F489672
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1080 | 470 | 2160 | 416 |
Family's Representative Sequence
| Representative Sequence | 3300049742|Ga0501080_0024566|Ga0501080_0024566_1773_3080 |
| Length | 421 |
| Sequence | LETAFNRKFTTWFLCNNCVSPNPLWQSLMDLASIGATPKGGVCRLALSDLDREGRDRVCSWLRAAGCKVEVDGIGNIFARRRGRNDSLPPVVAGSHIDTQPSGGKFDGNYGVMAALEVVRTLNDHRIETEHPFEVAIWTNEEGTRFTPVMMGSGVFAGAFTLQHALAQSDIDGKTVGAELGRIGYAGTAPIPRPMAAYFEAHIEQGPILEDTNKVIGVVQGALGLRWYDVAVTGQDAHAGPTPMRLRKDAMLGAARIVEAVNGIAAGHQPDGRGTVGFMQVKPNSRNVIPGSVRLSVDLRHADKASLDSMERQLREACRMIAEAGGVGIDLKCVTDYAPLSFDTALVNGVRQAASELGYPSLDIVSGAGHDACYVARVAPAAMIFVPCESGISHNEIENAKPSDLEAGGNVLLRSVLQAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 248 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 249 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 250 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 251 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 252 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 369 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 370 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 371 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 372 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 373 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 377 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 378 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 380 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 381 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 389 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 390 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 395 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 396 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 397 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 398 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 399 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 400 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 401 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 402 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 403 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 404 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 405 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 406 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 407 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 408 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 409 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 410 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 411 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 412 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 413 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 414 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 415 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 416 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 417 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 418 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 419 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 420 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 421 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 422 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 423 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 424 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 425 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 426 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 427 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 428 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 429 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 430 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 431 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 432 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 433 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 434 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 435 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 436 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 437 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 438 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 439 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 440 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 441 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 442 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 443 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 444 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 445 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 446 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 447 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 448 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 449 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 450 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 451 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 452 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 453 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 454 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 455 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 456 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 457 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 458 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 459 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 460 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 461 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 462 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 463 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 464 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 465 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 466 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 467 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 468 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 469 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 470 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.87 |
| Metatranscriptomes | 0 |
| Isolates | 7.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.28 |
| Nodule | 0.74 |
| Rhizoplane | 2.78 |
| Rhizosphere | 77.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501080_0024566 | 3300049742 | Bacteria | 5587 |
| 2 | RicEn_C2987 | 2010549000 | Bacteria | 2825 |
| 3 | JGI25155J39150_1000140 | 3300002704 | Bacteria | 34372 |
| 4 | JGI25155J39150_1000562 | 3300002704 | Bacteria | 8330 |
| 5 | JGI25156J39149_1000120 | 3300002705 | Bacteria | 56713 |
| 6 | JGI25156J39149_1000370 | 3300002705 | Bacteria | 28936 |
| 7 | JGI25154J39366_1000372 | 3300002738 | Bacteria | 24998 |
| 8 | JGI25154J39366_1001022 | 3300002738 | Bacteria | 11253 |
| 9 | JGI25154J39366_1001082 | 3300002738 | Bacteria | 10702 |
| 10 | JGI25158J39367_1001790 | 3300002739 | Bacteria | 3659 |
| 11 | JGI25157J39369_1000294 | 3300002741 | Bacteria | 36390 |
| 12 | JGI25152J39213_1000487 | 3300002773 | Bacteria | 22528 |
| 13 | JGI25150J39212_1000644 | 3300002774 | Bacteria | 13137 |
| 14 | JGI25150J39212_1001243 | 3300002774 | Bacteria | 7377 |
| 15 | JGI25159J45721_1000989 | 3300002987 | Bacteria | 12278 |
| 16 | JGI25159J45721_1003515 | 3300002987 | Bacteria | 5520 |
| 17 | JGI25151J46595_10000568 | 3300003187 | Bacteria | 33251 |
| 18 | rootL2_10156471 | 3300003322 | Bacteria | 6470 |
| 19 | JGI25161J50226_1001985 | 3300003374 | Bacteria | 5611 |
| 20 | Ga0055538_1000024 | 3300003751 | Bacteria | 241526 |
| 21 | Ga0055539_1000031 | 3300003752 | Bacteria | 241526 |
| 22 | Ga0055533_1000041 | 3300003756 | Bacteria | 241526 |
| 23 | Ga0055532_1000074 | 3300003758 | Bacteria | 125513 |
| 24 | Ga0055525_1000006 | 3300003759 | Bacteria | 642912 |
| 25 | Ga0055525_1000049 | 3300003759 | Bacteria | 241526 |
| 26 | Ga0055529_1000537 | 3300003763 | Bacteria | 32520 |
| 27 | Ga0055526_1000035 | 3300003771 | Bacteria | 135873 |
| 28 | Ga0055526_1000047 | 3300003771 | Bacteria | 120080 |
| 29 | Ga0055526_1000729 | 3300003771 | Bacteria | 24835 |
| 30 | Ga0055526_1006694 | 3300003771 | Bacteria | 6180 |
| 31 | Ga0055537_1000078 | 3300003773 | Bacteria | 70140 |
| 32 | Ga0055537_1007096 | 3300003773 | Bacteria | 2750 |
| 33 | Ga0055524_1000053 | 3300003775 | Bacteria | 144892 |
| 34 | Ga0055524_1003340 | 3300003775 | Bacteria | 7824 |
| 35 | Ga0055524_1005701 | 3300003775 | Bacteria | 5519 |
| 36 | Ga0055536_1000458 | 3300003781 | Bacteria | 28710 |
| 37 | Ga0055536_1003852 | 3300003781 | Bacteria | 7892 |
| 38 | Ga0055534_1000070 | 3300003784 | Bacteria | 80000 |
| 39 | Ga0055534_1000105 | 3300003784 | Bacteria | 64494 |
| 40 | Ga0055534_1003475 | 3300003784 | Bacteria | 4942 |
| 41 | Ga0055528_1000224 | 3300003790 | Bacteria | 47488 |
| 42 | Ga0055528_1012389 | 3300003790 | Bacteria | 3312 |
| 43 | Ga0055530_10006363 | 3300003791 | Bacteria | 5296 |
| 44 | Ga0055530_10007199 | 3300003791 | Bacteria | 4749 |
| 45 | Ga0055530_10009880 | 3300003791 | Bacteria | 3598 |
| 46 | Ga0055540_1000344 | 3300003792 | Bacteria | 39592 |
| 47 | Ga0055531_10002512 | 3300003794 | Bacteria | 12231 |
| 48 | Ga0055541_1000022 | 3300003841 | Bacteria | 241526 |
| 49 | Ga0055543_1000889 | 3300004625 | Bacteria | 14193 |
| 50 | Ga0055543_1010749 | 3300004625 | Bacteria | 1906 |
| 51 | Ga0065165_1000287 | 3300005262 | Bacteria | 85987 |
| 52 | Ga0065165_1000619 | 3300005262 | Bacteria | 51595 |
| 53 | Ga0065165_1005746 | 3300005262 | Bacteria | 6812 |
| 54 | Ga0070683_100010175 | 3300005329 | Bacteria | 8073 |
| 55 | Ga0070690_100003772 | 3300005330 | Bacteria | 8345 |
| 56 | Ga0070670_100005802 | 3300005331 | Bacteria | 10434 |
| 57 | Ga0068869_100004897 | 3300005334 | Bacteria | 8377 |
| 58 | Ga0068869_100005563 | 3300005334 | Bacteria | 7928 |
| 59 | Ga0070666_10000254 | 3300005335 | Bacteria | 35480 |
| 60 | Ga0070666_10100848 | 3300005335 | Bacteria | 1989 |
| 61 | Ga0070680_100029945 | 3300005336 | Bacteria | 4371 |
| 62 | Ga0070680_100110627 | 3300005336 | Bacteria | 2287 |
| 63 | Ga0070680_100187264 | 3300005336 | Bacteria | 1744 |
| 64 | Ga0068868_100000728 | 3300005338 | Bacteria | 22233 |
| 65 | Ga0070660_100039822 | 3300005339 | Bacteria | 3573 |
| 66 | Ga0070660_100131788 | 3300005339 | Bacteria | 2001 |
| 67 | Ga0070689_100000500 | 3300005340 | Bacteria | 23117 |
| 68 | Ga0070691_10089219 | 3300005341 | Bacteria | 1518 |
| 69 | Ga0070661_100003517 | 3300005344 | Bacteria | 10795 |
| 70 | Ga0070661_100004042 | 3300005344 | Bacteria | 10093 |
| 71 | Ga0070668_100020780 | 3300005347 | Bacteria | 4958 |
| 72 | Ga0070675_100066488 | 3300005354 | Bacteria | 2982 |
| 73 | Ga0070675_100095596 | 3300005354 | Bacteria | 2495 |
| 74 | Ga0070675_100139538 | 3300005354 | Bacteria | 2071 |
| 75 | Ga0070675_100176484 | 3300005354 | Bacteria | 1845 |
| 76 | Ga0070671_100002017 | 3300005355 | Bacteria | 15614 |
| 77 | Ga0070673_100000114 | 3300005364 | Bacteria | 37125 |
| 78 | Ga0070688_100000295 | 3300005365 | Bacteria | 25560 |
| 79 | Ga0070659_100036274 | 3300005366 | Bacteria | 3843 |
| 80 | Ga0070659_100172664 | 3300005366 | Bacteria | 1771 |
| 81 | Ga0070667_100002145 | 3300005367 | Bacteria | 17371 |
| 82 | Ga0070667_100150634 | 3300005367 | Bacteria | 2043 |
| 83 | Ga0070709_10039550 | 3300005434 | Bacteria | 2894 |
| 84 | Ga0070709_10055229 | 3300005434 | Bacteria | 2507 |
| 85 | Ga0070714_100023965 | 3300005435 | Bacteria | 5020 |
| 86 | Ga0070713_100000481 | 3300005436 | Bacteria | 25385 |
| 87 | Ga0070713_100039530 | 3300005436 | Bacteria | 3829 |
| 88 | Ga0070710_10041613 | 3300005437 | Bacteria | 2537 |
| 89 | Ga0070701_10018158 | 3300005438 | Bacteria | 3302 |
| 90 | Ga0070711_100000229 | 3300005439 | Bacteria | 29618 |
| 91 | Ga0070705_100005810 | 3300005440 | Bacteria | 6033 |
| 92 | Ga0070705_100028065 | 3300005440 | Bacteria | 3079 |
| 93 | Ga0070700_100157561 | 3300005441 | Bacteria | 1560 |
| 94 | Ga0070694_100014383 | 3300005444 | Bacteria | 4953 |
| 95 | Ga0070663_100049429 | 3300005455 | Bacteria | 2986 |
| 96 | Ga0070678_100009831 | 3300005456 | Bacteria | 5815 |
| 97 | Ga0070662_100108400 | 3300005457 | Bacteria | 2112 |
| 98 | Ga0070662_100185638 | 3300005457 | Bacteria | 1642 |
| 99 | Ga0070681_10004639 | 3300005458 | Bacteria | 13124 |
| 100 | Ga0068867_100086370 | 3300005459 | Bacteria | 2373 |
| 101 | Ga0068867_100155712 | 3300005459 | Bacteria | 1798 |
| 102 | Ga0070685_10000366 | 3300005466 | Bacteria | 27459 |
| 103 | Ga0070706_100047663 | 3300005467 | Bacteria | 3955 |
| 104 | Ga0070706_100247815 | 3300005467 | Bacteria | 1663 |
| 105 | Ga0070698_100117086 | 3300005471 | Bacteria | 2627 |
| 106 | Ga0070699_100024527 | 3300005518 | Bacteria | 5197 |
| 107 | Ga0070679_100012768 | 3300005530 | Bacteria | 8036 |
| 108 | Ga0070679_100030440 | 3300005530 | Bacteria | 5329 |
| 109 | Ga0070697_100029882 | 3300005536 | Bacteria | 4374 |
| 110 | Ga0068853_100087329 | 3300005539 | Bacteria | 2736 |
| 111 | Ga0070672_100069229 | 3300005543 | Bacteria | 2801 |
| 112 | Ga0070686_100054755 | 3300005544 | Bacteria | 2553 |
| 113 | Ga0070695_100182951 | 3300005545 | Bacteria | 1486 |
| 114 | Ga0070696_100021608 | 3300005546 | Bacteria | 4364 |
| 115 | Ga0070693_100003420 | 3300005547 | Bacteria | 7401 |
| 116 | Ga0070693_100014679 | 3300005547 | Bacteria | 4020 |
| 117 | Ga0070693_100112889 | 3300005547 | Bacteria | 1674 |
| 118 | Ga0070693_100126254 | 3300005547 | Bacteria | 1593 |
| 119 | Ga0070665_100019741 | 3300005548 | Bacteria | 6765 |
| 120 | Ga0070704_100003098 | 3300005549 | Bacteria | 9472 |
| 121 | Ga0068855_100007024 | 3300005563 | Bacteria | 13665 |
| 122 | Ga0068855_100009503 | 3300005563 | Bacteria | 11742 |
| 123 | Ga0068855_100012256 | 3300005563 | Bacteria | 10362 |
| 124 | Ga0068855_100038688 | 3300005563 | Bacteria | 5667 |
| 125 | Ga0068855_100038842 | 3300005563 | Bacteria | 5654 |
| 126 | Ga0068855_100082135 | 3300005563 | Bacteria | 3735 |
| 127 | Ga0068855_100101430 | 3300005563 | Bacteria | 3313 |
| 128 | Ga0068855_100138486 | 3300005563 | Bacteria | 2775 |
| 129 | Ga0070664_100014240 | 3300005564 | Bacteria | 6486 |
| 130 | Ga0070664_100021645 | 3300005564 | Bacteria | 5302 |
| 131 | Ga0070664_100038530 | 3300005564 | Bacteria | 4024 |
| 132 | Ga0070664_100051325 | 3300005564 | Bacteria | 3492 |
| 133 | Ga0070664_100097425 | 3300005564 | Bacteria | 2553 |
| 134 | Ga0070664_100106004 | 3300005564 | Bacteria | 2448 |
| 135 | Ga0070664_100109195 | 3300005564 | Bacteria | 2413 |
| 136 | Ga0068857_100002557 | 3300005577 | Bacteria | 14901 |
| 137 | Ga0068857_100048800 | 3300005577 | Bacteria | 3757 |
| 138 | Ga0068857_100060990 | 3300005577 | Bacteria | 3351 |
| 139 | Ga0068856_100028149 | 3300005614 | Bacteria | 5485 |
| 140 | Ga0068856_100029489 | 3300005614 | Bacteria | 5359 |
| 141 | Ga0068856_100034020 | 3300005614 | Bacteria | 4991 |
| 142 | Ga0068856_100292934 | 3300005614 | Bacteria | 1644 |
| 143 | Ga0068852_100001512 | 3300005616 | Bacteria | 15724 |
| 144 | Ga0068852_100022972 | 3300005616 | Bacteria | 5011 |
| 145 | Ga0068852_100027407 | 3300005616 | Bacteria | 4644 |
| 146 | Ga0068852_100079085 | 3300005616 | Bacteria | 2912 |
| 147 | Ga0068859_100000495 | 3300005617 | Bacteria | 38804 |
| 148 | Ga0068859_100051657 | 3300005617 | Bacteria | 4132 |
| 149 | Ga0068859_100298336 | 3300005617 | Bacteria | 1705 |
| 150 | Ga0068864_100000382 | 3300005618 | Bacteria | 38674 |
| 151 | Ga0068864_100222740 | 3300005618 | Bacteria | 1741 |
| 152 | Ga0068866_10002285 | 3300005718 | Bacteria | 7933 |
| 153 | Ga0068866_10066970 | 3300005718 | Bacteria | 1884 |
| 154 | Ga0068861_100032382 | 3300005719 | Bacteria | 3848 |
| 155 | Ga0068861_100170603 | 3300005719 | Bacteria | 1803 |
| 156 | Ga0068870_10005048 | 3300005840 | Bacteria | 5734 |
| 157 | Ga0068863_100001883 | 3300005841 | Bacteria | 20830 |
| 158 | Ga0068863_100043513 | 3300005841 | Bacteria | 4262 |
| 159 | Ga0068863_100057576 | 3300005841 | Bacteria | 3678 |
| 160 | Ga0068858_100001712 | 3300005842 | Bacteria | 22417 |
| 161 | Ga0068858_100013087 | 3300005842 | Bacteria | 7824 |
| 162 | Ga0068858_100103414 | 3300005842 | Bacteria | 2657 |
| 163 | Ga0068860_100014249 | 3300005843 | Bacteria | 7795 |
| 164 | Ga0081539_10007797 | 3300005985 | Bacteria | 9581 |
| 165 | Ga0070716_100009960 | 3300006173 | Bacteria | 4754 |
| 166 | Ga0070716_100028505 | 3300006173 | Bacteria | 3009 |
| 167 | Ga0070712_100001035 | 3300006175 | Bacteria | 16771 |
| 168 | Ga0070712_100118334 | 3300006175 | Bacteria | 1990 |
| 169 | Ga0075362_10012450 | 3300006177 | Bacteria | 3380 |
| 170 | Ga0075367_10008779 | 3300006178 | Bacteria | 5254 |
| 171 | Ga0075366_10021485 | 3300006195 | Bacteria | 3751 |
| 172 | Ga0097621_100003309 | 3300006237 | Bacteria | 11088 |
| 173 | Ga0097621_100011313 | 3300006237 | Bacteria | 6568 |
| 174 | Ga0097621_100020255 | 3300006237 | Bacteria | 5124 |
| 175 | Ga0075370_10033041 | 3300006353 | Bacteria | 2895 |
| 176 | Ga0068871_100011216 | 3300006358 | Bacteria | 6568 |
| 177 | Ga0068871_100023303 | 3300006358 | Bacteria | 4786 |
| 178 | Ga0068871_100195351 | 3300006358 | Bacteria | 1745 |
| 179 | Ga0097620_100000495 | 3300006931 | Bacteria | 38804 |
| 180 | Ga0097620_100051656 | 3300006931 | Bacteria | 4132 |
| 181 | Ga0097620_100200818 | 3300006931 | Bacteria | 2078 |
| 182 | Ga0097620_100298340 | 3300006931 | Bacteria | 1705 |
| 183 | Ga0079104_1017630 | 3300006946 | Bacteria | 2047 |
| 184 | Ga0099826_10000006 | 3300006948 | Bacteria | 432260 |
| 185 | Ga0105244_10002483 | 3300009036 | Bacteria | 13891 |
| 186 | Ga0105244_10030761 | 3300009036 | Bacteria | 2854 |
| 187 | Ga0105240_10000718 | 3300009093 | Bacteria | 60617 |
| 188 | Ga0105240_10002320 | 3300009093 | Bacteria | 30796 |
| 189 | Ga0105240_10007182 | 3300009093 | Bacteria | 16221 |
| 190 | Ga0105240_10016166 | 3300009093 | Bacteria | 10113 |
| 191 | Ga0105240_10017750 | 3300009093 | Bacteria | 9578 |
| 192 | Ga0105240_10200004 | 3300009093 | Bacteria | 2342 |
| 193 | Ga0105245_10002729 | 3300009098 | Bacteria | 15888 |
| 194 | Ga0105245_10007375 | 3300009098 | Bacteria | 9628 |
| 195 | Ga0105245_10025836 | 3300009098 | Bacteria | 5164 |
| 196 | Ga0105247_10011876 | 3300009101 | Bacteria | 5236 |
| 197 | Ga0114129_10109069 | 3300009147 | Bacteria | 3821 |
| 198 | Ga0105243_10001371 | 3300009148 | Bacteria | 21570 |
| 199 | Ga0105243_10116549 | 3300009148 | Bacteria | 2244 |
| 200 | Ga0105241_10022386 | 3300009174 | Bacteria | 4681 |
| 201 | Ga0105241_10141001 | 3300009174 | Bacteria | 1962 |
| 202 | Ga0105242_10024897 | 3300009176 | Bacteria | 4730 |
| 203 | Ga0105242_10088012 | 3300009176 | Bacteria | 2608 |
| 204 | Ga0105248_10001597 | 3300009177 | Bacteria | 25193 |
| 205 | Ga0105248_10007128 | 3300009177 | Bacteria | 12254 |
| 206 | Ga0105248_10034146 | 3300009177 | Bacteria | 5686 |
| 207 | Ga0105237_10006851 | 3300009545 | Bacteria | 12557 |
| 208 | Ga0105237_10017698 | 3300009545 | Bacteria | 7386 |
| 209 | Ga0105237_10149946 | 3300009545 | Bacteria | 2328 |
| 210 | Ga0105238_10000107 | 3300009551 | Bacteria | 91765 |
| 211 | Ga0105238_10005597 | 3300009551 | Bacteria | 12415 |
| 212 | Ga0105238_10079034 | 3300009551 | Bacteria | 3279 |
| 213 | Ga0105238_10174280 | 3300009551 | Bacteria | 2127 |
| 214 | Ga0105238_10212471 | 3300009551 | Bacteria | 1911 |
| 215 | Ga0105238_10437437 | 3300009551 | Bacteria | 1304 |
| 216 | Ga0105249_10299660 | 3300009553 | Bacteria | 1612 |
| 217 | Ga0105239_10000289 | 3300010375 | Bacteria | 74109 |
| 218 | Ga0105239_10011318 | 3300010375 | Bacteria | 9955 |
| 219 | Ga0105239_10154792 | 3300010375 | Bacteria | 2560 |
| 220 | Ga0105246_10028790 | 3300011119 | Bacteria | 3652 |
| 221 | Ga0157371_10041027 | 3300013102 | Bacteria | 3304 |
| 222 | Ga0157370_10021505 | 3300013104 | Bacteria | 6428 |
| 223 | Ga0157370_10034978 | 3300013104 | Bacteria | 4888 |
| 224 | Ga0157369_10063621 | 3300013105 | Bacteria | 3974 |
| 225 | Ga0157369_10076251 | 3300013105 | Bacteria | 3594 |
| 226 | Ga0157374_10004556 | 3300013296 | Bacteria | 11628 |
| 227 | Ga0157374_10012509 | 3300013296 | Bacteria | 7386 |
| 228 | Ga0157374_10013360 | 3300013296 | Bacteria | 7167 |
| 229 | Ga0157374_10267092 | 3300013296 | Bacteria | 1686 |
| 230 | Ga0157378_10007955 | 3300013297 | Bacteria | 9253 |
| 231 | Ga0157378_10019633 | 3300013297 | Bacteria | 5940 |
| 232 | Ga0163162_10005095 | 3300013306 | Bacteria | 12663 |
| 233 | Ga0163162_10024879 | 3300013306 | Bacteria | 5913 |
| 234 | Ga0157372_10005037 | 3300013307 | Bacteria | 14035 |
| 235 | Ga0157372_10310657 | 3300013307 | Bacteria | 1835 |
| 236 | Ga0157375_10001898 | 3300013308 | Bacteria | 17974 |
| 237 | Ga0157375_10049090 | 3300013308 | Bacteria | 4133 |
| 238 | Ga0163163_10000829 | 3300014325 | Bacteria | 26308 |
| 239 | Ga0182008_10000145 | 3300014497 | Bacteria | 54865 |
| 240 | Ga0157379_10001663 | 3300014968 | Bacteria | 18363 |
| 241 | Ga0157379_10204340 | 3300014968 | Bacteria | 1787 |
| 242 | Ga0157376_10001490 | 3300014969 | Bacteria | 15443 |
| 243 | Ga0157376_10007856 | 3300014969 | Bacteria | 7651 |
| 244 | Ga0157376_10024072 | 3300014969 | Bacteria | 4775 |
| 245 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 246 | Ga0182006_1000019 | 3300015261 | Bacteria | 294192 |
| 247 | Ga0182006_1029360 | 3300015261 | Bacteria | 2228 |
| 248 | Ga0182007_10000028 | 3300015262 | Bacteria | 167122 |
| 249 | Ga0182007_10005363 | 3300015262 | Bacteria | 5645 |
| 250 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 251 | Ga0182005_1000011 | 3300015265 | Bacteria | 420605 |
| 252 | Ga0182005_1000252 | 3300015265 | Bacteria | 34129 |
| 253 | Ga0163161_10005476 | 3300017792 | Bacteria | 8813 |
| 254 | Ga0163161_10018863 | 3300017792 | Bacteria | 4835 |
| 255 | Ga0213872_10000075 | 3300021361 | Bacteria | 90871 |
| 256 | Ga0213872_10000179 | 3300021361 | Bacteria | 56790 |
| 257 | Ga0213872_10001290 | 3300021361 | Bacteria | 16734 |
| 258 | Ga0213872_10001872 | 3300021361 | Bacteria | 12990 |
| 259 | Ga0213872_10003652 | 3300021361 | Bacteria | 8437 |
| 260 | Ga0209435_100055 | 3300025206 | Bacteria | 86115 |
| 261 | Ga0209435_100229 | 3300025206 | Bacteria | 15408 |
| 262 | Ga0209436_100124 | 3300025208 | Bacteria | 37907 |
| 263 | Ga0209784_100018 | 3300025224 | Bacteria | 456816 |
| 264 | Ga0209566_100016 | 3300025225 | Bacteria | 456824 |
| 265 | Ga0209674_100030 | 3300025226 | Bacteria | 456824 |
| 266 | Ga0209147_100097 | 3300025229 | Bacteria | 164034 |
| 267 | Ga0209563_100022 | 3300025230 | Bacteria | 643318 |
| 268 | Ga0209563_100034 | 3300025230 | Bacteria | 456824 |
| 269 | Ga0209437_100234 | 3300025233 | Bacteria | 92856 |
| 270 | Ga0209258_100192 | 3300025242 | Bacteria | 125565 |
| 271 | Ga0207425_1000013 | 3300025245 | Bacteria | 497384 |
| 272 | Ga0207425_1000141 | 3300025245 | Bacteria | 63719 |
| 273 | Ga0207425_1000349 | 3300025245 | Bacteria | 32189 |
| 274 | Ga0209646_1000103 | 3300025246 | Bacteria | 164034 |
| 275 | Ga0209646_1000219 | 3300025246 | Bacteria | 62071 |
| 276 | Ga0209646_1000346 | 3300025246 | Bacteria | 34384 |
| 277 | Ga0209026_1000134 | 3300025250 | Bacteria | 117098 |
| 278 | Ga0209026_1003583 | 3300025250 | Bacteria | 5010 |
| 279 | Ga0209677_100019 | 3300025253 | Bacteria | 456824 |
| 280 | Ga0209677_103351 | 3300025253 | Bacteria | 5265 |
| 281 | Ga0209148_1000554 | 3300025254 | Bacteria | 35482 |
| 282 | Ga0209759_1000091 | 3300025256 | Bacteria | 164034 |
| 283 | Ga0209759_1000094 | 3300025256 | Bacteria | 159426 |
| 284 | Ga0209759_1000767 | 3300025256 | Bacteria | 27265 |
| 285 | Ga0209129_1000106 | 3300025258 | Bacteria | 156102 |
| 286 | Ga0209129_1000956 | 3300025258 | Bacteria | 17406 |
| 287 | Ga0209129_1009845 | 3300025258 | Bacteria | 2459 |
| 288 | Ga0209565_1000035 | 3300025263 | Bacteria | 298125 |
| 289 | Ga0209565_1001523 | 3300025263 | Bacteria | 9999 |
| 290 | Ga0209565_1002212 | 3300025263 | Bacteria | 7285 |
| 291 | Ga0209565_1002406 | 3300025263 | Bacteria | 6777 |
| 292 | Ga0209565_1006605 | 3300025263 | Bacteria | 3232 |
| 293 | Ga0209455_1000033 | 3300025272 | Bacteria | 504606 |
| 294 | Ga0209455_1005803 | 3300025272 | Bacteria | 3750 |
| 295 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 296 | Ga0209130_1000086 | 3300025284 | Bacteria | 157063 |
| 297 | Ga0209130_1000322 | 3300025284 | Bacteria | 56118 |
| 298 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 299 | Ga0209675_1006765 | 3300025291 | Bacteria | 4534 |
| 300 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 301 | Ga0209676_1000300 | 3300025292 | Bacteria | 100399 |
| 302 | Ga0209025_1000174 | 3300025294 | Bacteria | 158915 |
| 303 | Ga0209025_1003824 | 3300025294 | Bacteria | 13734 |
| 304 | Ga0209564_1000028 | 3300025295 | Bacteria | 510986 |
| 305 | Ga0209564_1000032 | 3300025295 | Bacteria | 464041 |
| 306 | Ga0209564_1000083 | 3300025295 | Bacteria | 259272 |
| 307 | Ga0209564_1000202 | 3300025295 | Bacteria | 136555 |
| 308 | Ga0209564_1009714 | 3300025295 | Bacteria | 4533 |
| 309 | Ga0209758_1000031 | 3300025297 | Bacteria | 497252 |
| 310 | Ga0209758_1000583 | 3300025297 | Bacteria | 56955 |
| 311 | Ga0209050_1000078 | 3300025298 | Bacteria | 278409 |
| 312 | Ga0209050_1000226 | 3300025298 | Bacteria | 124227 |
| 313 | Ga0209050_1002985 | 3300025298 | Bacteria | 13166 |
| 314 | Ga0209050_1004270 | 3300025298 | Bacteria | 9809 |
| 315 | Ga0209256_1000035 | 3300025299 | Bacteria | 386754 |
| 316 | Ga0209256_1000322 | 3300025299 | Bacteria | 82681 |
| 317 | Ga0209256_1000508 | 3300025299 | Bacteria | 57334 |
| 318 | Ga0209256_1002611 | 3300025299 | Bacteria | 14257 |
| 319 | Ga0209256_1004993 | 3300025299 | Bacteria | 7941 |
| 320 | Ga0207426_1001307 | 3300025302 | Bacteria | 21310 |
| 321 | Ga0209051_1000098 | 3300025303 | Bacteria | 165284 |
| 322 | Ga0209257_1000097 | 3300025304 | Bacteria | 259243 |
| 323 | Ga0209257_1011227 | 3300025304 | Bacteria | 4348 |
| 324 | Ga0209257_1016786 | 3300025304 | Bacteria | 2935 |
| 325 | Ga0207655_1002824 | 3300025728 | Bacteria | 13460 |
| 326 | Ga0207692_10041895 | 3300025898 | Bacteria | 2270 |
| 327 | Ga0207642_10002638 | 3300025899 | Bacteria | 5590 |
| 328 | Ga0207642_10003692 | 3300025899 | Bacteria | 4863 |
| 329 | Ga0207710_10006209 | 3300025900 | Bacteria | 5114 |
| 330 | Ga0207680_10000184 | 3300025903 | Bacteria | 30323 |
| 331 | Ga0207699_10048033 | 3300025906 | Bacteria | 2505 |
| 332 | Ga0207643_10016782 | 3300025908 | Bacteria | 3996 |
| 333 | Ga0207705_10015863 | 3300025909 | Bacteria | 5409 |
| 334 | Ga0207684_10077919 | 3300025910 | Bacteria | 2819 |
| 335 | Ga0207707_10007366 | 3300025912 | Bacteria | 9582 |
| 336 | Ga0207707_10107716 | 3300025912 | Bacteria | 2436 |
| 337 | Ga0207695_10001004 | 3300025913 | Bacteria | 49973 |
| 338 | Ga0207695_10011204 | 3300025913 | Bacteria | 10877 |
| 339 | Ga0207695_10012700 | 3300025913 | Bacteria | 10085 |
| 340 | Ga0207695_10040095 | 3300025913 | Bacteria | 5027 |
| 341 | Ga0207695_10053375 | 3300025913 | Bacteria | 4228 |
| 342 | Ga0207695_10089618 | 3300025913 | Bacteria | 3093 |
| 343 | Ga0207671_10008252 | 3300025914 | Bacteria | 8862 |
| 344 | Ga0207671_10025688 | 3300025914 | Bacteria | 4421 |
| 345 | Ga0207671_10123375 | 3300025914 | Bacteria | 1982 |
| 346 | Ga0207671_10131739 | 3300025914 | Bacteria | 1919 |
| 347 | Ga0207693_10003805 | 3300025915 | Bacteria | 12846 |
| 348 | Ga0207693_10007691 | 3300025915 | Bacteria | 8849 |
| 349 | Ga0207663_10000216 | 3300025916 | Bacteria | 25624 |
| 350 | Ga0207660_10096256 | 3300025917 | Bacteria | 2204 |
| 351 | Ga0207660_10208313 | 3300025917 | Bacteria | 1530 |
| 352 | Ga0207657_10004518 | 3300025919 | Bacteria | 14697 |
| 353 | Ga0207657_10004885 | 3300025919 | Bacteria | 14103 |
| 354 | Ga0207657_10018798 | 3300025919 | Bacteria | 6582 |
| 355 | Ga0207657_10038927 | 3300025919 | Bacteria | 4228 |
| 356 | Ga0207649_10013185 | 3300025920 | Bacteria | 4610 |
| 357 | Ga0207649_10072957 | 3300025920 | Bacteria | 2197 |
| 358 | Ga0207652_10008588 | 3300025921 | Bacteria | 8220 |
| 359 | Ga0207652_10041247 | 3300025921 | Bacteria | 3923 |
| 360 | Ga0207652_10066752 | 3300025921 | Bacteria | 3118 |
| 361 | Ga0207646_10253015 | 3300025922 | Bacteria | 1592 |
| 362 | Ga0207681_10120915 | 3300025923 | Bacteria | 1920 |
| 363 | Ga0207694_10000075 | 3300025924 | Bacteria | 114693 |
| 364 | Ga0207694_10001533 | 3300025924 | Bacteria | 19662 |
| 365 | Ga0207650_10019053 | 3300025925 | Bacteria | 4823 |
| 366 | Ga0207650_10124002 | 3300025925 | Bacteria | 2014 |
| 367 | Ga0207687_10000171 | 3300025927 | Bacteria | 42958 |
| 368 | Ga0207687_10026081 | 3300025927 | Bacteria | 3912 |
| 369 | Ga0207687_10030876 | 3300025927 | Bacteria | 3617 |
| 370 | Ga0207700_10005562 | 3300025928 | Bacteria | 7558 |
| 371 | Ga0207700_10034914 | 3300025928 | Bacteria | 3615 |
| 372 | Ga0207664_10007467 | 3300025929 | Bacteria | 7583 |
| 373 | Ga0207664_10031707 | 3300025929 | Bacteria | 4046 |
| 374 | Ga0207644_10000563 | 3300025931 | Bacteria | 23815 |
| 375 | Ga0207644_10004179 | 3300025931 | Bacteria | 9367 |
| 376 | Ga0207690_10071636 | 3300025932 | Bacteria | 2391 |
| 377 | Ga0207690_10161369 | 3300025932 | Bacteria | 1671 |
| 378 | Ga0207686_10000953 | 3300025934 | Bacteria | 17273 |
| 379 | Ga0207686_10025755 | 3300025934 | Bacteria | 3426 |
| 380 | Ga0207686_10071207 | 3300025934 | Bacteria | 2237 |
| 381 | Ga0207709_10000130 | 3300025935 | Bacteria | 110843 |
| 382 | Ga0207709_10016469 | 3300025935 | Bacteria | 4109 |
| 383 | Ga0207670_10004704 | 3300025936 | Bacteria | 7402 |
| 384 | Ga0207665_10006712 | 3300025939 | Bacteria | 7632 |
| 385 | Ga0207665_10017352 | 3300025939 | Bacteria | 4730 |
| 386 | Ga0207711_10000157 | 3300025941 | Bacteria | 73266 |
| 387 | Ga0207711_10005820 | 3300025941 | Bacteria | 10412 |
| 388 | Ga0207711_10094372 | 3300025941 | Bacteria | 2636 |
| 389 | Ga0207711_10113955 | 3300025941 | Bacteria | 2407 |
| 390 | Ga0207711_10229229 | 3300025941 | Bacteria | 1701 |
| 391 | Ga0207689_10007339 | 3300025942 | Bacteria | 9669 |
| 392 | Ga0207689_10010020 | 3300025942 | Bacteria | 8170 |
| 393 | Ga0207689_10023166 | 3300025942 | Bacteria | 5214 |
| 394 | Ga0207689_10058811 | 3300025942 | Bacteria | 3162 |
| 395 | Ga0207689_10172411 | 3300025942 | Bacteria | 1784 |
| 396 | Ga0207661_10010229 | 3300025944 | Bacteria | 6746 |
| 397 | Ga0207679_10007163 | 3300025945 | Bacteria | 7063 |
| 398 | Ga0207679_10016667 | 3300025945 | Bacteria | 4881 |
| 399 | Ga0207679_10071153 | 3300025945 | Bacteria | 2623 |
| 400 | Ga0207679_10087190 | 3300025945 | Bacteria | 2403 |
| 401 | Ga0207667_10000110 | 3300025949 | Bacteria | 131872 |
| 402 | Ga0207667_10003783 | 3300025949 | Bacteria | 18635 |
| 403 | Ga0207667_10008363 | 3300025949 | Bacteria | 12299 |
| 404 | Ga0207667_10021206 | 3300025949 | Bacteria | 7202 |
| 405 | Ga0207667_10039822 | 3300025949 | Bacteria | 5005 |
| 406 | Ga0207667_10125460 | 3300025949 | Bacteria | 2644 |
| 407 | Ga0207667_10236654 | 3300025949 | Bacteria | 1869 |
| 408 | Ga0207651_10000171 | 3300025960 | Bacteria | 28182 |
| 409 | Ga0207640_10052490 | 3300025981 | Bacteria | 2656 |
| 410 | Ga0207640_10136890 | 3300025981 | Bacteria | 1779 |
| 411 | Ga0207658_10003562 | 3300025986 | Bacteria | 10992 |
| 412 | Ga0207677_10000221 | 3300026023 | Bacteria | 45379 |
| 413 | Ga0207677_10127095 | 3300026023 | Bacteria | 1928 |
| 414 | Ga0207677_10164708 | 3300026023 | Bacteria | 1727 |
| 415 | Ga0207677_10174283 | 3300026023 | Bacteria | 1686 |
| 416 | Ga0207703_10000374 | 3300026035 | Bacteria | 47821 |
| 417 | Ga0207703_10110630 | 3300026035 | Bacteria | 2344 |
| 418 | Ga0207639_10097541 | 3300026041 | Bacteria | 2367 |
| 419 | Ga0207708_10112888 | 3300026075 | Bacteria | 2111 |
| 420 | Ga0207702_10037982 | 3300026078 | Bacteria | 4033 |
| 421 | Ga0207702_10053897 | 3300026078 | Bacteria | 3406 |
| 422 | Ga0207702_10078997 | 3300026078 | Bacteria | 2850 |
| 423 | Ga0207702_10190867 | 3300026078 | Bacteria | 1893 |
| 424 | Ga0207641_10000603 | 3300026088 | Bacteria | 39496 |
| 425 | Ga0207641_10253651 | 3300026088 | Bacteria | 1644 |
| 426 | Ga0207648_10004108 | 3300026089 | Bacteria | 15067 |
| 427 | Ga0207648_10094592 | 3300026089 | Bacteria | 2613 |
| 428 | Ga0207676_10000054 | 3300026095 | Bacteria | 128222 |
| 429 | Ga0207676_10201243 | 3300026095 | Bacteria | 1760 |
| 430 | Ga0207674_10062673 | 3300026116 | Bacteria | 3755 |
| 431 | Ga0207675_100019706 | 3300026118 | Bacteria | 6296 |
| 432 | Ga0207683_10017484 | 3300026121 | Bacteria | 6112 |
| 433 | Ga0207698_10000842 | 3300026142 | Bacteria | 17781 |
| 434 | Ga0207698_10046078 | 3300026142 | Bacteria | 3290 |
| 435 | Ga0207698_10097486 | 3300026142 | Bacteria | 2427 |
| 436 | Ga0209281_1001845 | 3300027111 | Bacteria | 10316 |
| 437 | Ga0209281_1002589 | 3300027111 | Bacteria | 7004 |
| 438 | Ga0209371_1000050 | 3300027312 | Bacteria | 278645 |
| 439 | Ga0209371_1000112 | 3300027312 | Bacteria | 139930 |
| 440 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 441 | Ga0268266_10015295 | 3300028379 | Bacteria | 6586 |
| 442 | Ga0268265_10082243 | 3300028380 | Bacteria | 2546 |
| 443 | Ga0268264_10023638 | 3300028381 | Bacteria | 5013 |
| 444 | Ga0268264_10024820 | 3300028381 | Bacteria | 4897 |
| 445 | Ga0307515_10179545 | 3300028794 | Bacteria | 2073 |
| 446 | Ga0268256_1000017 | 3300030500 | Bacteria | 600718 |
| 447 | Ga0316177_1095886 | 3300030731 | Bacteria | 2086 |
| 448 | Ga0307408_100000596 | 3300031548 | Bacteria | 31031 |
| 449 | Ga0307408_100002140 | 3300031548 | Bacteria | 14157 |
| 450 | Ga0307408_100002964 | 3300031548 | Bacteria | 11761 |
| 451 | Ga0307408_100019423 | 3300031548 | Bacteria | 4576 |
| 452 | Ga0307408_100207792 | 3300031548 | Bacteria | 1589 |
| 453 | Ga0265314_10043808 | 3300031711 | Bacteria | 3177 |
| 454 | Ga0307405_10044240 | 3300031731 | Bacteria | 2722 |
| 455 | Ga0307416_100085851 | 3300032002 | Bacteria | 2680 |
| 456 | Ga0373934_0005744 | 3300035086 | Bacteria | 4596 |
| 457 | Ga0373923_0000532 | 3300035111 | Bacteria | 9268 |
| 458 | Ga0373945_0013225 | 3300035116 | Bacteria | 2752 |
| 459 | Ga0373953_0002606 | 3300035117 | Bacteria | 5457 |
| 460 | Ga0373954_0000547 | 3300035118 | Bacteria | 14096 |
| 461 | Ga0373956_0009377 | 3300035119 | Bacteria | 3981 |
| 462 | Ga0373957_0007770 | 3300035120 | Bacteria | 3444 |
| 463 | Ga0373955_0001069 | 3300035172 | Bacteria | 11676 |
| 464 | Ga0373935_0010552 | 3300035692 | Bacteria | 5542 |
| 465 | Ga0373927_0008057 | 3300035695 | Bacteria | 7115 |
| 466 | Ga0373933_0007254 | 3300035724 | Bacteria | 6043 |
| 467 | Ga0373947_0009692 | 3300035725 | Bacteria | 5526 |
| 468 | Ga0373937_0007581 | 3300036401 | Bacteria | 9398 |
| 469 | Ga0373937_0015001 | 3300036401 | Bacteria | 6845 |
| 470 | Ga0373937_0023239 | 3300036401 | Bacteria | 5581 |
| 471 | Ga0373937_0119091 | 3300036401 | Bacteria | 2460 |
| 472 | Ga0373925_0002796 | 3300037068 | Bacteria | 13782 |
| 473 | Ga0395899_0002523 | 3300037312 | Bacteria | 14829 |
| 474 | Ga0395899_0007801 | 3300037312 | Bacteria | 8254 |
| 475 | Ga0395899_0014681 | 3300037312 | Bacteria | 5976 |
| 476 | Ga0395899_0060856 | 3300037312 | Bacteria | 2781 |
| 477 | Ga0395899_0098549 | 3300037312 | Bacteria | 2112 |
| 478 | Ga0395900_0000328 | 3300037418 | Bacteria | 70344 |
| 479 | Ga0395900_0023374 | 3300037418 | Bacteria | 6327 |
| 480 | Ga0395900_0028057 | 3300037418 | Bacteria | 5763 |
| 481 | Ga0395900_0083321 | 3300037418 | Bacteria | 3285 |
| 482 | Ga0395900_0155990 | 3300037418 | Bacteria | 2331 |
| 483 | Ga0395900_0191458 | 3300037418 | Bacteria | 2074 |
| 484 | Ga0395898_0084295 | 3300037466 | Bacteria | 3063 |
| 485 | Ga0395898_0089206 | 3300037466 | Bacteria | 2967 |
| 486 | Ga0395898_0130172 | 3300037466 | Bacteria | 2410 |
| 487 | Ga0395898_0272404 | 3300037466 | Bacteria | 1614 |
| 488 | Ga0395905_0296349 | 3300037471 | Bacteria | 1504 |
| 489 | Ga0395901_0000845 | 3300038443 | Bacteria | 33703 |
| 490 | Ga0395901_0015989 | 3300038443 | Bacteria | 7646 |
| 491 | Ga0395901_0050369 | 3300038443 | Bacteria | 4327 |
| 492 | Ga0395901_0104897 | 3300038443 | Bacteria | 2966 |
| 493 | Ga0395901_0124417 | 3300038443 | Bacteria | 2709 |
| 494 | Ga0395901_0208657 | 3300038443 | Bacteria | 2045 |
| 495 | Ga0436361_0021035 | 3300039447 | Bacteria | 49397 |
| 496 | Ga0436361_0090832 | 3300039447 | Bacteria | 34932 |
| 497 | Ga0436361_0364057 | 3300039447 | Bacteria | 16829 |
| 498 | Ga0436361_0460205 | 3300039447 | Bacteria | 10460 |
| 499 | Ga0436361_0567363 | 3300039447 | Bacteria | 15669 |
| 500 | Ga0436361_0909074 | 3300039447 | Bacteria | 10354 |
| 501 | Ga0439448_0000563 | 3300042005 | Bacteria | 8718 |
| 502 | Ga0439455_0004991 | 3300042012 | Bacteria | 2669 |
| 503 | Ga0450911_003531 | 3300042115 | Bacteria | 2739 |
| 504 | Ga0450904_000301 | 3300042139 | Bacteria | 10508 |
| 505 | Ga0439458_0009941 | 3300042157 | Bacteria | 2118 |
| 506 | Ga0466969_0057358 | 3300044656 | Bacteria | 1898 |
| 507 | Ga0466972_0003639 | 3300044658 | Bacteria | 7659 |
| 508 | Ga0466965_0004912 | 3300044683 | Bacteria | 5976 |
| 509 | Ga0466965_0011537 | 3300044683 | Bacteria | 4145 |
| 510 | Ga0466965_0033382 | 3300044683 | Bacteria | 2515 |
| 511 | Ga0466966_0009892 | 3300044684 | Bacteria | 6321 |
| 512 | Ga0466961_0111519 | 3300044693 | Bacteria | 1720 |
| 513 | Ga0466963_0061851 | 3300044694 | Bacteria | 2504 |
| 514 | Ga0466964_0000209 | 3300044706 | Bacteria | 16542 |
| 515 | Ga0453684_0000450 | 3300044712 | Bacteria | 166110 |
| 516 | Ga0466957_0000872 | 3300044842 | Bacteria | 15496 |
| 517 | Ga0466957_0058721 | 3300044842 | Bacteria | 2357 |
| 518 | Ga0466959_0019111 | 3300045049 | Bacteria | 5036 |
| 519 | Ga0466958_0139404 | 3300045836 | Bacteria | 1526 |
| 520 | Ga0466967_0002431 | 3300045976 | Bacteria | 11585 |
| 521 | Ga0466967_0005571 | 3300045976 | Bacteria | 8750 |
| 522 | Ga0495617_000014 | 3300046452 | Bacteria | 286979 |
| 523 | Ga0495617_000023 | 3300046452 | Bacteria | 183865 |
| 524 | Ga0495617_001293 | 3300046452 | Bacteria | 11150 |
| 525 | Ga0495617_001845 | 3300046452 | Bacteria | 8996 |
| 526 | Ga0495617_003871 | 3300046452 | Bacteria | 5513 |
| 527 | Ga0495627_000016 | 3300046453 | Bacteria | 318947 |
| 528 | Ga0495627_000061 | 3300046453 | Bacteria | 139366 |
| 529 | Ga0495627_003768 | 3300046453 | Bacteria | 6550 |
| 530 | Ga0495627_009314 | 3300046453 | Bacteria | 3620 |
| 531 | Ga0495592_0005016 | 3300046454 | Bacteria | 9737 |
| 532 | Ga0495603_0014275 | 3300046455 | Bacteria | 4806 |
| 533 | Ga0495603_0044048 | 3300046455 | Bacteria | 2663 |
| 534 | Ga0495603_0051411 | 3300046455 | Bacteria | 2449 |
| 535 | Ga0495590_0000019 | 3300046457 | Bacteria | 213272 |
| 536 | Ga0495590_0000043 | 3300046457 | Bacteria | 120012 |
| 537 | Ga0495590_0000670 | 3300046457 | Bacteria | 15837 |
| 538 | Ga0495590_0007766 | 3300046457 | Bacteria | 4117 |
| 539 | Ga0495591_000187 | 3300046458 | Bacteria | 64594 |
| 540 | Ga0495591_002995 | 3300046458 | Bacteria | 9012 |
| 541 | Ga0495629_0014982 | 3300046459 | Bacteria | 5570 |
| 542 | Ga0495629_0084443 | 3300046459 | Bacteria | 2215 |
| 543 | Ga0495629_0127831 | 3300046459 | Bacteria | 1770 |
| 544 | Ga0495638_0000115 | 3300046460 | Bacteria | 129129 |
| 545 | Ga0495638_0006133 | 3300046460 | Bacteria | 8795 |
| 546 | Ga0495638_0038746 | 3300046460 | Bacteria | 3027 |
| 547 | Ga0495638_0049300 | 3300046460 | Bacteria | 2633 |
| 548 | Ga0495653_0000014 | 3300046463 | Bacteria | 215253 |
| 549 | Ga0495650_0000142 | 3300046471 | Bacteria | 168326 |
| 550 | Ga0495650_0000178 | 3300046471 | Bacteria | 138967 |
| 551 | Ga0495650_0000181 | 3300046471 | Bacteria | 137791 |
| 552 | Ga0495650_0000193 | 3300046471 | Bacteria | 131834 |
| 553 | Ga0495650_0000395 | 3300046471 | Bacteria | 73239 |
| 554 | Ga0495650_0000906 | 3300046471 | Bacteria | 34943 |
| 555 | Ga0495650_0001736 | 3300046471 | Bacteria | 19905 |
| 556 | Ga0495580_0004401 | 3300046472 | Bacteria | 11833 |
| 557 | Ga0495580_0121227 | 3300046472 | Bacteria | 1815 |
| 558 | Ga0495582_0000674 | 3300046473 | Bacteria | 18786 |
| 559 | Ga0495582_0006796 | 3300046473 | Bacteria | 6366 |
| 560 | Ga0495605_0000010 | 3300046474 | Bacteria | 319487 |
| 561 | Ga0495605_0000110 | 3300046474 | Bacteria | 104425 |
| 562 | Ga0495605_0000118 | 3300046474 | Bacteria | 102724 |
| 563 | Ga0495605_0000910 | 3300046474 | Bacteria | 20346 |
| 564 | Ga0495605_0011533 | 3300046474 | Bacteria | 4922 |
| 565 | Ga0495605_0012465 | 3300046474 | Bacteria | 4716 |
| 566 | Ga0495605_0041968 | 3300046474 | Bacteria | 2276 |
| 567 | Ga0495584_0000065 | 3300046491 | Bacteria | 75724 |
| 568 | Ga0495584_0000138 | 3300046491 | Bacteria | 50345 |
| 569 | Ga0495584_0000163 | 3300046491 | Bacteria | 46893 |
| 570 | Ga0495584_0000227 | 3300046491 | Bacteria | 40714 |
| 571 | Ga0495584_0001545 | 3300046491 | Bacteria | 13678 |
| 572 | Ga0495584_0011764 | 3300046491 | Bacteria | 4474 |
| 573 | Ga0495584_0024547 | 3300046491 | Bacteria | 3058 |
| 574 | Ga0495584_0058886 | 3300046491 | Bacteria | 1932 |
| 575 | Ga0495584_0098848 | 3300046491 | Bacteria | 1474 |
| 576 | Ga0495585_0000123 | 3300046492 | Bacteria | 84445 |
| 577 | Ga0495585_0000160 | 3300046492 | Bacteria | 72066 |
| 578 | Ga0495585_0001260 | 3300046492 | Bacteria | 20351 |
| 579 | Ga0495585_0005863 | 3300046492 | Bacteria | 7701 |
| 580 | Ga0495585_0008881 | 3300046492 | Bacteria | 6063 |
| 581 | Ga0495585_0011341 | 3300046492 | Bacteria | 5276 |
| 582 | Ga0495585_0026582 | 3300046492 | Bacteria | 3306 |
| 583 | Ga0495585_0026583 | 3300046492 | Bacteria | 3306 |
| 584 | Ga0495585_0035257 | 3300046492 | Bacteria | 2828 |
| 585 | Ga0495585_0036136 | 3300046492 | Bacteria | 2789 |
| 586 | Ga0495585_0041758 | 3300046492 | Bacteria | 2571 |
| 587 | Ga0495585_0067130 | 3300046492 | Bacteria | 1962 |
| 588 | Ga0495594_0008244 | 3300046499 | Bacteria | 5363 |
| 589 | Ga0495594_0009516 | 3300046499 | Bacteria | 5022 |
| 590 | Ga0495594_0019046 | 3300046499 | Bacteria | 3644 |
| 591 | Ga0495594_0103272 | 3300046499 | Bacteria | 1604 |
| 592 | Ga0495596_0000291 | 3300046500 | Bacteria | 33324 |
| 593 | Ga0495596_0000310 | 3300046500 | Bacteria | 32062 |
| 594 | Ga0495596_0000418 | 3300046500 | Bacteria | 27142 |
| 595 | Ga0495596_0003475 | 3300046500 | Bacteria | 7954 |
| 596 | Ga0495596_0006215 | 3300046500 | Bacteria | 5527 |
| 597 | Ga0495596_0025659 | 3300046500 | Bacteria | 2381 |
| 598 | Ga0495607_0000719 | 3300046501 | Bacteria | 31915 |
| 599 | Ga0495607_0000942 | 3300046501 | Bacteria | 26982 |
| 600 | Ga0495607_0004531 | 3300046501 | Bacteria | 10200 |
| 601 | Ga0495607_0008029 | 3300046501 | Bacteria | 7247 |
| 602 | Ga0495607_0008548 | 3300046501 | Bacteria | 6994 |
| 603 | Ga0495607_0014412 | 3300046501 | Bacteria | 5145 |
| 604 | Ga0495607_0021186 | 3300046501 | Bacteria | 4092 |
| 605 | Ga0495607_0044005 | 3300046501 | Bacteria | 2635 |
| 606 | Ga0495607_0057905 | 3300046501 | Bacteria | 2218 |
| 607 | Ga0495583_0000057 | 3300046506 | Bacteria | 200688 |
| 608 | Ga0495583_0000065 | 3300046506 | Bacteria | 192022 |
| 609 | Ga0495583_0000102 | 3300046506 | Bacteria | 143105 |
| 610 | Ga0495583_0000126 | 3300046506 | Bacteria | 128985 |
| 611 | Ga0495583_0001000 | 3300046506 | Bacteria | 32368 |
| 612 | Ga0495583_0001247 | 3300046506 | Bacteria | 26987 |
| 613 | Ga0495583_0004613 | 3300046506 | Bacteria | 9744 |
| 614 | Ga0495583_0009887 | 3300046506 | Bacteria | 5642 |
| 615 | Ga0495583_0020208 | 3300046506 | Bacteria | 3456 |
| 616 | Ga0495583_0057338 | 3300046506 | Bacteria | 1752 |
| 617 | Ga0495606_0000004 | 3300046507 | Bacteria | 406209 |
| 618 | Ga0495606_0000085 | 3300046507 | Bacteria | 158006 |
| 619 | Ga0495606_0000165 | 3300046507 | Bacteria | 116607 |
| 620 | Ga0495606_0000250 | 3300046507 | Bacteria | 94676 |
| 621 | Ga0495606_0000391 | 3300046507 | Bacteria | 74077 |
| 622 | Ga0495606_0000498 | 3300046507 | Bacteria | 64198 |
| 623 | Ga0495606_0000583 | 3300046507 | Bacteria | 57929 |
| 624 | Ga0495606_0002188 | 3300046507 | Bacteria | 23450 |
| 625 | Ga0495606_0003463 | 3300046507 | Bacteria | 16736 |
| 626 | Ga0495606_0015293 | 3300046507 | Bacteria | 5921 |
| 627 | Ga0495606_0023412 | 3300046507 | Bacteria | 4475 |
| 628 | Ga0495606_0040461 | 3300046507 | Bacteria | 3133 |
| 629 | Ga0495606_0044897 | 3300046507 | Bacteria | 2935 |
| 630 | Ga0495606_0073319 | 3300046507 | Bacteria | 2148 |
| 631 | Ga0495610_0000007 | 3300046512 | Bacteria | 820919 |
| 632 | Ga0495610_0004332 | 3300046512 | Bacteria | 10538 |
| 633 | Ga0495610_0007942 | 3300046512 | Bacteria | 6964 |
| 634 | Ga0495610_0013977 | 3300046512 | Bacteria | 4743 |
| 635 | Ga0495610_0017941 | 3300046512 | Bacteria | 4015 |
| 636 | Ga0495616_0000083 | 3300046513 | Bacteria | 80447 |
| 637 | Ga0495616_0000230 | 3300046513 | Bacteria | 45632 |
| 638 | Ga0495616_0001478 | 3300046513 | Bacteria | 16302 |
| 639 | Ga0495616_0010455 | 3300046513 | Bacteria | 5369 |
| 640 | Ga0495616_0014112 | 3300046513 | Bacteria | 4484 |
| 641 | Ga0495616_0019879 | 3300046513 | Bacteria | 3660 |
| 642 | Ga0495616_0026763 | 3300046513 | Bacteria | 3065 |
| 643 | Ga0495616_0027550 | 3300046513 | Bacteria | 3014 |
| 644 | Ga0495616_0050733 | 3300046513 | Bacteria | 2073 |
| 645 | Ga0495616_0069719 | 3300046513 | Bacteria | 1703 |
| 646 | Ga0495620_0017597 | 3300046515 | Bacteria | 3556 |
| 647 | Ga0495631_0000385 | 3300046518 | Bacteria | 30461 |
| 648 | Ga0495631_0000495 | 3300046518 | Bacteria | 26243 |
| 649 | Ga0495631_0013856 | 3300046518 | Bacteria | 3902 |
| 650 | Ga0495631_0024948 | 3300046518 | Bacteria | 2756 |
| 651 | Ga0495631_0038783 | 3300046518 | Bacteria | 2116 |
| 652 | Ga0495631_0055662 | 3300046518 | Bacteria | 1723 |
| 653 | Ga0495632_0000041 | 3300046519 | Bacteria | 145509 |
| 654 | Ga0495632_0000336 | 3300046519 | Bacteria | 44682 |
| 655 | Ga0495632_0001288 | 3300046519 | Bacteria | 21238 |
| 656 | Ga0495632_0005108 | 3300046519 | Bacteria | 8771 |
| 657 | Ga0495632_0021092 | 3300046519 | Bacteria | 3515 |
| 658 | Ga0495632_0037065 | 3300046519 | Bacteria | 2477 |
| 659 | Ga0495637_0000119 | 3300046520 | Bacteria | 58062 |
| 660 | Ga0495637_0000602 | 3300046520 | Bacteria | 25654 |
| 661 | Ga0495643_0000130 | 3300046522 | Bacteria | 121749 |
| 662 | Ga0495643_0000418 | 3300046522 | Bacteria | 55699 |
| 663 | Ga0495643_0000524 | 3300046522 | Bacteria | 47789 |
| 664 | Ga0495643_0000686 | 3300046522 | Bacteria | 39264 |
| 665 | Ga0495643_0002486 | 3300046522 | Bacteria | 14507 |
| 666 | Ga0495643_0013493 | 3300046522 | Bacteria | 4885 |
| 667 | Ga0495643_0022698 | 3300046522 | Bacteria | 3575 |
| 668 | Ga0495643_0063506 | 3300046522 | Bacteria | 1953 |
| 669 | Ga0495644_0002910 | 3300046523 | Bacteria | 6794 |
| 670 | Ga0495644_0005632 | 3300046523 | Bacteria | 4884 |
| 671 | Ga0495648_0000053 | 3300046524 | Bacteria | 159860 |
| 672 | Ga0495648_0000104 | 3300046524 | Bacteria | 105792 |
| 673 | Ga0495648_0000293 | 3300046524 | Bacteria | 56206 |
| 674 | Ga0495648_0000799 | 3300046524 | Bacteria | 33303 |
| 675 | Ga0495648_0001424 | 3300046524 | Bacteria | 23410 |
| 676 | Ga0495648_0004497 | 3300046524 | Bacteria | 11903 |
| 677 | Ga0495648_0006997 | 3300046524 | Bacteria | 9091 |
| 678 | Ga0495648_0018900 | 3300046524 | Bacteria | 4862 |
| 679 | Ga0495648_0029978 | 3300046524 | Bacteria | 3603 |
| 680 | Ga0495648_0044969 | 3300046524 | Bacteria | 2751 |
| 681 | Ga0495648_0062838 | 3300046524 | Bacteria | 2197 |
| 682 | Ga0495663_0012433 | 3300046525 | Bacteria | 2371 |
| 683 | Ga0495666_0000214 | 3300046526 | Bacteria | 24663 |
| 684 | Ga0495642_0000017 | 3300046528 | Bacteria | 111313 |
| 685 | Ga0495642_0000284 | 3300046528 | Bacteria | 28539 |
| 686 | Ga0495642_0002324 | 3300046528 | Bacteria | 7757 |
| 687 | Ga0495642_0005212 | 3300046528 | Bacteria | 5000 |
| 688 | Ga0495642_0006008 | 3300046528 | Bacteria | 4662 |
| 689 | Ga0495642_0014091 | 3300046528 | Bacteria | 3098 |
| 690 | Ga0495642_0022781 | 3300046528 | Bacteria | 2469 |
| 691 | Ga0495642_0022825 | 3300046528 | Bacteria | 2467 |
| 692 | Ga0495652_0022488 | 3300046529 | Bacteria | 5594 |
| 693 | Ga0495654_0000034 | 3300046530 | Bacteria | 196519 |
| 694 | Ga0495654_0004252 | 3300046530 | Bacteria | 8559 |
| 695 | Ga0495654_0018842 | 3300046530 | Bacteria | 3612 |
| 696 | Ga0495665_0000193 | 3300046531 | Bacteria | 31390 |
| 697 | Ga0495665_0003674 | 3300046531 | Bacteria | 8320 |
| 698 | Ga0495665_0004601 | 3300046531 | Bacteria | 7443 |
| 699 | Ga0495640_0028810 | 3300046533 | Bacteria | 3994 |
| 700 | Ga0495587_0007851 | 3300046536 | Bacteria | 6892 |
| 701 | Ga0495587_0053485 | 3300046536 | Bacteria | 2380 |
| 702 | Ga0495609_0000005 | 3300046538 | Bacteria | 439165 |
| 703 | Ga0495609_0000164 | 3300046538 | Bacteria | 69576 |
| 704 | Ga0495609_0000597 | 3300046538 | Bacteria | 28277 |
| 705 | Ga0495609_0000772 | 3300046538 | Bacteria | 24017 |
| 706 | Ga0495609_0001430 | 3300046538 | Bacteria | 15899 |
| 707 | Ga0495609_0001879 | 3300046538 | Bacteria | 13416 |
| 708 | Ga0495621_0002820 | 3300046539 | Bacteria | 4724 |
| 709 | Ga0495597_0000046 | 3300046542 | Bacteria | 104533 |
| 710 | Ga0495597_0000100 | 3300046542 | Bacteria | 77861 |
| 711 | Ga0495597_0000198 | 3300046542 | Bacteria | 55237 |
| 712 | Ga0495597_0000607 | 3300046542 | Bacteria | 29390 |
| 713 | Ga0495597_0006177 | 3300046542 | Bacteria | 6223 |
| 714 | Ga0495597_0007247 | 3300046542 | Bacteria | 5651 |
| 715 | Ga0495597_0007612 | 3300046542 | Bacteria | 5481 |
| 716 | Ga0495597_0025278 | 3300046542 | Bacteria | 2735 |
| 717 | Ga0495597_0028765 | 3300046542 | Bacteria | 2541 |
| 718 | Ga0495622_0000011 | 3300046557 | Bacteria | 201507 |
| 719 | Ga0495622_0000230 | 3300046557 | Bacteria | 44043 |
| 720 | Ga0495622_0000812 | 3300046557 | Bacteria | 17283 |
| 721 | Ga0495633_0000065 | 3300046558 | Bacteria | 139197 |
| 722 | Ga0495633_0000146 | 3300046558 | Bacteria | 94353 |
| 723 | Ga0495633_0000749 | 3300046558 | Bacteria | 29299 |
| 724 | Ga0495633_0001918 | 3300046558 | Bacteria | 15136 |
| 725 | Ga0495633_0003442 | 3300046558 | Bacteria | 10532 |
| 726 | Ga0495633_0005322 | 3300046558 | Bacteria | 7898 |
| 727 | Ga0495633_0009409 | 3300046558 | Bacteria | 5401 |
| 728 | Ga0495633_0010746 | 3300046558 | Bacteria | 4979 |
| 729 | Ga0495633_0011531 | 3300046558 | Bacteria | 4759 |
| 730 | Ga0495633_0012010 | 3300046558 | Bacteria | 4629 |
| 731 | Ga0495633_0013361 | 3300046558 | Bacteria | 4330 |
| 732 | Ga0495633_0051475 | 3300046558 | Bacteria | 1940 |
| 733 | Ga0495633_0055925 | 3300046558 | Bacteria | 1854 |
| 734 | Ga0495633_0059448 | 3300046558 | Bacteria | 1792 |
| 735 | Ga0495656_0014769 | 3300046615 | Bacteria | 2935 |
| 736 | Ga0495656_0027896 | 3300046615 | Bacteria | 2259 |
| 737 | Ga0495668_0000030 | 3300046616 | Bacteria | 262663 |
| 738 | Ga0495668_0000117 | 3300046616 | Bacteria | 122379 |
| 739 | Ga0495668_0000251 | 3300046616 | Bacteria | 76262 |
| 740 | Ga0495668_0000580 | 3300046616 | Bacteria | 44573 |
| 741 | Ga0495668_0001350 | 3300046616 | Bacteria | 24083 |
| 742 | Ga0495668_0001882 | 3300046616 | Bacteria | 18805 |
| 743 | Ga0495668_0004307 | 3300046616 | Bacteria | 10187 |
| 744 | Ga0495668_0004658 | 3300046616 | Bacteria | 9626 |
| 745 | Ga0495668_0024198 | 3300046616 | Bacteria | 3455 |
| 746 | Ga0495668_0025254 | 3300046616 | Bacteria | 3376 |
| 747 | Ga0495668_0045766 | 3300046616 | Bacteria | 2432 |
| 748 | Ga0495634_0070417 | 3300046642 | Bacteria | 2305 |
| 749 | Ga0495611_0000148 | 3300046648 | Bacteria | 49996 |
| 750 | Ga0495611_0009125 | 3300046648 | Bacteria | 4192 |
| 751 | Ga0495611_0009943 | 3300046648 | Bacteria | 4026 |
| 752 | Ga0495611_0018564 | 3300046648 | Bacteria | 2983 |
| 753 | Ga0495611_0037155 | 3300046648 | Bacteria | 2163 |
| 754 | Ga0495611_0089929 | 3300046648 | Bacteria | 1418 |
| 755 | Ga0495625_0000609 | 3300046660 | Bacteria | 51864 |
| 756 | Ga0495625_0000620 | 3300046660 | Bacteria | 51572 |
| 757 | Ga0495625_0001604 | 3300046660 | Bacteria | 26732 |
| 758 | Ga0495625_0003530 | 3300046660 | Bacteria | 15480 |
| 759 | Ga0495625_0009776 | 3300046660 | Bacteria | 7979 |
| 760 | Ga0495625_0027511 | 3300046660 | Bacteria | 4280 |
| 761 | Ga0495625_0036919 | 3300046660 | Bacteria | 3587 |
| 762 | Ga0495625_0040051 | 3300046660 | Bacteria | 3420 |
| 763 | Ga0495625_0068746 | 3300046660 | Bacteria | 2489 |
| 764 | Ga0495625_0088531 | 3300046660 | Bacteria | 2144 |
| 765 | Ga0495625_0138536 | 3300046660 | Bacteria | 1643 |
| 766 | Ga0495635_0001435 | 3300046663 | Bacteria | 15925 |
| 767 | Ga0495635_0030249 | 3300046663 | Bacteria | 3763 |
| 768 | Ga0495659_0000148 | 3300046664 | Bacteria | 30682 |
| 769 | Ga0495661_0000102 | 3300046665 | Bacteria | 104814 |
| 770 | Ga0495661_0000420 | 3300046665 | Bacteria | 44761 |
| 771 | Ga0495661_0000945 | 3300046665 | Bacteria | 26346 |
| 772 | Ga0495661_0001953 | 3300046665 | Bacteria | 16355 |
| 773 | Ga0495661_0006769 | 3300046665 | Bacteria | 8037 |
| 774 | Ga0495661_0008255 | 3300046665 | Bacteria | 7213 |
| 775 | Ga0495661_0008319 | 3300046665 | Bacteria | 7184 |
| 776 | Ga0495661_0031328 | 3300046665 | Bacteria | 3377 |
| 777 | Ga0495661_0031692 | 3300046665 | Bacteria | 3350 |
| 778 | Ga0495661_0038584 | 3300046665 | Bacteria | 2973 |
| 779 | Ga0495661_0040168 | 3300046665 | Bacteria | 2903 |
| 780 | Ga0495661_0043635 | 3300046665 | Bacteria | 2755 |
| 781 | Ga0495661_0050759 | 3300046665 | Bacteria | 2509 |
| 782 | Ga0495661_0051975 | 3300046665 | Bacteria | 2471 |
| 783 | Ga0495588_0000126 | 3300046674 | Bacteria | 128815 |
| 784 | Ga0495588_0017756 | 3300046674 | Bacteria | 3460 |
| 785 | Ga0495588_0036860 | 3300046674 | Bacteria | 2482 |
| 786 | Ga0495588_0064731 | 3300046674 | Bacteria | 1897 |
| 787 | Ga0495599_0069567 | 3300046678 | Bacteria | 2196 |
| 788 | Ga0495623_0006370 | 3300046679 | Bacteria | 7674 |
| 789 | Ga0495623_0102960 | 3300046679 | Bacteria | 1737 |
| 790 | Ga0495646_0007932 | 3300046680 | Bacteria | 6746 |
| 791 | Ga0495646_0042703 | 3300046680 | Bacteria | 2781 |
| 792 | Ga0495646_0104635 | 3300046680 | Bacteria | 1618 |
| 793 | Ga0495658_0000474 | 3300046683 | Bacteria | 22232 |
| 794 | Ga0495669_0000077 | 3300046684 | Bacteria | 65061 |
| 795 | Ga0495669_0033624 | 3300046684 | Bacteria | 2257 |
| 796 | Ga0495613_0001075 | 3300046689 | Bacteria | 20823 |
| 797 | Ga0495613_0041274 | 3300046689 | Bacteria | 3417 |
| 798 | Ga0495624_0025453 | 3300046690 | Bacteria | 3884 |
| 799 | Ga0495624_0036405 | 3300046690 | Bacteria | 3173 |
| 800 | Ga0495624_0053816 | 3300046690 | Bacteria | 2540 |
| 801 | Ga0495670_0000595 | 3300046691 | Bacteria | 17242 |
| 802 | Ga0495670_0001516 | 3300046691 | Bacteria | 11339 |
| 803 | Ga0495670_0004163 | 3300046691 | Bacteria | 7086 |
| 804 | Ga0495670_0014679 | 3300046691 | Bacteria | 3852 |
| 805 | Ga0495670_0024272 | 3300046691 | Bacteria | 2996 |
| 806 | Ga0495670_0065348 | 3300046691 | Bacteria | 1833 |
| 807 | Ga0495671_0000009 | 3300046692 | Bacteria | 369875 |
| 808 | Ga0495671_0000053 | 3300046692 | Bacteria | 129715 |
| 809 | Ga0495671_0000068 | 3300046692 | Bacteria | 99674 |
| 810 | Ga0495671_0012746 | 3300046692 | Bacteria | 4581 |
| 811 | Ga0495671_0014856 | 3300046692 | Bacteria | 4184 |
| 812 | Ga0495671_0014925 | 3300046692 | Bacteria | 4174 |
| 813 | Ga0495671_0029004 | 3300046692 | Bacteria | 2846 |
| 814 | Ga0495649_0000074 | 3300046694 | Bacteria | 85874 |
| 815 | Ga0495649_0015929 | 3300046694 | Bacteria | 4268 |
| 816 | Ga0495649_0026452 | 3300046694 | Bacteria | 3225 |
| 817 | Ga0495649_0048404 | 3300046694 | Bacteria | 2310 |
| 818 | Ga0495589_0000024 | 3300046794 | Bacteria | 191021 |
| 819 | Ga0495589_0000310 | 3300046794 | Bacteria | 38833 |
| 820 | Ga0495589_0001875 | 3300046794 | Bacteria | 11906 |
| 821 | Ga0495589_0010935 | 3300046794 | Bacteria | 4714 |
| 822 | Ga0495589_0013516 | 3300046794 | Bacteria | 4211 |
| 823 | Ga0495589_0039348 | 3300046794 | Bacteria | 2363 |
| 824 | Ga0495589_0041691 | 3300046794 | Bacteria | 2289 |
| 825 | Ga0495589_0046719 | 3300046794 | Bacteria | 2147 |
| 826 | Ga0495600_0006539 | 3300046809 | Bacteria | 7092 |
| 827 | Ga0495600_0011440 | 3300046809 | Bacteria | 5529 |
| 828 | Ga0495660_0000068 | 3300046810 | Bacteria | 119060 |
| 829 | Ga0495660_0000954 | 3300046810 | Bacteria | 21117 |
| 830 | Ga0495660_0001370 | 3300046810 | Bacteria | 16778 |
| 831 | Ga0495660_0011116 | 3300046810 | Bacteria | 5227 |
| 832 | Ga0495660_0015125 | 3300046810 | Bacteria | 4461 |
| 833 | Ga0495660_0025952 | 3300046810 | Bacteria | 3324 |
| 834 | Ga0495660_0065946 | 3300046810 | Bacteria | 1931 |
| 835 | Ga0495581_0000277 | 3300047315 | Bacteria | 24872 |
| 836 | Ga0495604_0030356 | 3300047317 | Bacteria | 4293 |
| 837 | Ga0495604_0030863 | 3300047317 | Bacteria | 4252 |
| 838 | Ga0495604_0055300 | 3300047317 | Bacteria | 3059 |
| 839 | Ga0495604_0137459 | 3300047317 | Bacteria | 1749 |
| 840 | Ga0495636_0000073 | 3300047318 | Bacteria | 42681 |
| 841 | Ga0495674_0002989 | 3300047319 | Bacteria | 16467 |
| 842 | Ga0495672_0000099 | 3300047320 | Bacteria | 140634 |
| 843 | Ga0495672_0000371 | 3300047320 | Bacteria | 56105 |
| 844 | Ga0495672_0000897 | 3300047320 | Bacteria | 31222 |
| 845 | Ga0495672_0001193 | 3300047320 | Bacteria | 26272 |
| 846 | Ga0495672_0001368 | 3300047320 | Bacteria | 24153 |
| 847 | Ga0495672_0002171 | 3300047320 | Bacteria | 18282 |
| 848 | Ga0495672_0016791 | 3300047320 | Bacteria | 4913 |
| 849 | Ga0495672_0021977 | 3300047320 | Bacteria | 4154 |
| 850 | Ga0495676_0000028 | 3300047321 | Bacteria | 140879 |
| 851 | Ga0495676_0037428 | 3300047321 | Bacteria | 4038 |
| 852 | Ga0495680_0054896 | 3300047322 | Bacteria | 3091 |
| 853 | Ga0495683_0000067 | 3300047323 | Bacteria | 111573 |
| 854 | Ga0495683_0000610 | 3300047323 | Bacteria | 26758 |
| 855 | Ga0495683_0037579 | 3300047323 | Bacteria | 2454 |
| 856 | Ga0495687_000008 | 3300047443 | Bacteria | 546666 |
| 857 | Ga0495687_000052 | 3300047443 | Bacteria | 199186 |
| 858 | Ga0495687_000085 | 3300047443 | Bacteria | 145052 |
| 859 | Ga0495687_000318 | 3300047443 | Bacteria | 62538 |
| 860 | Ga0495687_000840 | 3300047443 | Bacteria | 32718 |
| 861 | Ga0495687_000868 | 3300047443 | Bacteria | 32039 |
| 862 | Ga0495687_001500 | 3300047443 | Bacteria | 21263 |
| 863 | Ga0495687_007672 | 3300047443 | Bacteria | 6308 |
| 864 | Ga0495687_010494 | 3300047443 | Bacteria | 5076 |
| 865 | Ga0495675_0018080 | 3300047444 | Bacteria | 4469 |
| 866 | Ga0495675_0019623 | 3300047444 | Bacteria | 4294 |
| 867 | Ga0495677_0000007 | 3300047445 | Bacteria | 181193 |
| 868 | Ga0495677_0000063 | 3300047445 | Bacteria | 58478 |
| 869 | Ga0495677_0000088 | 3300047445 | Bacteria | 47898 |
| 870 | Ga0495677_0000857 | 3300047445 | Bacteria | 12318 |
| 871 | Ga0495677_0003195 | 3300047445 | Bacteria | 6389 |
| 872 | Ga0495677_0007176 | 3300047445 | Bacteria | 4170 |
| 873 | Ga0495677_0007489 | 3300047445 | Bacteria | 4076 |
| 874 | Ga0495677_0009025 | 3300047445 | Bacteria | 3688 |
| 875 | Ga0495677_0018797 | 3300047445 | Bacteria | 2505 |
| 876 | Ga0495677_0028677 | 3300047445 | Bacteria | 2022 |
| 877 | Ga0495679_003368 | 3300047446 | Bacteria | 7706 |
| 878 | Ga0495679_007583 | 3300047446 | Bacteria | 4510 |
| 879 | Ga0495685_000024 | 3300047447 | Bacteria | 64011 |
| 880 | Ga0495685_001575 | 3300047447 | Bacteria | 7020 |
| 881 | Ga0495673_0000031 | 3300047469 | Bacteria | 447868 |
| 882 | Ga0495673_0000032 | 3300047469 | Bacteria | 375856 |
| 883 | Ga0495673_0000105 | 3300047469 | Bacteria | 170731 |
| 884 | Ga0495673_0008057 | 3300047469 | Bacteria | 5970 |
| 885 | Ga0495673_0014428 | 3300047469 | Bacteria | 4109 |
| 886 | Ga0495681_0001051 | 3300047470 | Bacteria | 21061 |
| 887 | Ga0495681_0001118 | 3300047470 | Bacteria | 20339 |
| 888 | Ga0495681_0008667 | 3300047470 | Bacteria | 6349 |
| 889 | Ga0495681_0010293 | 3300047470 | Bacteria | 5666 |
| 890 | Ga0495681_0012679 | 3300047470 | Bacteria | 4939 |
| 891 | Ga0495681_0016124 | 3300047470 | Bacteria | 4204 |
| 892 | Ga0495681_0048028 | 3300047470 | Bacteria | 2026 |
| 893 | Ga0495684_0001806 | 3300047471 | Bacteria | 17187 |
| 894 | Ga0495684_0014218 | 3300047471 | Bacteria | 6124 |
| 895 | Ga0495686_0000156 | 3300047472 | Bacteria | 131196 |
| 896 | Ga0495686_0000203 | 3300047472 | Bacteria | 110612 |
| 897 | Ga0495686_0000370 | 3300047472 | Bacteria | 73065 |
| 898 | Ga0495686_0001097 | 3300047472 | Bacteria | 32205 |
| 899 | Ga0495686_0020766 | 3300047472 | Bacteria | 4377 |
| 900 | Ga0495686_0052400 | 3300047472 | Bacteria | 2558 |
| 901 | Ga0495686_0079968 | 3300047472 | Bacteria | 1999 |
| 902 | Ga0495593_0004097 | 3300047673 | Bacteria | 8669 |
| 903 | Ga0495602_0001014 | 3300048088 | Bacteria | 27301 |
| 904 | Ga0495602_0056638 | 3300048088 | Bacteria | 3445 |
| 905 | Ga0495602_0072223 | 3300048088 | Bacteria | 2944 |
| 906 | Ga0495614_0000617 | 3300048089 | Bacteria | 14901 |
| 907 | Ga0495626_0000054 | 3300048091 | Bacteria | 154997 |
| 908 | Ga0495626_0000149 | 3300048091 | Bacteria | 86385 |
| 909 | Ga0495626_0002253 | 3300048091 | Bacteria | 13814 |
| 910 | Ga0495626_0003234 | 3300048091 | Bacteria | 10549 |
| 911 | Ga0495626_0004043 | 3300048091 | Bacteria | 9144 |
| 912 | Ga0495626_0006416 | 3300048091 | Bacteria | 6698 |
| 913 | Ga0495626_0012181 | 3300048091 | Bacteria | 4520 |
| 914 | Ga0495626_0014075 | 3300048091 | Bacteria | 4137 |
| 915 | Ga0495626_0019470 | 3300048091 | Bacteria | 3396 |
| 916 | Ga0495626_0038532 | 3300048091 | Bacteria | 2265 |
| 917 | Ga0496100_0110788 | 3300048903 | Bacteria | 1906 |
| 918 | Ga0496101_0163270 | 3300048904 | Bacteria | 1709 |
| 919 | Ga0496102_0000215 | 3300048905 | Bacteria | 76113 |
| 920 | Ga0496102_0000369 | 3300048905 | Bacteria | 54037 |
| 921 | Ga0496102_0008630 | 3300048905 | Bacteria | 8745 |
| 922 | Ga0496102_0136492 | 3300048905 | Bacteria | 2298 |
| 923 | Ga0496103_0002327 | 3300048906 | Bacteria | 12011 |
| 924 | Ga0496103_0003122 | 3300048906 | Bacteria | 10187 |
| 925 | Ga0496104_0003193 | 3300048907 | Bacteria | 14093 |
| 926 | Ga0496105_0003540 | 3300048908 | Bacteria | 11579 |
| 927 | Ga0496106_0033314 | 3300048909 | Bacteria | 3844 |
| 928 | Ga0496107_0104568 | 3300048910 | Bacteria | 2078 |
| 929 | Ga0496107_0164972 | 3300048910 | Bacteria | 1642 |
| 930 | Ga0496109_0004034 | 3300048912 | Bacteria | 12262 |
| 931 | Ga0496109_0011003 | 3300048912 | Bacteria | 7754 |
| 932 | Ga0496110_0000817 | 3300048913 | Bacteria | 21822 |
| 933 | Ga0496110_0026144 | 3300048913 | Bacteria | 4992 |
| 934 | Ga0496112_0000733 | 3300048915 | Bacteria | 22846 |
| 935 | Ga0496112_0040689 | 3300048915 | Bacteria | 4545 |
| 936 | Ga0496112_0211211 | 3300048915 | Bacteria | 1898 |
| 937 | Ga0496113_0001668 | 3300048916 | Bacteria | 12557 |
| 938 | Ga0496114_0090073 | 3300048917 | Bacteria | 2604 |
| 939 | Ga0496115_0005708 | 3300048918 | Bacteria | 9058 |
| 940 | Ga0496115_0017770 | 3300048918 | Bacteria | 5445 |
| 941 | Ga0496116_0018963 | 3300048919 | Bacteria | 5282 |
| 942 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 943 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 944 | Ga0496121_0000978 | 3300048924 | Bacteria | 51196 |
| 945 | Ga0496121_0001372 | 3300048924 | Bacteria | 41423 |
| 946 | Ga0496121_0004394 | 3300048924 | Bacteria | 19023 |
| 947 | Ga0496121_0010245 | 3300048924 | Bacteria | 10606 |
| 948 | Ga0496122_0000864 | 3300048925 | Bacteria | 57030 |
| 949 | Ga0496122_0003892 | 3300048925 | Bacteria | 19132 |
| 950 | Ga0496122_0003927 | 3300048925 | Bacteria | 19016 |
| 951 | Ga0496122_0016640 | 3300048925 | Bacteria | 6936 |
| 952 | Ga0496122_0031684 | 3300048925 | Bacteria | 4392 |
| 953 | Ga0496122_0051883 | 3300048925 | Bacteria | 3111 |
| 954 | Ga0496122_0054437 | 3300048925 | Bacteria | 3005 |
| 955 | Ga0496123_0000099 | 3300048926 | Bacteria | 170756 |
| 956 | Ga0496123_0004147 | 3300048926 | Bacteria | 15495 |
| 957 | Ga0496123_0006218 | 3300048926 | Bacteria | 11651 |
| 958 | Ga0496123_0029518 | 3300048926 | Bacteria | 4034 |
| 959 | Ga0496123_0049983 | 3300048926 | Bacteria | 2798 |
| 960 | Ga0496124_0010847 | 3300048927 | Bacteria | 9175 |
| 961 | Ga0496124_0020767 | 3300048927 | Bacteria | 6061 |
| 962 | Ga0496124_0049620 | 3300048927 | Bacteria | 3579 |
| 963 | Ga0496124_0052264 | 3300048927 | Bacteria | 3472 |
| 964 | Ga0496124_0113113 | 3300048927 | Bacteria | 2182 |
| 965 | Ga0496125_0001800 | 3300048928 | Bacteria | 29607 |
| 966 | Ga0496125_0003100 | 3300048928 | Bacteria | 20723 |
| 967 | Ga0496125_0080848 | 3300048928 | Bacteria | 2485 |
| 968 | Ga0496126_0003835 | 3300048929 | Bacteria | 18607 |
| 969 | Ga0496126_0014871 | 3300048929 | Bacteria | 7850 |
| 970 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 971 | Ga0495678_000053 | 3300049459 | Bacteria | 154277 |
| 972 | Ga0495678_000225 | 3300049459 | Bacteria | 65737 |
| 973 | Ga0495678_000548 | 3300049459 | Bacteria | 36209 |
| 974 | Ga0495678_001622 | 3300049459 | Bacteria | 17158 |
| 975 | Ga0495678_001628 | 3300049459 | Bacteria | 17091 |
| 976 | Ga0495678_003050 | 3300049459 | Bacteria | 10644 |
| 977 | Ga0495678_003199 | 3300049459 | Bacteria | 10310 |
| 978 | Ga0495678_003824 | 3300049459 | Bacteria | 9065 |
| 979 | Ga0495678_013455 | 3300049459 | Bacteria | 3840 |
| 980 | Ga0495682_0000053 | 3300049460 | Bacteria | 107313 |
| 981 | Ga0495682_0000551 | 3300049460 | Bacteria | 25767 |
| 982 | Ga0501034_0002533 | 3300049571 | Bacteria | 21868 |
| 983 | Ga0501034_0049055 | 3300049571 | Bacteria | 4261 |
| 984 | Ga0501238_002604 | 3300049671 | Bacteria | 2167 |
| 985 | Ga0501249_001280 | 3300049679 | Bacteria | 5254 |
| 986 | Ga0501083_0091363 | 3300049744 | Bacteria | 2010 |
| 987 | Ga0501269_000123 | 3300049766 | Bacteria | 24539 |
| 988 | Ga0501279_002262 | 3300049775 | Bacteria | 2534 |
| 989 | Ga0501279_004296 | 3300049775 | Bacteria | 1869 |
| 990 | Ga0501035_0000855 | 3300049822 | Bacteria | 32447 |
| 991 | nmdc:mga03683_33884_c1 | 3300050489 | Bacteria | 2064 |
| 992 | nmdc:mga07m45_229_c1 | 3300050496 | Bacteria | 22348 |
| 993 | nmdc:mga0rr50_141003_c1 | 3300050513 | Bacteria | 1939 |
| 994 | Ga0495601_0005627 | 3300053077 | Bacteria | 7306 |
| 995 | Ga0500610_0016124 | 3300053079 | Bacteria | 3553 |
| 996 | Ga0500610_0081758 | 3300053079 | Bacteria | 1683 |
| 997 | Ga0495619_0002446 | 3300053085 | Bacteria | 12164 |
| 998 | Ga0500607_000211 | 3300053121 | Bacteria | 53358 |
| 999 | Ga0500608_066594 | 3300053122 | Bacteria | 1717 |
| 1000 | Ga0500618_000904 | 3300053125 | Bacteria | 15526 |
| 1001 | Ga0500619_000240 | 3300053154 | Bacteria | 12081 |
| 1002 | Ga0500627_0042780 | 3300053158 | Bacteria | 1951 |
| 1003 | Ga0501082_0142047 | 3300060353 | Bacteria | 2084 |
| 1004 | 2511250841 | 2511231003 | Bacteria | 5606035 |
| 1005 | 2511385058 | 2511231026 | Bacteria | 5225445 |
| 1006 | 2521560576 | 2521172590 | Bacteria | 5047645 |
| 1007 | 2550694227 | 2548876994 | Bacteria | 4904866 |
| 1008 | 2553005691 | 2551306416 | Bacteria | 6152985 |
| 1009 | 2601531923 | 2600255256 | Bacteria | 5597742 |
| 1010 | 2601537294 | 2600255257 | Bacteria | 5597196 |
| 1011 | 2601669226 | 2600255292 | Bacteria | 6300551 |
| 1012 | 2601755641 | 2600255310 | Bacteria | 5600903 |
| 1013 | 2601761009 | 2600255311 | Bacteria | 5598766 |
| 1014 | 2603638969 | 2602042046 | Bacteria | 5483348 |
| 1015 | 2643789695 | 2643221554 | Bacteria | 6603920 |
| 1016 | 2643796815 | 2643221556 | Bacteria | 7251154 |
| 1017 | 2644028500 | 2643221603 | Bacteria | 6147767 |
| 1018 | 2644214574 | 2643221638 | Bacteria | 6579467 |
| 1019 | 2644249943 | 2643221645 | Bacteria | 7207331 |
| 1020 | 2644326196 | 2643221658 | Bacteria | 6064537 |
| 1021 | 2644358621 | 2643221664 | Bacteria | 7272945 |
| 1022 | 2644470080 | 2643221684 | Bacteria | 7145183 |
| 1023 | 2738739538 | 2738541280 | Bacteria | 6630198 |
| 1024 | 2738827582 | 2738541297 | Bacteria | 6549566 |
| 1025 | 2738846115 | 2738541300 | Bacteria | 6675882 |
| 1026 | 2738880487 | 2738541307 | Bacteria | 8606193 |
| 1027 | 2739151378 | 2738541357 | Bacteria | 6549408 |
| 1028 | 2739193298 | 2738543003 | Bacteria | 6549560 |
| 1029 | 2739275732 | 2738543018 | Bacteria | 6718814 |
| 1030 | 2739319774 | 2738543026 | Bacteria | 6549408 |
| 1031 | 2739338015 | 2738543029 | Bacteria | 6549249 |
| 1032 | 2739344776 | 2738543030 | Bacteria | 6719714 |
| 1033 | 2765571822 | 2765235838 | Bacteria | 5445269 |
| 1034 | 2791925492 | 2791354903 | Bacteria | 4937680 |
| 1035 | 2808982172 | 2808606386 | Bacteria | 4471946 |
| 1036 | 2809130028 | 2808606415 | Bacteria | 4576710 |
| 1037 | 2809147143 | 2808606418 | Bacteria | 6724496 |
| 1038 | 2809148917 | 2808606419 | Bacteria | 4576925 |
| 1039 | 2813730030 | 2811995292 | Bacteria | 5303342 |
| 1040 | 2814697522 | 2814123068 | Bacteria | 5687681 |
| 1041 | 2819543288 | 2818991436 | Bacteria | 5376622 |
| 1042 | 2819595618 | 2818991445 | Bacteria | 4955017 |
| 1043 | 2819617268 | 2818991449 | Bacteria | 5518009 |
| 1044 | 2821136040 | 2821131069 | Bacteria | 6108407 |
| 1045 | 2834643455 | 2834641062 | Bacteria | 5559922 |
| 1046 | 2839098457 | 2839094727 | Bacteria | 5534556 |
| 1047 | 2842713000 | 2842711865 | Bacteria | 7155354 |
| 1048 | 2852619052 | 2852618963 | Bacteria | 4577824 |
| 1049 | 2857549358 | 2857547612 | Bacteria | 6179999 |
| 1050 | 2857555558 | 2857553236 | Bacteria | 6166726 |
| 1051 | 2857562963 | 2857558681 | Bacteria | 6617694 |
| 1052 | 2857569205 | 2857564685 | Bacteria | 6290584 |
| 1053 | 2882461700 | 2882456835 | Bacteria | 6863978 |
| 1054 | 2883092901 | 2883087390 | Bacteria | 9532701 |
| 1055 | 2884816178 | 2884811622 | Bacteria | 5552861 |
| 1056 | 2884839379 | 2884836552 | Bacteria | 5219991 |
| 1057 | 2884856811 | 2884852848 | Bacteria | 5221161 |
| 1058 | 2885085967 | 2885080285 | Bacteria | 6355622 |
| 1059 | 2885201268 | 2885198086 | Bacteria | 7212419 |
| 1060 | 2885214940 | 2885211737 | Bacteria | 7212420 |
| 1061 | 2896158157 | 2896154374 | Bacteria | 5221518 |
| 1062 | 2900640992 | 2900634093 | Bacteria | 10263517 |
| 1063 | 2904429378 | 2904424332 | Bacteria | 7633521 |
| 1064 | 2904442907 | 2904439833 | Bacteria | 5931679 |
| 1065 | 2904534896 | 2904530477 | Bacteria | 5876334 |
| 1066 | 2904588764 | 2904584206 | Bacteria | 6028872 |
| 1067 | 2904594162 | 2904589729 | Bacteria | 6113573 |
| 1068 | 2904605000 | 2904601388 | Bacteria | 5884906 |
| 1069 | 2919048594 | 2919046199 | Bacteria | 5567169 |
| 1070 | 2919083234 | 2919079590 | Bacteria | 5946433 |
| 1071 | 2919479383 | 2919476304 | Bacteria | 5888696 |
| 1072 | 2923514369 | 2923510766 | Bacteria | 5926163 |
| 1073 | 2928133094 | 2928130867 | Bacteria | 5467269 |
| 1074 | 2932414480 | 2932410948 | Bacteria | 6312192 |
| 1075 | 2932420999 | 2932416698 | Bacteria | 6315112 |
| 1076 | 2974322312 | 2974320154 | Bacteria | 4571377 |
| 1077 | 642615354 | 642555113 | Bacteria | 8214658 |
| 1078 | 8003405200 | 8003400568 | Bacteria | 5535898 |
| 1079 | 8047676916 | 8047673197 | Bacteria | 7395230 |
| 1080 | 8054007568 | 8054002106 | Bacteria | 7987183 |
| 1081 | Ga0501080_0024566 | |||
| 1082 | RicEn_C2987 | |||
| 1083 | JGI25155J39150_1000140 | |||
| 1084 | JGI25155J39150_1000562 | |||
| 1085 | JGI25156J39149_1000120 | |||
| 1086 | JGI25156J39149_1000370 | |||
| 1087 | JGI25154J39366_1000372 | |||
| 1088 | JGI25154J39366_1001022 | |||
| 1089 | JGI25154J39366_1001082 | |||
| 1090 | JGI25158J39367_1001790 | |||
| 1091 | JGI25157J39369_1000294 | |||
| 1092 | JGI25152J39213_1000487 | |||
| 1093 | JGI25150J39212_1000644 | |||
| 1094 | JGI25150J39212_1001243 | |||
| 1095 | JGI25159J45721_1000989 | |||
| 1096 | JGI25159J45721_1003515 | |||
| 1097 | JGI25151J46595_10000568 | |||
| 1098 | rootL2_10156471 | |||
| 1099 | JGI25161J50226_1001985 | |||
| 1100 | Ga0055538_1000024 | |||
| 1101 | Ga0055539_1000031 | |||
| 1102 | Ga0055533_1000041 | |||
| 1103 | Ga0055532_1000074 | |||
| 1104 | Ga0055525_1000006 | |||
| 1105 | Ga0055525_1000049 | |||
| 1106 | Ga0055529_1000537 | |||
| 1107 | Ga0055526_1000035 | |||
| 1108 | Ga0055526_1000047 | |||
| 1109 | Ga0055526_1000729 | |||
| 1110 | Ga0055526_1006694 | |||
| 1111 | Ga0055537_1000078 | |||
| 1112 | Ga0055537_1007096 | |||
| 1113 | Ga0055524_1000053 | |||
| 1114 | Ga0055524_1003340 | |||
| 1115 | Ga0055524_1005701 | |||
| 1116 | Ga0055536_1000458 | |||
| 1117 | Ga0055536_1003852 | |||
| 1118 | Ga0055534_1000070 | |||
| 1119 | Ga0055534_1000105 | |||
| 1120 | Ga0055534_1003475 | |||
| 1121 | Ga0055528_1000224 | |||
| 1122 | Ga0055528_1012389 | |||
| 1123 | Ga0055530_10006363 | |||
| 1124 | Ga0055530_10007199 | |||
| 1125 | Ga0055530_10009880 | |||
| 1126 | Ga0055540_1000344 | |||
| 1127 | Ga0055531_10002512 | |||
| 1128 | Ga0055541_1000022 | |||
| 1129 | Ga0055543_1000889 | |||
| 1130 | Ga0055543_1010749 | |||
| 1131 | Ga0065165_1000287 | |||
| 1132 | Ga0065165_1000619 | |||
| 1133 | Ga0065165_1005746 | |||
| 1134 | Ga0070683_100010175 | |||
| 1135 | Ga0070690_100003772 | |||
| 1136 | Ga0070670_100005802 | |||
| 1137 | Ga0068869_100004897 | |||
| 1138 | Ga0068869_100005563 | |||
| 1139 | Ga0070666_10000254 | |||
| 1140 | Ga0070666_10100848 | |||
| 1141 | Ga0070680_100029945 | |||
| 1142 | Ga0070680_100110627 | |||
| 1143 | Ga0070680_100187264 | |||
| 1144 | Ga0068868_100000728 | |||
| 1145 | Ga0070660_100039822 | |||
| 1146 | Ga0070660_100131788 | |||
| 1147 | Ga0070689_100000500 | |||
| 1148 | Ga0070691_10089219 | |||
| 1149 | Ga0070661_100003517 | |||
| 1150 | Ga0070661_100004042 | |||
| 1151 | Ga0070668_100020780 | |||
| 1152 | Ga0070675_100066488 | |||
| 1153 | Ga0070675_100095596 | |||
| 1154 | Ga0070675_100139538 | |||
| 1155 | Ga0070675_100176484 | |||
| 1156 | Ga0070671_100002017 | |||
| 1157 | Ga0070673_100000114 | |||
| 1158 | Ga0070688_100000295 | |||
| 1159 | Ga0070659_100036274 | |||
| 1160 | Ga0070659_100172664 | |||
| 1161 | Ga0070667_100002145 | |||
| 1162 | Ga0070667_100150634 | |||
| 1163 | Ga0070709_10039550 | |||
| 1164 | Ga0070709_10055229 | |||
| 1165 | Ga0070714_100023965 | |||
| 1166 | Ga0070713_100000481 | |||
| 1167 | Ga0070713_100039530 | |||
| 1168 | Ga0070710_10041613 | |||
| 1169 | Ga0070701_10018158 | |||
| 1170 | Ga0070711_100000229 | |||
| 1171 | Ga0070705_100005810 | |||
| 1172 | Ga0070705_100028065 | |||
| 1173 | Ga0070700_100157561 | |||
| 1174 | Ga0070694_100014383 | |||
| 1175 | Ga0070663_100049429 | |||
| 1176 | Ga0070678_100009831 | |||
| 1177 | Ga0070662_100108400 | |||
| 1178 | Ga0070662_100185638 | |||
| 1179 | Ga0070681_10004639 | |||
| 1180 | Ga0068867_100086370 | |||
| 1181 | Ga0068867_100155712 | |||
| 1182 | Ga0070685_10000366 | |||
| 1183 | Ga0070706_100047663 | |||
| 1184 | Ga0070706_100247815 | |||
| 1185 | Ga0070698_100117086 | |||
| 1186 | Ga0070699_100024527 | |||
| 1187 | Ga0070679_100012768 | |||
| 1188 | Ga0070679_100030440 | |||
| 1189 | Ga0070697_100029882 | |||
| 1190 | Ga0068853_100087329 | |||
| 1191 | Ga0070672_100069229 | |||
| 1192 | Ga0070686_100054755 | |||
| 1193 | Ga0070695_100182951 | |||
| 1194 | Ga0070696_100021608 | |||
| 1195 | Ga0070693_100003420 | |||
| 1196 | Ga0070693_100014679 | |||
| 1197 | Ga0070693_100112889 | |||
| 1198 | Ga0070693_100126254 | |||
| 1199 | Ga0070665_100019741 | |||
| 1200 | Ga0070704_100003098 | |||
| 1201 | Ga0068855_100007024 | |||
| 1202 | Ga0068855_100009503 | |||
| 1203 | Ga0068855_100012256 | |||
| 1204 | Ga0068855_100038688 | |||
| 1205 | Ga0068855_100038842 | |||
| 1206 | Ga0068855_100082135 | |||
| 1207 | Ga0068855_100101430 | |||
| 1208 | Ga0068855_100138486 | |||
| 1209 | Ga0070664_100014240 | |||
| 1210 | Ga0070664_100021645 | |||
| 1211 | Ga0070664_100038530 | |||
| 1212 | Ga0070664_100051325 | |||
| 1213 | Ga0070664_100097425 | |||
| 1214 | Ga0070664_100106004 | |||
| 1215 | Ga0070664_100109195 | |||
| 1216 | Ga0068857_100002557 | |||
| 1217 | Ga0068857_100048800 | |||
| 1218 | Ga0068857_100060990 | |||
| 1219 | Ga0068856_100028149 | |||
| 1220 | Ga0068856_100029489 | |||
| 1221 | Ga0068856_100034020 | |||
| 1222 | Ga0068856_100292934 | |||
| 1223 | Ga0068852_100001512 | |||
| 1224 | Ga0068852_100022972 | |||
| 1225 | Ga0068852_100027407 | |||
| 1226 | Ga0068852_100079085 | |||
| 1227 | Ga0068859_100000495 | |||
| 1228 | Ga0068859_100051657 | |||
| 1229 | Ga0068859_100298336 | |||
| 1230 | Ga0068864_100000382 | |||
| 1231 | Ga0068864_100222740 | |||
| 1232 | Ga0068866_10002285 | |||
| 1233 | Ga0068866_10066970 | |||
| 1234 | Ga0068861_100032382 | |||
| 1235 | Ga0068861_100170603 | |||
| 1236 | Ga0068870_10005048 | |||
| 1237 | Ga0068863_100001883 | |||
| 1238 | Ga0068863_100043513 | |||
| 1239 | Ga0068863_100057576 | |||
| 1240 | Ga0068858_100001712 | |||
| 1241 | Ga0068858_100013087 | |||
| 1242 | Ga0068858_100103414 | |||
| 1243 | Ga0068860_100014249 | |||
| 1244 | Ga0081539_10007797 | |||
| 1245 | Ga0070716_100009960 | |||
| 1246 | Ga0070716_100028505 | |||
| 1247 | Ga0070712_100001035 | |||
| 1248 | Ga0070712_100118334 | |||
| 1249 | Ga0075362_10012450 | |||
| 1250 | Ga0075367_10008779 | |||
| 1251 | Ga0075366_10021485 | |||
| 1252 | Ga0097621_100003309 | |||
| 1253 | Ga0097621_100011313 | |||
| 1254 | Ga0097621_100020255 | |||
| 1255 | Ga0075370_10033041 | |||
| 1256 | Ga0068871_100011216 | |||
| 1257 | Ga0068871_100023303 | |||
| 1258 | Ga0068871_100195351 | |||
| 1259 | Ga0097620_100000495 | |||
| 1260 | Ga0097620_100051656 | |||
| 1261 | Ga0097620_100200818 | |||
| 1262 | Ga0097620_100298340 | |||
| 1263 | Ga0079104_1017630 | |||
| 1264 | Ga0099826_10000006 | |||
| 1265 | Ga0105244_10002483 | |||
| 1266 | Ga0105244_10030761 | |||
| 1267 | Ga0105240_10000718 | |||
| 1268 | Ga0105240_10002320 | |||
| 1269 | Ga0105240_10007182 | |||
| 1270 | Ga0105240_10016166 | |||
| 1271 | Ga0105240_10017750 | |||
| 1272 | Ga0105240_10200004 | |||
| 1273 | Ga0105245_10002729 | |||
| 1274 | Ga0105245_10007375 | |||
| 1275 | Ga0105245_10025836 | |||
| 1276 | Ga0105247_10011876 | |||
| 1277 | Ga0114129_10109069 | |||
| 1278 | Ga0105243_10001371 | |||
| 1279 | Ga0105243_10116549 | |||
| 1280 | Ga0105241_10022386 | |||
| 1281 | Ga0105241_10141001 | |||
| 1282 | Ga0105242_10024897 | |||
| 1283 | Ga0105242_10088012 | |||
| 1284 | Ga0105248_10001597 | |||
| 1285 | Ga0105248_10007128 | |||
| 1286 | Ga0105248_10034146 | |||
| 1287 | Ga0105237_10006851 | |||
| 1288 | Ga0105237_10017698 | |||
| 1289 | Ga0105237_10149946 | |||
| 1290 | Ga0105238_10000107 | |||
| 1291 | Ga0105238_10005597 | |||
| 1292 | Ga0105238_10079034 | |||
| 1293 | Ga0105238_10174280 | |||
| 1294 | Ga0105238_10212471 | |||
| 1295 | Ga0105238_10437437 | |||
| 1296 | Ga0105249_10299660 | |||
| 1297 | Ga0105239_10000289 | |||
| 1298 | Ga0105239_10011318 | |||
| 1299 | Ga0105239_10154792 | |||
| 1300 | Ga0105246_10028790 | |||
| 1301 | Ga0157371_10041027 | |||
| 1302 | Ga0157370_10021505 | |||
| 1303 | Ga0157370_10034978 | |||
| 1304 | Ga0157369_10063621 | |||
| 1305 | Ga0157369_10076251 | |||
| 1306 | Ga0157374_10004556 | |||
| 1307 | Ga0157374_10012509 | |||
| 1308 | Ga0157374_10013360 | |||
| 1309 | Ga0157374_10267092 | |||
| 1310 | Ga0157378_10007955 | |||
| 1311 | Ga0157378_10019633 | |||
| 1312 | Ga0163162_10005095 | |||
| 1313 | Ga0163162_10024879 | |||
| 1314 | Ga0157372_10005037 | |||
| 1315 | Ga0157372_10310657 | |||
| 1316 | Ga0157375_10001898 | |||
| 1317 | Ga0157375_10049090 | |||
| 1318 | Ga0163163_10000829 | |||
| 1319 | Ga0182008_10000145 | |||
| 1320 | Ga0157379_10001663 | |||
| 1321 | Ga0157379_10204340 | |||
| 1322 | Ga0157376_10001490 | |||
| 1323 | Ga0157376_10007856 | |||
| 1324 | Ga0157376_10024072 | |||
| 1325 | Ga0182006_1000004 | |||
| 1326 | Ga0182006_1000019 | |||
| 1327 | Ga0182006_1029360 | |||
| 1328 | Ga0182007_10000028 | |||
| 1329 | Ga0182007_10005363 | |||
| 1330 | Ga0182005_1000003 | |||
| 1331 | Ga0182005_1000011 | |||
| 1332 | Ga0182005_1000252 | |||
| 1333 | Ga0163161_10005476 | |||
| 1334 | Ga0163161_10018863 | |||
| 1335 | Ga0213872_10000075 | |||
| 1336 | Ga0213872_10000179 | |||
| 1337 | Ga0213872_10001290 | |||
| 1338 | Ga0213872_10001872 | |||
| 1339 | Ga0213872_10003652 | |||
| 1340 | Ga0209435_100055 | |||
| 1341 | Ga0209435_100229 | |||
| 1342 | Ga0209436_100124 | |||
| 1343 | Ga0209784_100018 | |||
| 1344 | Ga0209566_100016 | |||
| 1345 | Ga0209674_100030 | |||
| 1346 | Ga0209147_100097 | |||
| 1347 | Ga0209563_100022 | |||
| 1348 | Ga0209563_100034 | |||
| 1349 | Ga0209437_100234 | |||
| 1350 | Ga0209258_100192 | |||
| 1351 | Ga0207425_1000013 | |||
| 1352 | Ga0207425_1000141 | |||
| 1353 | Ga0207425_1000349 | |||
| 1354 | Ga0209646_1000103 | |||
| 1355 | Ga0209646_1000219 | |||
| 1356 | Ga0209646_1000346 | |||
| 1357 | Ga0209026_1000134 | |||
| 1358 | Ga0209026_1003583 | |||
| 1359 | Ga0209677_100019 | |||
| 1360 | Ga0209677_103351 | |||
| 1361 | Ga0209148_1000554 | |||
| 1362 | Ga0209759_1000091 | |||
| 1363 | Ga0209759_1000094 | |||
| 1364 | Ga0209759_1000767 | |||
| 1365 | Ga0209129_1000106 | |||
| 1366 | Ga0209129_1000956 | |||
| 1367 | Ga0209129_1009845 | |||
| 1368 | Ga0209565_1000035 | |||
| 1369 | Ga0209565_1001523 | |||
| 1370 | Ga0209565_1002212 | |||
| 1371 | Ga0209565_1002406 | |||
| 1372 | Ga0209565_1006605 | |||
| 1373 | Ga0209455_1000033 | |||
| 1374 | Ga0209455_1005803 | |||
| 1375 | Ga0209673_1000006 | |||
| 1376 | Ga0209130_1000086 | |||
| 1377 | Ga0209130_1000322 | |||
| 1378 | Ga0209675_1000005 | |||
| 1379 | Ga0209675_1006765 | |||
| 1380 | Ga0209676_1000098 | |||
| 1381 | Ga0209676_1000300 | |||
| 1382 | Ga0209025_1000174 | |||
| 1383 | Ga0209025_1003824 | |||
| 1384 | Ga0209564_1000028 | |||
| 1385 | Ga0209564_1000032 | |||
| 1386 | Ga0209564_1000083 | |||
| 1387 | Ga0209564_1000202 | |||
| 1388 | Ga0209564_1009714 | |||
| 1389 | Ga0209758_1000031 | |||
| 1390 | Ga0209758_1000583 | |||
| 1391 | Ga0209050_1000078 | |||
| 1392 | Ga0209050_1000226 | |||
| 1393 | Ga0209050_1002985 | |||
| 1394 | Ga0209050_1004270 | |||
| 1395 | Ga0209256_1000035 | |||
| 1396 | Ga0209256_1000322 | |||
| 1397 | Ga0209256_1000508 | |||
| 1398 | Ga0209256_1002611 | |||
| 1399 | Ga0209256_1004993 | |||
| 1400 | Ga0207426_1001307 | |||
| 1401 | Ga0209051_1000098 | |||
| 1402 | Ga0209257_1000097 | |||
| 1403 | Ga0209257_1011227 | |||
| 1404 | Ga0209257_1016786 | |||
| 1405 | Ga0207655_1002824 | |||
| 1406 | Ga0207692_10041895 | |||
| 1407 | Ga0207642_10002638 | |||
| 1408 | Ga0207642_10003692 | |||
| 1409 | Ga0207710_10006209 | |||
| 1410 | Ga0207680_10000184 | |||
| 1411 | Ga0207699_10048033 | |||
| 1412 | Ga0207643_10016782 | |||
| 1413 | Ga0207705_10015863 | |||
| 1414 | Ga0207684_10077919 | |||
| 1415 | Ga0207707_10007366 | |||
| 1416 | Ga0207707_10107716 | |||
| 1417 | Ga0207695_10001004 | |||
| 1418 | Ga0207695_10011204 | |||
| 1419 | Ga0207695_10012700 | |||
| 1420 | Ga0207695_10040095 | |||
| 1421 | Ga0207695_10053375 | |||
| 1422 | Ga0207695_10089618 | |||
| 1423 | Ga0207671_10008252 | |||
| 1424 | Ga0207671_10025688 | |||
| 1425 | Ga0207671_10123375 | |||
| 1426 | Ga0207671_10131739 | |||
| 1427 | Ga0207693_10003805 | |||
| 1428 | Ga0207693_10007691 | |||
| 1429 | Ga0207663_10000216 | |||
| 1430 | Ga0207660_10096256 | |||
| 1431 | Ga0207660_10208313 | |||
| 1432 | Ga0207657_10004518 | |||
| 1433 | Ga0207657_10004885 | |||
| 1434 | Ga0207657_10018798 | |||
| 1435 | Ga0207657_10038927 | |||
| 1436 | Ga0207649_10013185 | |||
| 1437 | Ga0207649_10072957 | |||
| 1438 | Ga0207652_10008588 | |||
| 1439 | Ga0207652_10041247 | |||
| 1440 | Ga0207652_10066752 | |||
| 1441 | Ga0207646_10253015 | |||
| 1442 | Ga0207681_10120915 | |||
| 1443 | Ga0207694_10000075 | |||
| 1444 | Ga0207694_10001533 | |||
| 1445 | Ga0207650_10019053 | |||
| 1446 | Ga0207650_10124002 | |||
| 1447 | Ga0207687_10000171 | |||
| 1448 | Ga0207687_10026081 | |||
| 1449 | Ga0207687_10030876 | |||
| 1450 | Ga0207700_10005562 | |||
| 1451 | Ga0207700_10034914 | |||
| 1452 | Ga0207664_10007467 | |||
| 1453 | Ga0207664_10031707 | |||
| 1454 | Ga0207644_10000563 | |||
| 1455 | Ga0207644_10004179 | |||
| 1456 | Ga0207690_10071636 | |||
| 1457 | Ga0207690_10161369 | |||
| 1458 | Ga0207686_10000953 | |||
| 1459 | Ga0207686_10025755 | |||
| 1460 | Ga0207686_10071207 | |||
| 1461 | Ga0207709_10000130 | |||
| 1462 | Ga0207709_10016469 | |||
| 1463 | Ga0207670_10004704 | |||
| 1464 | Ga0207665_10006712 | |||
| 1465 | Ga0207665_10017352 | |||
| 1466 | Ga0207711_10000157 | |||
| 1467 | Ga0207711_10005820 | |||
| 1468 | Ga0207711_10094372 | |||
| 1469 | Ga0207711_10113955 | |||
| 1470 | Ga0207711_10229229 | |||
| 1471 | Ga0207689_10007339 | |||
| 1472 | Ga0207689_10010020 | |||
| 1473 | Ga0207689_10023166 | |||
| 1474 | Ga0207689_10058811 | |||
| 1475 | Ga0207689_10172411 | |||
| 1476 | Ga0207661_10010229 | |||
| 1477 | Ga0207679_10007163 | |||
| 1478 | Ga0207679_10016667 | |||
| 1479 | Ga0207679_10071153 | |||
| 1480 | Ga0207679_10087190 | |||
| 1481 | Ga0207667_10000110 | |||
| 1482 | Ga0207667_10003783 | |||
| 1483 | Ga0207667_10008363 | |||
| 1484 | Ga0207667_10021206 | |||
| 1485 | Ga0207667_10039822 | |||
| 1486 | Ga0207667_10125460 | |||
| 1487 | Ga0207667_10236654 | |||
| 1488 | Ga0207651_10000171 | |||
| 1489 | Ga0207640_10052490 | |||
| 1490 | Ga0207640_10136890 | |||
| 1491 | Ga0207658_10003562 | |||
| 1492 | Ga0207677_10000221 | |||
| 1493 | Ga0207677_10127095 | |||
| 1494 | Ga0207677_10164708 | |||
| 1495 | Ga0207677_10174283 | |||
| 1496 | Ga0207703_10000374 | |||
| 1497 | Ga0207703_10110630 | |||
| 1498 | Ga0207639_10097541 | |||
| 1499 | Ga0207708_10112888 | |||
| 1500 | Ga0207702_10037982 | |||
| 1501 | Ga0207702_10053897 | |||
| 1502 | Ga0207702_10078997 | |||
| 1503 | Ga0207702_10190867 | |||
| 1504 | Ga0207641_10000603 | |||
| 1505 | Ga0207641_10253651 | |||
| 1506 | Ga0207648_10004108 | |||
| 1507 | Ga0207648_10094592 | |||
| 1508 | Ga0207676_10000054 | |||
| 1509 | Ga0207676_10201243 | |||
| 1510 | Ga0207674_10062673 | |||
| 1511 | Ga0207675_100019706 | |||
| 1512 | Ga0207683_10017484 | |||
| 1513 | Ga0207698_10000842 | |||
| 1514 | Ga0207698_10046078 | |||
| 1515 | Ga0207698_10097486 | |||
| 1516 | Ga0209281_1001845 | |||
| 1517 | Ga0209281_1002589 | |||
| 1518 | Ga0209371_1000050 | |||
| 1519 | Ga0209371_1000112 | |||
| 1520 | Ga0209282_1000003 | |||
| 1521 | Ga0268266_10015295 | |||
| 1522 | Ga0268265_10082243 | |||
| 1523 | Ga0268264_10023638 | |||
| 1524 | Ga0268264_10024820 | |||
| 1525 | Ga0307515_10179545 | |||
| 1526 | Ga0268256_1000017 | |||
| 1527 | Ga0316177_1095886 | |||
| 1528 | Ga0307408_100000596 | |||
| 1529 | Ga0307408_100002140 | |||
| 1530 | Ga0307408_100002964 | |||
| 1531 | Ga0307408_100019423 | |||
| 1532 | Ga0307408_100207792 | |||
| 1533 | Ga0265314_10043808 | |||
| 1534 | Ga0307405_10044240 | |||
| 1535 | Ga0307416_100085851 | |||
| 1536 | Ga0373934_0005744 | |||
| 1537 | Ga0373923_0000532 | |||
| 1538 | Ga0373945_0013225 | |||
| 1539 | Ga0373953_0002606 | |||
| 1540 | Ga0373954_0000547 | |||
| 1541 | Ga0373956_0009377 | |||
| 1542 | Ga0373957_0007770 | |||
| 1543 | Ga0373955_0001069 | |||
| 1544 | Ga0373935_0010552 | |||
| 1545 | Ga0373927_0008057 | |||
| 1546 | Ga0373933_0007254 | |||
| 1547 | Ga0373947_0009692 | |||
| 1548 | Ga0373937_0007581 | |||
| 1549 | Ga0373937_0015001 | |||
| 1550 | Ga0373937_0023239 | |||
| 1551 | Ga0373937_0119091 | |||
| 1552 | Ga0373925_0002796 | |||
| 1553 | Ga0395899_0002523 | |||
| 1554 | Ga0395899_0007801 | |||
| 1555 | Ga0395899_0014681 | |||
| 1556 | Ga0395899_0060856 | |||
| 1557 | Ga0395899_0098549 | |||
| 1558 | Ga0395900_0000328 | |||
| 1559 | Ga0395900_0023374 | |||
| 1560 | Ga0395900_0028057 | |||
| 1561 | Ga0395900_0083321 | |||
| 1562 | Ga0395900_0155990 | |||
| 1563 | Ga0395900_0191458 | |||
| 1564 | Ga0395898_0084295 | |||
| 1565 | Ga0395898_0089206 | |||
| 1566 | Ga0395898_0130172 | |||
| 1567 | Ga0395898_0272404 | |||
| 1568 | Ga0395905_0296349 | |||
| 1569 | Ga0395901_0000845 | |||
| 1570 | Ga0395901_0015989 | |||
| 1571 | Ga0395901_0050369 | |||
| 1572 | Ga0395901_0104897 | |||
| 1573 | Ga0395901_0124417 | |||
| 1574 | Ga0395901_0208657 | |||
| 1575 | Ga0436361_0021035 | |||
| 1576 | Ga0436361_0090832 | |||
| 1577 | Ga0436361_0364057 | |||
| 1578 | Ga0436361_0460205 | |||
| 1579 | Ga0436361_0567363 | |||
| 1580 | Ga0436361_0909074 | |||
| 1581 | Ga0439448_0000563 | |||
| 1582 | Ga0439455_0004991 | |||
| 1583 | Ga0450911_003531 | |||
| 1584 | Ga0450904_000301 | |||
| 1585 | Ga0439458_0009941 | |||
| 1586 | Ga0466969_0057358 | |||
| 1587 | Ga0466972_0003639 | |||
| 1588 | Ga0466965_0004912 | |||
| 1589 | Ga0466965_0011537 | |||
| 1590 | Ga0466965_0033382 | |||
| 1591 | Ga0466966_0009892 | |||
| 1592 | Ga0466961_0111519 | |||
| 1593 | Ga0466963_0061851 | |||
| 1594 | Ga0466964_0000209 | |||
| 1595 | Ga0453684_0000450 | |||
| 1596 | Ga0466957_0000872 | |||
| 1597 | Ga0466957_0058721 | |||
| 1598 | Ga0466959_0019111 | |||
| 1599 | Ga0466958_0139404 | |||
| 1600 | Ga0466967_0002431 | |||
| 1601 | Ga0466967_0005571 | |||
| 1602 | Ga0495617_000014 | |||
| 1603 | Ga0495617_000023 | |||
| 1604 | Ga0495617_001293 | |||
| 1605 | Ga0495617_001845 | |||
| 1606 | Ga0495617_003871 | |||
| 1607 | Ga0495627_000016 | |||
| 1608 | Ga0495627_000061 | |||
| 1609 | Ga0495627_003768 | |||
| 1610 | Ga0495627_009314 | |||
| 1611 | Ga0495592_0005016 | |||
| 1612 | Ga0495603_0014275 | |||
| 1613 | Ga0495603_0044048 | |||
| 1614 | Ga0495603_0051411 | |||
| 1615 | Ga0495590_0000019 | |||
| 1616 | Ga0495590_0000043 | |||
| 1617 | Ga0495590_0000670 | |||
| 1618 | Ga0495590_0007766 | |||
| 1619 | Ga0495591_000187 | |||
| 1620 | Ga0495591_002995 | |||
| 1621 | Ga0495629_0014982 | |||
| 1622 | Ga0495629_0084443 | |||
| 1623 | Ga0495629_0127831 | |||
| 1624 | Ga0495638_0000115 | |||
| 1625 | Ga0495638_0006133 | |||
| 1626 | Ga0495638_0038746 | |||
| 1627 | Ga0495638_0049300 | |||
| 1628 | Ga0495653_0000014 | |||
| 1629 | Ga0495650_0000142 | |||
| 1630 | Ga0495650_0000178 | |||
| 1631 | Ga0495650_0000181 | |||
| 1632 | Ga0495650_0000193 | |||
| 1633 | Ga0495650_0000395 | |||
| 1634 | Ga0495650_0000906 | |||
| 1635 | Ga0495650_0001736 | |||
| 1636 | Ga0495580_0004401 | |||
| 1637 | Ga0495580_0121227 | |||
| 1638 | Ga0495582_0000674 | |||
| 1639 | Ga0495582_0006796 | |||
| 1640 | Ga0495605_0000010 | |||
| 1641 | Ga0495605_0000110 | |||
| 1642 | Ga0495605_0000118 | |||
| 1643 | Ga0495605_0000910 | |||
| 1644 | Ga0495605_0011533 | |||
| 1645 | Ga0495605_0012465 | |||
| 1646 | Ga0495605_0041968 | |||
| 1647 | Ga0495584_0000065 | |||
| 1648 | Ga0495584_0000138 | |||
| 1649 | Ga0495584_0000163 | |||
| 1650 | Ga0495584_0000227 | |||
| 1651 | Ga0495584_0001545 | |||
| 1652 | Ga0495584_0011764 | |||
| 1653 | Ga0495584_0024547 | |||
| 1654 | Ga0495584_0058886 | |||
| 1655 | Ga0495584_0098848 | |||
| 1656 | Ga0495585_0000123 | |||
| 1657 | Ga0495585_0000160 | |||
| 1658 | Ga0495585_0001260 | |||
| 1659 | Ga0495585_0005863 | |||
| 1660 | Ga0495585_0008881 | |||
| 1661 | Ga0495585_0011341 | |||
| 1662 | Ga0495585_0026582 | |||
| 1663 | Ga0495585_0026583 | |||
| 1664 | Ga0495585_0035257 | |||
| 1665 | Ga0495585_0036136 | |||
| 1666 | Ga0495585_0041758 | |||
| 1667 | Ga0495585_0067130 | |||
| 1668 | Ga0495594_0008244 | |||
| 1669 | Ga0495594_0009516 | |||
| 1670 | Ga0495594_0019046 | |||
| 1671 | Ga0495594_0103272 | |||
| 1672 | Ga0495596_0000291 | |||
| 1673 | Ga0495596_0000310 | |||
| 1674 | Ga0495596_0000418 | |||
| 1675 | Ga0495596_0003475 | |||
| 1676 | Ga0495596_0006215 | |||
| 1677 | Ga0495596_0025659 | |||
| 1678 | Ga0495607_0000719 | |||
| 1679 | Ga0495607_0000942 | |||
| 1680 | Ga0495607_0004531 | |||
| 1681 | Ga0495607_0008029 | |||
| 1682 | Ga0495607_0008548 | |||
| 1683 | Ga0495607_0014412 | |||
| 1684 | Ga0495607_0021186 | |||
| 1685 | Ga0495607_0044005 | |||
| 1686 | Ga0495607_0057905 | |||
| 1687 | Ga0495583_0000057 | |||
| 1688 | Ga0495583_0000065 | |||
| 1689 | Ga0495583_0000102 | |||
| 1690 | Ga0495583_0000126 | |||
| 1691 | Ga0495583_0001000 | |||
| 1692 | Ga0495583_0001247 | |||
| 1693 | Ga0495583_0004613 | |||
| 1694 | Ga0495583_0009887 | |||
| 1695 | Ga0495583_0020208 | |||
| 1696 | Ga0495583_0057338 | |||
| 1697 | Ga0495606_0000004 | |||
| 1698 | Ga0495606_0000085 | |||
| 1699 | Ga0495606_0000165 | |||
| 1700 | Ga0495606_0000250 | |||
| 1701 | Ga0495606_0000391 | |||
| 1702 | Ga0495606_0000498 | |||
| 1703 | Ga0495606_0000583 | |||
| 1704 | Ga0495606_0002188 | |||
| 1705 | Ga0495606_0003463 | |||
| 1706 | Ga0495606_0015293 | |||
| 1707 | Ga0495606_0023412 | |||
| 1708 | Ga0495606_0040461 | |||
| 1709 | Ga0495606_0044897 | |||
| 1710 | Ga0495606_0073319 | |||
| 1711 | Ga0495610_0000007 | |||
| 1712 | Ga0495610_0004332 | |||
| 1713 | Ga0495610_0007942 | |||
| 1714 | Ga0495610_0013977 | |||
| 1715 | Ga0495610_0017941 | |||
| 1716 | Ga0495616_0000083 | |||
| 1717 | Ga0495616_0000230 | |||
| 1718 | Ga0495616_0001478 | |||
| 1719 | Ga0495616_0010455 | |||
| 1720 | Ga0495616_0014112 | |||
| 1721 | Ga0495616_0019879 | |||
| 1722 | Ga0495616_0026763 | |||
| 1723 | Ga0495616_0027550 | |||
| 1724 | Ga0495616_0050733 | |||
| 1725 | Ga0495616_0069719 | |||
| 1726 | Ga0495620_0017597 | |||
| 1727 | Ga0495631_0000385 | |||
| 1728 | Ga0495631_0000495 | |||
| 1729 | Ga0495631_0013856 | |||
| 1730 | Ga0495631_0024948 | |||
| 1731 | Ga0495631_0038783 | |||
| 1732 | Ga0495631_0055662 | |||
| 1733 | Ga0495632_0000041 | |||
| 1734 | Ga0495632_0000336 | |||
| 1735 | Ga0495632_0001288 | |||
| 1736 | Ga0495632_0005108 | |||
| 1737 | Ga0495632_0021092 | |||
| 1738 | Ga0495632_0037065 | |||
| 1739 | Ga0495637_0000119 | |||
| 1740 | Ga0495637_0000602 | |||
| 1741 | Ga0495643_0000130 | |||
| 1742 | Ga0495643_0000418 | |||
| 1743 | Ga0495643_0000524 | |||
| 1744 | Ga0495643_0000686 | |||
| 1745 | Ga0495643_0002486 | |||
| 1746 | Ga0495643_0013493 | |||
| 1747 | Ga0495643_0022698 | |||
| 1748 | Ga0495643_0063506 | |||
| 1749 | Ga0495644_0002910 | |||
| 1750 | Ga0495644_0005632 | |||
| 1751 | Ga0495648_0000053 | |||
| 1752 | Ga0495648_0000104 | |||
| 1753 | Ga0495648_0000293 | |||
| 1754 | Ga0495648_0000799 | |||
| 1755 | Ga0495648_0001424 | |||
| 1756 | Ga0495648_0004497 | |||
| 1757 | Ga0495648_0006997 | |||
| 1758 | Ga0495648_0018900 | |||
| 1759 | Ga0495648_0029978 | |||
| 1760 | Ga0495648_0044969 | |||
| 1761 | Ga0495648_0062838 | |||
| 1762 | Ga0495663_0012433 | |||
| 1763 | Ga0495666_0000214 | |||
| 1764 | Ga0495642_0000017 | |||
| 1765 | Ga0495642_0000284 | |||
| 1766 | Ga0495642_0002324 | |||
| 1767 | Ga0495642_0005212 | |||
| 1768 | Ga0495642_0006008 | |||
| 1769 | Ga0495642_0014091 | |||
| 1770 | Ga0495642_0022781 | |||
| 1771 | Ga0495642_0022825 | |||
| 1772 | Ga0495652_0022488 | |||
| 1773 | Ga0495654_0000034 | |||
| 1774 | Ga0495654_0004252 | |||
| 1775 | Ga0495654_0018842 | |||
| 1776 | Ga0495665_0000193 | |||
| 1777 | Ga0495665_0003674 | |||
| 1778 | Ga0495665_0004601 | |||
| 1779 | Ga0495640_0028810 | |||
| 1780 | Ga0495587_0007851 | |||
| 1781 | Ga0495587_0053485 | |||
| 1782 | Ga0495609_0000005 | |||
| 1783 | Ga0495609_0000164 | |||
| 1784 | Ga0495609_0000597 | |||
| 1785 | Ga0495609_0000772 | |||
| 1786 | Ga0495609_0001430 | |||
| 1787 | Ga0495609_0001879 | |||
| 1788 | Ga0495621_0002820 | |||
| 1789 | Ga0495597_0000046 | |||
| 1790 | Ga0495597_0000100 | |||
| 1791 | Ga0495597_0000198 | |||
| 1792 | Ga0495597_0000607 | |||
| 1793 | Ga0495597_0006177 | |||
| 1794 | Ga0495597_0007247 | |||
| 1795 | Ga0495597_0007612 | |||
| 1796 | Ga0495597_0025278 | |||
| 1797 | Ga0495597_0028765 | |||
| 1798 | Ga0495622_0000011 | |||
| 1799 | Ga0495622_0000230 | |||
| 1800 | Ga0495622_0000812 | |||
| 1801 | Ga0495633_0000065 | |||
| 1802 | Ga0495633_0000146 | |||
| 1803 | Ga0495633_0000749 | |||
| 1804 | Ga0495633_0001918 | |||
| 1805 | Ga0495633_0003442 | |||
| 1806 | Ga0495633_0005322 | |||
| 1807 | Ga0495633_0009409 | |||
| 1808 | Ga0495633_0010746 | |||
| 1809 | Ga0495633_0011531 | |||
| 1810 | Ga0495633_0012010 | |||
| 1811 | Ga0495633_0013361 | |||
| 1812 | Ga0495633_0051475 | |||
| 1813 | Ga0495633_0055925 | |||
| 1814 | Ga0495633_0059448 | |||
| 1815 | Ga0495656_0014769 | |||
| 1816 | Ga0495656_0027896 | |||
| 1817 | Ga0495668_0000030 | |||
| 1818 | Ga0495668_0000117 | |||
| 1819 | Ga0495668_0000251 | |||
| 1820 | Ga0495668_0000580 | |||
| 1821 | Ga0495668_0001350 | |||
| 1822 | Ga0495668_0001882 | |||
| 1823 | Ga0495668_0004307 | |||
| 1824 | Ga0495668_0004658 | |||
| 1825 | Ga0495668_0024198 | |||
| 1826 | Ga0495668_0025254 | |||
| 1827 | Ga0495668_0045766 | |||
| 1828 | Ga0495634_0070417 | |||
| 1829 | Ga0495611_0000148 | |||
| 1830 | Ga0495611_0009125 | |||
| 1831 | Ga0495611_0009943 | |||
| 1832 | Ga0495611_0018564 | |||
| 1833 | Ga0495611_0037155 | |||
| 1834 | Ga0495611_0089929 | |||
| 1835 | Ga0495625_0000609 | |||
| 1836 | Ga0495625_0000620 | |||
| 1837 | Ga0495625_0001604 | |||
| 1838 | Ga0495625_0003530 | |||
| 1839 | Ga0495625_0009776 | |||
| 1840 | Ga0495625_0027511 | |||
| 1841 | Ga0495625_0036919 | |||
| 1842 | Ga0495625_0040051 | |||
| 1843 | Ga0495625_0068746 | |||
| 1844 | Ga0495625_0088531 | |||
| 1845 | Ga0495625_0138536 | |||
| 1846 | Ga0495635_0001435 | |||
| 1847 | Ga0495635_0030249 | |||
| 1848 | Ga0495659_0000148 | |||
| 1849 | Ga0495661_0000102 | |||
| 1850 | Ga0495661_0000420 | |||
| 1851 | Ga0495661_0000945 | |||
| 1852 | Ga0495661_0001953 | |||
| 1853 | Ga0495661_0006769 | |||
| 1854 | Ga0495661_0008255 | |||
| 1855 | Ga0495661_0008319 | |||
| 1856 | Ga0495661_0031328 | |||
| 1857 | Ga0495661_0031692 | |||
| 1858 | Ga0495661_0038584 | |||
| 1859 | Ga0495661_0040168 | |||
| 1860 | Ga0495661_0043635 | |||
| 1861 | Ga0495661_0050759 | |||
| 1862 | Ga0495661_0051975 | |||
| 1863 | Ga0495588_0000126 | |||
| 1864 | Ga0495588_0017756 | |||
| 1865 | Ga0495588_0036860 | |||
| 1866 | Ga0495588_0064731 | |||
| 1867 | Ga0495599_0069567 | |||
| 1868 | Ga0495623_0006370 | |||
| 1869 | Ga0495623_0102960 | |||
| 1870 | Ga0495646_0007932 | |||
| 1871 | Ga0495646_0042703 | |||
| 1872 | Ga0495646_0104635 | |||
| 1873 | Ga0495658_0000474 | |||
| 1874 | Ga0495669_0000077 | |||
| 1875 | Ga0495669_0033624 | |||
| 1876 | Ga0495613_0001075 | |||
| 1877 | Ga0495613_0041274 | |||
| 1878 | Ga0495624_0025453 | |||
| 1879 | Ga0495624_0036405 | |||
| 1880 | Ga0495624_0053816 | |||
| 1881 | Ga0495670_0000595 | |||
| 1882 | Ga0495670_0001516 | |||
| 1883 | Ga0495670_0004163 | |||
| 1884 | Ga0495670_0014679 | |||
| 1885 | Ga0495670_0024272 | |||
| 1886 | Ga0495670_0065348 | |||
| 1887 | Ga0495671_0000009 | |||
| 1888 | Ga0495671_0000053 | |||
| 1889 | Ga0495671_0000068 | |||
| 1890 | Ga0495671_0012746 | |||
| 1891 | Ga0495671_0014856 | |||
| 1892 | Ga0495671_0014925 | |||
| 1893 | Ga0495671_0029004 | |||
| 1894 | Ga0495649_0000074 | |||
| 1895 | Ga0495649_0015929 | |||
| 1896 | Ga0495649_0026452 | |||
| 1897 | Ga0495649_0048404 | |||
| 1898 | Ga0495589_0000024 | |||
| 1899 | Ga0495589_0000310 | |||
| 1900 | Ga0495589_0001875 | |||
| 1901 | Ga0495589_0010935 | |||
| 1902 | Ga0495589_0013516 | |||
| 1903 | Ga0495589_0039348 | |||
| 1904 | Ga0495589_0041691 | |||
| 1905 | Ga0495589_0046719 | |||
| 1906 | Ga0495600_0006539 | |||
| 1907 | Ga0495600_0011440 | |||
| 1908 | Ga0495660_0000068 | |||
| 1909 | Ga0495660_0000954 | |||
| 1910 | Ga0495660_0001370 | |||
| 1911 | Ga0495660_0011116 | |||
| 1912 | Ga0495660_0015125 | |||
| 1913 | Ga0495660_0025952 | |||
| 1914 | Ga0495660_0065946 | |||
| 1915 | Ga0495581_0000277 | |||
| 1916 | Ga0495604_0030356 | |||
| 1917 | Ga0495604_0030863 | |||
| 1918 | Ga0495604_0055300 | |||
| 1919 | Ga0495604_0137459 | |||
| 1920 | Ga0495636_0000073 | |||
| 1921 | Ga0495674_0002989 | |||
| 1922 | Ga0495672_0000099 | |||
| 1923 | Ga0495672_0000371 | |||
| 1924 | Ga0495672_0000897 | |||
| 1925 | Ga0495672_0001193 | |||
| 1926 | Ga0495672_0001368 | |||
| 1927 | Ga0495672_0002171 | |||
| 1928 | Ga0495672_0016791 | |||
| 1929 | Ga0495672_0021977 | |||
| 1930 | Ga0495676_0000028 | |||
| 1931 | Ga0495676_0037428 | |||
| 1932 | Ga0495680_0054896 | |||
| 1933 | Ga0495683_0000067 | |||
| 1934 | Ga0495683_0000610 | |||
| 1935 | Ga0495683_0037579 | |||
| 1936 | Ga0495687_000008 | |||
| 1937 | Ga0495687_000052 | |||
| 1938 | Ga0495687_000085 | |||
| 1939 | Ga0495687_000318 | |||
| 1940 | Ga0495687_000840 | |||
| 1941 | Ga0495687_000868 | |||
| 1942 | Ga0495687_001500 | |||
| 1943 | Ga0495687_007672 | |||
| 1944 | Ga0495687_010494 | |||
| 1945 | Ga0495675_0018080 | |||
| 1946 | Ga0495675_0019623 | |||
| 1947 | Ga0495677_0000007 | |||
| 1948 | Ga0495677_0000063 | |||
| 1949 | Ga0495677_0000088 | |||
| 1950 | Ga0495677_0000857 | |||
| 1951 | Ga0495677_0003195 | |||
| 1952 | Ga0495677_0007176 | |||
| 1953 | Ga0495677_0007489 | |||
| 1954 | Ga0495677_0009025 | |||
| 1955 | Ga0495677_0018797 | |||
| 1956 | Ga0495677_0028677 | |||
| 1957 | Ga0495679_003368 | |||
| 1958 | Ga0495679_007583 | |||
| 1959 | Ga0495685_000024 | |||
| 1960 | Ga0495685_001575 | |||
| 1961 | Ga0495673_0000031 | |||
| 1962 | Ga0495673_0000032 | |||
| 1963 | Ga0495673_0000105 | |||
| 1964 | Ga0495673_0008057 | |||
| 1965 | Ga0495673_0014428 | |||
| 1966 | Ga0495681_0001051 | |||
| 1967 | Ga0495681_0001118 | |||
| 1968 | Ga0495681_0008667 | |||
| 1969 | Ga0495681_0010293 | |||
| 1970 | Ga0495681_0012679 | |||
| 1971 | Ga0495681_0016124 | |||
| 1972 | Ga0495681_0048028 | |||
| 1973 | Ga0495684_0001806 | |||
| 1974 | Ga0495684_0014218 | |||
| 1975 | Ga0495686_0000156 | |||
| 1976 | Ga0495686_0000203 | |||
| 1977 | Ga0495686_0000370 | |||
| 1978 | Ga0495686_0001097 | |||
| 1979 | Ga0495686_0020766 | |||
| 1980 | Ga0495686_0052400 | |||
| 1981 | Ga0495686_0079968 | |||
| 1982 | Ga0495593_0004097 | |||
| 1983 | Ga0495602_0001014 | |||
| 1984 | Ga0495602_0056638 | |||
| 1985 | Ga0495602_0072223 | |||
| 1986 | Ga0495614_0000617 | |||
| 1987 | Ga0495626_0000054 | |||
| 1988 | Ga0495626_0000149 | |||
| 1989 | Ga0495626_0002253 | |||
| 1990 | Ga0495626_0003234 | |||
| 1991 | Ga0495626_0004043 | |||
| 1992 | Ga0495626_0006416 | |||
| 1993 | Ga0495626_0012181 | |||
| 1994 | Ga0495626_0014075 | |||
| 1995 | Ga0495626_0019470 | |||
| 1996 | Ga0495626_0038532 | |||
| 1997 | Ga0496100_0110788 | |||
| 1998 | Ga0496101_0163270 | |||
| 1999 | Ga0496102_0000215 | |||
| 2000 | Ga0496102_0000369 | |||
| 2001 | Ga0496102_0008630 | |||
| 2002 | Ga0496102_0136492 | |||
| 2003 | Ga0496103_0002327 | |||
| 2004 | Ga0496103_0003122 | |||
| 2005 | Ga0496104_0003193 | |||
| 2006 | Ga0496105_0003540 | |||
| 2007 | Ga0496106_0033314 | |||
| 2008 | Ga0496107_0104568 | |||
| 2009 | Ga0496107_0164972 | |||
| 2010 | Ga0496109_0004034 | |||
| 2011 | Ga0496109_0011003 | |||
| 2012 | Ga0496110_0000817 | |||
| 2013 | Ga0496110_0026144 | |||
| 2014 | Ga0496112_0000733 | |||
| 2015 | Ga0496112_0040689 | |||
| 2016 | Ga0496112_0211211 | |||
| 2017 | Ga0496113_0001668 | |||
| 2018 | Ga0496114_0090073 | |||
| 2019 | Ga0496115_0005708 | |||
| 2020 | Ga0496115_0017770 | |||
| 2021 | Ga0496116_0018963 | |||
| 2022 | Ga0496117_0000011 | |||
| 2023 | Ga0496118_0000010 | |||
| 2024 | Ga0496121_0000978 | |||
| 2025 | Ga0496121_0001372 | |||
| 2026 | Ga0496121_0004394 | |||
| 2027 | Ga0496121_0010245 | |||
| 2028 | Ga0496122_0000864 | |||
| 2029 | Ga0496122_0003892 | |||
| 2030 | Ga0496122_0003927 | |||
| 2031 | Ga0496122_0016640 | |||
| 2032 | Ga0496122_0031684 | |||
| 2033 | Ga0496122_0051883 | |||
| 2034 | Ga0496122_0054437 | |||
| 2035 | Ga0496123_0000099 | |||
| 2036 | Ga0496123_0004147 | |||
| 2037 | Ga0496123_0006218 | |||
| 2038 | Ga0496123_0029518 | |||
| 2039 | Ga0496123_0049983 | |||
| 2040 | Ga0496124_0010847 | |||
| 2041 | Ga0496124_0020767 | |||
| 2042 | Ga0496124_0049620 | |||
| 2043 | Ga0496124_0052264 | |||
| 2044 | Ga0496124_0113113 | |||
| 2045 | Ga0496125_0001800 | |||
| 2046 | Ga0496125_0003100 | |||
| 2047 | Ga0496125_0080848 | |||
| 2048 | Ga0496126_0003835 | |||
| 2049 | Ga0496126_0014871 | |||
| 2050 | Ga0495678_000001 | |||
| 2051 | Ga0495678_000053 | |||
| 2052 | Ga0495678_000225 | |||
| 2053 | Ga0495678_000548 | |||
| 2054 | Ga0495678_001622 | |||
| 2055 | Ga0495678_001628 | |||
| 2056 | Ga0495678_003050 | |||
| 2057 | Ga0495678_003199 | |||
| 2058 | Ga0495678_003824 | |||
| 2059 | Ga0495678_013455 | |||
| 2060 | Ga0495682_0000053 | |||
| 2061 | Ga0495682_0000551 | |||
| 2062 | Ga0501034_0002533 | |||
| 2063 | Ga0501034_0049055 | |||
| 2064 | Ga0501238_002604 | |||
| 2065 | Ga0501249_001280 | |||
| 2066 | Ga0501083_0091363 | |||
| 2067 | Ga0501269_000123 | |||
| 2068 | Ga0501279_002262 | |||
| 2069 | Ga0501279_004296 | |||
| 2070 | Ga0501035_0000855 | |||
| 2071 | nmdc:mga03683_33884_c1 | |||
| 2072 | nmdc:mga07m45_229_c1 | |||
| 2073 | nmdc:mga0rr50_141003_c1 | |||
| 2074 | Ga0495601_0005627 | |||
| 2075 | Ga0500610_0016124 | |||
| 2076 | Ga0500610_0081758 | |||
| 2077 | Ga0495619_0002446 | |||
| 2078 | Ga0500607_000211 | |||
| 2079 | Ga0500608_066594 | |||
| 2080 | Ga0500618_000904 | |||
| 2081 | Ga0500619_000240 | |||
| 2082 | Ga0500627_0042780 | |||
| 2083 | Ga0501082_0142047 | |||
| 2084 | 2511250841 | |||
| 2085 | 2511385058 | |||
| 2086 | 2521560576 | |||
| 2087 | 2550694227 | |||
| 2088 | 2553005691 | |||
| 2089 | 2601531923 | |||
| 2090 | 2601537294 | |||
| 2091 | 2601669226 | |||
| 2092 | 2601755641 | |||
| 2093 | 2601761009 | |||
| 2094 | 2603638969 | |||
| 2095 | 2643789695 | |||
| 2096 | 2643796815 | |||
| 2097 | 2644028500 | |||
| 2098 | 2644214574 | |||
| 2099 | 2644249943 | |||
| 2100 | 2644326196 | |||
| 2101 | 2644358621 | |||
| 2102 | 2644470080 | |||
| 2103 | 2738739538 | |||
| 2104 | 2738827582 | |||
| 2105 | 2738846115 | |||
| 2106 | 2738880487 | |||
| 2107 | 2739151378 | |||
| 2108 | 2739193298 | |||
| 2109 | 2739275732 | |||
| 2110 | 2739319774 | |||
| 2111 | 2739338015 | |||
| 2112 | 2739344776 | |||
| 2113 | 2765571822 | |||
| 2114 | 2791925492 | |||
| 2115 | 2808982172 | |||
| 2116 | 2809130028 | |||
| 2117 | 2809147143 | |||
| 2118 | 2809148917 | |||
| 2119 | 2813730030 | |||
| 2120 | 2814697522 | |||
| 2121 | 2819543288 | |||
| 2122 | 2819595618 | |||
| 2123 | 2819617268 | |||
| 2124 | 2821136040 | |||
| 2125 | 2834643455 | |||
| 2126 | 2839098457 | |||
| 2127 | 2842713000 | |||
| 2128 | 2852619052 | |||
| 2129 | 2857549358 | |||
| 2130 | 2857555558 | |||
| 2131 | 2857562963 | |||
| 2132 | 2857569205 | |||
| 2133 | 2882461700 | |||
| 2134 | 2883092901 | |||
| 2135 | 2884816178 | |||
| 2136 | 2884839379 | |||
| 2137 | 2884856811 | |||
| 2138 | 2885085967 | |||
| 2139 | 2885201268 | |||
| 2140 | 2885214940 | |||
| 2141 | 2896158157 | |||
| 2142 | 2900640992 | |||
| 2143 | 2904429378 | |||
| 2144 | 2904442907 | |||
| 2145 | 2904534896 | |||
| 2146 | 2904588764 | |||
| 2147 | 2904594162 | |||
| 2148 | 2904605000 | |||
| 2149 | 2919048594 | |||
| 2150 | 2919083234 | |||
| 2151 | 2919479383 | |||
| 2152 | 2923514369 | |||
| 2153 | 2928133094 | |||
| 2154 | 2932414480 | |||
| 2155 | 2932420999 | |||
| 2156 | 2974322312 | |||
| 2157 | 642615354 | |||
| 2158 | 8003405200 | |||
| 2159 | 8047676916 | |||
| 2160 | 8054007568 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8aq0-assembly1.cif.gz_B | crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c | 0.8905 | 16 | 416 |
| 8apz-assembly1.cif.gz_B | crystal structure of wild-type l-n-carbamoylase from sinorhizobium meliloti | 0.8882 | 18 | 417 |
| 5i4m-assembly1.cif.gz_B | crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis | 0.8806 | 15 | 417 |
| 8aq0-assembly1.cif.gz_B | crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c | 0.87 | 16 | 416 |
| 8apz-assembly1.cif.gz_B | crystal structure of wild-type l-n-carbamoylase from sinorhizobium meliloti | 0.8656 | 18 | 417 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5i4mB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9706 | 15 | 413 | 3.40.630.10 |
| 5i4mB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.948 | 15 | 413 | 3.40.630.10 |
| 3n5fA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9151 | 21 | 413 | 3.40.630.10 |
| 6c0dA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9042 | 18 | 414 | 3.40.630.10 |
| 3n5fA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.903 | 21 | 413 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382V0H9-F1-model_v4 | Zn-dependent hydrolase | 0.9964 | 18 | 120 |
GO:0016813
|
| AF-A0A536UMS7-F1-model_v4 | M20/M25/M40 family metallo-hydrolase | 0.9956 | 14 | 173 |
GO:0016813
|
| AF-A0A356HR59-F1-model_v4 | deleted | 0.9955 | 17 | 144 |
|
| AF-A0A349SFW1-F1-model_v4 | Zn-dependent hydrolase | 0.994 | 17 | 212 |
GO:0016813
|
| AF-A0A377V0X5-F1-model_v4 | Beta-ureidopropionase (EC 3.5.-.-) | 0.9938 | 68 | 171 |
GO:0016813
|