105244_10030761 3300009036 Bacteria 2854
187 Ga0105240_10000718 3300009093 Bacteria 60617
188 Ga0105240_10002320 3300009093 Bacteria 30796
189 Ga0105240_10007182 3300009093 Bacteria 16221
190 Ga0105240_10016166 3300009093 Bacteria 10113
191 Ga0105240_10017750 3300009093 Bacteria 9578
192 Ga0105240_10200004 3300009093 Bacteria 2342
193 Ga0105245_10002729 3300009098 Bacteria 15888
194 Ga0105245_10007375 3300009098 Bacteria 9628
195 Ga0105245_10025836 3300009098 Bacteria 5164
196 Ga0105247_10011876 3300009101 Bacteria 5236
197 Ga0114129_10109069 3300009147 Bacteria 3821
198 Ga0105243_10001371 3300009148 Bacteria 21570
199 Ga0105243_10116549 3300009148 Bacteria 2244
200 Ga0105241_10022386 3300009174 Bacteria 4681
201 Ga0105241_10141001 3300009174 Bacteria 1962
202 Ga0105242_10024897 3300009176 Bacteria 4730
203 Ga0105242_10088012 3300009176 Bacteria 2608
204 Ga0105248_10001597 3300009177 Bacteria 25193
205 Ga0105248_10007128 3300009177 Bacteria 12254
206 Ga0105248_10034146 3300009177 Bacteria 5686
207 Ga0105237_10006851 3300009545 Bacteria 12557
208 Ga0105237_10017698 3300009545 Bacteria 7386
209 Ga0105237_10149946 3300009545 Bacteria 2328
210 Ga0105238_10000107 3300009551 Bacteria 91765
211 Ga0105238_10005597 3300009551 Bacteria 12415
212 Ga0105238_10079034 3300009551 Bacteria 3279
213 Ga0105238_10174280 3300009551 Bacteria 2127
214 Ga0105238_10212471 3300009551 Bacteria 1911
215 Ga0105238_10437437 3300009551 Bacteria 1304
216 Ga0105249_10299660 3300009553 Bacteria 1612
217 Ga0105239_10000289 3300010375 Bacteria 74109
218 Ga0105239_10011318 3300010375 Bacteria 9955
219 Ga0105239_10154792 3300010375 Bacteria 2560
220 Ga0105246_10028790 3300011119 Bacteria 3652
221 Ga0157371_10041027 3300013102 Bacteria 3304
222 Ga0157370_10021505 3300013104 Bacteria 6428
223 Ga0157370_10034978 3300013104 Bacteria 4888
224 Ga0157369_10063621 3300013105 Bacteria 3974
225 Ga0157369_10076251 3300013105 Bacteria 3594
226 Ga0157374_10004556 3300013296 Bacteria 11628
227 Ga0157374_10012509 3300013296 Bacteria 7386
228 Ga0157374_10013360 3300013296 Bacteria 7167
229 Ga0157374_10267092 3300013296 Bacteria 1686
230 Ga0157378_10007955 3300013297 Bacteria 9253
231 Ga0157378_10019633 3300013297 Bacteria 5940
232 Ga0163162_10005095 3300013306 Bacteria 12663
233 Ga0163162_10024879 3300013306 Bacteria 5913
234 Ga0157372_10005037 3300013307 Bacteria 14035
235 Ga0157372_10310657 3300013307 Bacteria 1835
236 Ga0157375_10001898 3300013308 Bacteria 17974
237 Ga0157375_10049090 3300013308 Bacteria 4133
238 Ga0163163_10000829 3300014325 Bacteria 26308
239 Ga0182008_10000145 3300014497 Bacteria 54865
240 Ga0157379_10001663 3300014968 Bacteria 18363
241 Ga0157379_10204340 3300014968 Bacteria 1787
242 Ga0157376_10001490 3300014969 Bacteria 15443
243 Ga0157376_10007856 3300014969 Bacteria 7651
244 Ga0157376_10024072 3300014969 Bacteria 4775
245 Ga0182006_1000004 3300015261 Bacteria 622190
246 Ga0182006_1000019 3300015261 Bacteria 294192
247 Ga0182006_1029360 3300015261 Bacteria 2228
248 Ga0182007_10000028 3300015262 Bacteria 167122
249 Ga0182007_10005363 3300015262 Bacteria 5645
250 Ga0182005_1000003 3300015265 Bacteria 683269
251 Ga0182005_1000011 3300015265 Bacteria 420605
252 Ga0182005_1000252 3300015265 Bacteria 34129
253 Ga0163161_10005476 3300017792 Bacteria 8813
254 Ga0163161_10018863 3300017792 Bacteria 4835
255 Ga0213872_10000075 3300021361 Bacteria 90871
256 Ga0213872_10000179 3300021361 Bacteria 56790
257 Ga0213872_10001290 3300021361 Bacteria 16734
258 Ga0213872_10001872 3300021361 Bacteria 12990
259 Ga0213872_10003652 3300021361 Bacteria 8437
260 Ga0209435_100055 3300025206 Bacteria 86115
261 Ga0209435_100229 3300025206 Bacteria 15408
262 Ga0209436_100124 3300025208 Bacteria 37907
263 Ga0209784_100018 3300025224 Bacteria 456816
264 Ga0209566_100016 3300025225 Bacteria 456824
265 Ga0209674_100030 3300025226 Bacteria 456824
266 Ga0209147_100097 3300025229 Bacteria 164034
267 Ga0209563_100022 3300025230 Bacteria 643318
268 Ga0209563_100034 3300025230 Bacteria 456824
269 Ga0209437_100234 3300025233 Bacteria 92856
270 Ga0209258_100192 3300025242 Bacteria 125565
271 Ga0207425_1000013 3300025245 Bacteria 497384
272 Ga0207425_1000141 3300025245 Bacteria 63719
273 Ga0207425_1000349 3300025245 Bacteria 32189
274 Ga0209646_1000103 3300025246 Bacteria 164034
275 Ga0209646_1000219 3300025246 Bacteria 62071
276 Ga0209646_1000346 3300025246 Bacteria 34384
277 Ga0209026_1000134 3300025250 Bacteria 117098
278 Ga0209026_1003583 3300025250 Bacteria 5010
279 Ga0209677_100019 3300025253 Bacteria 456824
280 Ga0209677_103351 3300025253 Bacteria 5265
281 Ga0209148_1000554 3300025254 Bacteria 35482
282 Ga0209759_1000091 3300025256 Bacteria 164034
283 Ga0209759_1000094 3300025256 Bacteria 159426
284 Ga0209759_1000767 3300025256 Bacteria 27265
285 Ga0209129_1000106 3300025258 Bacteria 156102
286 Ga0209129_1000956 3300025258 Bacteria 17406
287 Ga0209129_1009845 3300025258 Bacteria 2459
288 Ga0209565_1000035 3300025263 Bacteria 298125
289 Ga0209565_1001523 3300025263 Bacteria 9999
290 Ga0209565_1002212 3300025263 Bacteria 7285
291 Ga0209565_1002406 3300025263 Bacteria 6777
292 Ga0209565_1006605 3300025263 Bacteria 3232
293 Ga0209455_1000033 3300025272 Bacteria 504606
294 Ga0209455_1005803 3300025272 Bacteria 3750
295 Ga0209673_1000006 3300025273 Bacteria 650600
296 Ga0209130_1000086 3300025284 Bacteria 157063
297 Ga0209130_1000322 3300025284 Bacteria 56118
298 Ga0209675_1000005 3300025291 Bacteria 849192
299 Ga0209675_1006765 3300025291 Bacteria 4534
300 Ga0209676_1000098 3300025292 Bacteria 234305
301 Ga0209676_1000300 3300025292 Bacteria 100399
302 Ga0209025_1000174 3300025294 Bacteria 158915
303 Ga0209025_1003824 3300025294 Bacteria 13734
304 Ga0209564_1000028 3300025295 Bacteria 510986
305 Ga0209564_1000032 3300025295 Bacteria 464041
306 Ga0209564_1000083 3300025295 Bacteria 259272
307 Ga0209564_1000202 3300025295 Bacteria 136555
308 Ga0209564_1009714 3300025295 Bacteria 4533
309 Ga0209758_1000031 3300025297 Bacteria 497252
310 Ga0209758_1000583 3300025297 Bacteria 56955
311 Ga0209050_1000078 3300025298 Bacteria 278409
312 Ga0209050_1000226 3300025298 Bacteria 124227
313 Ga0209050_1002985 3300025298 Bacteria 13166
314 Ga0209050_1004270 3300025298 Bacteria 9809
315 Ga0209256_1000035 3300025299 Bacteria 386754
316 Ga0209256_1000322 3300025299 Bacteria 82681
317 Ga0209256_1000508 3300025299 Bacteria 57334
318 Ga0209256_1002611 3300025299 Bacteria 14257
319 Ga0209256_1004993 3300025299 Bacteria 7941
320 Ga0207426_1001307 3300025302 Bacteria 21310
321 Ga0209051_1000098 3300025303 Bacteria 165284
322 Ga0209257_1000097 3300025304 Bacteria 259243
323 Ga0209257_1011227 3300025304 Bacteria 4348
324 Ga0209257_1016786 3300025304 Bacteria 2935
325 Ga0207655_1002824 3300025728 Bacteria 13460
326 Ga0207692_10041895 3300025898 Bacteria 2270
327 Ga0207642_10002638 3300025899 Bacteria 5590
328 Ga0207642_10003692 3300025899 Bacteria 4863
329 Ga0207710_10006209 3300025900 Bacteria 5114
330 Ga0207680_10000184 3300025903 Bacteria 30323
331 Ga0207699_10048033 3300025906 Bacteria 2505
332 Ga0207643_10016782 3300025908 Bacteria 3996
333 Ga0207705_10015863 3300025909 Bacteria 5409
334 Ga0207684_10077919 3300025910 Bacteria 2819
335 Ga0207707_10007366 3300025912 Bacteria 9582
336 Ga0207707_10107716 3300025912 Bacteria 2436
337 Ga0207695_10001004 3300025913 Bacteria 49973
338 Ga0207695_10011204 3300025913 Bacteria 10877
339 Ga0207695_10012700 3300025913 Bacteria 10085
340 Ga0207695_10040095 3300025913 Bacteria 5027
341 Ga0207695_10053375 3300025913 Bacteria 4228
342 Ga0207695_10089618 3300025913 Bacteria 3093
343 Ga0207671_10008252 3300025914 Bacteria 8862
344 Ga0207671_10025688 3300025914 Bacteria 4421
345 Ga0207671_10123375 3300025914 Bacteria 1982
346 Ga0207671_10131739 3300025914 Bacteria 1919
347 Ga0207693_10003805 3300025915 Bacteria 12846
348 Ga0207693_10007691 3300025915 Bacteria 8849
349 Ga0207663_10000216 3300025916 Bacteria 25624
350 Ga0207660_10096256 3300025917 Bacteria 2204
351 Ga0207660_10208313 3300025917 Bacteria 1530
352 Ga0207657_10004518 3300025919 Bacteria 14697
353 Ga0207657_10004885 3300025919 Bacteria 14103
354 Ga0207657_10018798 3300025919 Bacteria 6582
355 Ga0207657_10038927 3300025919 Bacteria 4228
356 Ga0207649_10013185 3300025920 Bacteria 4610
357 Ga0207649_10072957 3300025920 Bacteria 2197
358 Ga0207652_10008588 3300025921 Bacteria 8220
359 Ga0207652_10041247 3300025921 Bacteria 3923
360 Ga0207652_10066752 3300025921 Bacteria 3118
361 Ga0207646_10253015 3300025922 Bacteria 1592
362 Ga0207681_10120915 3300025923 Bacteria 1920
363 Ga0207694_10000075 3300025924 Bacteria 114693
364 Ga0207694_10001533 3300025924 Bacteria 19662
365 Ga0207650_10019053 3300025925 Bacteria 4823
366 Ga0207650_10124002 3300025925 Bacteria 2014
367 Ga0207687_10000171 3300025927 Bacteria 42958
368 Ga0207687_10026081 3300025927 Bacteria 3912
369 Ga0207687_10030876 3300025927 Bacteria 3617
370 Ga0207700_10005562 3300025928 Bacteria 7558
371 Ga0207700_10034914 3300025928 Bacteria 3615
372 Ga0207664_10007467 3300025929 Bacteria 7583
373 Ga0207664_10031707 3300025929 Bacteria 4046
374 Ga0207644_10000563 3300025931 Bacteria 23815
375 Ga0207644_10004179 3300025931 Bacteria 9367
376 Ga0207690_10071636 3300025932 Bacteria 2391
377 Ga0207690_10161369 3300025932 Bacteria 1671
378 Ga0207686_10000953 3300025934 Bacteria 17273
379 Ga0207686_10025755 3300025934 Bacteria 3426
380 Ga0207686_10071207 3300025934 Bacteria 2237
381 Ga0207709_10000130 3300025935 Bacteria 110843
382 Ga0207709_10016469 3300025935 Bacteria 4109
383 Ga0207670_10004704 3300025936 Bacteria 7402
384 Ga0207665_10006712 3300025939 Bacteria 7632
385 Ga0207665_10017352 3300025939 Bacteria 4730
386 Ga0207711_10000157 3300025941 Bacteria 73266
387 Ga0207711_10005820 3300025941 Bacteria 10412
388 Ga0207711_10094372 3300025941 Bacteria 2636
389 Ga0207711_10113955 3300025941 Bacteria 2407
390 Ga0207711_10229229 3300025941 Bacteria 1701
391 Ga0207689_10007339 3300025942 Bacteria 9669
392 Ga0207689_10010020 3300025942 Bacteria 8170
393 Ga0207689_10023166 3300025942 Bacteria 5214
394 Ga0207689_10058811 3300025942 Bacteria 3162
395 Ga0207689_10172411 3300025942 Bacteria 1784
396 Ga0207661_10010229 3300025944 Bacteria 6746
397 Ga0207679_10007163 3300025945 Bacteria 7063
398 Ga0207679_10016667 3300025945 Bacteria 4881
399 Ga0207679_10071153 3300025945 Bacteria 2623
400 Ga0207679_10087190 3300025945 Bacteria 2403
401 Ga0207667_10000110 3300025949 Bacteria 131872
402 Ga0207667_10003783 3300025949 Bacteria 18635
403 Ga0207667_10008363 3300025949 Bacteria 12299
404 Ga0207667_10021206 3300025949 Bacteria 7202
405 Ga0207667_10039822 3300025949 Bacteria 5005
406 Ga0207667_10125460 3300025949 Bacteria 2644
407 Ga0207667_10236654 3300025949 Bacteria 1869
408 Ga0207651_10000171 3300025960 Bacteria 28182
409 Ga0207640_10052490 3300025981 Bacteria 2656
410 Ga0207640_10136890 3300025981 Bacteria 1779
411 Ga0207658_10003562 3300025986 Bacteria 10992
412 Ga0207677_10000221 3300026023 Bacteria 45379
413 Ga0207677_10127095 3300026023 Bacteria 1928
414 Ga0207677_10164708 3300026023 Bacteria 1727
415 Ga0207677_10174283 3300026023 Bacteria 1686
416 Ga0207703_10000374 3300026035 Bacteria 47821
417 Ga0207703_10110630 3300026035 Bacteria 2344
418 Ga0207639_10097541 3300026041 Bacteria 2367
419 Ga0207708_10112888 3300026075 Bacteria 2111
420 Ga0207702_10037982 3300026078 Bacteria 4033
421 Ga0207702_10053897 3300026078 Bacteria 3406
422 Ga0207702_10078997 3300026078 Bacteria 2850
423 Ga0207702_10190867 3300026078 Bacteria 1893
424 Ga0207641_10000603 3300026088 Bacteria 39496
425 Ga0207641_10253651 3300026088 Bacteria 1644
426 Ga0207648_10004108 3300026089 Bacteria 15067
427 Ga0207648_10094592 3300026089 Bacteria 2613
428 Ga0207676_10000054 3300026095 Bacteria 128222
429 Ga0207676_10201243 3300026095 Bacteria 1760
430 Ga0207674_10062673 3300026116 Bacteria 3755
431 Ga0207675_100019706 3300026118 Bacteria 6296
432 Ga0207683_10017484 3300026121 Bacteria 6112
433 Ga0207698_10000842 3300026142 Bacteria 17781
434 Ga0207698_10046078 3300026142 Bacteria 3290
435 Ga0207698_10097486 3300026142 Bacteria 2427
436 Ga0209281_1001845 3300027111 Bacteria 10316
437 Ga0209281_1002589 3300027111 Bacteria 7004
438 Ga0209371_1000050 3300027312 Bacteria 278645
439 Ga0209371_1000112 3300027312 Bacteria 139930
440 Ga0209282_1000003 3300027666 Bacteria 856377
441 Ga0268266_10015295 3300028379 Bacteria 6586
442 Ga0268265_10082243 3300028380 Bacteria 2546
443 Ga0268264_10023638 3300028381 Bacteria 5013
444 Ga0268264_10024820 3300028381 Bacteria 4897
445 Ga0307515_10179545 3300028794 Bacteria 2073
446 Ga0268256_1000017 3300030500 Bacteria 600718
447 Ga0316177_1095886 3300030731 Bacteria 2086
448 Ga0307408_100000596 3300031548 Bacteria 31031
449 Ga0307408_100002140 3300031548 Bacteria 14157
450 Ga0307408_100002964 3300031548 Bacteria 11761
451 Ga0307408_100019423 3300031548 Bacteria 4576
452 Ga0307408_100207792 3300031548 Bacteria 1589
453 Ga0265314_10043808 3300031711 Bacteria 3177
454 Ga0307405_10044240 3300031731 Bacteria 2722
455 Ga0307416_100085851 3300032002 Bacteria 2680
456 Ga0373934_0005744 3300035086 Bacteria 4596
457 Ga0373923_0000532 3300035111 Bacteria 9268
458 Ga0373945_0013225 3300035116 Bacteria 2752
459 Ga0373953_0002606 3300035117 Bacteria 5457
460 Ga0373954_0000547 3300035118 Bacteria 14096
461 Ga0373956_0009377 3300035119 Bacteria 3981
462 Ga0373957_0007770 3300035120 Bacteria 3444
463 Ga0373955_0001069 3300035172 Bacteria 11676
464 Ga0373935_0010552 3300035692 Bacteria 5542
465 Ga0373927_0008057 3300035695 Bacteria 7115
466 Ga0373933_0007254 3300035724 Bacteria 6043
467 Ga0373947_0009692 3300035725 Bacteria 5526
468 Ga0373937_0007581 3300036401 Bacteria 9398
469 Ga0373937_0015001 3300036401 Bacteria 6845
470 Ga0373937_0023239 3300036401 Bacteria 5581
471 Ga0373937_0119091 3300036401 Bacteria 2460
472 Ga0373925_0002796 3300037068 Bacteria 13782
473 Ga0395899_0002523 3300037312 Bacteria 14829
474 Ga0395899_0007801 3300037312 Bacteria 8254
475 Ga0395899_0014681 3300037312 Bacteria 5976
476 Ga0395899_0060856 3300037312 Bacteria 2781
477 Ga0395899_0098549 3300037312 Bacteria 2112
478 Ga0395900_0000328 3300037418 Bacteria 70344
479 Ga0395900_0023374 3300037418 Bacteria 6327
480 Ga0395900_0028057 3300037418 Bacteria 5763
481 Ga0395900_0083321 3300037418 Bacteria 3285
482 Ga0395900_0155990 3300037418 Bacteria 2331
483 Ga0395900_0191458 3300037418 Bacteria 2074
484 Ga0395898_0084295 3300037466 Bacteria 3063
485 Ga0395898_0089206 3300037466 Bacteria 2967
486 Ga0395898_0130172 3300037466 Bacteria 2410
487 Ga0395898_0272404 3300037466 Bacteria 1614
488 Ga0395905_0296349 3300037471 Bacteria 1504
489 Ga0395901_0000845 3300038443 Bacteria 33703
490 Ga0395901_0015989 3300038443 Bacteria 7646
491 Ga0395901_0050369 3300038443 Bacteria 4327
492 Ga0395901_0104897 3300038443 Bacteria 2966
493 Ga0395901_0124417 3300038443 Bacteria 2709
494 Ga0395901_0208657 3300038443 Bacteria 2045
495 Ga0436361_0021035 3300039447 Bacteria 49397
496 Ga0436361_0090832 3300039447 Bacteria 34932
497 Ga0436361_0364057 3300039447 Bacteria 16829
498 Ga0436361_0460205 3300039447 Bacteria 10460
499 Ga0436361_0567363 3300039447 Bacteria 15669
500 Ga0436361_0909074 3300039447 Bacteria 10354
501 Ga0439448_0000563 3300042005 Bacteria 8718
502 Ga0439455_0004991 3300042012 Bacteria 2669
503 Ga0450911_003531 3300042115 Bacteria 2739
504 Ga0450904_000301 3300042139 Bacteria 10508
505 Ga0439458_0009941 3300042157 Bacteria 2118
506 Ga0466969_0057358 3300044656 Bacteria 1898
507 Ga0466972_0003639 3300044658 Bacteria 7659
508 Ga0466965_0004912 3300044683 Bacteria 5976
509 Ga0466965_0011537 3300044683 Bacteria 4145
510 Ga0466965_0033382 3300044683 Bacteria 2515
511 Ga0466966_0009892 3300044684 Bacteria 6321
512 Ga0466961_0111519 3300044693 Bacteria 1720
513 Ga0466963_0061851 3300044694 Bacteria 2504
514 Ga0466964_0000209 3300044706 Bacteria 16542
515 Ga0453684_0000450 3300044712 Bacteria 166110
516 Ga0466957_0000872 3300044842 Bacteria 15496
517 Ga0466957_0058721 3300044842 Bacteria 2357
518 Ga0466959_0019111 3300045049 Bacteria 5036
519 Ga0466958_0139404 3300045836 Bacteria 1526
520 Ga0466967_0002431 3300045976 Bacteria 11585
521 Ga0466967_0005571 3300045976 Bacteria 8750
522 Ga0495617_000014 3300046452 Bacteria 286979
523 Ga0495617_000023 3300046452 Bacteria 183865
524 Ga0495617_001293 3300046452 Bacteria 11150
525 Ga0495617_001845 3300046452 Bacteria 8996
526 Ga0495617_003871 3300046452 Bacteria 5513
527 Ga0495627_000016 3300046453 Bacteria 318947
528 Ga0495627_000061 3300046453 Bacteria 139366
529 Ga0495627_003768 3300046453 Bacteria 6550
530 Ga0495627_009314 3300046453 Bacteria 3620
531 Ga0495592_0005016 3300046454 Bacteria 9737
532 Ga0495603_0014275 3300046455 Bacteria 4806
533 Ga0495603_0044048 3300046455 Bacteria 2663
534 Ga0495603_0051411 3300046455 Bacteria 2449
535 Ga0495590_0000019 3300046457 Bacteria 213272
536 Ga0495590_0000043 3300046457 Bacteria 120012
537 Ga0495590_0000670 3300046457 Bacteria 15837
538 Ga0495590_0007766 3300046457 Bacteria 4117
539 Ga0495591_000187 3300046458 Bacteria 64594
540 Ga0495591_002995 3300046458 Bacteria 9012
541 Ga0495629_0014982 3300046459 Bacteria 5570
542 Ga0495629_0084443 3300046459 Bacteria 2215
543 Ga0495629_0127831 3300046459 Bacteria 1770
544 Ga0495638_0000115 3300046460 Bacteria 129129
545 Ga0495638_0006133 3300046460 Bacteria 8795
546 Ga0495638_0038746 3300046460 Bacteria 3027
547 Ga0495638_0049300 3300046460 Bacteria 2633
548 Ga0495653_0000014 3300046463 Bacteria 215253
549 Ga0495650_0000142 3300046471 Bacteria 168326
550 Ga0495650_0000178 3300046471 Bacteria 138967
551 Ga0495650_0000181 3300046471 Bacteria 137791
552 Ga0495650_0000193 3300046471 Bacteria 131834
553 Ga0495650_0000395 3300046471 Bacteria 73239
554 Ga0495650_0000906 3300046471 Bacteria 34943
555 Ga0495650_0001736 3300046471 Bacteria 19905
556 Ga0495580_0004401 3300046472 Bacteria 11833
557 Ga0495580_0121227 3300046472 Bacteria 1815
558 Ga0495582_0000674 3300046473 Bacteria 18786
559 Ga0495582_0006796 3300046473 Bacteria 6366
560 Ga0495605_0000010 3300046474 Bacteria 319487
561 Ga0495605_0000110 3300046474 Bacteria 104425
562 Ga0495605_0000118 3300046474 Bacteria 102724
563 Ga0495605_0000910 3300046474 Bacteria 20346
564 Ga0495605_0011533 3300046474 Bacteria 4922
565 Ga0495605_0012465 3300046474 Bacteria 4716
566 Ga0495605_0041968 3300046474 Bacteria 2276
567 Ga0495584_0000065 3300046491 Bacteria 75724
568 Ga0495584_0000138 3300046491 Bacteria 50345
569 Ga0495584_0000163 3300046491 Bacteria 46893
570 Ga0495584_0000227 3300046491 Bacteria 40714
571 Ga0495584_0001545 3300046491 Bacteria 13678
572 Ga0495584_0011764 3300046491 Bacteria 4474
573 Ga0495584_0024547 3300046491 Bacteria 3058
574 Ga0495584_0058886 3300046491 Bacteria 1932
575 Ga0495584_0098848 3300046491 Bacteria 1474
576 Ga0495585_0000123 3300046492 Bacteria 84445
577 Ga0495585_0000160 3300046492 Bacteria 72066
578 Ga0495585_0001260 3300046492 Bacteria 20351
579 Ga0495585_0005863 3300046492 Bacteria 7701
580 Ga0495585_0008881 3300046492 Bacteria 6063
581 Ga0495585_0011341 3300046492 Bacteria 5276
582 Ga0495585_0026582 3300046492 Bacteria 3306
583 Ga0495585_0026583 3300046492 Bacteria 3306
584 Ga0495585_0035257 3300046492 Bacteria 2828
585 Ga0495585_0036136 3300046492 Bacteria 2789
586 Ga0495585_0041758 3300046492 Bacteria 2571
587 Ga0495585_0067130 3300046492 Bacteria 1962
588 Ga0495594_0008244 3300046499 Bacteria 5363
589 Ga0495594_0009516 3300046499 Bacteria 5022
590 Ga0495594_0019046 3300046499 Bacteria 3644
591 Ga0495594_0103272 3300046499 Bacteria 1604
592 Ga0495596_0000291 3300046500 Bacteria 33324
593 Ga0495596_0000310 3300046500 Bacteria 32062
594 Ga0495596_0000418 3300046500 Bacteria 27142
595 Ga0495596_0003475 3300046500 Bacteria 7954
596 Ga0495596_0006215 3300046500 Bacteria 5527
597 Ga0495596_0025659 3300046500 Bacteria 2381
598 Ga0495607_0000719 3300046501 Bacteria 31915
599 Ga0495607_0000942 3300046501 Bacteria 26982
600 Ga0495607_0004531 3300046501 Bacteria 10200
601 Ga0495607_0008029 3300046501 Bacteria 7247
602 Ga0495607_0008548 3300046501 Bacteria 6994
603 Ga0495607_0014412 3300046501 Bacteria 5145
604 Ga0495607_0021186 3300046501 Bacteria 4092
605 Ga0495607_0044005 3300046501 Bacteria 2635
606 Ga0495607_0057905 3300046501 Bacteria 2218
607 Ga0495583_0000057 3300046506 Bacteria 200688
608 Ga0495583_0000065 3300046506 Bacteria 192022
609 Ga0495583_0000102 3300046506 Bacteria 143105
610 Ga0495583_0000126 3300046506 Bacteria 128985
611 Ga0495583_0001000 3300046506 Bacteria 32368
612 Ga0495583_0001247 3300046506 Bacteria 26987
613 Ga0495583_0004613 3300046506 Bacteria 9744
614 Ga0495583_0009887 3300046506 Bacteria 5642
615 Ga0495583_0020208 3300046506 Bacteria 3456
616 Ga0495583_0057338 3300046506 Bacteria 1752
617 Ga0495606_0000004 3300046507 Bacteria 406209
618 Ga0495606_0000085 3300046507 Bacteria 158006
619 Ga0495606_0000165 3300046507 Bacteria 116607
620 Ga0495606_0000250 3300046507 Bacteria 94676
621 Ga0495606_0000391 3300046507 Bacteria 74077
622 Ga0495606_0000498 3300046507 Bacteria 64198
623 Ga0495606_0000583 3300046507 Bacteria 57929
624 Ga0495606_0002188 3300046507 Bacteria 23450
625 Ga0495606_0003463 3300046507 Bacteria 16736
626 Ga0495606_0015293 3300046507 Bacteria 5921
627 Ga0495606_0023412 3300046507 Bacteria 4475
628 Ga0495606_0040461 3300046507 Bacteria 3133
629 Ga0495606_0044897 3300046507 Bacteria 2935
630 Ga0495606_0073319 3300046507 Bacteria 2148
631 Ga0495610_0000007 3300046512 Bacteria 820919
632 Ga0495610_0004332 3300046512 Bacteria 10538
633 Ga0495610_0007942 3300046512 Bacteria 6964
634 Ga0495610_0013977 3300046512 Bacteria 4743
635 Ga0495610_0017941 3300046512 Bacteria 4015
636 Ga0495616_0000083 3300046513 Bacteria 80447
637 Ga0495616_0000230 3300046513 Bacteria 45632
638 Ga0495616_0001478 3300046513 Bacteria 16302
639 Ga0495616_0010455 3300046513 Bacteria 5369
640 Ga0495616_0014112 3300046513 Bacteria 4484
641 Ga0495616_0019879 3300046513 Bacteria 3660
642 Ga0495616_0026763 3300046513 Bacteria 3065
643 Ga0495616_0027550 3300046513 Bacteria 3014
644 Ga0495616_0050733 3300046513 Bacteria 2073
645 Ga0495616_0069719 3300046513 Bacteria 1703
646 Ga0495620_0017597 3300046515 Bacteria 3556
647 Ga0495631_0000385 3300046518 Bacteria 30461
648 Ga0495631_0000495 3300046518 Bacteria 26243
649 Ga0495631_0013856 3300046518 Bacteria 3902
650 Ga0495631_0024948 3300046518 Bacteria 2756
651 Ga0495631_0038783 3300046518 Bacteria 2116
652 Ga0495631_0055662 3300046518 Bacteria 1723
653 Ga0495632_0000041 3300046519 Bacteria 145509
654 Ga0495632_0000336 3300046519 Bacteria 44682
655 Ga0495632_0001288 3300046519 Bacteria 21238
656 Ga0495632_0005108 3300046519 Bacteria 8771
657 Ga0495632_0021092 3300046519 Bacteria 3515
658 Ga0495632_0037065 3300046519 Bacteria 2477
659 Ga0495637_0000119 3300046520 Bacteria 58062
660 Ga0495637_0000602 3300046520 Bacteria 25654
661 Ga0495643_0000130 3300046522 Bacteria 121749
662 Ga0495643_0000418 3300046522 Bacteria 55699
663 Ga0495643_0000524 3300046522 Bacteria 47789
664 Ga0495643_0000686 3300046522 Bacteria 39264
665 Ga0495643_0002486 3300046522 Bacteria 14507
666 Ga0495643_0013493 3300046522 Bacteria 4885
667 Ga0495643_0022698 3300046522 Bacteria 3575
668 Ga0495643_0063506 3300046522 Bacteria 1953
669 Ga0495644_0002910 3300046523 Bacteria 6794
670 Ga0495644_0005632 3300046523 Bacteria 4884
671 Ga0495648_0000053 3300046524 Bacteria 159860
672 Ga0495648_0000104 3300046524 Bacteria 105792
673 Ga0495648_0000293 3300046524 Bacteria 56206
674 Ga0495648_0000799 3300046524 Bacteria 33303
675 Ga0495648_0001424 3300046524 Bacteria 23410
676 Ga0495648_0004497 3300046524 Bacteria 11903
677 Ga0495648_0006997 3300046524 Bacteria 9091
678 Ga0495648_0018900 3300046524 Bacteria 4862
679 Ga0495648_0029978 3300046524 Bacteria 3603
680 Ga0495648_0044969 3300046524 Bacteria 2751
681 Ga0495648_0062838 3300046524 Bacteria 2197
682 Ga0495663_0012433 3300046525 Bacteria 2371
683 Ga0495666_0000214 3300046526 Bacteria 24663
684 Ga0495642_0000017 3300046528 Bacteria 111313
685 Ga0495642_0000284 3300046528 Bacteria 28539
686 Ga0495642_0002324 3300046528 Bacteria 7757
687 Ga0495642_0005212 3300046528 Bacteria 5000
688 Ga0495642_0006008 3300046528 Bacteria 4662
689 Ga0495642_0014091 3300046528 Bacteria 3098
690 Ga0495642_0022781 3300046528 Bacteria 2469
691 Ga0495642_0022825 3300046528 Bacteria 2467
692 Ga0495652_0022488 3300046529 Bacteria 5594
693 Ga0495654_0000034 3300046530 Bacteria 196519
694 Ga0495654_0004252 3300046530 Bacteria 8559
695 Ga0495654_0018842 3300046530 Bacteria 3612
696 Ga0495665_0000193 3300046531 Bacteria 31390
697 Ga0495665_0003674 3300046531 Bacteria 8320
698 Ga0495665_0004601 3300046531 Bacteria 7443
699 Ga0495640_0028810 3300046533 Bacteria 3994
700 Ga0495587_0007851 3300046536 Bacteria 6892
701 Ga0495587_0053485 3300046536 Bacteria 2380
702 Ga0495609_0000005 3300046538 Bacteria 439165
703 Ga0495609_0000164 3300046538 Bacteria 69576
704 Ga0495609_0000597 3300046538 Bacteria 28277
705 Ga0495609_0000772 3300046538 Bacteria 24017
706 Ga0495609_0001430 3300046538 Bacteria 15899
707 Ga0495609_0001879 3300046538 Bacteria 13416
708 Ga0495621_0002820 3300046539 Bacteria 4724
709 Ga0495597_0000046 3300046542 Bacteria 104533
710 Ga0495597_0000100 3300046542 Bacteria 77861
711 Ga0495597_0000198 3300046542 Bacteria 55237
712 Ga0495597_0000607 3300046542 Bacteria 29390
713 Ga0495597_0006177 3300046542 Bacteria 6223
714 Ga0495597_0007247 3300046542 Bacteria 5651
715 Ga0495597_0007612 3300046542 Bacteria 5481
716 Ga0495597_0025278 3300046542 Bacteria 2735
717 Ga0495597_0028765 3300046542 Bacteria 2541
718 Ga0495622_0000011 3300046557 Bacteria 201507
719 Ga0495622_0000230 3300046557 Bacteria 44043
720 Ga0495622_0000812 3300046557 Bacteria 17283
721 Ga0495633_0000065 3300046558 Bacteria 139197
722 Ga0495633_0000146 3300046558 Bacteria 94353
723 Ga0495633_0000749 3300046558 Bacteria 29299
724 Ga0495633_0001918 3300046558 Bacteria 15136
725 Ga0495633_0003442 3300046558 Bacteria 10532
726 Ga0495633_0005322 3300046558 Bacteria 7898
727 Ga0495633_0009409 3300046558 Bacteria 5401
728 Ga0495633_0010746 3300046558 Bacteria 4979
729 Ga0495633_0011531 3300046558 Bacteria 4759
730 Ga0495633_0012010 3300046558 Bacteria 4629
731 Ga0495633_0013361 3300046558 Bacteria 4330
732 Ga0495633_0051475 3300046558 Bacteria 1940
733 Ga0495633_0055925 3300046558 Bacteria 1854
734 Ga0495633_0059448 3300046558 Bacteria 1792
735 Ga0495656_0014769 3300046615 Bacteria 2935
736 Ga0495656_0027896 3300046615 Bacteria 2259
737 Ga0495668_0000030 3300046616 Bacteria 262663
738 Ga0495668_0000117 3300046616 Bacteria 122379
739 Ga0495668_0000251 3300046616 Bacteria 76262
740 Ga0495668_0000580 3300046616 Bacteria 44573
741 Ga0495668_0001350 3300046616 Bacteria 24083
742 Ga0495668_0001882 3300046616 Bacteria 18805
743 Ga0495668_0004307 3300046616 Bacteria 10187
744 Ga0495668_0004658 3300046616 Bacteria 9626
745 Ga0495668_0024198 3300046616 Bacteria 3455
746 Ga0495668_0025254 3300046616 Bacteria 3376
747 Ga0495668_0045766 3300046616 Bacteria 2432
748 Ga0495634_0070417 3300046642 Bacteria 2305
749 Ga0495611_0000148 3300046648 Bacteria 49996
750 Ga0495611_0009125 3300046648 Bacteria 4192
751 Ga0495611_0009943 3300046648 Bacteria 4026
752 Ga0495611_0018564 3300046648 Bacteria 2983
753 Ga0495611_0037155 3300046648 Bacteria 2163
754 Ga0495611_0089929 3300046648 Bacteria 1418
755 Ga0495625_0000609 3300046660 Bacteria 51864
756 Ga0495625_0000620 3300046660 Bacteria 51572
757 Ga0495625_0001604 3300046660 Bacteria 26732
758 Ga0495625_0003530 3300046660 Bacteria 15480
759 Ga0495625_0009776 3300046660 Bacteria 7979
760 Ga0495625_0027511 3300046660 Bacteria 4280
761 Ga0495625_0036919 3300046660 Bacteria 3587
762 Ga0495625_0040051 3300046660 Bacteria 3420
763 Ga0495625_0068746 3300046660 Bacteria 2489
764 Ga0495625_0088531 3300046660 Bacteria 2144
765 Ga0495625_0138536 3300046660 Bacteria 1643
766 Ga0495635_0001435 3300046663 Bacteria 15925
767 Ga0495635_0030249 3300046663 Bacteria 3763
768 Ga0495659_0000148 3300046664 Bacteria 30682
769 Ga0495661_0000102 3300046665 Bacteria 104814
770 Ga0495661_0000420 3300046665 Bacteria 44761
771 Ga0495661_0000945 3300046665 Bacteria 26346
772 Ga0495661_0001953 3300046665 Bacteria 16355
773 Ga0495661_0006769 3300046665 Bacteria 8037
774 Ga0495661_0008255 3300046665 Bacteria 7213
775 Ga0495661_0008319 3300046665 Bacteria 7184
776 Ga0495661_0031328 3300046665 Bacteria 3377
777 Ga0495661_0031692 3300046665 Bacteria 3350
778 Ga0495661_0038584 3300046665 Bacteria 2973
779 Ga0495661_0040168 3300046665 Bacteria 2903
780 Ga0495661_0043635 3300046665 Bacteria 2755
781 Ga0495661_0050759 3300046665 Bacteria 2509
782 Ga0495661_0051975 3300046665 Bacteria 2471
783 Ga0495588_0000126 3300046674 Bacteria 128815
784 Ga0495588_0017756 3300046674 Bacteria 3460
785 Ga0495588_0036860 3300046674 Bacteria 2482
786 Ga0495588_0064731 3300046674 Bacteria 1897
787 Ga0495599_0069567 3300046678 Bacteria 2196
788 Ga0495623_0006370 3300046679 Bacteria 7674
789 Ga0495623_0102960 3300046679 Bacteria 1737
790 Ga0495646_0007932 3300046680 Bacteria 6746
791 Ga0495646_0042703 3300046680 Bacteria 2781
792 Ga0495646_0104635 3300046680 Bacteria 1618
793 Ga0495658_0000474 3300046683 Bacteria 22232
794 Ga0495669_0000077 3300046684 Bacteria 65061
795 Ga0495669_0033624 3300046684 Bacteria 2257
796 Ga0495613_0001075 3300046689 Bacteria 20823
797 Ga0495613_0041274 3300046689 Bacteria 3417
798 Ga0495624_0025453 3300046690 Bacteria 3884
799 Ga0495624_0036405 3300046690 Bacteria 3173
800 Ga0495624_0053816 3300046690 Bacteria 2540
801 Ga0495670_0000595 3300046691 Bacteria 17242
802 Ga0495670_0001516 3300046691 Bacteria 11339
803 Ga0495670_0004163 3300046691 Bacteria 7086
804 Ga0495670_0014679 3300046691 Bacteria 3852
805 Ga0495670_0024272 3300046691 Bacteria 2996
806 Ga0495670_0065348 3300046691 Bacteria 1833
807 Ga0495671_0000009 3300046692 Bacteria 369875
808 Ga0495671_0000053 3300046692 Bacteria 129715
809 Ga0495671_0000068 3300046692 Bacteria 99674
810 Ga0495671_0012746 3300046692 Bacteria 4581
811 Ga0495671_0014856 3300046692 Bacteria 4184
812 Ga0495671_0014925 3300046692 Bacteria 4174
813 Ga0495671_0029004 3300046692 Bacteria 2846
814 Ga0495649_0000074 3300046694 Bacteria 85874
815 Ga0495649_0015929 3300046694 Bacteria 4268
816 Ga0495649_0026452 3300046694 Bacteria 3225
817 Ga0495649_0048404 3300046694 Bacteria 2310
818 Ga0495589_0000024 3300046794 Bacteria 191021
819 Ga0495589_0000310 3300046794 Bacteria 38833
820 Ga0495589_0001875 3300046794 Bacteria 11906
821 Ga0495589_0010935 3300046794 Bacteria 4714
822 Ga0495589_0013516 3300046794 Bacteria 4211
823 Ga0495589_0039348 3300046794 Bacteria 2363
824 Ga0495589_0041691 3300046794 Bacteria 2289
825 Ga0495589_0046719 3300046794 Bacteria 2147
826 Ga0495600_0006539 3300046809 Bacteria 7092
827 Ga0495600_0011440 3300046809 Bacteria 5529
828 Ga0495660_0000068 3300046810 Bacteria 119060
829 Ga0495660_0000954 3300046810 Bacteria 21117
830 Ga0495660_0001370 3300046810 Bacteria 16778
831 Ga0495660_0011116 3300046810 Bacteria 5227
832 Ga0495660_0015125 3300046810 Bacteria 4461
833 Ga0495660_0025952 3300046810 Bacteria 3324
834 Ga0495660_0065946 3300046810 Bacteria 1931
835 Ga0495581_0000277 3300047315 Bacteria 24872
836 Ga0495604_0030356 3300047317 Bacteria 4293
837 Ga0495604_0030863 3300047317 Bacteria 4252
838 Ga0495604_0055300 3300047317 Bacteria 3059
839 Ga0495604_0137459 3300047317 Bacteria 1749
840 Ga0495636_0000073 3300047318 Bacteria 42681
841 Ga0495674_0002989 3300047319 Bacteria 16467
842 Ga0495672_0000099 3300047320 Bacteria 140634
843 Ga0495672_0000371 3300047320 Bacteria 56105
844 Ga0495672_0000897 3300047320 Bacteria 31222
845 Ga0495672_0001193 3300047320 Bacteria 26272
846 Ga0495672_0001368 3300047320 Bacteria 24153
847 Ga0495672_0002171 3300047320 Bacteria 18282
848 Ga0495672_0016791 3300047320 Bacteria 4913
849 Ga0495672_0021977 3300047320 Bacteria 4154
850 Ga0495676_0000028 3300047321 Bacteria 140879
851 Ga0495676_0037428 3300047321 Bacteria 4038
852 Ga0495680_0054896 3300047322 Bacteria 3091
853 Ga0495683_0000067 3300047323 Bacteria 111573
854 Ga0495683_0000610 3300047323 Bacteria 26758
855 Ga0495683_0037579 3300047323 Bacteria 2454
856 Ga0495687_000008 3300047443 Bacteria 546666
857 Ga0495687_000052 3300047443 Bacteria 199186
858 Ga0495687_000085 3300047443 Bacteria 145052
859 Ga0495687_000318 3300047443 Bacteria 62538
860 Ga0495687_000840 3300047443 Bacteria 32718
861 Ga0495687_000868 3300047443 Bacteria 32039
862 Ga0495687_001500 3300047443 Bacteria 21263
863 Ga0495687_007672 3300047443 Bacteria 6308
864 Ga0495687_010494 3300047443 Bacteria 5076
865 Ga0495675_0018080 3300047444 Bacteria 4469
866 Ga0495675_0019623 3300047444 Bacteria 4294
867 Ga0495677_0000007 3300047445 Bacteria 181193
868 Ga0495677_0000063 3300047445 Bacteria 58478
869 Ga0495677_0000088 3300047445 Bacteria 47898
870 Ga0495677_0000857 3300047445 Bacteria 12318
871 Ga0495677_0003195 3300047445 Bacteria 6389
872 Ga0495677_0007176 3300047445 Bacteria 4170
873 Ga0495677_0007489 3300047445 Bacteria 4076
874 Ga0495677_0009025 3300047445 Bacteria 3688
875 Ga0495677_0018797 3300047445 Bacteria 2505
876 Ga0495677_0028677 3300047445 Bacteria 2022
877 Ga0495679_003368 3300047446 Bacteria 7706
878 Ga0495679_007583 3300047446 Bacteria 4510
879 Ga0495685_000024 3300047447 Bacteria 64011
880 Ga0495685_001575 3300047447 Bacteria 7020
881 Ga0495673_0000031 3300047469 Bacteria 447868
882 Ga0495673_0000032 3300047469 Bacteria 375856
883 Ga0495673_0000105 3300047469 Bacteria 170731
884 Ga0495673_0008057 3300047469 Bacteria 5970
885 Ga0495673_0014428 3300047469 Bacteria 4109
886 Ga0495681_0001051 3300047470 Bacteria 21061
887 Ga0495681_0001118 3300047470 Bacteria 20339
888 Ga0495681_0008667 3300047470 Bacteria 6349
889 Ga0495681_0010293 3300047470 Bacteria 5666
890 Ga0495681_0012679 3300047470 Bacteria 4939
891 Ga0495681_0016124 3300047470 Bacteria 4204
892 Ga0495681_0048028 3300047470 Bacteria 2026
893 Ga0495684_0001806 3300047471 Bacteria 17187
894 Ga0495684_0014218 3300047471 Bacteria 6124
895 Ga0495686_0000156 3300047472 Bacteria 131196
896 Ga0495686_0000203 3300047472 Bacteria 110612
897 Ga0495686_0000370 3300047472 Bacteria 73065
898 Ga0495686_0001097 3300047472 Bacteria 32205
899 Ga0495686_0020766 3300047472 Bacteria 4377
900 Ga0495686_0052400 3300047472 Bacteria 2558
901 Ga0495686_0079968 3300047472 Bacteria 1999
902 Ga0495593_0004097 3300047673 Bacteria 8669
903 Ga0495602_0001014 3300048088 Bacteria 27301
904 Ga0495602_0056638 3300048088 Bacteria 3445
905 Ga0495602_0072223 3300048088 Bacteria 2944
906 Ga0495614_0000617 3300048089 Bacteria 14901
907 Ga0495626_0000054 3300048091 Bacteria 154997
908 Ga0495626_0000149 3300048091 Bacteria 86385
909 Ga0495626_0002253 3300048091 Bacteria 13814
910 Ga0495626_0003234 3300048091 Bacteria 10549
911 Ga0495626_0004043 3300048091 Bacteria 9144
912 Ga0495626_0006416 3300048091 Bacteria 6698
913 Ga0495626_0012181 3300048091 Bacteria 4520
914 Ga0495626_0014075 3300048091 Bacteria 4137
915 Ga0495626_0019470 3300048091 Bacteria 3396
916 Ga0495626_0038532 3300048091 Bacteria 2265
917 Ga0496100_0110788 3300048903 Bacteria 1906
918 Ga0496101_0163270 3300048904 Bacteria 1709
919 Ga0496102_0000215 3300048905 Bacteria 76113
920 Ga0496102_0000369 3300048905 Bacteria 54037
921 Ga0496102_0008630 3300048905 Bacteria 8745
922 Ga0496102_0136492 3300048905 Bacteria 2298
923 Ga0496103_0002327 3300048906 Bacteria 12011
924 Ga0496103_0003122 3300048906 Bacteria 10187
925 Ga0496104_0003193 3300048907 Bacteria 14093
926 Ga0496105_0003540 3300048908 Bacteria 11579
927 Ga0496106_0033314 3300048909 Bacteria 3844
928 Ga0496107_0104568 3300048910 Bacteria 2078
929 Ga0496107_0164972 3300048910 Bacteria 1642
930 Ga0496109_0004034 3300048912 Bacteria 12262
931 Ga0496109_0011003 3300048912 Bacteria 7754
932 Ga0496110_0000817 3300048913 Bacteria 21822
933 Ga0496110_0026144 3300048913 Bacteria 4992
934 Ga0496112_0000733 3300048915 Bacteria 22846
935 Ga0496112_0040689 3300048915 Bacteria 4545
936 Ga0496112_0211211 3300048915 Bacteria 1898
937 Ga0496113_0001668 3300048916 Bacteria 12557
938 Ga0496114_0090073 3300048917 Bacteria 2604
939 Ga0496115_0005708 3300048918 Bacteria 9058
940 Ga0496115_0017770 3300048918 Bacteria 5445
941 Ga0496116_0018963 3300048919 Bacteria 5282
942 Ga0496117_0000011 3300048920 Bacteria 610930
943 Ga0496118_0000010 3300048921 Bacteria 610930
944 Ga0496121_0000978 3300048924 Bacteria 51196
945 Ga0496121_0001372 3300048924 Bacteria 41423
946 Ga0496121_0004394 3300048924 Bacteria 19023
947 Ga0496121_0010245 3300048924 Bacteria 10606
948 Ga0496122_0000864 3300048925 Bacteria 57030
949 Ga0496122_0003892 3300048925 Bacteria 19132
950 Ga0496122_0003927 3300048925 Bacteria 19016
951 Ga0496122_0016640 3300048925 Bacteria 6936
952 Ga0496122_0031684 3300048925 Bacteria 4392
953 Ga0496122_0051883 3300048925 Bacteria 3111
954 Ga0496122_0054437 3300048925 Bacteria 3005
955 Ga0496123_0000099 3300048926 Bacteria 170756
956 Ga0496123_0004147 3300048926 Bacteria 15495
957 Ga0496123_0006218 3300048926 Bacteria 11651
958 Ga0496123_0029518 3300048926 Bacteria 4034
959 Ga0496123_0049983 3300048926 Bacteria 2798
960 Ga0496124_0010847 3300048927 Bacteria 9175
961 Ga0496124_0020767 3300048927 Bacteria 6061
962 Ga0496124_0049620 3300048927 Bacteria 3579
963 Ga0496124_0052264 3300048927 Bacteria 3472
964 Ga0496124_0113113 3300048927 Bacteria 2182
965 Ga0496125_0001800 3300048928 Bacteria 29607
966 Ga0496125_0003100 3300048928 Bacteria 20723
967 Ga0496125_0080848 3300048928 Bacteria 2485
968 Ga0496126_0003835 3300048929 Bacteria 18607
969 Ga0496126_0014871 3300048929 Bacteria 7850
970 Ga0495678_000001 3300049459 Bacteria 1060340
971 Ga0495678_000053 3300049459 Bacteria 154277
972 Ga0495678_000225 3300049459 Bacteria 65737
973 Ga0495678_000548 3300049459 Bacteria 36209
974 Ga0495678_001622 3300049459 Bacteria 17158
975 Ga0495678_001628 3300049459 Bacteria 17091
976 Ga0495678_003050 3300049459 Bacteria 10644
977 Ga0495678_003199 3300049459 Bacteria 10310
978 Ga0495678_003824 3300049459 Bacteria 9065
979 Ga0495678_013455 3300049459 Bacteria 3840
980 Ga0495682_0000053 3300049460 Bacteria 107313
981 Ga0495682_0000551 3300049460 Bacteria 25767
982 Ga0501034_0002533 3300049571 Bacteria 21868
983 Ga0501034_0049055 3300049571 Bacteria 4261
984 Ga0501238_002604 3300049671 Bacteria 2167
985 Ga0501249_001280 3300049679 Bacteria 5254
986 Ga0501083_0091363 3300049744 Bacteria 2010
987 Ga0501269_000123 3300049766 Bacteria 24539
988 Ga0501279_002262 3300049775 Bacteria 2534
989 Ga0501279_004296 3300049775 Bacteria 1869
990 Ga0501035_0000855 3300049822 Bacteria 32447
991 nmdc:mga03683_33884_c1 3300050489 Bacteria 2064
992 nmdc:mga07m45_229_c1 3300050496 Bacteria 22348
993 nmdc:mga0rr50_141003_c1 3300050513 Bacteria 1939
994 Ga0495601_0005627 3300053077 Bacteria 7306
995 Ga0500610_0016124 3300053079 Bacteria 3553
996 Ga0500610_0081758 3300053079 Bacteria 1683
997 Ga0495619_0002446 3300053085 Bacteria 12164
998 Ga0500607_000211 3300053121 Bacteria 53358
999 Ga0500608_066594 3300053122 Bacteria 1717
1000 Ga0500618_000904 3300053125 Bacteria 15526
1001 Ga0500619_000240 3300053154 Bacteria 12081
1002 Ga0500627_0042780 3300053158 Bacteria 1951
1003 Ga0501082_0142047 3300060353 Bacteria 2084
1004 2511250841 2511231003 Bacteria 5606035
1005 2511385058 2511231026 Bacteria 5225445
1006 2521560576 2521172590 Bacteria 5047645
1007 2550694227 2548876994 Bacteria 4904866
1008 2553005691 2551306416 Bacteria 6152985
1009 2601531923 2600255256 Bacteria 5597742
1010 2601537294 2600255257 Bacteria 5597196
1011 2601669226 2600255292 Bacteria 6300551
1012 2601755641 2600255310 Bacteria 5600903
1013 2601761009 2600255311 Bacteria 5598766
1014 2603638969 2602042046 Bacteria 5483348
1015 2643789695 2643221554 Bacteria 6603920
1016 2643796815 2643221556 Bacteria 7251154
1017 2644028500 2643221603 Bacteria 6147767
1018 2644214574 2643221638 Bacteria 6579467
1019 2644249943 2643221645 Bacteria 7207331
1020 2644326196 2643221658 Bacteria 6064537
1021 2644358621 2643221664 Bacteria 7272945
1022 2644470080 2643221684 Bacteria 7145183
1023 2738739538 2738541280 Bacteria 6630198
1024 2738827582 2738541297 Bacteria 6549566
1025 2738846115 2738541300 Bacteria 6675882
1026 2738880487 2738541307 Bacteria 8606193
1027 2739151378 2738541357 Bacteria 6549408
1028 2739193298 2738543003 Bacteria 6549560
1029 2739275732 2738543018 Bacteria 6718814
1030 2739319774 2738543026 Bacteria 6549408
1031 2739338015 2738543029 Bacteria 6549249
1032 2739344776 2738543030 Bacteria 6719714
1033 2765571822 2765235838 Bacteria 5445269
1034 2791925492 2791354903 Bacteria 4937680
1035 2808982172 2808606386 Bacteria 4471946
1036 2809130028 2808606415 Bacteria 4576710
1037 2809147143 2808606418 Bacteria 6724496
1038 2809148917 2808606419 Bacteria 4576925
1039 2813730030 2811995292 Bacteria 5303342
1040 2814697522 2814123068 Bacteria 5687681
1041 2819543288 2818991436 Bacteria 5376622
1042 2819595618 2818991445 Bacteria 4955017
1043 2819617268 2818991449 Bacteria 5518009
1044 2821136040 2821131069 Bacteria 6108407
1045 2834643455 2834641062 Bacteria 5559922
1046 2839098457 2839094727 Bacteria 5534556
1047 2842713000 2842711865 Bacteria 7155354
1048 2852619052 2852618963 Bacteria 4577824
1049 2857549358 2857547612 Bacteria 6179999
1050 2857555558 2857553236 Bacteria 6166726
1051 2857562963 2857558681 Bacteria 6617694
1052 2857569205 2857564685 Bacteria 6290584
1053 2882461700 2882456835 Bacteria 6863978
1054 2883092901 2883087390 Bacteria 9532701
1055 2884816178 2884811622 Bacteria 5552861
1056 2884839379 2884836552 Bacteria 5219991
1057 2884856811 2884852848 Bacteria 5221161
1058 2885085967 2885080285 Bacteria 6355622
1059 2885201268 2885198086 Bacteria 7212419
1060 2885214940 2885211737 Bacteria 7212420
1061 2896158157 2896154374 Bacteria 5221518
1062 2900640992 2900634093 Bacteria 10263517
1063 2904429378 2904424332 Bacteria 7633521
1064 2904442907 2904439833 Bacteria 5931679
1065 2904534896 2904530477 Bacteria 5876334
1066 2904588764 2904584206 Bacteria 6028872
1067 2904594162 2904589729 Bacteria 6113573
1068 2904605000 2904601388 Bacteria 5884906
1069 2919048594 2919046199 Bacteria 5567169
1070 2919083234 2919079590 Bacteria 5946433
1071 2919479383 2919476304 Bacteria 5888696
1072 2923514369 2923510766 Bacteria 5926163
1073 2928133094 2928130867 Bacteria 5467269
1074 2932414480 2932410948 Bacteria 6312192
1075 2932420999 2932416698 Bacteria 6315112
1076 2974322312 2974320154 Bacteria 4571377
1077 642615354 642555113 Bacteria 8214658
1078 8003405200 8003400568 Bacteria 5535898
1079 8047676916 8047673197 Bacteria 7395230
1080 8054007568 8054002106 Bacteria 7987183
1081 Ga0501080_0024566
1082 RicEn_C2987
1083 JGI25155J39150_1000140
1084 JGI25155J39150_1000562
1085 JGI25156J39149_1000120
1086 JGI25156J39149_1000370
1087 JGI25154J39366_1000372
1088 JGI25154J39366_1001022
1089 JGI25154J39366_1001082
1090 JGI25158J39367_1001790
1091 JGI25157J39369_1000294
1092 JGI25152J39213_1000487
1093 JGI25150J39212_1000644
1094 JGI25150J39212_1001243
1095 JGI25159J45721_1000989
1096 JGI25159J45721_1003515
1097 JGI25151J46595_10000568
1098 rootL2_10156471
1099 JGI25161J50226_1001985
1100 Ga0055538_1000024
1101 Ga0055539_1000031
1102 Ga0055533_1000041
1103 Ga0055532_1000074
1104 Ga0055525_1000006
1105 Ga0055525_1000049
1106 Ga0055529_1000537
1107 Ga0055526_1000035
1108 Ga0055526_1000047
1109 Ga0055526_1000729
1110 Ga0055526_1006694
1111 Ga0055537_1000078
1112 Ga0055537_1007096
1113 Ga0055524_1000053
1114 Ga0055524_1003340
1115 Ga0055524_1005701
1116 Ga0055536_1000458
1117 Ga0055536_1003852
1118 Ga0055534_1000070
1119 Ga0055534_1000105
1120 Ga0055534_1003475
1121 Ga0055528_1000224
1122 Ga0055528_1012389
1123 Ga0055530_10006363
1124 Ga0055530_10007199
1125 Ga0055530_10009880
1126 Ga0055540_1000344
1127 Ga0055531_10002512
1128 Ga0055541_1000022
1129 Ga0055543_1000889
1130 Ga0055543_1010749
1131 Ga0065165_1000287
1132 Ga0065165_1000619
1133 Ga0065165_1005746
1134 Ga0070683_100010175
1135 Ga0070690_100003772
1136 Ga0070670_100005802
1137 Ga0068869_100004897
1138 Ga0068869_100005563
1139 Ga0070666_10000254
1140 Ga0070666_10100848
1141 Ga0070680_100029945
1142 Ga0070680_100110627
1143 Ga0070680_100187264
1144 Ga0068868_100000728
1145 Ga0070660_100039822
1146 Ga0070660_100131788
1147 Ga0070689_100000500
1148 Ga0070691_10089219
1149 Ga0070661_100003517
1150 Ga0070661_100004042
1151 Ga0070668_100020780
1152 Ga0070675_100066488
1153 Ga0070675_100095596
1154 Ga0070675_100139538
1155 Ga0070675_100176484
1156 Ga0070671_100002017
1157 Ga0070673_100000114
1158 Ga0070688_100000295
1159 Ga0070659_100036274
1160 Ga0070659_100172664
1161 Ga0070667_100002145
1162 Ga0070667_100150634
1163 Ga0070709_10039550
1164 Ga0070709_10055229
1165 Ga0070714_100023965
1166 Ga0070713_100000481
1167 Ga0070713_100039530
1168 Ga0070710_10041613
1169 Ga0070701_10018158
1170 Ga0070711_100000229
1171 Ga0070705_100005810
1172 Ga0070705_100028065
1173 Ga0070700_100157561
1174 Ga0070694_100014383
1175 Ga0070663_100049429
1176 Ga0070678_100009831
1177 Ga0070662_100108400
1178 Ga0070662_100185638
1179 Ga0070681_10004639
1180 Ga0068867_100086370
1181 Ga0068867_100155712
1182 Ga0070685_10000366
1183 Ga0070706_100047663
1184 Ga0070706_100247815
1185 Ga0070698_100117086
1186 Ga0070699_100024527
1187 Ga0070679_100012768
1188 Ga0070679_100030440
1189 Ga0070697_100029882
1190 Ga0068853_100087329
1191 Ga0070672_100069229
1192 Ga0070686_100054755
1193 Ga0070695_100182951
1194 Ga0070696_100021608
1195 Ga0070693_100003420
1196 Ga0070693_100014679
1197 Ga0070693_100112889
1198 Ga0070693_100126254
1199 Ga0070665_100019741
1200 Ga0070704_100003098
1201 Ga0068855_100007024
1202 Ga0068855_100009503
1203 Ga0068855_100012256
1204 Ga0068855_100038688
1205 Ga0068855_100038842
1206 Ga0068855_100082135
1207 Ga0068855_100101430
1208 Ga0068855_100138486
1209 Ga0070664_100014240
1210 Ga0070664_100021645
1211 Ga0070664_100038530
1212 Ga0070664_100051325
1213 Ga0070664_100097425
1214 Ga0070664_100106004
1215 Ga0070664_100109195
1216 Ga0068857_100002557
1217 Ga0068857_100048800
1218 Ga0068857_100060990
1219 Ga0068856_100028149
1220 Ga0068856_100029489
1221 Ga0068856_100034020
1222 Ga0068856_100292934
1223 Ga0068852_100001512
1224 Ga0068852_100022972
1225 Ga0068852_100027407
1226 Ga0068852_100079085
1227 Ga0068859_100000495
1228 Ga0068859_100051657
1229 Ga0068859_100298336
1230 Ga0068864_100000382
1231 Ga0068864_100222740
1232 Ga0068866_10002285
1233 Ga0068866_10066970
1234 Ga0068861_100032382
1235 Ga0068861_100170603
1236 Ga0068870_10005048
1237 Ga0068863_100001883
1238 Ga0068863_100043513
1239 Ga0068863_100057576
1240 Ga0068858_100001712
1241 Ga0068858_100013087
1242 Ga0068858_100103414
1243 Ga0068860_100014249
1244 Ga0081539_10007797
1245 Ga0070716_100009960
1246 Ga0070716_100028505
1247 Ga0070712_100001035
1248 Ga0070712_100118334
1249 Ga0075362_10012450
1250 Ga0075367_10008779
1251 Ga0075366_10021485
1252 Ga0097621_100003309
1253 Ga0097621_100011313
1254 Ga0097621_100020255
1255 Ga0075370_10033041
1256 Ga0068871_100011216
1257 Ga0068871_100023303
1258 Ga0068871_100195351
1259 Ga0097620_100000495
1260 Ga0097620_100051656
1261 Ga0097620_100200818
1262 Ga0097620_100298340
1263 Ga0079104_1017630
1264 Ga0099826_10000006
1265 Ga0105244_10002483
1266 Ga0105244_10030761
1267 Ga0105240_10000718
1268 Ga0105240_10002320
1269 Ga0105240_10007182
1270 Ga0105240_10016166
1271 Ga0105240_10017750
1272 Ga0105240_10200004
1273 Ga0105245_10002729
1274 Ga0105245_10007375
1275 Ga0105245_10025836
1276 Ga0105247_10011876
1277 Ga0114129_10109069
1278 Ga0105243_10001371
1279 Ga0105243_10116549
1280 Ga0105241_10022386
1281 Ga0105241_10141001
1282 Ga0105242_10024897
1283 Ga0105242_10088012
1284 Ga0105248_10001597
1285 Ga0105248_10007128
1286 Ga0105248_10034146
1287 Ga0105237_10006851
1288 Ga0105237_10017698
1289 Ga0105237_10149946
1290 Ga0105238_10000107
1291 Ga0105238_10005597
1292 Ga0105238_10079034
1293 Ga0105238_10174280
1294 Ga0105238_10212471
1295 Ga0105238_10437437
1296 Ga0105249_10299660
1297 Ga0105239_10000289
1298 Ga0105239_10011318
1299 Ga0105239_10154792
1300 Ga0105246_10028790
1301 Ga0157371_10041027
1302 Ga0157370_10021505
1303 Ga0157370_10034978
1304 Ga0157369_10063621
1305 Ga0157369_10076251
1306 Ga0157374_10004556
1307 Ga0157374_10012509
1308 Ga0157374_10013360
1309 Ga0157374_10267092
1310 Ga0157378_10007955
1311 Ga0157378_10019633
1312 Ga0163162_10005095
1313 Ga0163162_10024879
1314 Ga0157372_10005037
1315 Ga0157372_10310657
1316 Ga0157375_10001898
1317 Ga0157375_10049090
1318 Ga0163163_10000829
1319 Ga0182008_10000145
1320 Ga0157379_10001663
1321 Ga0157379_10204340
1322 Ga0157376_10001490
1323 Ga0157376_10007856
1324 Ga0157376_10024072
1325 Ga0182006_1000004
1326 Ga0182006_1000019
1327 Ga0182006_1029360
1328 Ga0182007_10000028
1329 Ga0182007_10005363
1330 Ga0182005_1000003
1331 Ga0182005_1000011
1332 Ga0182005_1000252
1333 Ga0163161_10005476
1334 Ga0163161_10018863
1335 Ga0213872_10000075
1336 Ga0213872_10000179
1337 Ga0213872_10001290
1338 Ga0213872_10001872
1339 Ga0213872_10003652
1340 Ga0209435_100055
1341 Ga0209435_100229
1342 Ga0209436_100124
1343 Ga0209784_100018
1344 Ga0209566_100016
1345 Ga0209674_100030
1346 Ga0209147_100097
1347 Ga0209563_100022
1348 Ga0209563_100034
1349 Ga0209437_100234
1350 Ga0209258_100192
1351 Ga0207425_1000013
1352 Ga0207425_1000141
1353 Ga0207425_1000349
1354 Ga0209646_1000103
1355 Ga0209646_1000219
1356 Ga0209646_1000346
1357 Ga0209026_1000134
1358 Ga0209026_1003583
1359 Ga0209677_100019
1360 Ga0209677_103351
1361 Ga0209148_1000554
1362 Ga0209759_1000091
1363 Ga0209759_1000094
1364 Ga0209759_1000767
1365 Ga0209129_1000106
1366 Ga0209129_1000956
1367 Ga0209129_1009845
1368 Ga0209565_1000035
1369 Ga0209565_1001523
1370 Ga0209565_1002212
1371 Ga0209565_1002406
1372 Ga0209565_1006605
1373 Ga0209455_1000033
1374 Ga0209455_1005803
1375 Ga0209673_1000006
1376 Ga0209130_1000086
1377 Ga0209130_1000322
1378 Ga0209675_1000005
1379 Ga0209675_1006765
1380 Ga0209676_1000098
1381 Ga0209676_1000300
1382 Ga0209025_1000174
1383 Ga0209025_1003824
1384 Ga0209564_1000028
1385 Ga0209564_1000032
1386 Ga0209564_1000083
1387 Ga0209564_1000202
1388 Ga0209564_1009714
1389 Ga0209758_1000031
1390 Ga0209758_1000583
1391 Ga0209050_1000078
1392 Ga0209050_1000226
1393 Ga0209050_1002985
1394 Ga0209050_1004270
1395 Ga0209256_1000035
1396 Ga0209256_1000322
1397 Ga0209256_1000508
1398 Ga0209256_1002611
1399 Ga0209256_1004993
1400 Ga0207426_1001307
1401 Ga0209051_1000098
1402 Ga0209257_1000097
1403 Ga0209257_1011227
1404 Ga0209257_1016786
1405 Ga0207655_1002824
1406 Ga0207692_10041895
1407 Ga0207642_10002638
1408 Ga0207642_10003692
1409 Ga0207710_10006209
1410 Ga0207680_10000184
1411 Ga0207699_10048033
1412 Ga0207643_10016782
1413 Ga0207705_10015863
1414 Ga0207684_10077919
1415 Ga0207707_10007366
1416 Ga0207707_10107716
1417 Ga0207695_10001004
1418 Ga0207695_10011204
1419 Ga0207695_10012700
1420 Ga0207695_10040095
1421 Ga0207695_10053375
1422 Ga0207695_10089618
1423 Ga0207671_10008252
1424 Ga0207671_10025688
1425 Ga0207671_10123375
1426 Ga0207671_10131739
1427 Ga0207693_10003805
1428 Ga0207693_10007691
1429 Ga0207663_10000216
1430 Ga0207660_10096256
1431 Ga0207660_10208313
1432 Ga0207657_10004518
1433 Ga0207657_10004885
1434 Ga0207657_10018798
1435 Ga0207657_10038927
1436 Ga0207649_10013185
1437 Ga0207649_10072957
1438 Ga0207652_10008588
1439 Ga0207652_10041247
1440 Ga0207652_10066752
1441 Ga0207646_10253015
1442 Ga0207681_10120915
1443 Ga0207694_10000075
1444 Ga0207694_10001533
1445 Ga0207650_10019053
1446 Ga0207650_10124002
1447 Ga0207687_10000171
1448 Ga0207687_10026081
1449 Ga0207687_10030876
1450 Ga0207700_10005562
1451 Ga0207700_10034914
1452 Ga0207664_10007467
1453 Ga0207664_10031707
1454 Ga0207644_10000563
1455 Ga0207644_10004179
1456 Ga0207690_10071636
1457 Ga0207690_10161369
1458 Ga0207686_10000953
1459 Ga0207686_10025755
1460 Ga0207686_10071207
1461 Ga0207709_10000130
1462 Ga0207709_10016469
1463 Ga0207670_10004704
1464 Ga0207665_10006712
1465 Ga0207665_10017352
1466 Ga0207711_10000157
1467 Ga0207711_10005820
1468 Ga0207711_10094372
1469 Ga0207711_10113955
1470 Ga0207711_10229229
1471 Ga0207689_10007339
1472 Ga0207689_10010020
1473 Ga0207689_10023166
1474 Ga0207689_10058811
1475 Ga0207689_10172411
1476 Ga0207661_10010229
1477 Ga0207679_10007163
1478 Ga0207679_10016667
1479 Ga0207679_10071153
1480 Ga0207679_10087190
1481 Ga0207667_10000110
1482 Ga0207667_10003783
1483 Ga0207667_10008363
1484 Ga0207667_10021206
1485 Ga0207667_10039822
1486 Ga0207667_10125460
1487 Ga0207667_10236654
1488 Ga0207651_10000171
1489 Ga0207640_10052490
1490 Ga0207640_10136890
1491 Ga0207658_10003562
1492 Ga0207677_10000221
1493 Ga0207677_10127095
1494 Ga0207677_10164708
1495 Ga0207677_10174283
1496 Ga0207703_10000374
1497 Ga0207703_10110630
1498 Ga0207639_10097541
1499 Ga0207708_10112888
1500 Ga0207702_10037982
1501 Ga0207702_10053897
1502 Ga0207702_10078997
1503 Ga0207702_10190867
1504 Ga0207641_10000603
1505 Ga0207641_10253651
1506 Ga0207648_10004108
1507 Ga0207648_10094592
1508 Ga0207676_10000054
1509 Ga0207676_10201243
1510 Ga0207674_10062673
1511 Ga0207675_100019706
1512 Ga0207683_10017484
1513 Ga0207698_10000842
1514 Ga0207698_10046078
1515 Ga0207698_10097486
1516 Ga0209281_1001845
1517 Ga0209281_1002589
1518 Ga0209371_1000050
1519 Ga0209371_1000112
1520 Ga0209282_1000003
1521 Ga0268266_10015295
1522 Ga0268265_10082243
1523 Ga0268264_10023638
1524 Ga0268264_10024820
1525 Ga0307515_10179545
1526 Ga0268256_1000017
1527 Ga0316177_1095886
1528 Ga0307408_100000596
1529 Ga0307408_100002140
1530 Ga0307408_100002964
1531 Ga0307408_100019423
1532 Ga0307408_100207792
1533 Ga0265314_10043808
1534 Ga0307405_10044240
1535 Ga0307416_100085851
1536 Ga0373934_0005744
1537 Ga0373923_0000532
1538 Ga0373945_0013225
1539 Ga0373953_0002606
1540 Ga0373954_0000547
1541 Ga0373956_0009377
1542 Ga0373957_0007770
1543 Ga0373955_0001069
1544 Ga0373935_0010552
1545 Ga0373927_0008057
1546 Ga0373933_0007254
1547 Ga0373947_0009692
1548 Ga0373937_0007581
1549 Ga0373937_0015001
1550 Ga0373937_0023239
1551 Ga0373937_0119091
1552 Ga0373925_0002796
1553 Ga0395899_0002523
1554 Ga0395899_0007801
1555 Ga0395899_0014681
1556 Ga0395899_0060856
1557 Ga0395899_0098549
1558 Ga0395900_0000328
1559 Ga0395900_0023374
1560 Ga0395900_0028057
1561 Ga0395900_0083321
1562 Ga0395900_0155990
1563 Ga0395900_0191458
1564 Ga0395898_0084295
1565 Ga0395898_0089206
1566 Ga0395898_0130172
1567 Ga0395898_0272404
1568 Ga0395905_0296349
1569 Ga0395901_0000845
1570 Ga0395901_0015989
1571 Ga0395901_0050369
1572 Ga0395901_0104897
1573 Ga0395901_0124417
1574 Ga0395901_0208657
1575 Ga0436361_0021035
1576 Ga0436361_0090832
1577 Ga0436361_0364057
1578 Ga0436361_0460205
1579 Ga0436361_0567363
1580 Ga0436361_0909074
1581 Ga0439448_0000563
1582 Ga0439455_0004991
1583 Ga0450911_003531
1584 Ga0450904_000301
1585 Ga0439458_0009941
1586 Ga0466969_0057358
1587 Ga0466972_0003639
1588 Ga0466965_0004912
1589 Ga0466965_0011537
1590 Ga0466965_0033382
1591 Ga0466966_0009892
1592 Ga0466961_0111519
1593 Ga0466963_0061851
1594 Ga0466964_0000209
1595 Ga0453684_0000450
1596 Ga0466957_0000872
1597 Ga0466957_0058721
1598 Ga0466959_0019111
1599 Ga0466958_0139404
1600 Ga0466967_0002431
1601 Ga0466967_0005571
1602 Ga0495617_000014
1603 Ga0495617_000023
1604 Ga0495617_001293
1605 Ga0495617_001845
1606 Ga0495617_003871
1607 Ga0495627_000016
1608 Ga0495627_000061
1609 Ga0495627_003768
1610 Ga0495627_009314
1611 Ga0495592_0005016
1612 Ga0495603_0014275
1613 Ga0495603_0044048
1614 Ga0495603_0051411
1615 Ga0495590_0000019
1616 Ga0495590_0000043
1617 Ga0495590_0000670
1618 Ga0495590_0007766
1619 Ga0495591_000187
1620 Ga0495591_002995
1621 Ga0495629_0014982
1622 Ga0495629_0084443
1623 Ga0495629_0127831
1624 Ga0495638_0000115
1625 Ga0495638_0006133
1626 Ga0495638_0038746
1627 Ga0495638_0049300
1628 Ga0495653_0000014
1629 Ga0495650_0000142
1630 Ga0495650_0000178
1631 Ga0495650_0000181
1632 Ga0495650_0000193
1633 Ga0495650_0000395
1634 Ga0495650_0000906
1635 Ga0495650_0001736
1636 Ga0495580_0004401
1637 Ga0495580_0121227
1638 Ga0495582_0000674
1639 Ga0495582_0006796
1640 Ga0495605_0000010
1641 Ga0495605_0000110
1642 Ga0495605_0000118
1643 Ga0495605_0000910
1644 Ga0495605_0011533
1645 Ga0495605_0012465
1646 Ga0495605_0041968
1647 Ga0495584_0000065
1648 Ga0495584_0000138
1649 Ga0495584_0000163
1650 Ga0495584_0000227
1651 Ga0495584_0001545
1652 Ga0495584_0011764
1653 Ga0495584_0024547
1654 Ga0495584_0058886
1655 Ga0495584_0098848
1656 Ga0495585_0000123
1657 Ga0495585_0000160
1658 Ga0495585_0001260
1659 Ga0495585_0005863
1660 Ga0495585_0008881
1661 Ga0495585_0011341
1662 Ga0495585_0026582
1663 Ga0495585_0026583
1664 Ga0495585_0035257
1665 Ga0495585_0036136
1666 Ga0495585_0041758
1667 Ga0495585_0067130
1668 Ga0495594_0008244
1669 Ga0495594_0009516
1670 Ga0495594_0019046
1671 Ga0495594_0103272
1672 Ga0495596_0000291
1673 Ga0495596_0000310
1674 Ga0495596_0000418
1675 Ga0495596_0003475
1676 Ga0495596_0006215
1677 Ga0495596_0025659
1678 Ga0495607_0000719
1679 Ga0495607_0000942
1680 Ga0495607_0004531
1681 Ga0495607_0008029
1682 Ga0495607_0008548
1683 Ga0495607_0014412
1684 Ga0495607_0021186
1685 Ga0495607_0044005
1686 Ga0495607_0057905
1687 Ga0495583_0000057
1688 Ga0495583_0000065
1689 Ga0495583_0000102
1690 Ga0495583_0000126
1691 Ga0495583_0001000
1692 Ga0495583_0001247
1693 Ga0495583_0004613
1694 Ga0495583_0009887
1695 Ga0495583_0020208
1696 Ga0495583_0057338
1697 Ga0495606_0000004
1698 Ga0495606_0000085
1699 Ga0495606_0000165
1700 Ga0495606_0000250
1701 Ga0495606_0000391
1702 Ga0495606_0000498
1703 Ga0495606_0000583
1704 Ga0495606_0002188
1705 Ga0495606_0003463
1706 Ga0495606_0015293
1707 Ga0495606_0023412
1708 Ga0495606_0040461
1709 Ga0495606_0044897
1710 Ga0495606_0073319
1711 Ga0495610_0000007
1712 Ga0495610_0004332
1713 Ga0495610_0007942
1714 Ga0495610_0013977
1715 Ga0495610_0017941
1716 Ga0495616_0000083
1717 Ga0495616_0000230
1718 Ga0495616_0001478
1719 Ga0495616_0010455
1720 Ga0495616_0014112
1721 Ga0495616_0019879
1722 Ga0495616_0026763
1723 Ga0495616_0027550
1724 Ga0495616_0050733
1725 Ga0495616_0069719
1726 Ga0495620_0017597
1727 Ga0495631_0000385
1728 Ga0495631_0000495
1729 Ga0495631_0013856
1730 Ga0495631_0024948
1731 Ga0495631_0038783
1732 Ga0495631_0055662
1733 Ga0495632_0000041
1734 Ga0495632_0000336
1735 Ga0495632_0001288
1736 Ga0495632_0005108
1737 Ga0495632_0021092
1738 Ga0495632_0037065
1739 Ga0495637_0000119
1740 Ga0495637_0000602
1741 Ga0495643_0000130
1742 Ga0495643_0000418
1743 Ga0495643_0000524
1744 Ga0495643_0000686
1745 Ga0495643_0002486
1746 Ga0495643_0013493
1747 Ga0495643_0022698
1748 Ga0495643_0063506
1749 Ga0495644_0002910
1750 Ga0495644_0005632
1751 Ga0495648_0000053
1752 Ga0495648_0000104
1753 Ga0495648_0000293
1754 Ga0495648_0000799
1755 Ga0495648_0001424
1756 Ga0495648_0004497
1757 Ga0495648_0006997
1758 Ga0495648_0018900
1759 Ga0495648_0029978
1760 Ga0495648_0044969
1761 Ga0495648_0062838
1762 Ga0495663_0012433
1763 Ga0495666_0000214
1764 Ga0495642_0000017
1765 Ga0495642_0000284
1766 Ga0495642_0002324
1767 Ga0495642_0005212
1768 Ga0495642_0006008
1769 Ga0495642_0014091
1770 Ga0495642_0022781
1771 Ga0495642_0022825
1772 Ga0495652_0022488
1773 Ga0495654_0000034
1774 Ga0495654_0004252
1775 Ga0495654_0018842
1776 Ga0495665_0000193
1777 Ga0495665_0003674
1778 Ga0495665_0004601
1779 Ga0495640_0028810
1780 Ga0495587_0007851
1781 Ga0495587_0053485
1782 Ga0495609_0000005
1783 Ga0495609_0000164
1784 Ga0495609_0000597
1785 Ga0495609_0000772
1786 Ga0495609_0001430
1787 Ga0495609_0001879
1788 Ga0495621_0002820
1789 Ga0495597_0000046
1790 Ga0495597_0000100
1791 Ga0495597_0000198
1792 Ga0495597_0000607
1793 Ga0495597_0006177
1794 Ga0495597_0007247
1795 Ga0495597_0007612
1796 Ga0495597_0025278
1797 Ga0495597_0028765
1798 Ga0495622_0000011
1799 Ga0495622_0000230
1800 Ga0495622_0000812
1801 Ga0495633_0000065
1802 Ga0495633_0000146
1803 Ga0495633_0000749
1804 Ga0495633_0001918
1805 Ga0495633_0003442
1806 Ga0495633_0005322
1807 Ga0495633_0009409
1808 Ga0495633_0010746
1809 Ga0495633_0011531
1810 Ga0495633_0012010
1811 Ga0495633_0013361
1812 Ga0495633_0051475
1813 Ga0495633_0055925
1814 Ga0495633_0059448
1815 Ga0495656_0014769
1816 Ga0495656_0027896
1817 Ga0495668_0000030
1818 Ga0495668_0000117
1819 Ga0495668_0000251
1820 Ga0495668_0000580
1821 Ga0495668_0001350
1822 Ga0495668_0001882
1823 Ga0495668_0004307
1824 Ga0495668_0004658
1825 Ga0495668_0024198
1826 Ga0495668_0025254
1827 Ga0495668_0045766
1828 Ga0495634_0070417
1829 Ga0495611_0000148
1830 Ga0495611_0009125
1831 Ga0495611_0009943
1832 Ga0495611_0018564
1833 Ga0495611_0037155
1834 Ga0495611_0089929
1835 Ga0495625_0000609
1836 Ga0495625_0000620
1837 Ga0495625_0001604
1838 Ga0495625_0003530
1839 Ga0495625_0009776
1840 Ga0495625_0027511
1841 Ga0495625_0036919
1842 Ga0495625_0040051
1843 Ga0495625_0068746
1844 Ga0495625_0088531
1845 Ga0495625_0138536
1846 Ga0495635_0001435
1847 Ga0495635_0030249
1848 Ga0495659_0000148
1849 Ga0495661_0000102
1850 Ga0495661_0000420
1851 Ga0495661_0000945
1852 Ga0495661_0001953
1853 Ga0495661_0006769
1854 Ga0495661_0008255
1855 Ga0495661_0008319
1856 Ga0495661_0031328
1857 Ga0495661_0031692
1858 Ga0495661_0038584
1859 Ga0495661_0040168
1860 Ga0495661_0043635
1861 Ga0495661_0050759
1862 Ga0495661_0051975
1863 Ga0495588_0000126
1864 Ga0495588_0017756
1865 Ga0495588_0036860
1866 Ga0495588_0064731
1867 Ga0495599_0069567
1868 Ga0495623_0006370
1869 Ga0495623_0102960
1870 Ga0495646_0007932
1871 Ga0495646_0042703
1872 Ga0495646_0104635
1873 Ga0495658_0000474
1874 Ga0495669_0000077
1875 Ga0495669_0033624
1876 Ga0495613_0001075
1877 Ga0495613_0041274
1878 Ga0495624_0025453
1879 Ga0495624_0036405
1880 Ga0495624_0053816
1881 Ga0495670_0000595
1882 Ga0495670_0001516
1883 Ga0495670_0004163
1884 Ga0495670_0014679
1885 Ga0495670_0024272
1886 Ga0495670_0065348
1887 Ga0495671_0000009
1888 Ga0495671_0000053
1889 Ga0495671_0000068
1890 Ga0495671_0012746
1891 Ga0495671_0014856
1892 Ga0495671_0014925
1893 Ga0495671_0029004
1894 Ga0495649_0000074
1895 Ga0495649_0015929
1896 Ga0495649_0026452
1897 Ga0495649_0048404
1898 Ga0495589_0000024
1899 Ga0495589_0000310
1900 Ga0495589_0001875
1901 Ga0495589_0010935
1902 Ga0495589_0013516
1903 Ga0495589_0039348
1904 Ga0495589_0041691
1905 Ga0495589_0046719
1906 Ga0495600_0006539
1907 Ga0495600_0011440
1908 Ga0495660_0000068
1909 Ga0495660_0000954
1910 Ga0495660_0001370
1911 Ga0495660_0011116
1912 Ga0495660_0015125
1913 Ga0495660_0025952
1914 Ga0495660_0065946
1915 Ga0495581_0000277
1916 Ga0495604_0030356
1917 Ga0495604_0030863
1918 Ga0495604_0055300
1919 Ga0495604_0137459
1920 Ga0495636_0000073
1921 Ga0495674_0002989
1922 Ga0495672_0000099
1923 Ga0495672_0000371
1924 Ga0495672_0000897
1925 Ga0495672_0001193
1926 Ga0495672_0001368
1927 Ga0495672_0002171
1928 Ga0495672_0016791
1929 Ga0495672_0021977
1930 Ga0495676_0000028
1931 Ga0495676_0037428
1932 Ga0495680_0054896
1933 Ga0495683_0000067
1934 Ga0495683_0000610
1935 Ga0495683_0037579
1936 Ga0495687_000008
1937 Ga0495687_000052
1938 Ga0495687_000085
1939 Ga0495687_000318
1940 Ga0495687_000840
1941 Ga0495687_000868
1942 Ga0495687_001500
1943 Ga0495687_007672
1944 Ga0495687_010494
1945 Ga0495675_0018080
1946 Ga0495675_0019623
1947 Ga0495677_0000007
1948 Ga0495677_0000063
1949 Ga0495677_0000088
1950 Ga0495677_0000857
1951 Ga0495677_0003195
1952 Ga0495677_0007176
1953 Ga0495677_0007489
1954 Ga0495677_0009025
1955 Ga0495677_0018797
1956 Ga0495677_0028677
1957 Ga0495679_003368
1958 Ga0495679_007583
1959 Ga0495685_000024
1960 Ga0495685_001575
1961 Ga0495673_0000031
1962 Ga0495673_0000032
1963 Ga0495673_0000105
1964 Ga0495673_0008057
1965 Ga0495673_0014428
1966 Ga0495681_0001051
1967 Ga0495681_0001118
1968 Ga0495681_0008667
1969 Ga0495681_0010293
1970 Ga0495681_0012679
1971 Ga0495681_0016124
1972 Ga0495681_0048028
1973 Ga0495684_0001806
1974 Ga0495684_0014218
1975 Ga0495686_0000156
1976 Ga0495686_0000203
1977 Ga0495686_0000370
1978 Ga0495686_0001097
1979 Ga0495686_0020766
1980 Ga0495686_0052400
1981 Ga0495686_0079968
1982 Ga0495593_0004097
1983 Ga0495602_0001014
1984 Ga0495602_0056638
1985 Ga0495602_0072223
1986 Ga0495614_0000617
1987 Ga0495626_0000054
1988 Ga0495626_0000149
1989 Ga0495626_0002253
1990 Ga0495626_0003234
1991 Ga0495626_0004043
1992 Ga0495626_0006416
1993 Ga0495626_0012181
1994 Ga0495626_0014075
1995 Ga0495626_0019470
1996 Ga0495626_0038532
1997 Ga0496100_0110788
1998 Ga0496101_0163270
1999 Ga0496102_0000215
2000 Ga0496102_0000369
2001 Ga0496102_0008630
2002 Ga0496102_0136492
2003 Ga0496103_0002327
2004 Ga0496103_0003122
2005 Ga0496104_0003193
2006 Ga0496105_0003540
2007 Ga0496106_0033314
2008 Ga0496107_0104568
2009 Ga0496107_0164972
2010 Ga0496109_0004034
2011 Ga0496109_0011003
2012 Ga0496110_0000817
2013 Ga0496110_0026144
2014 Ga0496112_0000733
2015 Ga0496112_0040689
2016 Ga0496112_0211211
2017 Ga0496113_0001668
2018 Ga0496114_0090073
2019 Ga0496115_0005708
2020 Ga0496115_0017770
2021 Ga0496116_0018963
2022 Ga0496117_0000011
2023 Ga0496118_0000010
2024 Ga0496121_0000978
2025 Ga0496121_0001372
2026 Ga0496121_0004394
2027 Ga0496121_0010245
2028 Ga0496122_0000864
2029 Ga0496122_0003892
2030 Ga0496122_0003927
2031 Ga0496122_0016640
2032 Ga0496122_0031684
2033 Ga0496122_0051883
2034 Ga0496122_0054437
2035 Ga0496123_0000099
2036 Ga0496123_0004147
2037 Ga0496123_0006218
2038 Ga0496123_0029518
2039 Ga0496123_0049983
2040 Ga0496124_0010847
2041 Ga0496124_0020767
2042 Ga0496124_0049620
2043 Ga0496124_0052264
2044 Ga0496124_0113113
2045 Ga0496125_0001800
2046 Ga0496125_0003100
2047 Ga0496125_0080848
2048 Ga0496126_0003835
2049 Ga0496126_0014871
2050 Ga0495678_000001
2051 Ga0495678_000053
2052 Ga0495678_000225
2053 Ga0495678_000548
2054 Ga0495678_001622
2055 Ga0495678_001628
2056 Ga0495678_003050
2057 Ga0495678_003199
2058 Ga0495678_003824
2059 Ga0495678_013455
2060 Ga0495682_0000053
2061 Ga0495682_0000551
2062 Ga0501034_0002533
2063 Ga0501034_0049055
2064 Ga0501238_002604
2065 Ga0501249_001280
2066 Ga0501083_0091363
2067 Ga0501269_000123
2068 Ga0501279_002262
2069 Ga0501279_004296
2070 Ga0501035_0000855
2071 nmdc:mga03683_33884_c1
2072 nmdc:mga07m45_229_c1
2073 nmdc:mga0rr50_141003_c1
2074 Ga0495601_0005627
2075 Ga0500610_0016124
2076 Ga0500610_0081758
2077 Ga0495619_0002446
2078 Ga0500607_000211
2079 Ga0500608_066594
2080 Ga0500618_000904
2081 Ga0500619_000240
2082 Ga0500627_0042780
2083 Ga0501082_0142047
2084 2511250841
2085 2511385058
2086 2521560576
2087 2550694227
2088 2553005691
2089 2601531923
2090 2601537294
2091 2601669226
2092 2601755641
2093 2601761009
2094 2603638969
2095 2643789695
2096 2643796815
2097 2644028500
2098 2644214574
2099 2644249943
2100 2644326196
2101 2644358621
2102 2644470080
2103 2738739538
2104 2738827582
2105 2738846115
2106 2738880487
2107 2739151378
2108 2739193298
2109 2739275732
2110 2739319774
2111 2739338015
2112 2739344776
2113 2765571822
2114 2791925492
2115 2808982172
2116 2809130028
2117 2809147143
2118 2809148917
2119 2813730030
2120 2814697522
2121 2819543288
2122 2819595618
2123 2819617268
2124 2821136040
2125 2834643455
2126 2839098457
2127 2842713000
2128 2852619052
2129 2857549358
2130 2857555558
2131 2857562963
2132 2857569205
2133 2882461700
2134 2883092901
2135 2884816178
2136 2884839379
2137 2884856811
2138 2885085967
2139 2885201268
2140 2885214940
2141 2896158157
2142 2900640992
2143 2904429378
2144 2904442907
2145 2904534896
2146 2904588764
2147 2904594162
2148 2904605000
2149 2919048594
2150 2919083234
2151 2919479383
2152 2923514369
2153 2928133094
2154 2932414480
2155 2932420999
2156 2974322312
2157 642615354
2158 8003405200
2159 8047676916
2160 8054007568

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

92

418

0.94

PF04389

Peptidase_M28

Peptidase family M28

76

180

0.86

PF07687

M20_dimer

Peptidase dimerisation domain

221

325

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8aq0-assembly1.cif.gz_B crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c 0.8905 16 416
8apz-assembly1.cif.gz_B crystal structure of wild-type l-n-carbamoylase from sinorhizobium meliloti 0.8882 18 417
5i4m-assembly1.cif.gz_B crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis 0.8806 15 417
8aq0-assembly1.cif.gz_B crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c 0.87 16 416
8apz-assembly1.cif.gz_B crystal structure of wild-type l-n-carbamoylase from sinorhizobium meliloti 0.8656 18 417
ID Description Score Start End Superfamily
5i4mB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9706 15 413 3.40.630.10
5i4mB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.948 15 413 3.40.630.10
3n5fA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9151 21 413 3.40.630.10
6c0dA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9042 18 414 3.40.630.10
3n5fA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.903 21 413 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A382V0H9-F1-model_v4 Zn-dependent hydrolase 0.9964 18 120 GO:0016813
AF-A0A536UMS7-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9956 14 173 GO:0016813
AF-A0A356HR59-F1-model_v4 deleted 0.9955 17 144
AF-A0A349SFW1-F1-model_v4 Zn-dependent hydrolase 0.994 17 212 GO:0016813
AF-A0A377V0X5-F1-model_v4 Beta-ureidopropionase (EC 3.5.-.-) 0.9938 68 171 GO:0016813

Map